F484070
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 868 | 366 | 822 | 496 |
Family's Representative Sequence
| Representative Sequence | 3300005290|Ga0065712_10006895|Ga0065712_100068951 |
| Length | 560 |
| Sequence | LICNIYVIRVLXKLNRFDTAQVSNLRGEAANWQQQAMIVAQKLITKKVEEIASPDFIGIANKIMSELKIHNSYSRQKEVFKSITPGHVGMYVCGPTVSGESHLGHARPYITFDVIYRYLVHLGNKVRYVRNITDAGHFEEEGREAEDKISKKAILEKLEPMELVQKYTNLYHWAMEQFNTLKPTIEPTATGHIVEQIGMIEEIIKAGYAYEVNGSVYFDVKKYAASHDYGKLSGRVIDDLLETTRDLEGQEEKRDTADFALWKNAAPEXIMRWKSPWGVGFPGWHIECSAMATKYLGAQXDIHGGGMDLLFPHHESEIAQSTICNHVAPVRYWIHNNMITINGKKMGKSYNNVIKLTELFSGDHPALEKAYHPMVVRFFILQTHYRSTLDFGNEALQAAEKGLKRLWEAYEKLSQLAVGSEQSAVDTELDSKVKKLIAEFDEFMDDDFSTAKVMANMFELVPVINSMRDKTIPVSALSKETFELLQKQMKAYIENILGLKSVTEADNEKLKGVMDLLIDIRKEAKGKKDFTTSDKIRNQLTRLGISLKDEKDGGMSWNIE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 4 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 5 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 6 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 7 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 8 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 9 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 10 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 11 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 12 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 13 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 14 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 15 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 16 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 17 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 18 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 19 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 20 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 21 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 22 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 23 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 24 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 25 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 26 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 27 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 28 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 29 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 30 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 31 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 32 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 33 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 34 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 35 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 36 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 37 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 38 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 39 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 40 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 41 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 42 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 43 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 44 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 45 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 46 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 47 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 48 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 49 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 50 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 51 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 53 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 54 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 55 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 56 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 57 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 58 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 59 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 61 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 62 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 63 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 64 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 68 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 72 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 74 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 83 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 88 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 89 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 92 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 94 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 96 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 99 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 101 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 102 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 103 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 104 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 105 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 106 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 107 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 108 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 109 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 110 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 111 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 112 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 113 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 114 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 115 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 117 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 118 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 119 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 120 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 121 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 122 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 148 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 152 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 155 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 158 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 159 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 217 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 221 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 222 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 223 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 224 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 225 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 226 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 227 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 228 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 229 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 230 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 231 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 232 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 234 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 235 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 236 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 237 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 238 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 239 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 240 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 241 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 242 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 243 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 244 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 246 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 249 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 251 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 252 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 253 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 254 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 255 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 256 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 257 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 258 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 259 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 260 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 261 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 262 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 263 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 264 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 265 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 266 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 267 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 268 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 269 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 270 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 271 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 272 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 273 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 274 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 275 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 276 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 277 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 278 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 279 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 280 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 299 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 300 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 302 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 303 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 304 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 305 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 317 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 318 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 319 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 320 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 321 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 322 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 323 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 324 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 325 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 326 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 327 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 328 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 329 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 330 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 331 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 332 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 333 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 334 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 335 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 337 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 340 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 341 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 348 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 349 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 350 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 351 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 352 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 353 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 354 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 355 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 356 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 357 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 358 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 359 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 360 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 361 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 362 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 363 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 365 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 366 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.35 |
| Metatranscriptomes | 0.35 |
| Isolates | 5.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.65 |
| Nodule | 0 |
| Rhizoplane | 0.58 |
| Rhizosphere | 87.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_577364 | 2162886007 | Bacteria | 146603 |
| 2 | MBSR1b_contig_4329513 | 2162886012 | Unclassified | 2169 |
| 3 | JGI24739J22299_10000004 | 3300001989 | Bacteria | 75936 |
| 4 | JGI24744J21845_10002391 | 3300002077 | Bacteria | 3826 |
| 5 | JGI24751J29686_10001711 | 3300002459 | Bacteria | 4513 |
| 6 | JGI25406J46586_10009223 | 3300003203 | Bacteria | 4424 |
| 7 | JGI25153J46596_10000276 | 3300003215 | Bacteria | 40180 |
| 8 | rootH1_10036148 | 3300003316 | Bacteria | 3346 |
| 9 | rootH2_10006463 | 3300003320 | Bacteria | 45674 |
| 10 | rootH2_10043903 | 3300003320 | Bacteria | 12034 |
| 11 | rootL2_10005908 | 3300003322 | Bacteria | 1883 |
| 12 | rootH1_10007795 | 3300003323 | Bacteria | 36145 |
| 13 | JGI25160J50197_1005967 | 3300003354 | Bacteria | 5001 |
| 14 | JGI25160J50197_1015689 | 3300003354 | Bacteria | 2477 |
| 15 | Ga0055528_1000785 | 3300003790 | Bacteria | 22113 |
| 16 | Ga0055530_10000102 | 3300003791 | Bacteria | 72819 |
| 17 | Ga0055531_10000173 | 3300003794 | Bacteria | 72625 |
| 18 | Ga0055531_10030395 | 3300003794 | Bacteria | 1815 |
| 19 | Ga0065165_1000027 | 3300005262 | Bacteria | 228507 |
| 20 | Ga0065704_10070133 | 3300005289 | Bacteria | 1266035 |
| 21 | Ga0065704_10077065 | 3300005289 | Bacteria | 4866 |
| 22 | Ga0065704_10104076 | 3300005289 | Bacteria | 2152 |
| 23 | Ga0065712_10006895 | 3300005290 | Bacteria | 3530 |
| 24 | Ga0065712_10083528 | 3300005290 | Bacteria | 2815 |
| 25 | Ga0070676_10000167 | 3300005328 | Bacteria | 26643 |
| 26 | Ga0070676_10002364 | 3300005328 | Bacteria | 9661 |
| 27 | Ga0070676_10047244 | 3300005328 | Bacteria | 2513 |
| 28 | Ga0070683_100006129 | 3300005329 | Bacteria | 10082 |
| 29 | Ga0070683_100038887 | 3300005329 | Bacteria | 4363 |
| 30 | Ga0070683_100039857 | 3300005329 | Bacteria | 4315 |
| 31 | Ga0070683_100128293 | 3300005329 | Bacteria | 2399 |
| 32 | Ga0070683_100134817 | 3300005329 | Bacteria | 2338 |
| 33 | Ga0070670_100024005 | 3300005331 | Bacteria | 5245 |
| 34 | Ga0070670_100028223 | 3300005331 | Bacteria | 4830 |
| 35 | Ga0070670_100049693 | 3300005331 | Bacteria | 3605 |
| 36 | Ga0070670_100071766 | 3300005331 | Unclassified | 2973 |
| 37 | Ga0070670_100073374 | 3300005331 | Bacteria | 2939 |
| 38 | Ga0070670_100180796 | 3300005331 | Bacteria | 1831 |
| 39 | Ga0068869_100004707 | 3300005334 | Bacteria | 8514 |
| 40 | Ga0068869_100005758 | 3300005334 | Bacteria | 7820 |
| 41 | Ga0068869_100011463 | 3300005334 | Bacteria | 5813 |
| 42 | Ga0068869_100011750 | 3300005334 | Bacteria | 5757 |
| 43 | Ga0068869_100100643 | 3300005334 | Bacteria | 2185 |
| 44 | Ga0068869_100100888 | 3300005334 | Bacteria | 2183 |
| 45 | Ga0070666_10000064 | 3300005335 | Bacteria | 79823 |
| 46 | Ga0070666_10000512 | 3300005335 | Bacteria | 23407 |
| 47 | Ga0070666_10009089 | 3300005335 | Bacteria | 6197 |
| 48 | Ga0070666_10033872 | 3300005335 | Bacteria | 3384 |
| 49 | Ga0070666_10044594 | 3300005335 | Bacteria | 2971 |
| 50 | Ga0070680_100012373 | 3300005336 | Bacteria | 6625 |
| 51 | Ga0070680_100043915 | 3300005336 | Bacteria | 3631 |
| 52 | Ga0070680_100058207 | 3300005336 | Bacteria | 3161 |
| 53 | Ga0070680_100060917 | 3300005336 | Bacteria | 3088 |
| 54 | Ga0070682_100000012 | 3300005337 | Bacteria | 265658 |
| 55 | Ga0070682_100005414 | 3300005337 | Bacteria | 7109 |
| 56 | Ga0070682_100009425 | 3300005337 | Bacteria | 5525 |
| 57 | Ga0070682_100052324 | 3300005337 | Bacteria | 2555 |
| 58 | Ga0068868_100002356 | 3300005338 | Bacteria | 13082 |
| 59 | Ga0068868_100108198 | 3300005338 | Bacteria | 2256 |
| 60 | Ga0068868_100121563 | 3300005338 | Bacteria | 2130 |
| 61 | Ga0068868_100175865 | 3300005338 | Unclassified | 1774 |
| 62 | Ga0070660_100000295 | 3300005339 | Bacteria | 33225 |
| 63 | Ga0070660_100005708 | 3300005339 | Bacteria | 8619 |
| 64 | Ga0070660_100024047 | 3300005339 | Bacteria | 4519 |
| 65 | Ga0070689_100002022 | 3300005340 | Bacteria | 13155 |
| 66 | Ga0070689_100018308 | 3300005340 | Bacteria | 5158 |
| 67 | Ga0070689_100022450 | 3300005340 | Bacteria | 4710 |
| 68 | Ga0070689_100028005 | 3300005340 | Bacteria | 4255 |
| 69 | Ga0070689_100039902 | 3300005340 | Bacteria | 3597 |
| 70 | Ga0070687_100015694 | 3300005343 | Bacteria | 3432 |
| 71 | Ga0070661_100000394 | 3300005344 | Bacteria | 33858 |
| 72 | Ga0070661_100009290 | 3300005344 | Bacteria | 6800 |
| 73 | Ga0070668_100000736 | 3300005347 | Bacteria | 22377 |
| 74 | Ga0070668_100037275 | 3300005347 | Bacteria | 3712 |
| 75 | Ga0070669_100001547 | 3300005353 | Bacteria | 16634 |
| 76 | Ga0070675_100002115 | 3300005354 | Bacteria | 14665 |
| 77 | Ga0070675_100032708 | 3300005354 | Bacteria | 4210 |
| 78 | Ga0070675_100091999 | 3300005354 | Bacteria | 2542 |
| 79 | Ga0070675_100099032 | 3300005354 | Bacteria | 2453 |
| 80 | Ga0070671_100020931 | 3300005355 | Bacteria | 5336 |
| 81 | Ga0070671_100079615 | 3300005355 | Bacteria | 2739 |
| 82 | Ga0070674_100016973 | 3300005356 | Bacteria | 4569 |
| 83 | Ga0070674_100031799 | 3300005356 | Bacteria | 3500 |
| 84 | Ga0070673_100001051 | 3300005364 | Bacteria | 15685 |
| 85 | Ga0070673_100043716 | 3300005364 | Bacteria | 3464 |
| 86 | Ga0070673_100077212 | 3300005364 | Bacteria | 2691 |
| 87 | Ga0070688_100011565 | 3300005365 | Bacteria | 4908 |
| 88 | Ga0070688_100019853 | 3300005365 | Bacteria | 3898 |
| 89 | Ga0070659_100005182 | 3300005366 | Bacteria | 9355 |
| 90 | Ga0070659_100007270 | 3300005366 | Bacteria | 8040 |
| 91 | Ga0070659_100030890 | 3300005366 | Bacteria | 4147 |
| 92 | Ga0070667_100002471 | 3300005367 | Bacteria | 16141 |
| 93 | Ga0070667_100016043 | 3300005367 | Bacteria | 6197 |
| 94 | Ga0070667_100035635 | 3300005367 | Bacteria | 4170 |
| 95 | Ga0070667_100060084 | 3300005367 | Bacteria | 3217 |
| 96 | Ga0070701_10004865 | 3300005438 | Bacteria | 5494 |
| 97 | Ga0070662_100024116 | 3300005457 | Bacteria | 4187 |
| 98 | Ga0070681_10137639 | 3300005458 | Bacteria | 2372 |
| 99 | Ga0068867_100000714 | 3300005459 | Bacteria | 22153 |
| 100 | Ga0068867_100033400 | 3300005459 | Bacteria | 3726 |
| 101 | Ga0068867_100049482 | 3300005459 | Bacteria | 3095 |
| 102 | Ga0068867_100103341 | 3300005459 | Bacteria | 2179 |
| 103 | Ga0068867_100119248 | 3300005459 | Bacteria | 2037 |
| 104 | Ga0070698_100004403 | 3300005471 | Bacteria | 15475 |
| 105 | Ga0070698_100013144 | 3300005471 | Bacteria | 8759 |
| 106 | Ga0070698_100013999 | 3300005471 | Bacteria | 8484 |
| 107 | Ga0070699_100048813 | 3300005518 | Bacteria | 3663 |
| 108 | Ga0070679_100000174 | 3300005530 | Bacteria | 51897 |
| 109 | Ga0070679_100000908 | 3300005530 | Bacteria | 25669 |
| 110 | Ga0070679_100016542 | 3300005530 | Bacteria | 7120 |
| 111 | Ga0070679_100070447 | 3300005530 | Bacteria | 3488 |
| 112 | Ga0070684_100000214 | 3300005535 | Bacteria | 40555 |
| 113 | Ga0070684_100003556 | 3300005535 | Bacteria | 11717 |
| 114 | Ga0070684_100004375 | 3300005535 | Bacteria | 10739 |
| 115 | Ga0070684_100010994 | 3300005535 | Bacteria | 7198 |
| 116 | Ga0068853_100004391 | 3300005539 | Bacteria | 10920 |
| 117 | Ga0068853_100004488 | 3300005539 | Bacteria | 10826 |
| 118 | Ga0068853_100004926 | 3300005539 | Bacteria | 10394 |
| 119 | Ga0068853_100009182 | 3300005539 | Bacteria | 7965 |
| 120 | Ga0068853_100012524 | 3300005539 | Bacteria | 6901 |
| 121 | Ga0068853_100016332 | 3300005539 | Bacteria | 6108 |
| 122 | Ga0068853_100025540 | 3300005539 | Bacteria | 4958 |
| 123 | Ga0068853_100028674 | 3300005539 | Bacteria | 4685 |
| 124 | Ga0068853_100166001 | 3300005539 | Bacteria | 1995 |
| 125 | Ga0070672_100042571 | 3300005543 | Bacteria | 3497 |
| 126 | Ga0070672_100053372 | 3300005543 | Bacteria | 3160 |
| 127 | Ga0070672_100060446 | 3300005543 | Bacteria | 2983 |
| 128 | Ga0070686_100037082 | 3300005544 | Bacteria | 3022 |
| 129 | Ga0070686_100079981 | 3300005544 | Bacteria | 2162 |
| 130 | Ga0070693_100040142 | 3300005547 | Bacteria | 2626 |
| 131 | Ga0070665_100000002 | 3300005548 | Bacteria | 849037 |
| 132 | Ga0070665_100003228 | 3300005548 | Bacteria | 17524 |
| 133 | Ga0070665_100091459 | 3300005548 | Bacteria | 3048 |
| 134 | Ga0068855_100001122 | 3300005563 | Bacteria | 33246 |
| 135 | Ga0068855_100002019 | 3300005563 | Bacteria | 25173 |
| 136 | Ga0068855_100019121 | 3300005563 | Bacteria | 8231 |
| 137 | Ga0068855_100026762 | 3300005563 | Bacteria | 6901 |
| 138 | Ga0068855_100083156 | 3300005563 | Bacteria | 3708 |
| 139 | Ga0070664_100002301 | 3300005564 | Bacteria | 15347 |
| 140 | Ga0070664_100008829 | 3300005564 | Bacteria | 8167 |
| 141 | Ga0070664_100047892 | 3300005564 | Bacteria | 3613 |
| 142 | Ga0068857_100008115 | 3300005577 | Bacteria | 9064 |
| 143 | Ga0068857_100036762 | 3300005577 | Bacteria | 4338 |
| 144 | Ga0068857_100054563 | 3300005577 | Bacteria | 3546 |
| 145 | Ga0068857_100101256 | 3300005577 | Bacteria | 2585 |
| 146 | Ga0068857_100234524 | 3300005577 | Bacteria | 1679 |
| 147 | Ga0068854_100016442 | 3300005578 | Bacteria | 4933 |
| 148 | Ga0068854_100060534 | 3300005578 | Bacteria | 2740 |
| 149 | Ga0068854_100123263 | 3300005578 | Bacteria | 1970 |
| 150 | Ga0068856_100057374 | 3300005614 | Bacteria | 3844 |
| 151 | Ga0068856_100079488 | 3300005614 | Bacteria | 3252 |
| 152 | Ga0068852_100000391 | 3300005616 | Bacteria | 29415 |
| 153 | Ga0068852_100000706 | 3300005616 | Bacteria | 21835 |
| 154 | Ga0068852_100008114 | 3300005616 | Bacteria | 7707 |
| 155 | Ga0068852_100021900 | 3300005616 | Bacteria | 5114 |
| 156 | Ga0068852_100053313 | 3300005616 | Bacteria | 3481 |
| 157 | Ga0068852_100065192 | 3300005616 | Bacteria | 3177 |
| 158 | Ga0068859_100000003 | 3300005617 | Bacteria | 479218 |
| 159 | Ga0068859_100004846 | 3300005617 | Bacteria | 13695 |
| 160 | Ga0068859_100014150 | 3300005617 | Bacteria | 8001 |
| 161 | Ga0068859_100090517 | 3300005617 | Bacteria | 3110 |
| 162 | Ga0068859_100112370 | 3300005617 | Bacteria | 2787 |
| 163 | Ga0068864_100004147 | 3300005618 | Bacteria | 11896 |
| 164 | Ga0068864_100006628 | 3300005618 | Bacteria | 9477 |
| 165 | Ga0068864_100097951 | 3300005618 | Bacteria | 2597 |
| 166 | Ga0068861_100005751 | 3300005719 | Bacteria | 8412 |
| 167 | Ga0068861_100061699 | 3300005719 | Bacteria | 2878 |
| 168 | Ga0068861_100094417 | 3300005719 | Bacteria | 2367 |
| 169 | Ga0068851_10010183 | 3300005834 | Bacteria | 4383 |
| 170 | Ga0068851_10021134 | 3300005834 | Bacteria | 3159 |
| 171 | Ga0068870_10009295 | 3300005840 | Bacteria | 4465 |
| 172 | Ga0068863_100003550 | 3300005841 | Bacteria | 15382 |
| 173 | Ga0068863_100007919 | 3300005841 | Bacteria | 10387 |
| 174 | Ga0068863_100018993 | 3300005841 | Bacteria | 6578 |
| 175 | Ga0068863_100069003 | 3300005841 | Bacteria | 3343 |
| 176 | Ga0068863_100192024 | 3300005841 | Bacteria | 1963 |
| 177 | Ga0068858_100002928 | 3300005842 | Bacteria | 17176 |
| 178 | Ga0068858_100004188 | 3300005842 | Bacteria | 14197 |
| 179 | Ga0068858_100115260 | 3300005842 | Bacteria | 2510 |
| 180 | Ga0068858_100132931 | 3300005842 | Bacteria | 2334 |
| 181 | Ga0068858_100221747 | 3300005842 | Bacteria | 1791 |
| 182 | Ga0068860_100000003 | 3300005843 | Bacteria | 575741 |
| 183 | Ga0068860_100002264 | 3300005843 | Bacteria | 20238 |
| 184 | Ga0068860_100003019 | 3300005843 | Bacteria | 17387 |
| 185 | Ga0068860_100004200 | 3300005843 | Bacteria | 14762 |
| 186 | Ga0068860_100010703 | 3300005843 | Bacteria | 9060 |
| 187 | Ga0068860_100033177 | 3300005843 | Bacteria | 4956 |
| 188 | Ga0068860_100035838 | 3300005843 | Bacteria | 4757 |
| 189 | Ga0068862_100002255 | 3300005844 | Bacteria | 17251 |
| 190 | Ga0068862_100016622 | 3300005844 | Bacteria | 6126 |
| 191 | Ga0068862_100071433 | 3300005844 | Bacteria | 2997 |
| 192 | Ga0068862_100080426 | 3300005844 | Bacteria | 2826 |
| 193 | Ga0068862_100194413 | 3300005844 | Bacteria | 1827 |
| 194 | Ga0081539_10000042 | 3300005985 | Bacteria | 289955 |
| 195 | Ga0081539_10010380 | 3300005985 | Bacteria | 7573 |
| 196 | Ga0075366_10004372 | 3300006195 | Bacteria | 7580 |
| 197 | Ga0097621_100003013 | 3300006237 | Bacteria | 11572 |
| 198 | Ga0097621_100003397 | 3300006237 | Bacteria | 10963 |
| 199 | Ga0097621_100005389 | 3300006237 | Bacteria | 9017 |
| 200 | Ga0097621_100024637 | 3300006237 | Bacteria | 4701 |
| 201 | Ga0068871_100002146 | 3300006358 | Bacteria | 13383 |
| 202 | Ga0068871_100033509 | 3300006358 | Bacteria | 4068 |
| 203 | Ga0068871_100043443 | 3300006358 | Bacteria | 3610 |
| 204 | Ga0068871_100099703 | 3300006358 | Bacteria | 2432 |
| 205 | Ga0068871_100209613 | 3300006358 | Bacteria | 1685 |
| 206 | Ga0075428_100014704 | 3300006844 | Bacteria | 8692 |
| 207 | Ga0075428_100038397 | 3300006844 | Bacteria | 5269 |
| 208 | Ga0075430_100044628 | 3300006846 | Bacteria | 3747 |
| 209 | Ga0075430_100109755 | 3300006846 | Bacteria | 2301 |
| 210 | Ga0075431_100008461 | 3300006847 | Bacteria | 10303 |
| 211 | Ga0075431_100011173 | 3300006847 | Bacteria | 9040 |
| 212 | Ga0075431_100067224 | 3300006847 | Bacteria | 3700 |
| 213 | Ga0075429_100001064 | 3300006880 | Bacteria | 21975 |
| 214 | Ga0068865_100007946 | 3300006881 | Bacteria | 6550 |
| 215 | Ga0068865_100026788 | 3300006881 | Bacteria | 3803 |
| 216 | Ga0097620_100000003 | 3300006931 | Bacteria | 479218 |
| 217 | Ga0097620_100004846 | 3300006931 | Bacteria | 13695 |
| 218 | Ga0097620_100014150 | 3300006931 | Bacteria | 8001 |
| 219 | Ga0097620_100090518 | 3300006931 | Bacteria | 3110 |
| 220 | Ga0097620_100112367 | 3300006931 | Bacteria | 2787 |
| 221 | Ga0105240_10000011 | 3300009093 | Bacteria | 523646 |
| 222 | Ga0105240_10000664 | 3300009093 | Bacteria | 63206 |
| 223 | Ga0105240_10003002 | 3300009093 | Bacteria | 26548 |
| 224 | Ga0105240_10003432 | 3300009093 | Bacteria | 24627 |
| 225 | Ga0105240_10006894 | 3300009093 | Bacteria | 16604 |
| 226 | Ga0105240_10012199 | 3300009093 | Bacteria | 11885 |
| 227 | Ga0105240_10015806 | 3300009093 | Bacteria | 10241 |
| 228 | Ga0105240_10028575 | 3300009093 | Bacteria | 7280 |
| 229 | Ga0105240_10032147 | 3300009093 | Bacteria | 6796 |
| 230 | Ga0105240_10034353 | 3300009093 | Bacteria | 6540 |
| 231 | Ga0105240_10069783 | 3300009093 | Bacteria | 4349 |
| 232 | Ga0111539_10002241 | 3300009094 | Bacteria | 25812 |
| 233 | Ga0105245_10095714 | 3300009098 | Bacteria | 2740 |
| 234 | Ga0105247_10016750 | 3300009101 | Bacteria | 4395 |
| 235 | Ga0105247_10072797 | 3300009101 | Bacteria | 2152 |
| 236 | Ga0114129_10011797 | 3300009147 | Bacteria | 12432 |
| 237 | Ga0114129_10028251 | 3300009147 | Bacteria | 7948 |
| 238 | Ga0114129_10115042 | 3300009147 | Bacteria | 3708 |
| 239 | Ga0105241_10000543 | 3300009174 | Bacteria | 28453 |
| 240 | Ga0105241_10002666 | 3300009174 | Bacteria | 13368 |
| 241 | Ga0105241_10006184 | 3300009174 | Bacteria | 8832 |
| 242 | Ga0105241_10016655 | 3300009174 | Bacteria | 5394 |
| 243 | Ga0105241_10126068 | 3300009174 | Bacteria | 2067 |
| 244 | Ga0105242_10034224 | 3300009176 | Bacteria | 4073 |
| 245 | Ga0105242_10073754 | 3300009176 | Bacteria | 2838 |
| 246 | Ga0105242_10160235 | 3300009176 | Bacteria | 1969 |
| 247 | Ga0105248_10036272 | 3300009177 | Bacteria | 5514 |
| 248 | Ga0105248_10110662 | 3300009177 | Bacteria | 3097 |
| 249 | Ga0105237_10000144 | 3300009545 | Bacteria | 100105 |
| 250 | Ga0105237_10009785 | 3300009545 | Bacteria | 10250 |
| 251 | Ga0105237_10015222 | 3300009545 | Bacteria | 8014 |
| 252 | Ga0105237_10015997 | 3300009545 | Bacteria | 7801 |
| 253 | Ga0105237_10032931 | 3300009545 | Bacteria | 5248 |
| 254 | Ga0105237_10034202 | 3300009545 | Bacteria | 5147 |
| 255 | Ga0105237_10034915 | 3300009545 | Bacteria | 5089 |
| 256 | Ga0105237_10040928 | 3300009545 | Bacteria | 4674 |
| 257 | Ga0105237_10141893 | 3300009545 | Bacteria | 2396 |
| 258 | Ga0105237_10173320 | 3300009545 | Bacteria | 2158 |
| 259 | Ga0105238_10088408 | 3300009551 | Bacteria | 3084 |
| 260 | Ga0105249_10003454 | 3300009553 | Bacteria | 13686 |
| 261 | Ga0105249_10011067 | 3300009553 | Bacteria | 7927 |
| 262 | Ga0105249_10021119 | 3300009553 | Bacteria | 5828 |
| 263 | Ga0105249_10025790 | 3300009553 | Bacteria | 5294 |
| 264 | Ga0105249_10042876 | 3300009553 | Bacteria | 4116 |
| 265 | Ga0105249_10116875 | 3300009553 | Bacteria | 2529 |
| 266 | Ga0105239_10000122 | 3300010375 | Bacteria | 109167 |
| 267 | Ga0105239_10000488 | 3300010375 | Bacteria | 57554 |
| 268 | Ga0105239_10000925 | 3300010375 | Bacteria | 41596 |
| 269 | Ga0105239_10001910 | 3300010375 | Bacteria | 27144 |
| 270 | Ga0105239_10008508 | 3300010375 | Bacteria | 11666 |
| 271 | Ga0105239_10009963 | 3300010375 | Bacteria | 10670 |
| 272 | Ga0105239_10010365 | 3300010375 | Bacteria | 10433 |
| 273 | Ga0105239_10021156 | 3300010375 | Bacteria | 7174 |
| 274 | Ga0105239_10030991 | 3300010375 | Bacteria | 5883 |
| 275 | Ga0105239_10059960 | 3300010375 | Bacteria | 4175 |
| 276 | Ga0105239_10174428 | 3300010375 | Bacteria | 2405 |
| 277 | Ga0105239_10183270 | 3300010375 | Bacteria | 2343 |
| 278 | Ga0105239_10346907 | 3300010375 | Bacteria | 1676 |
| 279 | Ga0105246_10014719 | 3300011119 | Bacteria | 4925 |
| 280 | Ga0157373_10002582 | 3300013100 | Bacteria | 13751 |
| 281 | Ga0157373_10006643 | 3300013100 | Bacteria | 8616 |
| 282 | Ga0157373_10008723 | 3300013100 | Bacteria | 7517 |
| 283 | Ga0157373_10031516 | 3300013100 | Bacteria | 3816 |
| 284 | Ga0157373_10077004 | 3300013100 | Bacteria | 2353 |
| 285 | Ga0157371_10002131 | 3300013102 | Bacteria | 19255 |
| 286 | Ga0157371_10003413 | 3300013102 | Bacteria | 14431 |
| 287 | Ga0157371_10004222 | 3300013102 | Bacteria | 12636 |
| 288 | Ga0157371_10005032 | 3300013102 | Bacteria | 11316 |
| 289 | Ga0157371_10005838 | 3300013102 | Bacteria | 10296 |
| 290 | Ga0157371_10018901 | 3300013102 | Bacteria | 5090 |
| 291 | Ga0157371_10020420 | 3300013102 | Unclassified | 4874 |
| 292 | Ga0157371_10021501 | 3300013102 | Bacteria | 4735 |
| 293 | Ga0157371_10078366 | 3300013102 | Bacteria | 2340 |
| 294 | Ga0157371_10123275 | 3300013102 | Bacteria | 1843 |
| 295 | Ga0157370_10000945 | 3300013104 | Bacteria | 36860 |
| 296 | Ga0157370_10001484 | 3300013104 | Bacteria | 29041 |
| 297 | Ga0157370_10001848 | 3300013104 | Bacteria | 26098 |
| 298 | Ga0157370_10048874 | 3300013104 | Bacteria | 4052 |
| 299 | Ga0157370_10175507 | 3300013104 | Bacteria | 1992 |
| 300 | Ga0157370_10183259 | 3300013104 | Bacteria | 1945 |
| 301 | Ga0157369_10036810 | 3300013105 | Bacteria | 5360 |
| 302 | Ga0157369_10218046 | 3300013105 | Bacteria | 1998 |
| 303 | Ga0157374_10000013 | 3300013296 | Bacteria | 461240 |
| 304 | Ga0157374_10021281 | 3300013296 | Bacteria | 5768 |
| 305 | Ga0157374_10028110 | 3300013296 | Bacteria | 5079 |
| 306 | Ga0157374_10029675 | 3300013296 | Bacteria | 4957 |
| 307 | Ga0157374_10056656 | 3300013296 | Bacteria | 3659 |
| 308 | Ga0157374_10204341 | 3300013296 | Bacteria | 1935 |
| 309 | Ga0157378_10082331 | 3300013297 | Bacteria | 2910 |
| 310 | Ga0157378_10175329 | 3300013297 | Bacteria | 2013 |
| 311 | Ga0163162_10000725 | 3300013306 | Bacteria | 30582 |
| 312 | Ga0163162_10001229 | 3300013306 | Bacteria | 23943 |
| 313 | Ga0163162_10002095 | 3300013306 | Bacteria | 18722 |
| 314 | Ga0163162_10009682 | 3300013306 | Bacteria | 9375 |
| 315 | Ga0163162_10010213 | 3300013306 | Bacteria | 9122 |
| 316 | Ga0163162_10014151 | 3300013306 | Bacteria | 7796 |
| 317 | Ga0163162_10032847 | 3300013306 | Bacteria | 5154 |
| 318 | Ga0163162_10066875 | 3300013306 | Bacteria | 3643 |
| 319 | Ga0163162_10078034 | 3300013306 | Bacteria | 3377 |
| 320 | Ga0163162_10188543 | 3300013306 | Bacteria | 2189 |
| 321 | Ga0163162_10230478 | 3300013306 | Bacteria | 1982 |
| 322 | Ga0157372_10000747 | 3300013307 | Bacteria | 35352 |
| 323 | Ga0157372_10002589 | 3300013307 | Bacteria | 19570 |
| 324 | Ga0157372_10007573 | 3300013307 | Bacteria | 11545 |
| 325 | Ga0157372_10007754 | 3300013307 | Bacteria | 11407 |
| 326 | Ga0157372_10009489 | 3300013307 | Bacteria | 10348 |
| 327 | Ga0157372_10011748 | 3300013307 | Bacteria | 9325 |
| 328 | Ga0157372_10017972 | 3300013307 | Bacteria | 7599 |
| 329 | Ga0157372_10022870 | 3300013307 | Bacteria | 6769 |
| 330 | Ga0157372_10025595 | 3300013307 | Bacteria | 6419 |
| 331 | Ga0157372_10034861 | 3300013307 | Bacteria | 5537 |
| 332 | Ga0157372_10062158 | 3300013307 | Bacteria | 4183 |
| 333 | Ga0157372_10133588 | 3300013307 | Bacteria | 2857 |
| 334 | Ga0157372_10187581 | 3300013307 | Bacteria | 2395 |
| 335 | Ga0157372_10253229 | 3300013307 | Bacteria | 2044 |
| 336 | Ga0157375_10000422 | 3300013308 | Bacteria | 38347 |
| 337 | Ga0157375_10005771 | 3300013308 | Bacteria | 10770 |
| 338 | Ga0157375_10009510 | 3300013308 | Bacteria | 8534 |
| 339 | Ga0157375_10011400 | 3300013308 | Bacteria | 7847 |
| 340 | Ga0157375_10045028 | 3300013308 | Bacteria | 4292 |
| 341 | Ga0157375_10059483 | 3300013308 | Bacteria | 3786 |
| 342 | Ga0157375_10200208 | 3300013308 | Bacteria | 2153 |
| 343 | Ga0163163_10000526 | 3300014325 | Bacteria | 34147 |
| 344 | Ga0163163_10000952 | 3300014325 | Bacteria | 24583 |
| 345 | Ga0163163_10001180 | 3300014325 | Bacteria | 22130 |
| 346 | Ga0163163_10022474 | 3300014325 | Bacteria | 5974 |
| 347 | Ga0163163_10039539 | 3300014325 | Bacteria | 4603 |
| 348 | Ga0163163_10175547 | 3300014325 | Bacteria | 2189 |
| 349 | Ga0157380_10000358 | 3300014326 | Bacteria | 27356 |
| 350 | Ga0157380_10004013 | 3300014326 | Bacteria | 10163 |
| 351 | Ga0182008_10032437 | 3300014497 | Bacteria | 2625 |
| 352 | Ga0157377_10002055 | 3300014745 | Bacteria | 8826 |
| 353 | Ga0157377_10004188 | 3300014745 | Bacteria | 6594 |
| 354 | Ga0157377_10009714 | 3300014745 | Bacteria | 4734 |
| 355 | Ga0157377_10016310 | 3300014745 | Bacteria | 3819 |
| 356 | Ga0157379_10001164 | 3300014968 | Bacteria | 21405 |
| 357 | Ga0157379_10002405 | 3300014968 | Bacteria | 15634 |
| 358 | Ga0157379_10022586 | 3300014968 | Bacteria | 5573 |
| 359 | Ga0157379_10072422 | 3300014968 | Bacteria | 3082 |
| 360 | Ga0157379_10125516 | 3300014968 | Bacteria | 2309 |
| 361 | Ga0157376_10000878 | 3300014969 | Bacteria | 19713 |
| 362 | Ga0157376_10001116 | 3300014969 | Bacteria | 17609 |
| 363 | Ga0157376_10006585 | 3300014969 | Bacteria | 8221 |
| 364 | Ga0157376_10025879 | 3300014969 | Bacteria | 4628 |
| 365 | Ga0157376_10028697 | 3300014969 | Bacteria | 4426 |
| 366 | Ga0157376_10089346 | 3300014969 | Bacteria | 2664 |
| 367 | Ga0182006_1007082 | 3300015261 | Bacteria | 5161 |
| 368 | Ga0182005_1000043 | 3300015265 | Bacteria | 140285 |
| 369 | Ga0163161_10002456 | 3300017792 | Bacteria | 13233 |
| 370 | Ga0163161_10039613 | 3300017792 | Bacteria | 3383 |
| 371 | Ga0163161_10120223 | 3300017792 | Bacteria | 1973 |
| 372 | Ga0213876_10000885 | 3300021384 | Bacteria | 20042 |
| 373 | Ga0209436_106139 | 3300025208 | Bacteria | 2669 |
| 374 | Ga0209258_100032 | 3300025242 | Bacteria | 452764 |
| 375 | Ga0209646_1000004 | 3300025246 | Bacteria | 786587 |
| 376 | Ga0209026_1000095 | 3300025250 | Bacteria | 164309 |
| 377 | Ga0209148_1000131 | 3300025254 | Bacteria | 174079 |
| 378 | Ga0209673_1000078 | 3300025273 | Bacteria | 227727 |
| 379 | Ga0209130_1001858 | 3300025284 | Bacteria | 12106 |
| 380 | Ga0209758_1000834 | 3300025297 | Bacteria | 43015 |
| 381 | Ga0209758_1008970 | 3300025297 | Bacteria | 6334 |
| 382 | Ga0209758_1010247 | 3300025297 | Bacteria | 5647 |
| 383 | Ga0209050_1000097 | 3300025298 | Bacteria | 239919 |
| 384 | Ga0207426_1000033 | 3300025302 | Bacteria | 455976 |
| 385 | Ga0207426_1000105 | 3300025302 | Bacteria | 247269 |
| 386 | Ga0207426_1000456 | 3300025302 | Bacteria | 64765 |
| 387 | Ga0207426_1001120 | 3300025302 | Bacteria | 24512 |
| 388 | Ga0209257_1000070 | 3300025304 | Bacteria | 336454 |
| 389 | Ga0209257_1001349 | 3300025304 | Bacteria | 29771 |
| 390 | Ga0207697_10027713 | 3300025315 | Bacteria | 2316 |
| 391 | Ga0207697_10029676 | 3300025315 | Bacteria | 2239 |
| 392 | Ga0207656_10000333 | 3300025321 | Bacteria | 16102 |
| 393 | Ga0207656_10005711 | 3300025321 | Bacteria | 4421 |
| 394 | Ga0207656_10013289 | 3300025321 | Bacteria | 3144 |
| 395 | Ga0207710_10001920 | 3300025900 | Bacteria | 9955 |
| 396 | Ga0207680_10000388 | 3300025903 | Bacteria | 21000 |
| 397 | Ga0207680_10046689 | 3300025903 | Bacteria | 2562 |
| 398 | Ga0207647_10000131 | 3300025904 | Bacteria | 58960 |
| 399 | Ga0207647_10018700 | 3300025904 | Bacteria | 4679 |
| 400 | Ga0207647_10047794 | 3300025904 | Bacteria | 2660 |
| 401 | Ga0207645_10001118 | 3300025907 | Bacteria | 22193 |
| 402 | Ga0207645_10002926 | 3300025907 | Bacteria | 13197 |
| 403 | Ga0207645_10007440 | 3300025907 | Bacteria | 7733 |
| 404 | Ga0207645_10030160 | 3300025907 | Bacteria | 3494 |
| 405 | Ga0207645_10032122 | 3300025907 | Bacteria | 3375 |
| 406 | Ga0207643_10017131 | 3300025908 | Bacteria | 3957 |
| 407 | Ga0207643_10039838 | 3300025908 | Bacteria | 2643 |
| 408 | Ga0207705_10005067 | 3300025909 | Bacteria | 9877 |
| 409 | Ga0207705_10032789 | 3300025909 | Bacteria | 3712 |
| 410 | Ga0207705_10053943 | 3300025909 | Bacteria | 2897 |
| 411 | Ga0207705_10107177 | 3300025909 | Bacteria | 2061 |
| 412 | Ga0207705_10141297 | 3300025909 | Bacteria | 1798 |
| 413 | Ga0207654_10001481 | 3300025911 | Bacteria | 12399 |
| 414 | Ga0207654_10124553 | 3300025911 | Bacteria | 1623 |
| 415 | Ga0207707_10024994 | 3300025912 | Bacteria | 5226 |
| 416 | Ga0207707_10092500 | 3300025912 | Bacteria | 2643 |
| 417 | Ga0207695_10000010 | 3300025913 | Bacteria | 981919 |
| 418 | Ga0207695_10001317 | 3300025913 | Bacteria | 42084 |
| 419 | Ga0207695_10001383 | 3300025913 | Bacteria | 41051 |
| 420 | Ga0207695_10002258 | 3300025913 | Bacteria | 28855 |
| 421 | Ga0207695_10008072 | 3300025913 | Bacteria | 13242 |
| 422 | Ga0207695_10017403 | 3300025913 | Bacteria | 8364 |
| 423 | Ga0207695_10021984 | 3300025913 | Bacteria | 7259 |
| 424 | Ga0207695_10032855 | 3300025913 | Bacteria | 5672 |
| 425 | Ga0207695_10181482 | 3300025913 | Bacteria | 2026 |
| 426 | Ga0207695_10203740 | 3300025913 | Bacteria | 1892 |
| 427 | Ga0207671_10000126 | 3300025914 | Bacteria | 118967 |
| 428 | Ga0207671_10001848 | 3300025914 | Bacteria | 23634 |
| 429 | Ga0207671_10006294 | 3300025914 | Bacteria | 10604 |
| 430 | Ga0207671_10008066 | 3300025914 | Bacteria | 8997 |
| 431 | Ga0207671_10113076 | 3300025914 | Bacteria | 2068 |
| 432 | Ga0207660_10008378 | 3300025917 | Bacteria | 6687 |
| 433 | Ga0207660_10157829 | 3300025917 | Bacteria | 1748 |
| 434 | Ga0207657_10002329 | 3300025919 | Bacteria | 20592 |
| 435 | Ga0207657_10002631 | 3300025919 | Bacteria | 19391 |
| 436 | Ga0207657_10079840 | 3300025919 | Bacteria | 2752 |
| 437 | Ga0207649_10004740 | 3300025920 | Bacteria | 7362 |
| 438 | Ga0207649_10073468 | 3300025920 | Bacteria | 2191 |
| 439 | Ga0207652_10000035 | 3300025921 | Bacteria | 138263 |
| 440 | Ga0207652_10000132 | 3300025921 | Bacteria | 80345 |
| 441 | Ga0207652_10021939 | 3300025921 | Bacteria | 5276 |
| 442 | Ga0207652_10022399 | 3300025921 | Bacteria | 5226 |
| 443 | Ga0207652_10027902 | 3300025921 | Bacteria | 4708 |
| 444 | Ga0207652_10038378 | 3300025921 | Bacteria | 4060 |
| 445 | Ga0207652_10090593 | 3300025921 | Bacteria | 2688 |
| 446 | Ga0207681_10002654 | 3300025923 | Bacteria | 11336 |
| 447 | Ga0207650_10000813 | 3300025925 | Bacteria | 23983 |
| 448 | Ga0207650_10007657 | 3300025925 | Bacteria | 7357 |
| 449 | Ga0207650_10054602 | 3300025925 | Bacteria | 2964 |
| 450 | Ga0207659_10056737 | 3300025926 | Bacteria | 2806 |
| 451 | Ga0207659_10086518 | 3300025926 | Bacteria | 2331 |
| 452 | Ga0207687_10122252 | 3300025927 | Bacteria | 1948 |
| 453 | Ga0207644_10009272 | 3300025931 | Bacteria | 6457 |
| 454 | Ga0207644_10032638 | 3300025931 | Bacteria | 3634 |
| 455 | Ga0207690_10002315 | 3300025932 | Bacteria | 11612 |
| 456 | Ga0207690_10047766 | 3300025932 | Bacteria | 2842 |
| 457 | Ga0207690_10100658 | 3300025932 | Bacteria | 2063 |
| 458 | Ga0207686_10001307 | 3300025934 | Bacteria | 14268 |
| 459 | Ga0207686_10030919 | 3300025934 | Bacteria | 3176 |
| 460 | Ga0207686_10131598 | 3300025934 | Bacteria | 1716 |
| 461 | Ga0207670_10055422 | 3300025936 | Bacteria | 2679 |
| 462 | Ga0207670_10076591 | 3300025936 | Bacteria | 2328 |
| 463 | Ga0207669_10061180 | 3300025937 | Bacteria | 2313 |
| 464 | Ga0207704_10061292 | 3300025938 | Bacteria | 2332 |
| 465 | Ga0207665_10039567 | 3300025939 | Bacteria | 3144 |
| 466 | Ga0207691_10000234 | 3300025940 | Bacteria | 54055 |
| 467 | Ga0207691_10015441 | 3300025940 | Bacteria | 7262 |
| 468 | Ga0207691_10024604 | 3300025940 | Bacteria | 5663 |
| 469 | Ga0207691_10055070 | 3300025940 | Bacteria | 3627 |
| 470 | Ga0207691_10076955 | 3300025940 | Bacteria | 3006 |
| 471 | Ga0207691_10152709 | 3300025940 | Bacteria | 2029 |
| 472 | Ga0207691_10164640 | 3300025940 | Bacteria | 1944 |
| 473 | Ga0207691_10178365 | 3300025940 | Bacteria | 1857 |
| 474 | Ga0207711_10045385 | 3300025941 | Bacteria | 3756 |
| 475 | Ga0207689_10001731 | 3300025942 | Bacteria | 20624 |
| 476 | Ga0207689_10002903 | 3300025942 | Bacteria | 15819 |
| 477 | Ga0207689_10009247 | 3300025942 | Bacteria | 8520 |
| 478 | Ga0207689_10009943 | 3300025942 | Bacteria | 8205 |
| 479 | Ga0207689_10013291 | 3300025942 | Bacteria | 7022 |
| 480 | Ga0207689_10022012 | 3300025942 | Bacteria | 5360 |
| 481 | Ga0207689_10076912 | 3300025942 | Bacteria | 2744 |
| 482 | Ga0207661_10008794 | 3300025944 | Bacteria | 7226 |
| 483 | Ga0207661_10011866 | 3300025944 | Bacteria | 6329 |
| 484 | Ga0207661_10053266 | 3300025944 | Bacteria | 3237 |
| 485 | Ga0207661_10094061 | 3300025944 | Bacteria | 2503 |
| 486 | Ga0207661_10121104 | 3300025944 | Bacteria | 2228 |
| 487 | Ga0207679_10002212 | 3300025945 | Bacteria | 12010 |
| 488 | Ga0207679_10005363 | 3300025945 | Bacteria | 8038 |
| 489 | Ga0207679_10011951 | 3300025945 | Bacteria | 5642 |
| 490 | Ga0207679_10026650 | 3300025945 | Bacteria | 3988 |
| 491 | Ga0207679_10033867 | 3300025945 | Bacteria | 3598 |
| 492 | Ga0207667_10001836 | 3300025949 | Bacteria | 26673 |
| 493 | Ga0207667_10001839 | 3300025949 | Bacteria | 26648 |
| 494 | Ga0207667_10009289 | 3300025949 | Bacteria | 11600 |
| 495 | Ga0207667_10009325 | 3300025949 | Bacteria | 11574 |
| 496 | Ga0207667_10009593 | 3300025949 | Bacteria | 11391 |
| 497 | Ga0207667_10124347 | 3300025949 | Bacteria | 2657 |
| 498 | Ga0207667_10157962 | 3300025949 | Bacteria | 2333 |
| 499 | Ga0207651_10034033 | 3300025960 | Bacteria | 3294 |
| 500 | Ga0207651_10035779 | 3300025960 | Bacteria | 3234 |
| 501 | Ga0207712_10001902 | 3300025961 | Bacteria | 13729 |
| 502 | Ga0207712_10005835 | 3300025961 | Bacteria | 7759 |
| 503 | Ga0207712_10008201 | 3300025961 | Bacteria | 6603 |
| 504 | Ga0207712_10018213 | 3300025961 | Bacteria | 4571 |
| 505 | Ga0207712_10044296 | 3300025961 | Bacteria | 3074 |
| 506 | Ga0207668_10000432 | 3300025972 | Bacteria | 26449 |
| 507 | Ga0207668_10046555 | 3300025972 | Bacteria | 2964 |
| 508 | Ga0207668_10082096 | 3300025972 | Bacteria | 2340 |
| 509 | Ga0207640_10099570 | 3300025981 | Bacteria | 2035 |
| 510 | Ga0207658_10024873 | 3300025986 | Bacteria | 4189 |
| 511 | Ga0207658_10036299 | 3300025986 | Bacteria | 3533 |
| 512 | Ga0207658_10048778 | 3300025986 | Bacteria | 3107 |
| 513 | Ga0207658_10083697 | 3300025986 | Bacteria | 2453 |
| 514 | Ga0207677_10010228 | 3300026023 | Bacteria | 5302 |
| 515 | Ga0207677_10036891 | 3300026023 | Bacteria | 3190 |
| 516 | Ga0207677_10042459 | 3300026023 | Bacteria | 3015 |
| 517 | Ga0207677_10186850 | 3300026023 | Bacteria | 1635 |
| 518 | Ga0207703_10013593 | 3300026035 | Bacteria | 6344 |
| 519 | Ga0207703_10150063 | 3300026035 | Bacteria | 2031 |
| 520 | Ga0207639_10003843 | 3300026041 | Bacteria | 10119 |
| 521 | Ga0207639_10012382 | 3300026041 | Bacteria | 5939 |
| 522 | Ga0207639_10063591 | 3300026041 | Bacteria | 2858 |
| 523 | Ga0207639_10067763 | 3300026041 | Bacteria | 2778 |
| 524 | Ga0207639_10075856 | 3300026041 | Bacteria | 2646 |
| 525 | Ga0207639_10081919 | 3300026041 | Bacteria | 2557 |
| 526 | Ga0207639_10150960 | 3300026041 | Bacteria | 1946 |
| 527 | Ga0207678_10038315 | 3300026067 | Bacteria | 4165 |
| 528 | Ga0207702_10028372 | 3300026078 | Bacteria | 4652 |
| 529 | Ga0207702_10040370 | 3300026078 | Bacteria | 3913 |
| 530 | Ga0207702_10053768 | 3300026078 | Bacteria | 3410 |
| 531 | Ga0207641_10000026 | 3300026088 | Bacteria | 245091 |
| 532 | Ga0207641_10000422 | 3300026088 | Bacteria | 49394 |
| 533 | Ga0207641_10060156 | 3300026088 | Bacteria | 3237 |
| 534 | Ga0207641_10270577 | 3300026088 | Bacteria | 1594 |
| 535 | Ga0207641_10276628 | 3300026088 | Bacteria | 1577 |
| 536 | Ga0207648_10000768 | 3300026089 | Bacteria | 36105 |
| 537 | Ga0207648_10003325 | 3300026089 | Bacteria | 16891 |
| 538 | Ga0207648_10015205 | 3300026089 | Bacteria | 7082 |
| 539 | Ga0207648_10029956 | 3300026089 | Bacteria | 4827 |
| 540 | Ga0207648_10047742 | 3300026089 | Bacteria | 3751 |
| 541 | Ga0207648_10049961 | 3300026089 | Bacteria | 3658 |
| 542 | Ga0207648_10106411 | 3300026089 | Bacteria | 2461 |
| 543 | Ga0207648_10125080 | 3300026089 | Bacteria | 2261 |
| 544 | Ga0207676_10003977 | 3300026095 | Bacteria | 10429 |
| 545 | Ga0207676_10063950 | 3300026095 | Bacteria | 2923 |
| 546 | Ga0207676_10083732 | 3300026095 | Bacteria | 2598 |
| 547 | Ga0207674_10001969 | 3300026116 | Bacteria | 26000 |
| 548 | Ga0207674_10015924 | 3300026116 | Bacteria | 8239 |
| 549 | Ga0207674_10022101 | 3300026116 | Bacteria | 6837 |
| 550 | Ga0207674_10042154 | 3300026116 | Bacteria | 4716 |
| 551 | Ga0207674_10091641 | 3300026116 | Bacteria | 3029 |
| 552 | Ga0207674_10118979 | 3300026116 | Bacteria | 2611 |
| 553 | Ga0207674_10137700 | 3300026116 | Unclassified | 2402 |
| 554 | Ga0207674_10184078 | 3300026116 | Bacteria | 2039 |
| 555 | Ga0207675_100000144 | 3300026118 | Bacteria | 61517 |
| 556 | Ga0207675_100020719 | 3300026118 | Bacteria | 6130 |
| 557 | Ga0207675_100022457 | 3300026118 | Bacteria | 5876 |
| 558 | Ga0207675_100025828 | 3300026118 | Bacteria | 5464 |
| 559 | Ga0207683_10017481 | 3300026121 | Bacteria | 6112 |
| 560 | Ga0207683_10084988 | 3300026121 | Bacteria | 2813 |
| 561 | Ga0207683_10130854 | 3300026121 | Bacteria | 2257 |
| 562 | Ga0207698_10039715 | 3300026142 | Bacteria | 3489 |
| 563 | Ga0207698_10054329 | 3300026142 | Bacteria | 3081 |
| 564 | Ga0207698_10071168 | 3300026142 | Bacteria | 2759 |
| 565 | Ga0207698_10103946 | 3300026142 | Bacteria | 2362 |
| 566 | Ga0207698_10154109 | 3300026142 | Bacteria | 1999 |
| 567 | Ga0207698_10194199 | 3300026142 | Bacteria | 1812 |
| 568 | Ga0207428_10031022 | 3300027907 | Bacteria | 4415 |
| 569 | Ga0268266_10000169 | 3300028379 | Bacteria | 119437 |
| 570 | Ga0268265_10006981 | 3300028380 | Bacteria | 7639 |
| 571 | Ga0268265_10011311 | 3300028380 | Bacteria | 6034 |
| 572 | Ga0268265_10073664 | 3300028380 | Bacteria | 2668 |
| 573 | Ga0268265_10084602 | 3300028380 | Bacteria | 2515 |
| 574 | Ga0268264_10000063 | 3300028381 | Bacteria | 301702 |
| 575 | Ga0268264_10001719 | 3300028381 | Bacteria | 20165 |
| 576 | Ga0268264_10001931 | 3300028381 | Bacteria | 18678 |
| 577 | Ga0268264_10018882 | 3300028381 | Bacteria | 5637 |
| 578 | Ga0268264_10026822 | 3300028381 | Bacteria | 4707 |
| 579 | Ga0268264_10074753 | 3300028381 | Bacteria | 2879 |
| 580 | Ga0307517_10000487 | 3300028786 | Bacteria | 68165 |
| 581 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 582 | Ga0307515_10000031 | 3300028794 | Bacteria | 358648 |
| 583 | Ga0307511_10000409 | 3300030521 | Bacteria | 45829 |
| 584 | Ga0316177_1169895 | 3300030731 | Bacteria | 24080 |
| 585 | Ga0316183_1210954 | 3300030742 | Bacteria | 30051 |
| 586 | Ga0316181_1117584 | 3300030744 | Bacteria | 7603 |
| 587 | Ga0265327_10000022 | 3300031251 | Bacteria | 402724 |
| 588 | Ga0265327_10000024 | 3300031251 | Bacteria | 382499 |
| 589 | Ga0265327_10000098 | 3300031251 | Bacteria | 190693 |
| 590 | Ga0265327_10000115 | 3300031251 | Bacteria | 173854 |
| 591 | Ga0265327_10010626 | 3300031251 | Bacteria | 6445 |
| 592 | Ga0265327_10033672 | 3300031251 | Bacteria | 2852 |
| 593 | Ga0307509_10125570 | 3300031507 | Bacteria | 2532 |
| 594 | Ga0307408_100013503 | 3300031548 | Bacteria | 5422 |
| 595 | Ga0307508_10000990 | 3300031616 | Bacteria | 33005 |
| 596 | Ga0316575_10045977 | 3300031665 | Bacteria | 1733 |
| 597 | Ga0316579_10000254 | 3300031691 | Bacteria | 16325 |
| 598 | Ga0316579_10029177 | 3300031691 | Bacteria | 2516 |
| 599 | Ga0265314_10013970 | 3300031711 | Bacteria | 6456 |
| 600 | Ga0316576_10000606 | 3300031727 | Bacteria | 17198 |
| 601 | Ga0316576_10014694 | 3300031727 | Bacteria | 5235 |
| 602 | Ga0316576_10115726 | 3300031727 | Bacteria | 2012 |
| 603 | Ga0316578_10000170 | 3300031728 | Bacteria | 17695 |
| 604 | Ga0316578_10006539 | 3300031728 | Bacteria | 5763 |
| 605 | Ga0316578_10013340 | 3300031728 | Bacteria | 4357 |
| 606 | Ga0316578_10022524 | 3300031728 | Bacteria | 3513 |
| 607 | Ga0316578_10048839 | 3300031728 | Bacteria | 2472 |
| 608 | Ga0307516_10000384 | 3300031730 | Bacteria | 57633 |
| 609 | Ga0316577_10000544 | 3300031733 | Bacteria | 15259 |
| 610 | Ga0316577_10007819 | 3300031733 | Bacteria | 5711 |
| 611 | Ga0307413_10003715 | 3300031824 | Bacteria | 6491 |
| 612 | Ga0307413_10091415 | 3300031824 | Bacteria | 1983 |
| 613 | Ga0307410_10006996 | 3300031852 | Bacteria | 6139 |
| 614 | Ga0307410_10009417 | 3300031852 | Bacteria | 5478 |
| 615 | Ga0307416_100013580 | 3300032002 | Bacteria | 5543 |
| 616 | Ga0307416_100034718 | 3300032002 | Bacteria | 3842 |
| 617 | Ga0307414_10000265 | 3300032004 | Bacteria | 32893 |
| 618 | Ga0307414_10001628 | 3300032004 | Bacteria | 11692 |
| 619 | Ga0307414_10006160 | 3300032004 | Bacteria | 6666 |
| 620 | Ga0307414_10030112 | 3300032004 | Bacteria | 3542 |
| 621 | Ga0307415_100001814 | 3300032126 | Bacteria | 10459 |
| 622 | Ga0316585_10000090 | 3300032137 | Bacteria | 15919 |
| 623 | Ga0316585_10001471 | 3300032137 | Bacteria | 6234 |
| 624 | Ga0316585_10005628 | 3300032137 | Bacteria | 3544 |
| 625 | Ga0316580_10000022 | 3300032139 | Bacteria | 24359 |
| 626 | Ga0316580_10023244 | 3300032139 | Bacteria | 1914 |
| 627 | Ga0316593_10007337 | 3300032168 | Bacteria | 3024 |
| 628 | Ga0307507_10077837 | 3300033179 | Bacteria | 2945 |
| 629 | Ga0316592_1001868 | 3300033524 | Bacteria | 3524 |
| 630 | Ga0316596_1001179 | 3300033541 | Bacteria | 5140 |
| 631 | Ga0316574_0000475 | 3300035398 | Bacteria | 16212 |
| 632 | Ga0373937_0066181 | 3300036401 | Bacteria | 3327 |
| 633 | Ga0373937_0090256 | 3300036401 | Bacteria | 2838 |
| 634 | Ga0373937_0162063 | 3300036401 | Bacteria | 2097 |
| 635 | Ga0316582_0000433 | 3300036647 | Bacteria | 15355 |
| 636 | Ga0316582_0006556 | 3300036647 | Bacteria | 6127 |
| 637 | Ga0316582_0014502 | 3300036647 | Bacteria | 4473 |
| 638 | Ga0316582_0164071 | 3300036647 | Bacteria | 1506 |
| 639 | Ga0316584_0000285 | 3300036712 | Bacteria | 25979 |
| 640 | Ga0316584_0007080 | 3300036712 | Bacteria | 7642 |
| 641 | Ga0316584_0058296 | 3300036712 | Bacteria | 2891 |
| 642 | Ga0316584_0134144 | 3300036712 | Bacteria | 1849 |
| 643 | Ga0395899_0015284 | 3300037312 | Bacteria | 5849 |
| 644 | Ga0395899_0135775 | 3300037312 | Bacteria | 1753 |
| 645 | Ga0395900_0008860 | 3300037418 | Bacteria | 10332 |
| 646 | Ga0395900_0012723 | 3300037418 | Bacteria | 8600 |
| 647 | Ga0395900_0018392 | 3300037418 | Bacteria | 7126 |
| 648 | Ga0395900_0038660 | 3300037418 | Bacteria | 4918 |
| 649 | Ga0395900_0142031 | 3300037418 | Bacteria | 2458 |
| 650 | Ga0395900_0154886 | 3300037418 | Bacteria | 2340 |
| 651 | Ga0395898_0007992 | 3300037466 | Bacteria | 11222 |
| 652 | Ga0395898_0011506 | 3300037466 | Bacteria | 9188 |
| 653 | Ga0395898_0018041 | 3300037466 | Bacteria | 7199 |
| 654 | Ga0395898_0050747 | 3300037466 | Bacteria | 4059 |
| 655 | Ga0395898_0080524 | 3300037466 | Bacteria | 3140 |
| 656 | Ga0395905_0000001 | 3300037471 | Bacteria | 2037079 |
| 657 | Ga0395905_0026934 | 3300037471 | Bacteria | 5421 |
| 658 | Ga0395905_0075898 | 3300037471 | Bacteria | 3150 |
| 659 | Ga0395905_0142123 | 3300037471 | Bacteria | 2258 |
| 660 | Ga0316581_0000064 | 3300037588 | Bacteria | 12767 |
| 661 | Ga0395901_0002694 | 3300038443 | Bacteria | 17900 |
| 662 | Ga0395901_0004549 | 3300038443 | Bacteria | 13997 |
| 663 | Ga0395901_0005612 | 3300038443 | Bacteria | 12699 |
| 664 | Ga0395901_0014329 | 3300038443 | Bacteria | 8074 |
| 665 | Ga0395901_0130252 | 3300038443 | Bacteria | 2643 |
| 666 | Ga0395901_0145178 | 3300038443 | Bacteria | 2494 |
| 667 | Ga0400484_39394 | 3300038725 | Bacteria | 11243 |
| 668 | Ga0400490_23680 | 3300038726 | Bacteria | 4839 |
| 669 | Ga0400486_05096 | 3300038742 | Bacteria | 1674 |
| 670 | Ga0436365_1933142 | 3300039437 | Bacteria | 64226 |
| 671 | Ga0439465_0023158 | 3300041413 | Bacteria | 1954 |
| 672 | Ga0451849_1391693 | 3300041505 | Bacteria | 1468 |
| 673 | Ga0451853_2497079 | 3300041512 | Bacteria | 2586 |
| 674 | Ga0439431_0006689 | 3300041997 | Bacteria | 2556 |
| 675 | Ga0439431_0009752 | 3300041997 | Bacteria | 2172 |
| 676 | Ga0439449_0049712 | 3300042007 | Bacteria | 1551 |
| 677 | Ga0439434_0012643 | 3300042435 | Bacteria | 2498 |
| 678 | Ga0451577_0088718 | 3300042876 | Unclassified | 2759 |
| 679 | Ga0451577_0097971 | 3300042876 | Bacteria | 2619 |
| 680 | Ga0466972_0000001 | 3300044658 | Bacteria | 412457 |
| 681 | Ga0466972_0000009 | 3300044658 | Bacteria | 256374 |
| 682 | Ga0466972_0016018 | 3300044658 | Bacteria | 3747 |
| 683 | Ga0466972_0044812 | 3300044658 | Bacteria | 2144 |
| 684 | Ga0466966_0007506 | 3300044684 | Bacteria | 7221 |
| 685 | Ga0453684_0000310 | 3300044712 | Bacteria | 206883 |
| 686 | Ga0453684_0010921 | 3300044712 | Bacteria | 15366 |
| 687 | Ga0453684_0070018 | 3300044712 | Bacteria | 4445 |
| 688 | Ga0453684_0087334 | 3300044712 | Bacteria | 3865 |
| 689 | Ga0466971_0011942 | 3300044719 | Bacteria | 3805 |
| 690 | Ga0466968_0030723 | 3300044735 | Bacteria | 2226 |
| 691 | Ga0466970_0014643 | 3300044765 | Bacteria | 4028 |
| 692 | Ga0466957_0000378 | 3300044842 | Bacteria | 21778 |
| 693 | Ga0466957_0016025 | 3300044842 | Bacteria | 4381 |
| 694 | Ga0466960_0089080 | 3300044901 | Bacteria | 1570 |
| 695 | Ga0466959_0000003 | 3300045049 | Bacteria | 285164 |
| 696 | Ga0451576_0006077 | 3300045051 | Bacteria | 14888 |
| 697 | Ga0451576_0009193 | 3300045051 | Bacteria | 11482 |
| 698 | Ga0451576_0101877 | 3300045051 | Bacteria | 2986 |
| 699 | Ga0451576_0239037 | 3300045051 | Bacteria | 1897 |
| 700 | Ga0466967_0210447 | 3300045976 | Bacteria | 1844 |
| 701 | Ga0495627_002110 | 3300046453 | Bacteria | 10063 |
| 702 | Ga0495592_0023551 | 3300046454 | Bacteria | 4684 |
| 703 | Ga0495650_0041526 | 3300046471 | Bacteria | 1966 |
| 704 | Ga0495594_0022025 | 3300046499 | Bacteria | 3407 |
| 705 | Ga0495630_0065621 | 3300046517 | Unclassified | 2728 |
| 706 | Ga0495648_0017034 | 3300046524 | Bacteria | 5214 |
| 707 | Ga0495640_0125217 | 3300046533 | Bacteria | 1667 |
| 708 | Ga0495645_0062993 | 3300046543 | Unclassified | 2686 |
| 709 | Ga0495633_0000133 | 3300046558 | Bacteria | 100207 |
| 710 | Ga0495668_0000082 | 3300046616 | Bacteria | 154982 |
| 711 | Ga0495668_0000419 | 3300046616 | Bacteria | 55322 |
| 712 | Ga0495668_0004630 | 3300046616 | Bacteria | 9663 |
| 713 | Ga0495611_0000061 | 3300046648 | Bacteria | 77533 |
| 714 | Ga0495658_0040755 | 3300046683 | Unclassified | 2583 |
| 715 | Ga0495670_0016896 | 3300046691 | Bacteria | 3587 |
| 716 | Ga0495636_0000022 | 3300047318 | Bacteria | 72235 |
| 717 | Ga0495672_0015419 | 3300047320 | Bacteria | 5189 |
| 718 | Ga0495672_0052004 | 3300047320 | Bacteria | 2409 |
| 719 | Ga0495687_001475 | 3300047443 | Bacteria | 21512 |
| 720 | Ga0495675_0087728 | 3300047444 | Unclassified | 1955 |
| 721 | Ga0495686_0000010 | 3300047472 | Bacteria | 573229 |
| 722 | Ga0495686_0000230 | 3300047472 | Bacteria | 102747 |
| 723 | Ga0495686_0044521 | 3300047472 | Bacteria | 2810 |
| 724 | Ga0495686_0119367 | 3300047472 | Bacteria | 1573 |
| 725 | Ga0496104_0230964 | 3300048907 | Bacteria | 1762 |
| 726 | Ga0496105_0098991 | 3300048908 | Bacteria | 2408 |
| 727 | Ga0496109_0139217 | 3300048912 | Bacteria | 2269 |
| 728 | Ga0496115_0011125 | 3300048918 | Bacteria | 6742 |
| 729 | Ga0496115_0084779 | 3300048918 | Bacteria | 2584 |
| 730 | Ga0496121_0000086 | 3300048924 | Bacteria | 223703 |
| 731 | Ga0496126_0015448 | 3300048929 | Bacteria | 7678 |
| 732 | Ga0501292_004534 | 3300049515 | Bacteria | 1903 |
| 733 | Ga0501031_0028370 | 3300049568 | Bacteria | 3648 |
| 734 | Ga0501033_0054738 | 3300049570 | Bacteria | 2951 |
| 735 | Ga0501033_0073860 | 3300049570 | Bacteria | 2504 |
| 736 | Ga0501034_0000152 | 3300049571 | Bacteria | 130576 |
| 737 | Ga0501034_0007368 | 3300049571 | Bacteria | 11721 |
| 738 | Ga0501034_0017493 | 3300049571 | Bacteria | 7352 |
| 739 | Ga0501034_0023796 | 3300049571 | Bacteria | 6237 |
| 740 | Ga0501034_0058492 | 3300049571 | Bacteria | 3874 |
| 741 | Ga0501034_0149415 | 3300049571 | Bacteria | 2312 |
| 742 | Ga0501034_0333117 | 3300049571 | Bacteria | 1449 |
| 743 | Ga0501036_0001672 | 3300049572 | Bacteria | 17196 |
| 744 | Ga0501043_0021684 | 3300049579 | Bacteria | 5036 |
| 745 | Ga0501043_0031114 | 3300049579 | Bacteria | 4196 |
| 746 | Ga0501046_0060233 | 3300049580 | Bacteria | 2971 |
| 747 | Ga0501046_0068687 | 3300049580 | Bacteria | 2757 |
| 748 | Ga0501047_0037558 | 3300049581 | Bacteria | 4683 |
| 749 | Ga0501068_0025540 | 3300049584 | Bacteria | 3475 |
| 750 | Ga0501073_0008525 | 3300049589 | Bacteria | 7599 |
| 751 | Ga0501073_0062855 | 3300049589 | Bacteria | 2589 |
| 752 | Ga0501074_0004127 | 3300049590 | Bacteria | 10369 |
| 753 | Ga0501077_0038341 | 3300049593 | Bacteria | 3051 |
| 754 | Ga0501198_000923 | 3300049649 | Bacteria | 3704 |
| 755 | Ga0501201_002174 | 3300049651 | Bacteria | 1797 |
| 756 | Ga0501202_000366 | 3300049652 | Bacteria | 6277 |
| 757 | Ga0501202_000861 | 3300049652 | Bacteria | 4615 |
| 758 | Ga0501206_001276 | 3300049653 | Bacteria | 3151 |
| 759 | Ga0501207_000033 | 3300049654 | Bacteria | 9861 |
| 760 | Ga0501217_000032 | 3300049661 | Bacteria | 15163 |
| 761 | Ga0501222_001790 | 3300049662 | Bacteria | 2977 |
| 762 | Ga0501223_001089 | 3300049663 | Bacteria | 6399 |
| 763 | Ga0501224_000552 | 3300049664 | Bacteria | 4600 |
| 764 | Ga0501224_001773 | 3300049664 | Bacteria | 2904 |
| 765 | Ga0501233_000698 | 3300049668 | Bacteria | 5540 |
| 766 | Ga0501235_001149 | 3300049669 | Bacteria | 5562 |
| 767 | Ga0501243_001994 | 3300049675 | Bacteria | 2968 |
| 768 | Ga0501252_000123 | 3300049682 | Bacteria | 4539 |
| 769 | Ga0501259_000354 | 3300049688 | Bacteria | 7179 |
| 770 | Ga0501219_000135 | 3300049703 | Bacteria | 13063 |
| 771 | Ga0501221_000193 | 3300049704 | Bacteria | 8546 |
| 772 | Ga0501221_003634 | 3300049704 | Bacteria | 2541 |
| 773 | Ga0501221_011529 | 3300049704 | Bacteria | 1593 |
| 774 | Ga0501225_0003023 | 3300049705 | Bacteria | 5136 |
| 775 | Ga0501225_0008552 | 3300049705 | Bacteria | 2933 |
| 776 | Ga0501234_000488 | 3300049707 | Bacteria | 6078 |
| 777 | Ga0501245_000726 | 3300049708 | Bacteria | 4079 |
| 778 | Ga0501245_001563 | 3300049708 | Bacteria | 2979 |
| 779 | Ga0501080_0098250 | 3300049742 | Bacteria | 2718 |
| 780 | Ga0501266_000438 | 3300049763 | Bacteria | 5487 |
| 781 | Ga0501035_0006854 | 3300049822 | Bacteria | 10640 |
| 782 | Ga0501035_0093095 | 3300049822 | Bacteria | 2652 |
| 783 | Ga0501044_0036368 | 3300049823 | Bacteria | 5152 |
| 784 | Ga0501044_0047734 | 3300049823 | Bacteria | 4428 |
| 785 | Ga0501284_00001 | 3300050005 | Bacteria | 261916 |
| 786 | nmdc:mga0k408_109559_c1 | 3300050493 | Bacteria | 1632 |
| 787 | nmdc:mga0k408_111924_c1 | 3300050493 | Bacteria | 1614 |
| 788 | nmdc:mga0k408_22621_c1 | 3300050493 | Bacteria | 3540 |
| 789 | nmdc:mga0k408_3446_c2 | 3300050493 | Bacteria | 6350 |
| 790 | nmdc:mga05p37_135272_c1 | 3300050507 | Bacteria | 3023 |
| 791 | nmdc:mga05p37_1394_c1 | 3300050507 | Bacteria | 28114 |
| 792 | nmdc:mga09592_14999_c1 | 3300050508 | Bacteria | 6330 |
| 793 | nmdc:mga09592_85275_c1 | 3300050508 | Bacteria | 2695 |
| 794 | nmdc:mga0qj67_7275_c1 | 3300050509 | Bacteria | 8178 |
| 795 | nmdc:mga06r32_24207_c1 | 3300050510 | Bacteria | 5631 |
| 796 | nmdc:mga06r32_29407_c1 | 3300050510 | Bacteria | 5149 |
| 797 | nmdc:mga08y16_18928_c1 | 3300050511 | Bacteria | 7251 |
| 798 | nmdc:mga08y16_86406_c1 | 3300050511 | Bacteria | 3268 |
| 799 | Ga0495619_0090403 | 3300053085 | Bacteria | 2073 |
| 800 | Ga0500578_0000920 | 3300053086 | Bacteria | 33032 |
| 801 | Ga0500644_0000280 | 3300053088 | Bacteria | 28313 |
| 802 | Ga0500646_0006025 | 3300053090 | Bacteria | 3076 |
| 803 | Ga0500583_0002427 | 3300053092 | Bacteria | 5600 |
| 804 | Ga0500583_0006290 | 3300053092 | Bacteria | 4071 |
| 805 | Ga0500562_000024 | 3300053108 | Bacteria | 105996 |
| 806 | Ga0500642_0003936 | 3300053130 | Bacteria | 4578 |
| 807 | Ga0500561_0001063 | 3300053137 | Bacteria | 4414 |
| 808 | Ga0500568_0004057 | 3300053139 | Bacteria | 7928 |
| 809 | Ga0500577_0000645 | 3300053142 | Bacteria | 8942 |
| 810 | Ga0500604_0000475 | 3300053151 | Bacteria | 11057 |
| 811 | Ga0500616_0001228 | 3300053153 | Bacteria | 25762 |
| 812 | Ga0500616_0002857 | 3300053153 | Bacteria | 13857 |
| 813 | Ga0500622_0000157 | 3300053156 | Bacteria | 71381 |
| 814 | Ga0500622_0000353 | 3300053156 | Bacteria | 44849 |
| 815 | Ga0500622_0002409 | 3300053156 | Bacteria | 13517 |
| 816 | Ga0500627_0020614 | 3300053158 | Bacteria | 2646 |
| 817 | Ga0500633_0001976 | 3300053160 | Bacteria | 4078 |
| 818 | Ga0500637_0013682 | 3300053178 | Bacteria | 4263 |
| 819 | Ga0500611_000001 | 3300053727 | Bacteria | 385744 |
| 820 | Ga0501084_0012779 | 3300054114 | Bacteria | 6957 |
| 821 | Ga0500661_001032 | 3300055283 | Bacteria | 5252 |
| 822 | Ga0466962_0006769 | 3300061719 | Bacteria | 5499 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036712 | Ga0316584_0134144 | Ga0316584_0134144_20_1243 | 398 |
| 2 | 3300046533 | Ga0495640_0125217 | Ga0495640_0125217_368_1630 | 410 |
| 3 | 3300041505 | Ga0451849_1391693 | Ga0451849_1391693_16_1278 | 417 |
| 4 | 3300036647 | Ga0316582_0014502 | Ga0316582_0014502_3126_4424 | 426 |
| 5 | 3300031691 | Ga0316579_10029177 | Ga0316579_100291772 | 427 |
| 6 | 3300036647 | Ga0316582_0006556 | Ga0316582_0006556_547_2016 | 427 |
| 7 | 3300036712 | Ga0316584_0058296 | Ga0316584_0058296_597_2066 | 430 |
| 8 | 3300032137 | Ga0316585_10001471 | Ga0316585_100014712 | 435 |
| 9 | 3300032139 | Ga0316580_10023244 | Ga0316580_100232441 | 435 |
| 10 | 3300044901 | Ga0466960_0089080 | Ga0466960_0089080_23_1369 | 444 |
| 11 | 3300025938 | Ga0207704_10061292 | Ga0207704_100612921 | 446 |
| 12 | 3300037418 | Ga0395900_0012723 | Ga0395900_0012723_2279_3682 | 446 |
| 13 | 3300037466 | Ga0395898_0050747 | Ga0395898_0050747_563_1966 | 446 |
| 14 | 3300038443 | Ga0395901_0002694 | Ga0395901_0002694_6845_8248 | 446 |
| 15 | 3300005331 | Ga0070670_100071766 | Ga0070670_1000717662 | 447 |
| 16 | 3300032002 | Ga0307416_100013580 | Ga0307416_1000135802 | 449 |
| 17 | 3300038725 | Ga0400484_39394 | Ga0400484_39394_132_1574 | 449 |
| 18 | 3300038726 | Ga0400490_23680 | Ga0400490_23680_2198_3640 | 449 |
| 19 | 3300044658 | Ga0466972_0000001 | Ga0466972_0000001_177600_179033 | 449 |
| 20 | 3300044765 | Ga0466970_0014643 | Ga0466970_0014643_1976_3409 | 449 |
| 21 | 3300005518 | Ga0070699_100048813 | Ga0070699_1000488132 | 451 |
| 22 | 3300038443 | Ga0395901_0130252 | Ga0395901_0130252_164_1555 | 451 |
| 23 | 3300037418 | Ga0395900_0018392 | Ga0395900_0018392_3612_5015 | 454 |
| 24 | 3300037471 | Ga0395905_0026934 | Ga0395905_0026934_2730_4133 | 454 |
| 25 | 3300038443 | Ga0395901_0014329 | Ga0395901_0014329_805_2208 | 454 |
| 26 | 3300041997 | Ga0439431_0009752 | Ga0439431_0009752_688_2064 | 454 |
| 27 | 3300036647 | Ga0316582_0164071 | Ga0316582_0164071_56_1444 | 456 |
| 28 | 3300009545 | Ga0105237_10173320 | Ga0105237_101733202 | 460 |
| 29 | 3300038742 | Ga0400486_05096 | Ga0400486_05096_11_1453 | 461 |
| 30 | 3300049704 | Ga0501221_011529 | Ga0501221_011529_113_1576 | 461 |
| 31 | 3300049571 | Ga0501034_0333117 | Ga0501034_0333117_26_1435 | 462 |
| 32 | 3300025932 | Ga0207690_10100658 | Ga0207690_101006582 | 463 |
| 33 | 3300005340 | Ga0070689_100018308 | Ga0070689_1000183085 | 464 |
| 34 | 3300025936 | Ga0207670_10076591 | Ga0207670_100765912 | 464 |
| 35 | 3300047318 | Ga0495636_0000022 | Ga0495636_0000022_29512_30906 | 464 |
| 36 | 3300009545 | Ga0105237_10040928 | Ga0105237_100409282 | 467 |
| 37 | 3300025940 | Ga0207691_10164640 | Ga0207691_101646401 | 467 |
| 38 | 3300031548 | Ga0307408_100013503 | Ga0307408_1000135034 | 467 |
| 39 | 3300031824 | Ga0307413_10003715 | Ga0307413_100037156 | 467 |
| 40 | 3300031852 | Ga0307410_10006996 | Ga0307410_100069961 | 467 |
| 41 | 3300032002 | Ga0307416_100034718 | Ga0307416_1000347183 | 467 |
| 42 | 3300032126 | Ga0307415_100001814 | Ga0307415_1000018144 | 467 |
| 43 | 3300044658 | Ga0466972_0016018 | Ga0466972_0016018_1014_2447 | 467 |
| 44 | 3300044735 | Ga0466968_0030723 | Ga0466968_0030723_382_1815 | 467 |
| 45 | 3300049651 | Ga0501201_002174 | Ga0501201_002174_71_1570 | 467 |
| 46 | 3300049652 | Ga0501202_000366 | Ga0501202_000366_256_1755 | 467 |
| 47 | 3300049664 | Ga0501224_000552 | Ga0501224_000552_642_2141 | 467 |
| 48 | 3300049675 | Ga0501243_001994 | Ga0501243_001994_82_1581 | 467 |
| 49 | 3300049704 | Ga0501221_003634 | Ga0501221_003634_334_1833 | 467 |
| 50 | 3300049705 | Ga0501225_0008552 | Ga0501225_0008552_430_1929 | 467 |
| 51 | 3300049708 | Ga0501245_001563 | Ga0501245_001563_1300_2799 | 467 |
| 52 | 3300053142 | Ga0500577_0000645 | Ga0500577_0000645_7450_8868 | 467 |
| 53 | 3300009093 | Ga0105240_10003432 | Ga0105240_1000343222 | 468 |
| 54 | 3300009553 | Ga0105249_10042876 | Ga0105249_100428765 | 468 |
| 55 | 3300013306 | Ga0163162_10009682 | Ga0163162_100096825 | 468 |
| 56 | 3300025284 | Ga0209130_1001858 | Ga0209130_10018583 | 468 |
| 57 | 3300025302 | Ga0207426_1000033 | Ga0207426_100003383 | 468 |
| 58 | 3300025913 | Ga0207695_10001383 | Ga0207695_1000138329 | 468 |
| 59 | 3300025913 | Ga0207695_10181482 | Ga0207695_101814821 | 468 |
| 60 | 3300041997 | Ga0439431_0006689 | Ga0439431_0006689_1022_2446 | 468 |
| 61 | 3300042007 | Ga0439449_0049712 | Ga0439449_0049712_44_1468 | 468 |
| 62 | 3300047472 | Ga0495686_0000010 | Ga0495686_0000010_506035_507471 | 468 |
| 63 | 3300047472 | Ga0495686_0119367 | Ga0495686_0119367_62_1498 | 468 |
| 64 | 3300048929 | Ga0496126_0015448 | Ga0496126_0015448_5852_7273 | 468 |
| 65 | 3300050493 | nmdc:mga0k408_109559_c1 | nmdc:mga0k408_109559_c1_193_1608 | 468 |
| 66 | 3300050511 | nmdc:mga08y16_86406_c1 | nmdc:mga08y16_86406_c1_593_2008 | 468 |
| 67 | 3300053156 | Ga0500622_0000157 | Ga0500622_0000157_24984_26408 | 468 |
| 68 | 3300005336 | Ga0070680_100058207 | Ga0070680_1000582073 | 469 |
| 69 | 3300005530 | Ga0070679_100000908 | Ga0070679_10000090817 | 469 |
| 70 | 3300010375 | Ga0105239_10000488 | Ga0105239_1000048837 | 469 |
| 71 | 3300025909 | Ga0207705_10107177 | Ga0207705_101071772 | 469 |
| 72 | 3300025919 | Ga0207657_10079840 | Ga0207657_100798402 | 469 |
| 73 | 3300025921 | Ga0207652_10027902 | Ga0207652_100279021 | 469 |
| 74 | 3300009093 | Ga0105240_10003002 | Ga0105240_100030023 | 471 |
| 75 | 3300009545 | Ga0105237_10141893 | Ga0105237_101418931 | 471 |
| 76 | 3300025913 | Ga0207695_10001317 | Ga0207695_1000131712 | 471 |
| 77 | 3300031665 | Ga0316575_10045977 | Ga0316575_100459771 | 471 |
| 78 | 3300031691 | Ga0316579_10000254 | Ga0316579_100002549 | 471 |
| 79 | 3300031727 | Ga0316576_10000606 | Ga0316576_100006069 | 471 |
| 80 | 3300031727 | Ga0316576_10014694 | Ga0316576_100146943 | 471 |
| 81 | 3300031728 | Ga0316578_10000170 | Ga0316578_1000017010 | 471 |
| 82 | 3300031728 | Ga0316578_10022524 | Ga0316578_100225243 | 471 |
| 83 | 3300031733 | Ga0316577_10000544 | Ga0316577_1000054410 | 471 |
| 84 | 3300032137 | Ga0316585_10000090 | Ga0316585_100000908 | 471 |
| 85 | 3300032139 | Ga0316580_10000022 | Ga0316580_100000228 | 471 |
| 86 | 3300032168 | Ga0316593_10007337 | Ga0316593_100073372 | 471 |
| 87 | 3300033524 | Ga0316592_1001868 | Ga0316592_10018682 | 471 |
| 88 | 3300033541 | Ga0316596_1001179 | Ga0316596_10011794 | 471 |
| 89 | 3300035398 | Ga0316574_0000475 | Ga0316574_0000475_4362_5804 | 471 |
| 90 | 3300036647 | Ga0316582_0000433 | Ga0316582_0000433_8848_10290 | 471 |
| 91 | 3300036712 | Ga0316584_0000285 | Ga0316584_0000285_7185_8627 | 471 |
| 92 | 3300037588 | Ga0316581_0000064 | Ga0316581_0000064_10770_12212 | 471 |
| 93 | 3300006847 | Ga0075431_100008461 | Ga0075431_1000084613 | 472 |
| 94 | 3300009147 | Ga0114129_10028251 | Ga0114129_100282515 | 472 |
| 95 | 3300031251 | Ga0265327_10010626 | Ga0265327_100106266 | 472 |
| 96 | 3300044712 | Ga0453684_0070018 | Ga0453684_0070018_2231_3727 | 472 |
| 97 | 3300044712 | Ga0453684_0087334 | Ga0453684_0087334_260_1729 | 472 |
| 98 | 3300045051 | Ga0451576_0239037 | Ga0451576_0239037_167_1636 | 472 |
| 99 | 3300050507 | nmdc:mga05p37_135272_c1 | nmdc:mga05p37_135272_c1_1275_2720 | 472 |
| 100 | 3300050510 | nmdc:mga06r32_24207_c1 | nmdc:mga06r32_24207_c1_2912_4357 | 472 |
| 101 | 3300005337 | Ga0070682_100000012 | Ga0070682_100000012201 | 475 |
| 102 | 3300036401 | Ga0373937_0066181 | Ga0373937_0066181_32_1492 | 476 |
| 103 | 3300025940 | Ga0207691_10152709 | Ga0207691_101527092 | 478 |
| 104 | 3300028794 | Ga0307515_10000031 | Ga0307515_1000003146 | 478 |
| 105 | 3300005335 | Ga0070666_10033872 | Ga0070666_100338722 | 479 |
| 106 | 3300005544 | Ga0070686_100079981 | Ga0070686_1000799812 | 479 |
| 107 | 3300013306 | Ga0163162_10188543 | Ga0163162_101885432 | 479 |
| 108 | 3300025909 | Ga0207705_10032789 | Ga0207705_100327892 | 479 |
| 109 | 3300026023 | Ga0207677_10036891 | Ga0207677_100368912 | 479 |
| 110 | 3300013100 | Ga0157373_10077004 | Ga0157373_100770042 | 480 |
| 111 | 3300013102 | Ga0157371_10123275 | Ga0157371_101232752 | 480 |
| 112 | 3300037471 | Ga0395905_0142123 | Ga0395905_0142123_529_2025 | 480 |
| 113 | 3300046454 | Ga0495592_0023551 | Ga0495592_0023551_1083_2564 | 480 |
| 114 | 3300013307 | Ga0157372_10025595 | Ga0157372_100255958 | 481 |
| 115 | 3300025908 | Ga0207643_10039838 | Ga0207643_100398382 | 481 |
| 116 | 3300025939 | Ga0207665_10039567 | Ga0207665_100395672 | 481 |
| 117 | 3300032004 | Ga0307414_10030112 | Ga0307414_100301122 | 481 |
| 118 | 3300042876 | Ga0451577_0088718 | Ga0451577_0088718_1017_2489 | 481 |
| 119 | 3300044712 | Ga0453684_0000310 | Ga0453684_0000310_156776_158248 | 481 |
| 120 | 3300047320 | Ga0495672_0015419 | Ga0495672_0015419_980_2473 | 481 |
| 121 | iso_pu_bacteria | 2738541284 | 2738762007 | 481 |
| 122 | iso_pu_bacteria | 2738541302 | 2738854277 | 481 |
| 123 | iso_pu_bacteria | 2739367651 | 2739587381 | 481 |
| 124 | iso_pu_bacteria | 2739367656 | 2739614459 | 481 |
| 125 | iso_pu_bacteria | 2739367663 | 2739646575 | 481 |
| 126 | iso_pu_bacteria | 2775506987 | 2776615348 | 481 |
| 127 | iso_pu_bacteria | 2818991437 | 2819550223 | 481 |
| 128 | iso_pu_bacteria | 2842722452 | 2842726829 | 481 |
| 129 | iso_pu_bacteria | 2842903701 | 2842904907 | 481 |
| 130 | iso_pu_bacteria | 2842909656 | 2842911668 | 481 |
| 131 | iso_pu_bacteria | 2849281842 | 2849285068 | 481 |
| 132 | iso_pu_bacteria | 2852627209 | 2852628920 | 481 |
| 133 | iso_pu_bacteria | 2857627736 | 2857632591 | 481 |
| 134 | iso_pu_bacteria | 2902048731 | 2902050894 | 481 |
| 135 | iso_pu_bacteria | 2904445276 | 2904448882 | 481 |
| 136 | iso_pu_bacteria | 2919186247 | 2919188973 | 481 |
| 137 | iso_pu_bacteria | 2939664404 | 2939666872 | 481 |
| 138 | iso_pu_bacteria | 2945997725 | 2946002853 | 481 |
| 139 | iso_pu_bacteria | 2954016120 | 2954019716 | 481 |
| 140 | 3300031727 | Ga0316576_10115726 | Ga0316576_101157262 | 482 |
| 141 | 3300031728 | Ga0316578_10006539 | Ga0316578_100065395 | 482 |
| 142 | 3300031728 | Ga0316578_10013340 | Ga0316578_100133402 | 482 |
| 143 | 3300031728 | Ga0316578_10048839 | Ga0316578_100488392 | 482 |
| 144 | 3300031733 | Ga0316577_10007819 | Ga0316577_100078194 | 482 |
| 145 | 3300031824 | Ga0307413_10091415 | Ga0307413_100914152 | 482 |
| 146 | 3300032137 | Ga0316585_10005628 | Ga0316585_100056281 | 482 |
| 147 | 3300036712 | Ga0316584_0007080 | Ga0316584_0007080_2838_4307 | 482 |
| 148 | 3300042876 | Ga0451577_0097971 | Ga0451577_0097971_782_2251 | 482 |
| 149 | 3300044712 | Ga0453684_0010921 | Ga0453684_0010921_7082_8551 | 482 |
| 150 | 3300045051 | Ga0451576_0006077 | Ga0451576_0006077_8077_9546 | 482 |
| 151 | 3300045051 | Ga0451576_0009193 | Ga0451576_0009193_3346_4815 | 482 |
| 152 | iso_pu_bacteria | 3003233435 | 3003236954 | 482 |
| 153 | 3300045051 | Ga0451576_0101877 | Ga0451576_0101877_1133_2599 | 483 |
| 154 | iso_pu_bacteria | 2890737413 | 2890738020 | 483 |
| 155 | iso_pu_bacteria | 2896317667 | 2896321101 | 483 |
| 156 | iso_pu_bacteria | 2898713307 | 2898713591 | 483 |
| 157 | 3300005614 | Ga0068856_100057374 | Ga0068856_1000573743 | 484 |
| 158 | 3300013307 | Ga0157372_10062158 | Ga0157372_100621583 | 484 |
| 159 | 3300014326 | Ga0157380_10000358 | Ga0157380_1000035813 | 484 |
| 160 | 3300014497 | Ga0182008_10032437 | Ga0182008_100324372 | 484 |
| 161 | 3300026078 | Ga0207702_10040370 | Ga0207702_100403703 | 484 |
| 162 | 3300030731 | Ga0316177_1169895 | Ga0316177_11698957 | 484 |
| 163 | 3300030742 | Ga0316183_1210954 | Ga0316183_12109542 | 484 |
| 164 | 3300030744 | Ga0316181_1117584 | Ga0316181_11175843 | 484 |
| 165 | 3300032004 | Ga0307414_10000265 | Ga0307414_1000026511 | 484 |
| 166 | 3300032004 | Ga0307414_10006160 | Ga0307414_100061601 | 484 |
| 167 | 3300049570 | Ga0501033_0073860 | Ga0501033_0073860_1001_2461 | 484 |
| 168 | 3300005616 | Ga0068852_100021900 | Ga0068852_1000219005 | 485 |
| 169 | iso_pu_bacteria | 2739367866 | 2740031603 | 485 |
| 170 | 3300003322 | rootL2_10005908 | rootL2_100059081 | 486 |
| 171 | 3300015261 | Ga0182006_1007082 | Ga0182006_10070824 | 486 |
| 172 | 3300037471 | Ga0395905_0000001 | Ga0395905_0000001_868628_870112 | 486 |
| 173 | 3300006844 | Ga0075428_100038397 | Ga0075428_1000383976 | 487 |
| 174 | 3300006846 | Ga0075430_100044628 | Ga0075430_1000446284 | 487 |
| 175 | 3300006847 | Ga0075431_100067224 | Ga0075431_1000672244 | 487 |
| 176 | 3300009147 | Ga0114129_10115042 | Ga0114129_101150421 | 487 |
| 177 | 3300050508 | nmdc:mga09592_85275_c1 | nmdc:mga09592_85275_c1_295_1800 | 487 |
| 178 | 3300050509 | nmdc:mga0qj67_7275_c1 | nmdc:mga0qj67_7275_c1_43_1548 | 487 |
| 179 | iso_pu_bacteria | 2839989709 | 2839991706 | 488 |
| 180 | iso_pu_bacteria | 2910245624 | 2910246108 | 488 |
| 181 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000012893 | 489 |
| 182 | iso_pu_bacteria | 2818991442 | 2819574847 | 489 |
| 183 | iso_pu_bacteria | 2821136567 | 2821140946 | 489 |
| 184 | iso_pu_bacteria | 2904467357 | 2904471446 | 489 |
| 185 | 3300005719 | Ga0068861_100094417 | Ga0068861_1000944173 | 490 |
| 186 | 3300005841 | Ga0068863_100018993 | Ga0068863_1000189932 | 490 |
| 187 | 3300006237 | Ga0097621_100024637 | Ga0097621_1000246373 | 490 |
| 188 | 3300013297 | Ga0157378_10082331 | Ga0157378_100823312 | 490 |
| 189 | 3300025942 | Ga0207689_10009247 | Ga0207689_100092474 | 490 |
| 190 | 3300026118 | Ga0207675_100025828 | Ga0207675_1000258282 | 490 |
| 191 | 3300046471 | Ga0495650_0041526 | Ga0495650_0041526_66_1616 | 490 |
| 192 | 3300049571 | Ga0501034_0000152 | Ga0501034_0000152_48405_49898 | 490 |
| 193 | 3300049652 | Ga0501202_000861 | Ga0501202_000861_216_1709 | 490 |
| 194 | 3300049653 | Ga0501206_001276 | Ga0501206_001276_852_2345 | 490 |
| 195 | 3300049664 | Ga0501224_001773 | Ga0501224_001773_1015_2508 | 490 |
| 196 | 3300049688 | Ga0501259_000354 | Ga0501259_000354_3837_5330 | 490 |
| 197 | 3300049708 | Ga0501245_000726 | Ga0501245_000726_849_2342 | 490 |
| 198 | iso_pu_bacteria | 2818991460 | 2819676773 | 490 |
| 199 | iso_pu_bacteria | 2840677318 | 2840678917 | 490 |
| 200 | iso_pu_bacteria | 2883068021 | 2883070411 | 490 |
| 201 | iso_pu_bacteria | 2884791551 | 2884796630 | 490 |
| 202 | iso_pu_bacteria | 2896085136 | 2896086732 | 490 |
| 203 | iso_pu_bacteria | 2896109856 | 2896112929 | 490 |
| 204 | iso_pu_bacteria | 2929177148 | 2929177845 | 490 |
| 205 | iso_pu_bacteria | 2929239360 | 2929240200 | 490 |
| 206 | iso_pu_bacteria | 2929921140 | 2929921928 | 490 |
| 207 | iso_pu_bacteria | 2945977869 | 2945980195 | 490 |
| 208 | iso_pu_bacteria | 2946013367 | 2946013941 | 490 |
| 209 | iso_pu_bacteria | 8003151029 | 8003155849 | 490 |
| 210 | 3300002077 | JGI24744J21845_10002391 | JGI24744J21845_100023916 | 491 |
| 211 | 3300003316 | rootH1_10036148 | rootH1_100361481 | 491 |
| 212 | 3300013307 | Ga0157372_10187581 | Ga0157372_101875812 | 491 |
| 213 | 3300046616 | Ga0495668_0000082 | Ga0495668_0000082_49301_50785 | 491 |
| 214 | 3300049515 | Ga0501292_004534 | Ga0501292_004534_254_1753 | 491 |
| 215 | 3300049649 | Ga0501198_000923 | Ga0501198_000923_707_2206 | 491 |
| 216 | 3300049654 | Ga0501207_000033 | Ga0501207_000033_6280_7779 | 491 |
| 217 | 3300049661 | Ga0501217_000032 | Ga0501217_000032_1993_3492 | 491 |
| 218 | 3300049662 | Ga0501222_001790 | Ga0501222_001790_92_1591 | 491 |
| 219 | 3300049663 | Ga0501223_001089 | Ga0501223_001089_1962_3461 | 491 |
| 220 | 3300049668 | Ga0501233_000698 | Ga0501233_000698_2305_3804 | 491 |
| 221 | 3300049669 | Ga0501235_001149 | Ga0501235_001149_1768_3267 | 491 |
| 222 | 3300049682 | Ga0501252_000123 | Ga0501252_000123_632_2131 | 491 |
| 223 | 3300049704 | Ga0501221_000193 | Ga0501221_000193_4019_5518 | 491 |
| 224 | 3300049705 | Ga0501225_0003023 | Ga0501225_0003023_1069_2568 | 491 |
| 225 | 3300049707 | Ga0501234_000488 | Ga0501234_000488_97_1596 | 491 |
| 226 | iso_pu_bacteria | 2914759650 | 2914763271 | 491 |
| 227 | iso_pu_bacteria | 2929154850 | 2929159277 | 491 |
| 228 | 3300005331 | Ga0070670_100180796 | Ga0070670_1001807961 | 492 |
| 229 | 3300005334 | Ga0068869_100011463 | Ga0068869_1000114633 | 492 |
| 230 | 3300005336 | Ga0070680_100012373 | Ga0070680_1000123732 | 492 |
| 231 | 3300005337 | Ga0070682_100009425 | Ga0070682_1000094255 | 492 |
| 232 | 3300005338 | Ga0068868_100175865 | Ga0068868_1001758651 | 492 |
| 233 | 3300005339 | Ga0070660_100024047 | Ga0070660_1000240472 | 492 |
| 234 | 3300005366 | Ga0070659_100007270 | Ga0070659_1000072702 | 492 |
| 235 | 3300005366 | Ga0070659_100030890 | Ga0070659_1000308902 | 492 |
| 236 | 3300005530 | Ga0070679_100000174 | Ga0070679_10000017439 | 492 |
| 237 | 3300005530 | Ga0070679_100070447 | Ga0070679_1000704472 | 492 |
| 238 | 3300005535 | Ga0070684_100004375 | Ga0070684_1000043757 | 492 |
| 239 | 3300005539 | Ga0068853_100004391 | Ga0068853_1000043919 | 492 |
| 240 | 3300005539 | Ga0068853_100012524 | Ga0068853_1000125244 | 492 |
| 241 | 3300005539 | Ga0068853_100025540 | Ga0068853_1000255402 | 492 |
| 242 | 3300005563 | Ga0068855_100001122 | Ga0068855_10000112213 | 492 |
| 243 | 3300005563 | Ga0068855_100019121 | Ga0068855_1000191218 | 492 |
| 244 | 3300005563 | Ga0068855_100083156 | Ga0068855_1000831563 | 492 |
| 245 | 3300005564 | Ga0070664_100002301 | Ga0070664_1000023017 | 492 |
| 246 | 3300005614 | Ga0068856_100079488 | Ga0068856_1000794884 | 492 |
| 247 | 3300005616 | Ga0068852_100000706 | Ga0068852_10000070610 | 492 |
| 248 | 3300005616 | Ga0068852_100065192 | Ga0068852_1000651923 | 492 |
| 249 | 3300005617 | Ga0068859_100112370 | Ga0068859_1001123702 | 492 |
| 250 | 3300005834 | Ga0068851_10021134 | Ga0068851_100211342 | 492 |
| 251 | 3300005843 | Ga0068860_100002264 | Ga0068860_1000022644 | 492 |
| 252 | 3300005844 | Ga0068862_100002255 | Ga0068862_10000225512 | 492 |
| 253 | 3300005844 | Ga0068862_100071433 | Ga0068862_1000714333 | 492 |
| 254 | 3300006931 | Ga0097620_100112367 | Ga0097620_1001123672 | 492 |
| 255 | 3300009093 | Ga0105240_10000664 | Ga0105240_100006644 | 492 |
| 256 | 3300009093 | Ga0105240_10034353 | Ga0105240_100343536 | 492 |
| 257 | 3300009101 | Ga0105247_10016750 | Ga0105247_100167502 | 492 |
| 258 | 3300009174 | Ga0105241_10000543 | Ga0105241_100005437 | 492 |
| 259 | 3300009174 | Ga0105241_10006184 | Ga0105241_100061844 | 492 |
| 260 | 3300009545 | Ga0105237_10032931 | Ga0105237_100329314 | 492 |
| 261 | 3300010375 | Ga0105239_10009963 | Ga0105239_100099638 | 492 |
| 262 | 3300010375 | Ga0105239_10030991 | Ga0105239_100309915 | 492 |
| 263 | 3300013100 | Ga0157373_10002582 | Ga0157373_100025823 | 492 |
| 264 | 3300013100 | Ga0157373_10006643 | Ga0157373_100066432 | 492 |
| 265 | 3300013100 | Ga0157373_10008723 | Ga0157373_100087237 | 492 |
| 266 | 3300013100 | Ga0157373_10031516 | Ga0157373_100315163 | 492 |
| 267 | 3300013102 | Ga0157371_10002131 | Ga0157371_100021316 | 492 |
| 268 | 3300013102 | Ga0157371_10003413 | Ga0157371_100034133 | 492 |
| 269 | 3300013102 | Ga0157371_10004222 | Ga0157371_100042229 | 492 |
| 270 | 3300013102 | Ga0157371_10005032 | Ga0157371_100050322 | 492 |
| 271 | 3300013102 | Ga0157371_10005838 | Ga0157371_100058382 | 492 |
| 272 | 3300013102 | Ga0157371_10018901 | Ga0157371_100189014 | 492 |
| 273 | 3300013102 | Ga0157371_10020420 | Ga0157371_100204201 | 492 |
| 274 | 3300013102 | Ga0157371_10021501 | Ga0157371_100215015 | 492 |
| 275 | 3300013102 | Ga0157371_10078366 | Ga0157371_100783662 | 492 |
| 276 | 3300013104 | Ga0157370_10000945 | Ga0157370_100009457 | 492 |
| 277 | 3300013104 | Ga0157370_10001848 | Ga0157370_100018485 | 492 |
| 278 | 3300013104 | Ga0157370_10183259 | Ga0157370_101832591 | 492 |
| 279 | 3300013105 | Ga0157369_10036810 | Ga0157369_100368103 | 492 |
| 280 | 3300013296 | Ga0157374_10028110 | Ga0157374_100281103 | 492 |
| 281 | 3300013307 | Ga0157372_10011748 | Ga0157372_100117486 | 492 |
| 282 | 3300013307 | Ga0157372_10022870 | Ga0157372_100228702 | 492 |
| 283 | 3300013307 | Ga0157372_10034861 | Ga0157372_100348611 | 492 |
| 284 | 3300013307 | Ga0157372_10133588 | Ga0157372_101335883 | 492 |
| 285 | 3300013307 | Ga0157372_10253229 | Ga0157372_102532291 | 492 |
| 286 | 3300014325 | Ga0163163_10022474 | Ga0163163_100224747 | 492 |
| 287 | 3300021384 | Ga0213876_10000885 | Ga0213876_1000088519 | 492 |
| 288 | 3300025321 | Ga0207656_10013289 | Ga0207656_100132892 | 492 |
| 289 | 3300025900 | Ga0207710_10001920 | Ga0207710_100019207 | 492 |
| 290 | 3300025904 | Ga0207647_10000131 | Ga0207647_1000013156 | 492 |
| 291 | 3300025909 | Ga0207705_10005067 | Ga0207705_100050671 | 492 |
| 292 | 3300025909 | Ga0207705_10053943 | Ga0207705_100539433 | 492 |
| 293 | 3300025909 | Ga0207705_10141297 | Ga0207705_101412971 | 492 |
| 294 | 3300025913 | Ga0207695_10017403 | Ga0207695_100174034 | 492 |
| 295 | 3300025913 | Ga0207695_10021984 | Ga0207695_100219846 | 492 |
| 296 | 3300025917 | Ga0207660_10157829 | Ga0207660_101578291 | 492 |
| 297 | 3300025920 | Ga0207649_10073468 | Ga0207649_100734682 | 492 |
| 298 | 3300025921 | Ga0207652_10000035 | Ga0207652_1000003569 | 492 |
| 299 | 3300025921 | Ga0207652_10000132 | Ga0207652_1000013212 | 492 |
| 300 | 3300025921 | Ga0207652_10021939 | Ga0207652_100219392 | 492 |
| 301 | 3300025921 | Ga0207652_10038378 | Ga0207652_100383781 | 492 |
| 302 | 3300025921 | Ga0207652_10090593 | Ga0207652_100905932 | 492 |
| 303 | 3300025925 | Ga0207650_10000813 | Ga0207650_1000081319 | 492 |
| 304 | 3300025932 | Ga0207690_10002315 | Ga0207690_100023152 | 492 |
| 305 | 3300025942 | Ga0207689_10013291 | Ga0207689_100132915 | 492 |
| 306 | 3300025944 | Ga0207661_10121104 | Ga0207661_101211042 | 492 |
| 307 | 3300025945 | Ga0207679_10011951 | Ga0207679_100119512 | 492 |
| 308 | 3300025949 | Ga0207667_10001836 | Ga0207667_1000183615 | 492 |
| 309 | 3300025949 | Ga0207667_10009593 | Ga0207667_100095933 | 492 |
| 310 | 3300025949 | Ga0207667_10124347 | Ga0207667_101243471 | 492 |
| 311 | 3300026041 | Ga0207639_10003843 | Ga0207639_100038437 | 492 |
| 312 | 3300026041 | Ga0207639_10067763 | Ga0207639_100677631 | 492 |
| 313 | 3300026078 | Ga0207702_10053768 | Ga0207702_100537682 | 492 |
| 314 | 3300026116 | Ga0207674_10137700 | Ga0207674_101377002 | 492 |
| 315 | 3300026142 | Ga0207698_10039715 | Ga0207698_100397153 | 492 |
| 316 | 3300026142 | Ga0207698_10054329 | Ga0207698_100543293 | 492 |
| 317 | 3300026142 | Ga0207698_10154109 | Ga0207698_101541091 | 492 |
| 318 | 3300028380 | Ga0268265_10011311 | Ga0268265_100113114 | 492 |
| 319 | 3300028381 | Ga0268264_10018882 | Ga0268264_100188824 | 492 |
| 320 | 3300031711 | Ga0265314_10013970 | Ga0265314_100139704 | 492 |
| 321 | 3300037312 | Ga0395899_0015284 | Ga0395899_0015284_2750_4237 | 492 |
| 322 | 3300037312 | Ga0395899_0135775 | Ga0395899_0135775_72_1559 | 492 |
| 323 | 3300037418 | Ga0395900_0008860 | Ga0395900_0008860_886_2373 | 492 |
| 324 | 3300037418 | Ga0395900_0038660 | Ga0395900_0038660_2256_3743 | 492 |
| 325 | 3300037418 | Ga0395900_0154886 | Ga0395900_0154886_186_1673 | 492 |
| 326 | 3300037466 | Ga0395898_0007992 | Ga0395898_0007992_8292_9779 | 492 |
| 327 | 3300037466 | Ga0395898_0011506 | Ga0395898_0011506_7338_8825 | 492 |
| 328 | 3300037466 | Ga0395898_0018041 | Ga0395898_0018041_675_2162 | 492 |
| 329 | 3300037466 | Ga0395898_0080524 | Ga0395898_0080524_1383_2870 | 492 |
| 330 | 3300037471 | Ga0395905_0075898 | Ga0395905_0075898_667_2154 | 492 |
| 331 | 3300038443 | Ga0395901_0004549 | Ga0395901_0004549_9756_11243 | 492 |
| 332 | 3300038443 | Ga0395901_0005612 | Ga0395901_0005612_8797_10284 | 492 |
| 333 | 3300038443 | Ga0395901_0145178 | Ga0395901_0145178_574_2061 | 492 |
| 334 | 3300039437 | Ga0436365_1933142 | Ga0436365_1933142_15693_17195 | 492 |
| 335 | 3300047320 | Ga0495672_0052004 | Ga0495672_0052004_588_2075 | 492 |
| 336 | 3300049823 | Ga0501044_0036368 | Ga0501044_0036368_2190_3677 | 492 |
| 337 | iso_pu_bacteria | 2738541278 | 2738725081 | 492 |
| 338 | iso_pu_bacteria | 2818991444 | 2819585955 | 492 |
| 339 | 3300005289 | Ga0065704_10104076 | Ga0065704_101040762 | 493 |
| 340 | 3300005328 | Ga0070676_10000167 | Ga0070676_100001672 | 493 |
| 341 | 3300005329 | Ga0070683_100134817 | Ga0070683_1001348172 | 493 |
| 342 | 3300005331 | Ga0070670_100073374 | Ga0070670_1000733742 | 493 |
| 343 | 3300005335 | Ga0070666_10000512 | Ga0070666_1000051215 | 493 |
| 344 | 3300005335 | Ga0070666_10009089 | Ga0070666_100090893 | 493 |
| 345 | 3300005336 | Ga0070680_100043915 | Ga0070680_1000439152 | 493 |
| 346 | 3300005336 | Ga0070680_100060917 | Ga0070680_1000609172 | 493 |
| 347 | 3300005337 | Ga0070682_100005414 | Ga0070682_1000054145 | 493 |
| 348 | 3300005338 | Ga0068868_100108198 | Ga0068868_1001081982 | 493 |
| 349 | 3300005339 | Ga0070660_100000295 | Ga0070660_10000029535 | 493 |
| 350 | 3300005339 | Ga0070660_100005708 | Ga0070660_1000057082 | 493 |
| 351 | 3300005344 | Ga0070661_100009290 | Ga0070661_1000092902 | 493 |
| 352 | 3300005347 | Ga0070668_100000736 | Ga0070668_10000073624 | 493 |
| 353 | 3300005354 | Ga0070675_100002115 | Ga0070675_10000211511 | 493 |
| 354 | 3300005356 | Ga0070674_100016973 | Ga0070674_1000169733 | 493 |
| 355 | 3300005364 | Ga0070673_100077212 | Ga0070673_1000772122 | 493 |
| 356 | 3300005367 | Ga0070667_100002471 | Ga0070667_10000247118 | 493 |
| 357 | 3300005457 | Ga0070662_100024116 | Ga0070662_1000241163 | 493 |
| 358 | 3300005458 | Ga0070681_10137639 | Ga0070681_101376392 | 493 |
| 359 | 3300005459 | Ga0068867_100000714 | Ga0068867_10000071420 | 493 |
| 360 | 3300005530 | Ga0070679_100016542 | Ga0070679_1000165425 | 493 |
| 361 | 3300005539 | Ga0068853_100016332 | Ga0068853_1000163323 | 493 |
| 362 | 3300005539 | Ga0068853_100028674 | Ga0068853_1000286742 | 493 |
| 363 | 3300005543 | Ga0070672_100060446 | Ga0070672_1000604462 | 493 |
| 364 | 3300005547 | Ga0070693_100040142 | Ga0070693_1000401422 | 493 |
| 365 | 3300005548 | Ga0070665_100000002 | Ga0070665_100000002674 | 493 |
| 366 | 3300005548 | Ga0070665_100003228 | Ga0070665_1000032285 | 493 |
| 367 | 3300005577 | Ga0068857_100234524 | Ga0068857_1002345241 | 493 |
| 368 | 3300005578 | Ga0068854_100016442 | Ga0068854_1000164422 | 493 |
| 369 | 3300005578 | Ga0068854_100123263 | Ga0068854_1001232631 | 493 |
| 370 | 3300005616 | Ga0068852_100000391 | Ga0068852_1000003911 | 493 |
| 371 | 3300005616 | Ga0068852_100008114 | Ga0068852_1000081142 | 493 |
| 372 | 3300005616 | Ga0068852_100053313 | Ga0068852_1000533132 | 493 |
| 373 | 3300005617 | Ga0068859_100014150 | Ga0068859_1000141509 | 493 |
| 374 | 3300005618 | Ga0068864_100004147 | Ga0068864_1000041479 | 493 |
| 375 | 3300005841 | Ga0068863_100007919 | Ga0068863_1000079193 | 493 |
| 376 | 3300005842 | Ga0068858_100004188 | Ga0068858_1000041882 | 493 |
| 377 | 3300005842 | Ga0068858_100221747 | Ga0068858_1002217472 | 493 |
| 378 | 3300005843 | Ga0068860_100000003 | Ga0068860_100000003293 | 493 |
| 379 | 3300005843 | Ga0068860_100010703 | Ga0068860_1000107036 | 493 |
| 380 | 3300005843 | Ga0068860_100033177 | Ga0068860_1000331773 | 493 |
| 381 | 3300006237 | Ga0097621_100003013 | Ga0097621_10000301311 | 493 |
| 382 | 3300006237 | Ga0097621_100003397 | Ga0097621_1000033977 | 493 |
| 383 | 3300006358 | Ga0068871_100099703 | Ga0068871_1000997032 | 493 |
| 384 | 3300006931 | Ga0097620_100014150 | Ga0097620_1000141509 | 493 |
| 385 | 3300009093 | Ga0105240_10006894 | Ga0105240_100068949 | 493 |
| 386 | 3300009093 | Ga0105240_10012199 | Ga0105240_100121998 | 493 |
| 387 | 3300009093 | Ga0105240_10028575 | Ga0105240_100285754 | 493 |
| 388 | 3300009093 | Ga0105240_10032147 | Ga0105240_100321475 | 493 |
| 389 | 3300009093 | Ga0105240_10069783 | Ga0105240_100697833 | 493 |
| 390 | 3300009098 | Ga0105245_10095714 | Ga0105245_100957142 | 493 |
| 391 | 3300009101 | Ga0105247_10072797 | Ga0105247_100727972 | 493 |
| 392 | 3300009174 | Ga0105241_10016655 | Ga0105241_100166554 | 493 |
| 393 | 3300009174 | Ga0105241_10126068 | Ga0105241_101260681 | 493 |
| 394 | 3300009545 | Ga0105237_10000144 | Ga0105237_1000014458 | 493 |
| 395 | 3300009545 | Ga0105237_10015222 | Ga0105237_100152222 | 493 |
| 396 | 3300009545 | Ga0105237_10034202 | Ga0105237_100342024 | 493 |
| 397 | 3300009551 | Ga0105238_10088408 | Ga0105238_100884082 | 493 |
| 398 | 3300009553 | Ga0105249_10011067 | Ga0105249_100110673 | 493 |
| 399 | 3300010375 | Ga0105239_10008508 | Ga0105239_100085082 | 493 |
| 400 | 3300010375 | Ga0105239_10174428 | Ga0105239_101744282 | 493 |
| 401 | 3300013104 | Ga0157370_10001484 | Ga0157370_1000148412 | 493 |
| 402 | 3300013104 | Ga0157370_10175507 | Ga0157370_101755072 | 493 |
| 403 | 3300013296 | Ga0157374_10021281 | Ga0157374_100212816 | 493 |
| 404 | 3300013306 | Ga0163162_10000725 | Ga0163162_1000072522 | 493 |
| 405 | 3300013306 | Ga0163162_10001229 | Ga0163162_1000122923 | 493 |
| 406 | 3300013306 | Ga0163162_10002095 | Ga0163162_1000209518 | 493 |
| 407 | 3300013306 | Ga0163162_10066875 | Ga0163162_100668752 | 493 |
| 408 | 3300013307 | Ga0157372_10000747 | Ga0157372_1000074710 | 493 |
| 409 | 3300013307 | Ga0157372_10017972 | Ga0157372_100179726 | 493 |
| 410 | 3300013308 | Ga0157375_10009510 | Ga0157375_100095105 | 493 |
| 411 | 3300014325 | Ga0163163_10000526 | Ga0163163_1000052627 | 493 |
| 412 | 3300014968 | Ga0157379_10001164 | Ga0157379_100011647 | 493 |
| 413 | 3300014969 | Ga0157376_10006585 | Ga0157376_100065855 | 493 |
| 414 | 3300014969 | Ga0157376_10025879 | Ga0157376_100258793 | 493 |
| 415 | 3300014969 | Ga0157376_10028697 | Ga0157376_100286972 | 493 |
| 416 | 3300015265 | Ga0182005_1000043 | Ga0182005_100004378 | 493 |
| 417 | 3300025208 | Ga0209436_106139 | Ga0209436_1061392 | 493 |
| 418 | 3300025242 | Ga0209258_100032 | Ga0209258_100032396 | 493 |
| 419 | 3300025254 | Ga0209148_1000131 | Ga0209148_100013198 | 493 |
| 420 | 3300025321 | Ga0207656_10000333 | Ga0207656_100003335 | 493 |
| 421 | 3300025907 | Ga0207645_10007440 | Ga0207645_100074406 | 493 |
| 422 | 3300025911 | Ga0207654_10124553 | Ga0207654_101245531 | 493 |
| 423 | 3300025912 | Ga0207707_10024994 | Ga0207707_100249943 | 493 |
| 424 | 3300025912 | Ga0207707_10092500 | Ga0207707_100925003 | 493 |
| 425 | 3300025913 | Ga0207695_10032855 | Ga0207695_100328555 | 493 |
| 426 | 3300025913 | Ga0207695_10203740 | Ga0207695_102037402 | 493 |
| 427 | 3300025914 | Ga0207671_10006294 | Ga0207671_100062947 | 493 |
| 428 | 3300025914 | Ga0207671_10008066 | Ga0207671_100080664 | 493 |
| 429 | 3300025917 | Ga0207660_10008378 | Ga0207660_100083784 | 493 |
| 430 | 3300025919 | Ga0207657_10002329 | Ga0207657_1000232912 | 493 |
| 431 | 3300025919 | Ga0207657_10002631 | Ga0207657_1000263110 | 493 |
| 432 | 3300025921 | Ga0207652_10022399 | Ga0207652_100223992 | 493 |
| 433 | 3300025925 | Ga0207650_10054602 | Ga0207650_100546022 | 493 |
| 434 | 3300025927 | Ga0207687_10122252 | Ga0207687_101222522 | 493 |
| 435 | 3300025932 | Ga0207690_10047766 | Ga0207690_100477662 | 493 |
| 436 | 3300025937 | Ga0207669_10061180 | Ga0207669_100611802 | 493 |
| 437 | 3300025940 | Ga0207691_10000234 | Ga0207691_1000023443 | 493 |
| 438 | 3300025940 | Ga0207691_10024604 | Ga0207691_100246044 | 493 |
| 439 | 3300025945 | Ga0207679_10026650 | Ga0207679_100266502 | 493 |
| 440 | 3300025949 | Ga0207667_10001839 | Ga0207667_1000183913 | 493 |
| 441 | 3300025949 | Ga0207667_10157962 | Ga0207667_101579622 | 493 |
| 442 | 3300025960 | Ga0207651_10034033 | Ga0207651_100340332 | 493 |
| 443 | 3300025961 | Ga0207712_10005835 | Ga0207712_100058356 | 493 |
| 444 | 3300025972 | Ga0207668_10000432 | Ga0207668_100004325 | 493 |
| 445 | 3300025981 | Ga0207640_10099570 | Ga0207640_100995702 | 493 |
| 446 | 3300025986 | Ga0207658_10048778 | Ga0207658_100487782 | 493 |
| 447 | 3300026023 | Ga0207677_10010228 | Ga0207677_100102285 | 493 |
| 448 | 3300026035 | Ga0207703_10013593 | Ga0207703_100135935 | 493 |
| 449 | 3300026041 | Ga0207639_10081919 | Ga0207639_100819192 | 493 |
| 450 | 3300026041 | Ga0207639_10150960 | Ga0207639_101509602 | 493 |
| 451 | 3300026088 | Ga0207641_10276628 | Ga0207641_102766281 | 493 |
| 452 | 3300026089 | Ga0207648_10000768 | Ga0207648_1000076833 | 493 |
| 453 | 3300026089 | Ga0207648_10106411 | Ga0207648_101064112 | 493 |
| 454 | 3300026095 | Ga0207676_10063950 | Ga0207676_100639502 | 493 |
| 455 | 3300026116 | Ga0207674_10001969 | Ga0207674_1000196917 | 493 |
| 456 | 3300026116 | Ga0207674_10184078 | Ga0207674_101840782 | 493 |
| 457 | 3300026121 | Ga0207683_10017481 | Ga0207683_100174812 | 493 |
| 458 | 3300026121 | Ga0207683_10130854 | Ga0207683_101308542 | 493 |
| 459 | 3300026142 | Ga0207698_10071168 | Ga0207698_100711682 | 493 |
| 460 | 3300026142 | Ga0207698_10103946 | Ga0207698_101039462 | 493 |
| 461 | 3300028379 | Ga0268266_10000169 | Ga0268266_1000016977 | 493 |
| 462 | 3300028381 | Ga0268264_10000063 | Ga0268264_10000063210 | 493 |
| 463 | 3300028381 | Ga0268264_10001719 | Ga0268264_100017195 | 493 |
| 464 | 3300028381 | Ga0268264_10026822 | Ga0268264_100268223 | 493 |
| 465 | 3300028786 | Ga0307517_10000487 | Ga0307517_100004873 | 493 |
| 466 | 3300030521 | Ga0307511_10000409 | Ga0307511_1000040928 | 493 |
| 467 | 3300031730 | Ga0307516_10000384 | Ga0307516_1000038411 | 493 |
| 468 | 3300036401 | Ga0373937_0090256 | Ga0373937_0090256_1133_2626 | 493 |
| 469 | 3300044842 | Ga0466957_0016025 | Ga0466957_0016025_384_1949 | 493 |
| 470 | 3300045976 | Ga0466967_0210447 | Ga0466967_0210447_324_1826 | 493 |
| 471 | 3300046524 | Ga0495648_0017034 | Ga0495648_0017034_1915_3411 | 493 |
| 472 | 3300046543 | Ga0495645_0062993 | Ga0495645_0062993_935_2425 | 493 |
| 473 | 3300046683 | Ga0495658_0040755 | Ga0495658_0040755_1045_2535 | 493 |
| 474 | 3300046691 | Ga0495670_0016896 | Ga0495670_0016896_184_1686 | 493 |
| 475 | 3300047443 | Ga0495687_001475 | Ga0495687_001475_2002_3498 | 493 |
| 476 | 3300048907 | Ga0496104_0230964 | Ga0496104_0230964_167_1657 | 493 |
| 477 | 3300048908 | Ga0496105_0098991 | Ga0496105_0098991_563_2053 | 493 |
| 478 | 3300048912 | Ga0496109_0139217 | Ga0496109_0139217_606_2096 | 493 |
| 479 | 3300048924 | Ga0496121_0000086 | Ga0496121_0000086_212056_213555 | 493 |
| 480 | 3300049571 | Ga0501034_0058492 | Ga0501034_0058492_257_1753 | 493 |
| 481 | 3300049589 | Ga0501073_0062855 | Ga0501073_0062855_515_2005 | 493 |
| 482 | 3300053085 | Ga0495619_0090403 | Ga0495619_0090403_467_1957 | 493 |
| 483 | 3300053088 | Ga0500644_0000280 | Ga0500644_0000280_14257_15753 | 493 |
| 484 | 3300053090 | Ga0500646_0006025 | Ga0500646_0006025_289_1779 | 493 |
| 485 | 3300053092 | Ga0500583_0002427 | Ga0500583_0002427_805_2301 | 493 |
| 486 | 3300053092 | Ga0500583_0006290 | Ga0500583_0006290_846_2339 | 493 |
| 487 | 3300053137 | Ga0500561_0001063 | Ga0500561_0001063_2756_4252 | 493 |
| 488 | 3300053156 | Ga0500622_0002409 | Ga0500622_0002409_3595_5091 | 493 |
| 489 | 3300053160 | Ga0500633_0001976 | Ga0500633_0001976_545_2041 | 493 |
| 490 | 3300053178 | Ga0500637_0013682 | Ga0500637_0013682_569_2059 | 493 |
| 491 | 3300054114 | Ga0501084_0012779 | Ga0501084_0012779_2880_4370 | 493 |
| 492 | iso_pu_bacteria | 2881955468 | 2881958326 | 493 |
| 493 | 2162886012 | MBSR1b_contig_4329513 | MBSR1b_0376.00005560 | 494 |
| 494 | 3300001989 | JGI24739J22299_10000004 | JGI24739J22299_1000000423 | 494 |
| 495 | 3300003215 | JGI25153J46596_10000276 | JGI25153J46596_1000027624 | 494 |
| 496 | 3300003320 | rootH2_10043903 | rootH2_1004390313 | 494 |
| 497 | 3300003323 | rootH1_10007795 | rootH1_1000779529 | 494 |
| 498 | 3300003354 | JGI25160J50197_1005967 | JGI25160J50197_10059674 | 494 |
| 499 | 3300003354 | JGI25160J50197_1015689 | JGI25160J50197_10156891 | 494 |
| 500 | 3300003790 | Ga0055528_1000785 | Ga0055528_10007859 | 494 |
| 501 | 3300003791 | Ga0055530_10000102 | Ga0055530_1000010220 | 494 |
| 502 | 3300003794 | Ga0055531_10000173 | Ga0055531_1000017364 | 494 |
| 503 | 3300003794 | Ga0055531_10030395 | Ga0055531_100303951 | 494 |
| 504 | 3300005262 | Ga0065165_1000027 | Ga0065165_100002723 | 494 |
| 505 | 3300005290 | Ga0065712_10006895 | Ga0065712_100068951 | 494 |
| 506 | 3300005290 | Ga0065712_10083528 | Ga0065712_100835281 | 494 |
| 507 | 3300005328 | Ga0070676_10002364 | Ga0070676_1000236410 | 494 |
| 508 | 3300005328 | Ga0070676_10047244 | Ga0070676_100472442 | 494 |
| 509 | 3300005329 | Ga0070683_100039857 | Ga0070683_1000398574 | 494 |
| 510 | 3300005329 | Ga0070683_100128293 | Ga0070683_1001282932 | 494 |
| 511 | 3300005331 | Ga0070670_100024005 | Ga0070670_1000240052 | 494 |
| 512 | 3300005331 | Ga0070670_100028223 | Ga0070670_1000282232 | 494 |
| 513 | 3300005331 | Ga0070670_100049693 | Ga0070670_1000496932 | 494 |
| 514 | 3300005334 | Ga0068869_100004707 | Ga0068869_1000047072 | 494 |
| 515 | 3300005334 | Ga0068869_100005758 | Ga0068869_1000057582 | 494 |
| 516 | 3300005334 | Ga0068869_100100643 | Ga0068869_1001006431 | 494 |
| 517 | 3300005334 | Ga0068869_100100888 | Ga0068869_1001008882 | 494 |
| 518 | 3300005335 | Ga0070666_10044594 | Ga0070666_100445941 | 494 |
| 519 | 3300005338 | Ga0068868_100002356 | Ga0068868_1000023563 | 494 |
| 520 | 3300005338 | Ga0068868_100121563 | Ga0068868_1001215632 | 494 |
| 521 | 3300005340 | Ga0070689_100002022 | Ga0070689_1000020226 | 494 |
| 522 | 3300005340 | Ga0070689_100022450 | Ga0070689_1000224505 | 494 |
| 523 | 3300005340 | Ga0070689_100028005 | Ga0070689_1000280052 | 494 |
| 524 | 3300005340 | Ga0070689_100039902 | Ga0070689_1000399022 | 494 |
| 525 | 3300005347 | Ga0070668_100037275 | Ga0070668_1000372752 | 494 |
| 526 | 3300005353 | Ga0070669_100001547 | Ga0070669_1000015473 | 494 |
| 527 | 3300005354 | Ga0070675_100091999 | Ga0070675_1000919992 | 494 |
| 528 | 3300005354 | Ga0070675_100099032 | Ga0070675_1000990322 | 494 |
| 529 | 3300005356 | Ga0070674_100031799 | Ga0070674_1000317992 | 494 |
| 530 | 3300005364 | Ga0070673_100001051 | Ga0070673_1000010512 | 494 |
| 531 | 3300005364 | Ga0070673_100043716 | Ga0070673_1000437162 | 494 |
| 532 | 3300005365 | Ga0070688_100011565 | Ga0070688_1000115653 | 494 |
| 533 | 3300005365 | Ga0070688_100019853 | Ga0070688_1000198533 | 494 |
| 534 | 3300005367 | Ga0070667_100060084 | Ga0070667_1000600843 | 494 |
| 535 | 3300005438 | Ga0070701_10004865 | Ga0070701_100048653 | 494 |
| 536 | 3300005459 | Ga0068867_100033400 | Ga0068867_1000334003 | 494 |
| 537 | 3300005459 | Ga0068867_100049482 | Ga0068867_1000494822 | 494 |
| 538 | 3300005459 | Ga0068867_100103341 | Ga0068867_1001033411 | 494 |
| 539 | 3300005459 | Ga0068867_100119248 | Ga0068867_1001192481 | 494 |
| 540 | 3300005471 | Ga0070698_100004403 | Ga0070698_1000044037 | 494 |
| 541 | 3300005471 | Ga0070698_100013144 | Ga0070698_1000131443 | 494 |
| 542 | 3300005471 | Ga0070698_100013999 | Ga0070698_1000139995 | 494 |
| 543 | 3300005535 | Ga0070684_100003556 | Ga0070684_1000035568 | 494 |
| 544 | 3300005535 | Ga0070684_100010994 | Ga0070684_1000109942 | 494 |
| 545 | 3300005539 | Ga0068853_100004488 | Ga0068853_1000044883 | 494 |
| 546 | 3300005539 | Ga0068853_100009182 | Ga0068853_1000091826 | 494 |
| 547 | 3300005543 | Ga0070672_100042571 | Ga0070672_1000425713 | 494 |
| 548 | 3300005548 | Ga0070665_100091459 | Ga0070665_1000914592 | 494 |
| 549 | 3300005563 | Ga0068855_100026762 | Ga0068855_1000267625 | 494 |
| 550 | 3300005564 | Ga0070664_100047892 | Ga0070664_1000478923 | 494 |
| 551 | 3300005577 | Ga0068857_100036762 | Ga0068857_1000367622 | 494 |
| 552 | 3300005577 | Ga0068857_100054563 | Ga0068857_1000545632 | 494 |
| 553 | 3300005577 | Ga0068857_100101256 | Ga0068857_1001012562 | 494 |
| 554 | 3300005578 | Ga0068854_100060534 | Ga0068854_1000605342 | 494 |
| 555 | 3300005617 | Ga0068859_100004846 | Ga0068859_1000048464 | 494 |
| 556 | 3300005617 | Ga0068859_100090517 | Ga0068859_1000905173 | 494 |
| 557 | 3300005719 | Ga0068861_100005751 | Ga0068861_1000057518 | 494 |
| 558 | 3300005719 | Ga0068861_100061699 | Ga0068861_1000616992 | 494 |
| 559 | 3300005840 | Ga0068870_10009295 | Ga0068870_100092952 | 494 |
| 560 | 3300005841 | Ga0068863_100069003 | Ga0068863_1000690033 | 494 |
| 561 | 3300005841 | Ga0068863_100192024 | Ga0068863_1001920242 | 494 |
| 562 | 3300005842 | Ga0068858_100132931 | Ga0068858_1001329311 | 494 |
| 563 | 3300005843 | Ga0068860_100035838 | Ga0068860_1000358385 | 494 |
| 564 | 3300005844 | Ga0068862_100016622 | Ga0068862_1000166227 | 494 |
| 565 | 3300005844 | Ga0068862_100194413 | Ga0068862_1001944132 | 494 |
| 566 | 3300005985 | Ga0081539_10010380 | Ga0081539_100103802 | 494 |
| 567 | 3300006195 | Ga0075366_10004372 | Ga0075366_100043726 | 494 |
| 568 | 3300006358 | Ga0068871_100033509 | Ga0068871_1000335093 | 494 |
| 569 | 3300006847 | Ga0075431_100011173 | Ga0075431_1000111739 | 494 |
| 570 | 3300006881 | Ga0068865_100007946 | Ga0068865_1000079465 | 494 |
| 571 | 3300006881 | Ga0068865_100026788 | Ga0068865_1000267883 | 494 |
| 572 | 3300006931 | Ga0097620_100004846 | Ga0097620_1000048464 | 494 |
| 573 | 3300006931 | Ga0097620_100090518 | Ga0097620_1000905183 | 494 |
| 574 | 3300009093 | Ga0105240_10015806 | Ga0105240_100158068 | 494 |
| 575 | 3300009094 | Ga0111539_10002241 | Ga0111539_1000224111 | 494 |
| 576 | 3300009147 | Ga0114129_10011797 | Ga0114129_100117974 | 494 |
| 577 | 3300009176 | Ga0105242_10160235 | Ga0105242_101602351 | 494 |
| 578 | 3300009177 | Ga0105248_10110662 | Ga0105248_101106622 | 494 |
| 579 | 3300009553 | Ga0105249_10025790 | Ga0105249_100257903 | 494 |
| 580 | 3300009553 | Ga0105249_10116875 | Ga0105249_101168752 | 494 |
| 581 | 3300010375 | Ga0105239_10000925 | Ga0105239_100009255 | 494 |
| 582 | 3300010375 | Ga0105239_10183270 | Ga0105239_101832701 | 494 |
| 583 | 3300011119 | Ga0105246_10014719 | Ga0105246_100147192 | 494 |
| 584 | 3300013104 | Ga0157370_10048874 | Ga0157370_100488743 | 494 |
| 585 | 3300013296 | Ga0157374_10000013 | Ga0157374_10000013360 | 494 |
| 586 | 3300013296 | Ga0157374_10056656 | Ga0157374_100566562 | 494 |
| 587 | 3300013296 | Ga0157374_10204341 | Ga0157374_102043412 | 494 |
| 588 | 3300013306 | Ga0163162_10032847 | Ga0163162_100328474 | 494 |
| 589 | 3300013306 | Ga0163162_10078034 | Ga0163162_100780342 | 494 |
| 590 | 3300013307 | Ga0157372_10002589 | Ga0157372_1000258914 | 494 |
| 591 | 3300013307 | Ga0157372_10007573 | Ga0157372_100075733 | 494 |
| 592 | 3300013307 | Ga0157372_10009489 | Ga0157372_100094899 | 494 |
| 593 | 3300013308 | Ga0157375_10005771 | Ga0157375_100057717 | 494 |
| 594 | 3300013308 | Ga0157375_10011400 | Ga0157375_100114004 | 494 |
| 595 | 3300013308 | Ga0157375_10059483 | Ga0157375_100594833 | 494 |
| 596 | 3300013308 | Ga0157375_10200208 | Ga0157375_102002081 | 494 |
| 597 | 3300014325 | Ga0163163_10001180 | Ga0163163_100011807 | 494 |
| 598 | 3300014325 | Ga0163163_10175547 | Ga0163163_101755471 | 494 |
| 599 | 3300014326 | Ga0157380_10004013 | Ga0157380_100040139 | 494 |
| 600 | 3300014745 | Ga0157377_10002055 | Ga0157377_100020557 | 494 |
| 601 | 3300014745 | Ga0157377_10004188 | Ga0157377_100041885 | 494 |
| 602 | 3300014745 | Ga0157377_10009714 | Ga0157377_100097142 | 494 |
| 603 | 3300014968 | Ga0157379_10022586 | Ga0157379_100225862 | 494 |
| 604 | 3300014968 | Ga0157379_10125516 | Ga0157379_101255162 | 494 |
| 605 | 3300014969 | Ga0157376_10001116 | Ga0157376_1000111611 | 494 |
| 606 | 3300014969 | Ga0157376_10089346 | Ga0157376_100893462 | 494 |
| 607 | 3300017792 | Ga0163161_10039613 | Ga0163161_100396132 | 494 |
| 608 | 3300017792 | Ga0163161_10120223 | Ga0163161_101202231 | 494 |
| 609 | 3300025246 | Ga0209646_1000004 | Ga0209646_1000004400 | 494 |
| 610 | 3300025250 | Ga0209026_1000095 | Ga0209026_10000958 | 494 |
| 611 | 3300025273 | Ga0209673_1000078 | Ga0209673_1000078124 | 494 |
| 612 | 3300025297 | Ga0209758_1000834 | Ga0209758_100083434 | 494 |
| 613 | 3300025297 | Ga0209758_1008970 | Ga0209758_10089705 | 494 |
| 614 | 3300025297 | Ga0209758_1010247 | Ga0209758_10102471 | 494 |
| 615 | 3300025298 | Ga0209050_1000097 | Ga0209050_1000097138 | 494 |
| 616 | 3300025302 | Ga0207426_1000456 | Ga0207426_100045612 | 494 |
| 617 | 3300025302 | Ga0207426_1001120 | Ga0207426_100112012 | 494 |
| 618 | 3300025304 | Ga0209257_1000070 | Ga0209257_1000070112 | 494 |
| 619 | 3300025304 | Ga0209257_1001349 | Ga0209257_100134925 | 494 |
| 620 | 3300025315 | Ga0207697_10027713 | Ga0207697_100277132 | 494 |
| 621 | 3300025315 | Ga0207697_10029676 | Ga0207697_100296762 | 494 |
| 622 | 3300025903 | Ga0207680_10046689 | Ga0207680_100466891 | 494 |
| 623 | 3300025904 | Ga0207647_10047794 | Ga0207647_100477942 | 494 |
| 624 | 3300025907 | Ga0207645_10001118 | Ga0207645_1000111816 | 494 |
| 625 | 3300025907 | Ga0207645_10002926 | Ga0207645_1000292610 | 494 |
| 626 | 3300025907 | Ga0207645_10032122 | Ga0207645_100321223 | 494 |
| 627 | 3300025908 | Ga0207643_10017131 | Ga0207643_100171314 | 494 |
| 628 | 3300025913 | Ga0207695_10002258 | Ga0207695_1000225816 | 494 |
| 629 | 3300025923 | Ga0207681_10002654 | Ga0207681_100026546 | 494 |
| 630 | 3300025925 | Ga0207650_10007657 | Ga0207650_100076571 | 494 |
| 631 | 3300025926 | Ga0207659_10056737 | Ga0207659_100567372 | 494 |
| 632 | 3300025926 | Ga0207659_10086518 | Ga0207659_100865181 | 494 |
| 633 | 3300025934 | Ga0207686_10001307 | Ga0207686_100013073 | 494 |
| 634 | 3300025934 | Ga0207686_10030919 | Ga0207686_100309192 | 494 |
| 635 | 3300025934 | Ga0207686_10131598 | Ga0207686_101315981 | 494 |
| 636 | 3300025936 | Ga0207670_10055422 | Ga0207670_100554223 | 494 |
| 637 | 3300025940 | Ga0207691_10055070 | Ga0207691_100550703 | 494 |
| 638 | 3300025940 | Ga0207691_10178365 | Ga0207691_101783651 | 494 |
| 639 | 3300025942 | Ga0207689_10001731 | Ga0207689_1000173113 | 494 |
| 640 | 3300025942 | Ga0207689_10009943 | Ga0207689_100099436 | 494 |
| 641 | 3300025942 | Ga0207689_10076912 | Ga0207689_100769122 | 494 |
| 642 | 3300025944 | Ga0207661_10053266 | Ga0207661_100532663 | 494 |
| 643 | 3300025944 | Ga0207661_10094061 | Ga0207661_100940612 | 494 |
| 644 | 3300025945 | Ga0207679_10033867 | Ga0207679_100338672 | 494 |
| 645 | 3300025949 | Ga0207667_10009289 | Ga0207667_100092896 | 494 |
| 646 | 3300025960 | Ga0207651_10035779 | Ga0207651_100357793 | 494 |
| 647 | 3300025961 | Ga0207712_10018213 | Ga0207712_100182133 | 494 |
| 648 | 3300025961 | Ga0207712_10044296 | Ga0207712_100442962 | 494 |
| 649 | 3300025972 | Ga0207668_10082096 | Ga0207668_100820962 | 494 |
| 650 | 3300025986 | Ga0207658_10036299 | Ga0207658_100362992 | 494 |
| 651 | 3300025986 | Ga0207658_10083697 | Ga0207658_100836972 | 494 |
| 652 | 3300026023 | Ga0207677_10042459 | Ga0207677_100424591 | 494 |
| 653 | 3300026041 | Ga0207639_10063591 | Ga0207639_100635913 | 494 |
| 654 | 3300026041 | Ga0207639_10075856 | Ga0207639_100758562 | 494 |
| 655 | 3300026067 | Ga0207678_10038315 | Ga0207678_100383153 | 494 |
| 656 | 3300026088 | Ga0207641_10000422 | Ga0207641_100004226 | 494 |
| 657 | 3300026088 | Ga0207641_10270577 | Ga0207641_102705771 | 494 |
| 658 | 3300026089 | Ga0207648_10003325 | Ga0207648_1000332512 | 494 |
| 659 | 3300026089 | Ga0207648_10015205 | Ga0207648_100152055 | 494 |
| 660 | 3300026089 | Ga0207648_10047742 | Ga0207648_100477422 | 494 |
| 661 | 3300026089 | Ga0207648_10125080 | Ga0207648_101250803 | 494 |
| 662 | 3300026116 | Ga0207674_10015924 | Ga0207674_100159241 | 494 |
| 663 | 3300026116 | Ga0207674_10022101 | Ga0207674_100221014 | 494 |
| 664 | 3300026116 | Ga0207674_10091641 | Ga0207674_100916412 | 494 |
| 665 | 3300026118 | Ga0207675_100000144 | Ga0207675_10000014411 | 494 |
| 666 | 3300026118 | Ga0207675_100020719 | Ga0207675_1000207195 | 494 |
| 667 | 3300027907 | Ga0207428_10031022 | Ga0207428_100310222 | 494 |
| 668 | 3300028380 | Ga0268265_10006981 | Ga0268265_100069817 | 494 |
| 669 | 3300028380 | Ga0268265_10073664 | Ga0268265_100736642 | 494 |
| 670 | 3300028381 | Ga0268264_10074753 | Ga0268264_100747532 | 494 |
| 671 | 3300031251 | Ga0265327_10000024 | Ga0265327_1000002449 | 494 |
| 672 | 3300036401 | Ga0373937_0162063 | Ga0373937_0162063_182_1675 | 494 |
| 673 | 3300037418 | Ga0395900_0142031 | Ga0395900_0142031_409_1905 | 494 |
| 674 | 3300041413 | Ga0439465_0023158 | Ga0439465_0023158_59_1549 | 494 |
| 675 | 3300042435 | Ga0439434_0012643 | Ga0439434_0012643_562_2064 | 494 |
| 676 | 3300044719 | Ga0466971_0011942 | Ga0466971_0011942_1424_2929 | 494 |
| 677 | 3300046453 | Ga0495627_002110 | Ga0495627_002110_5219_6718 | 494 |
| 678 | 3300046499 | Ga0495594_0022025 | Ga0495594_0022025_1592_3085 | 494 |
| 679 | 3300046517 | Ga0495630_0065621 | Ga0495630_0065621_722_2224 | 494 |
| 680 | 3300046558 | Ga0495633_0000133 | Ga0495633_0000133_38915_40414 | 494 |
| 681 | 3300047444 | Ga0495675_0087728 | Ga0495675_0087728_440_1942 | 494 |
| 682 | 3300047472 | Ga0495686_0044521 | Ga0495686_0044521_1077_2570 | 494 |
| 683 | 3300049568 | Ga0501031_0028370 | Ga0501031_0028370_438_1934 | 494 |
| 684 | 3300049572 | Ga0501036_0001672 | Ga0501036_0001672_3827_5320 | 494 |
| 685 | 3300049579 | Ga0501043_0021684 | Ga0501043_0021684_2493_3989 | 494 |
| 686 | 3300049579 | Ga0501043_0031114 | Ga0501043_0031114_1614_3107 | 494 |
| 687 | 3300049580 | Ga0501046_0060233 | Ga0501046_0060233_1306_2802 | 494 |
| 688 | 3300049580 | Ga0501046_0068687 | Ga0501046_0068687_175_1668 | 494 |
| 689 | 3300049593 | Ga0501077_0038341 | Ga0501077_0038341_466_1959 | 494 |
| 690 | 3300049763 | Ga0501266_000438 | Ga0501266_000438_3259_4767 | 494 |
| 691 | 3300050493 | nmdc:mga0k408_3446_c2 | nmdc:mga0k408_3446_c2_2599_4092 | 494 |
| 692 | 3300050510 | nmdc:mga06r32_29407_c1 | nmdc:mga06r32_29407_c1_2515_4008 | 494 |
| 693 | 3300050511 | nmdc:mga08y16_18928_c1 | nmdc:mga08y16_18928_c1_3438_4940 | 494 |
| 694 | 3300053139 | Ga0500568_0004057 | Ga0500568_0004057_1928_3415 | 494 |
| 695 | 3300053153 | Ga0500616_0002857 | Ga0500616_0002857_2499_3992 | 494 |
| 696 | 3300055283 | Ga0500661_001032 | Ga0500661_001032_2400_3899 | 494 |
| 697 | 3300061719 | Ga0466962_0006769 | Ga0466962_0006769_1081_2586 | 494 |
| 698 | 3300002459 | JGI24751J29686_10001711 | JGI24751J29686_100017114 | 495 |
| 699 | 3300003203 | JGI25406J46586_10009223 | JGI25406J46586_100092234 | 495 |
| 700 | 3300005329 | Ga0070683_100038887 | Ga0070683_1000388873 | 495 |
| 701 | 3300005334 | Ga0068869_100011750 | Ga0068869_1000117505 | 495 |
| 702 | 3300005335 | Ga0070666_10000064 | Ga0070666_1000006468 | 495 |
| 703 | 3300005367 | Ga0070667_100035635 | Ga0070667_1000356352 | 495 |
| 704 | 3300005539 | Ga0068853_100166001 | Ga0068853_1001660011 | 495 |
| 705 | 3300005543 | Ga0070672_100053372 | Ga0070672_1000533722 | 495 |
| 706 | 3300005617 | Ga0068859_100000003 | Ga0068859_100000003153 | 495 |
| 707 | 3300005618 | Ga0068864_100006628 | Ga0068864_1000066289 | 495 |
| 708 | 3300005618 | Ga0068864_100097951 | Ga0068864_1000979512 | 495 |
| 709 | 3300005834 | Ga0068851_10010183 | Ga0068851_100101834 | 495 |
| 710 | 3300005841 | Ga0068863_100003550 | Ga0068863_1000035505 | 495 |
| 711 | 3300005842 | Ga0068858_100002928 | Ga0068858_10000292813 | 495 |
| 712 | 3300005843 | Ga0068860_100003019 | Ga0068860_10000301911 | 495 |
| 713 | 3300005843 | Ga0068860_100004200 | Ga0068860_1000042008 | 495 |
| 714 | 3300005844 | Ga0068862_100080426 | Ga0068862_1000804262 | 495 |
| 715 | 3300005985 | Ga0081539_10000042 | Ga0081539_100000425 | 495 |
| 716 | 3300006237 | Ga0097621_100005389 | Ga0097621_1000053894 | 495 |
| 717 | 3300006358 | Ga0068871_100043443 | Ga0068871_1000434432 | 495 |
| 718 | 3300006931 | Ga0097620_100000003 | Ga0097620_100000003153 | 495 |
| 719 | 3300009093 | Ga0105240_10000011 | Ga0105240_10000011139 | 495 |
| 720 | 3300009174 | Ga0105241_10002666 | Ga0105241_100026668 | 495 |
| 721 | 3300009545 | Ga0105237_10009785 | Ga0105237_100097858 | 495 |
| 722 | 3300009545 | Ga0105237_10034915 | Ga0105237_100349152 | 495 |
| 723 | 3300009553 | Ga0105249_10003454 | Ga0105249_100034548 | 495 |
| 724 | 3300009553 | Ga0105249_10021119 | Ga0105249_100211195 | 495 |
| 725 | 3300010375 | Ga0105239_10000122 | Ga0105239_10000122104 | 495 |
| 726 | 3300010375 | Ga0105239_10010365 | Ga0105239_100103655 | 495 |
| 727 | 3300010375 | Ga0105239_10021156 | Ga0105239_100211567 | 495 |
| 728 | 3300010375 | Ga0105239_10059960 | Ga0105239_100599603 | 495 |
| 729 | 3300013105 | Ga0157369_10218046 | Ga0157369_102180462 | 495 |
| 730 | 3300013296 | Ga0157374_10029675 | Ga0157374_100296753 | 495 |
| 731 | 3300013306 | Ga0163162_10014151 | Ga0163162_100141512 | 495 |
| 732 | 3300013308 | Ga0157375_10045028 | Ga0157375_100450284 | 495 |
| 733 | 3300014325 | Ga0163163_10039539 | Ga0163163_100395392 | 495 |
| 734 | 3300025302 | Ga0207426_1000105 | Ga0207426_100010530 | 495 |
| 735 | 3300025321 | Ga0207656_10005711 | Ga0207656_100057111 | 495 |
| 736 | 3300025903 | Ga0207680_10000388 | Ga0207680_1000038811 | 495 |
| 737 | 3300025911 | Ga0207654_10001481 | Ga0207654_100014812 | 495 |
| 738 | 3300025913 | Ga0207695_10000010 | Ga0207695_10000010527 | 495 |
| 739 | 3300025914 | Ga0207671_10001848 | Ga0207671_1000184815 | 495 |
| 740 | 3300025931 | Ga0207644_10032638 | Ga0207644_100326382 | 495 |
| 741 | 3300025940 | Ga0207691_10076955 | Ga0207691_100769553 | 495 |
| 742 | 3300025942 | Ga0207689_10002903 | Ga0207689_1000290311 | 495 |
| 743 | 3300025944 | Ga0207661_10011866 | Ga0207661_100118664 | 495 |
| 744 | 3300025961 | Ga0207712_10001902 | Ga0207712_100019022 | 495 |
| 745 | 3300025961 | Ga0207712_10008201 | Ga0207712_100082015 | 495 |
| 746 | 3300025972 | Ga0207668_10046555 | Ga0207668_100465552 | 495 |
| 747 | 3300025986 | Ga0207658_10024873 | Ga0207658_100248733 | 495 |
| 748 | 3300026088 | Ga0207641_10000026 | Ga0207641_10000026138 | 495 |
| 749 | 3300026088 | Ga0207641_10060156 | Ga0207641_100601562 | 495 |
| 750 | 3300026089 | Ga0207648_10049961 | Ga0207648_100499613 | 495 |
| 751 | 3300026095 | Ga0207676_10003977 | Ga0207676_100039775 | 495 |
| 752 | 3300026095 | Ga0207676_10083732 | Ga0207676_100837322 | 495 |
| 753 | 3300026142 | Ga0207698_10194199 | Ga0207698_101941992 | 495 |
| 754 | 3300028380 | Ga0268265_10084602 | Ga0268265_100846022 | 495 |
| 755 | 3300028381 | Ga0268264_10001931 | Ga0268264_1000193118 | 495 |
| 756 | 3300031616 | Ga0307508_10000990 | Ga0307508_1000099025 | 495 |
| 757 | 3300031852 | Ga0307410_10009417 | Ga0307410_100094172 | 495 |
| 758 | 3300033179 | Ga0307507_10077837 | Ga0307507_100778372 | 495 |
| 759 | 3300049570 | Ga0501033_0054738 | Ga0501033_0054738_1164_2675 | 495 |
| 760 | 3300049571 | Ga0501034_0007368 | Ga0501034_0007368_4319_5830 | 495 |
| 761 | 3300049571 | Ga0501034_0017493 | Ga0501034_0017493_3886_5397 | 495 |
| 762 | 3300049742 | Ga0501080_0098250 | Ga0501080_0098250_1119_2630 | 495 |
| 763 | 3300049823 | Ga0501044_0047734 | Ga0501044_0047734_1196_2707 | 495 |
| 764 | 3300053108 | Ga0500562_000024 | Ga0500562_000024_71165_72673 | 495 |
| 765 | 3300053156 | Ga0500622_0000353 | Ga0500622_0000353_35089_36597 | 495 |
| 766 | 3300005329 | Ga0070683_100006129 | Ga0070683_1000061299 | 496 |
| 767 | 3300005337 | Ga0070682_100052324 | Ga0070682_1000523241 | 496 |
| 768 | 3300005343 | Ga0070687_100015694 | Ga0070687_1000156942 | 496 |
| 769 | 3300005344 | Ga0070661_100000394 | Ga0070661_1000003947 | 496 |
| 770 | 3300005354 | Ga0070675_100032708 | Ga0070675_1000327082 | 496 |
| 771 | 3300005355 | Ga0070671_100079615 | Ga0070671_1000796152 | 496 |
| 772 | 3300005366 | Ga0070659_100005182 | Ga0070659_1000051823 | 496 |
| 773 | 3300005535 | Ga0070684_100000214 | Ga0070684_1000002146 | 496 |
| 774 | 3300005539 | Ga0068853_100004926 | Ga0068853_1000049265 | 496 |
| 775 | 3300005564 | Ga0070664_100008829 | Ga0070664_1000088295 | 496 |
| 776 | 3300005577 | Ga0068857_100008115 | Ga0068857_1000081152 | 496 |
| 777 | 3300005842 | Ga0068858_100115260 | Ga0068858_1001152602 | 496 |
| 778 | 3300006358 | Ga0068871_100209613 | Ga0068871_1002096131 | 496 |
| 779 | 3300006844 | Ga0075428_100014704 | Ga0075428_1000147047 | 496 |
| 780 | 3300006846 | Ga0075430_100109755 | Ga0075430_1001097551 | 496 |
| 781 | 3300006880 | Ga0075429_100001064 | Ga0075429_10000106410 | 496 |
| 782 | 3300009176 | Ga0105242_10073754 | Ga0105242_100737542 | 496 |
| 783 | 3300013297 | Ga0157378_10175329 | Ga0157378_101753292 | 496 |
| 784 | 3300014745 | Ga0157377_10016310 | Ga0157377_100163102 | 496 |
| 785 | 3300025907 | Ga0207645_10030160 | Ga0207645_100301602 | 496 |
| 786 | 3300025920 | Ga0207649_10004740 | Ga0207649_100047403 | 496 |
| 787 | 3300025940 | Ga0207691_10015441 | Ga0207691_100154416 | 496 |
| 788 | 3300025942 | Ga0207689_10022012 | Ga0207689_100220125 | 496 |
| 789 | 3300025944 | Ga0207661_10008794 | Ga0207661_100087949 | 496 |
| 790 | 3300025945 | Ga0207679_10002212 | Ga0207679_100022127 | 496 |
| 791 | 3300025945 | Ga0207679_10005363 | Ga0207679_100053634 | 496 |
| 792 | 3300026023 | Ga0207677_10186850 | Ga0207677_101868501 | 496 |
| 793 | 3300026035 | Ga0207703_10150063 | Ga0207703_101500631 | 496 |
| 794 | 3300026041 | Ga0207639_10012382 | Ga0207639_100123823 | 496 |
| 795 | 3300026089 | Ga0207648_10029956 | Ga0207648_100299562 | 496 |
| 796 | 3300026116 | Ga0207674_10118979 | Ga0207674_101189792 | 496 |
| 797 | 3300026118 | Ga0207675_100022457 | Ga0207675_1000224573 | 496 |
| 798 | 3300031251 | Ga0265327_10000115 | Ga0265327_10000115133 | 496 |
| 799 | 3300031251 | Ga0265327_10033672 | Ga0265327_100336721 | 496 |
| 800 | 3300032004 | Ga0307414_10001628 | Ga0307414_100016289 | 496 |
| 801 | 3300041512 | Ga0451853_2497079 | Ga0451853_2497079_333_1829 | 496 |
| 802 | 3300044658 | Ga0466972_0000009 | Ga0466972_0000009_227040_228536 | 496 |
| 803 | 3300044658 | Ga0466972_0044812 | Ga0466972_0044812_27_1523 | 496 |
| 804 | 3300044684 | Ga0466966_0007506 | Ga0466966_0007506_2826_4325 | 496 |
| 805 | 3300044842 | Ga0466957_0000378 | Ga0466957_0000378_12035_13534 | 496 |
| 806 | 3300045049 | Ga0466959_0000003 | Ga0466959_0000003_230897_232396 | 496 |
| 807 | 3300048918 | Ga0496115_0011125 | Ga0496115_0011125_4826_6319 | 496 |
| 808 | 3300049571 | Ga0501034_0023796 | Ga0501034_0023796_2982_4496 | 496 |
| 809 | 3300049571 | Ga0501034_0149415 | Ga0501034_0149415_284_1786 | 496 |
| 810 | 3300049581 | Ga0501047_0037558 | Ga0501047_0037558_1826_3328 | 496 |
| 811 | 3300049584 | Ga0501068_0025540 | Ga0501068_0025540_1498_3012 | 496 |
| 812 | 3300049589 | Ga0501073_0008525 | Ga0501073_0008525_4801_6315 | 496 |
| 813 | 3300049590 | Ga0501074_0004127 | Ga0501074_0004127_1614_3128 | 496 |
| 814 | 3300049703 | Ga0501219_000135 | Ga0501219_000135_3171_4664 | 496 |
| 815 | 3300049822 | Ga0501035_0006854 | Ga0501035_0006854_9091_10605 | 496 |
| 816 | 3300050005 | Ga0501284_00001 | Ga0501284_00001_50548_52041 | 496 |
| 817 | 3300050493 | nmdc:mga0k408_111924_c1 | nmdc:mga0k408_111924_c1_23_1522 | 496 |
| 818 | 3300050493 | nmdc:mga0k408_22621_c1 | nmdc:mga0k408_22621_c1_788_2284 | 496 |
| 819 | 3300050507 | nmdc:mga05p37_1394_c1 | nmdc:mga05p37_1394_c1_11498_12997 | 496 |
| 820 | 3300050508 | nmdc:mga09592_14999_c1 | nmdc:mga09592_14999_c1_3851_5428 | 496 |
| 821 | 3300053086 | Ga0500578_0000920 | Ga0500578_0000920_11542_13038 | 496 |
| 822 | 3300053727 | Ga0500611_000001 | Ga0500611_000001_278096_279661 | 496 |
| 823 | 2162886007 | SwRhRL2b_contig_577364 | SwRhRL2b_0794.00000170 | 497 |
| 824 | 3300003320 | rootH2_10006463 | rootH2_1000646318 | 497 |
| 825 | 3300005289 | Ga0065704_10070133 | Ga0065704_10070133635 | 497 |
| 826 | 3300005289 | Ga0065704_10077065 | Ga0065704_100770653 | 497 |
| 827 | 3300005355 | Ga0070671_100020931 | Ga0070671_1000209315 | 497 |
| 828 | 3300005367 | Ga0070667_100016043 | Ga0070667_1000160434 | 497 |
| 829 | 3300005544 | Ga0070686_100037082 | Ga0070686_1000370822 | 497 |
| 830 | 3300005563 | Ga0068855_100002019 | Ga0068855_1000020199 | 497 |
| 831 | 3300006358 | Ga0068871_100002146 | Ga0068871_1000021465 | 497 |
| 832 | 3300009176 | Ga0105242_10034224 | Ga0105242_100342244 | 497 |
| 833 | 3300009177 | Ga0105248_10036272 | Ga0105248_100362723 | 497 |
| 834 | 3300009545 | Ga0105237_10015997 | Ga0105237_100159976 | 497 |
| 835 | 3300010375 | Ga0105239_10001910 | Ga0105239_1000191015 | 497 |
| 836 | 3300010375 | Ga0105239_10346907 | Ga0105239_103469071 | 497 |
| 837 | 3300013306 | Ga0163162_10010213 | Ga0163162_100102132 | 497 |
| 838 | 3300013306 | Ga0163162_10230478 | Ga0163162_102304781 | 497 |
| 839 | 3300013307 | Ga0157372_10007754 | Ga0157372_100077542 | 497 |
| 840 | 3300013308 | Ga0157375_10000422 | Ga0157375_100004228 | 497 |
| 841 | 3300014325 | Ga0163163_10000952 | Ga0163163_1000095220 | 497 |
| 842 | 3300014968 | Ga0157379_10002405 | Ga0157379_100024058 | 497 |
| 843 | 3300014968 | Ga0157379_10072422 | Ga0157379_100724223 | 497 |
| 844 | 3300014969 | Ga0157376_10000878 | Ga0157376_100008782 | 497 |
| 845 | 3300017792 | Ga0163161_10002456 | Ga0163161_100024567 | 497 |
| 846 | 3300025904 | Ga0207647_10018700 | Ga0207647_100187004 | 497 |
| 847 | 3300025913 | Ga0207695_10008072 | Ga0207695_100080728 | 497 |
| 848 | 3300025914 | Ga0207671_10000126 | Ga0207671_1000012625 | 497 |
| 849 | 3300025914 | Ga0207671_10113076 | Ga0207671_101130762 | 497 |
| 850 | 3300025931 | Ga0207644_10009272 | Ga0207644_100092726 | 497 |
| 851 | 3300025941 | Ga0207711_10045385 | Ga0207711_100453855 | 497 |
| 852 | 3300025949 | Ga0207667_10009325 | Ga0207667_100093259 | 497 |
| 853 | 3300026078 | Ga0207702_10028372 | Ga0207702_100283722 | 497 |
| 854 | 3300026116 | Ga0207674_10042154 | Ga0207674_100421543 | 497 |
| 855 | 3300026121 | Ga0207683_10084988 | Ga0207683_100849882 | 497 |
| 856 | 3300031251 | Ga0265327_10000022 | Ga0265327_1000002283 | 497 |
| 857 | 3300031251 | Ga0265327_10000098 | Ga0265327_1000009833 | 497 |
| 858 | 3300031507 | Ga0307509_10125570 | Ga0307509_101255702 | 497 |
| 859 | 3300046616 | Ga0495668_0000419 | Ga0495668_0000419_34508_36001 | 497 |
| 860 | 3300046616 | Ga0495668_0004630 | Ga0495668_0004630_7271_8773 | 497 |
| 861 | 3300046648 | Ga0495611_0000061 | Ga0495611_0000061_13432_14973 | 497 |
| 862 | 3300047472 | Ga0495686_0000230 | Ga0495686_0000230_89290_90783 | 497 |
| 863 | 3300048918 | Ga0496115_0084779 | Ga0496115_0084779_987_2480 | 497 |
| 864 | 3300049822 | Ga0501035_0093095 | Ga0501035_0093095_936_2429 | 497 |
| 865 | 3300053130 | Ga0500642_0003936 | Ga0500642_0003936_973_2466 | 497 |
| 866 | 3300053151 | Ga0500604_0000475 | Ga0500604_0000475_6881_8383 | 497 |
| 867 | 3300053153 | Ga0500616_0001228 | Ga0500616_0001228_11777_13270 | 497 |
| 868 | 3300053158 | Ga0500627_0020614 | Ga0500627_0020614_530_2023 | 497 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ujd-assembly1.cif.gz_A-2 | crystal structure of cysteine-trna ligase from elizabethkingia sp. | 0.9335 | 2 | 440 |
| 6ujd-assembly1.cif.gz_A-2 | crystal structure of cysteine-trna ligase from elizabethkingia sp. | 0.9313 | 2 | 440 |
| 8qhp-assembly1.cif.gz_B | cysteine trna ligase homodimer | 0.9301 | 2 | 435 |
| 3tqo-assembly1.cif.gz_A | structure of the cysteinyl-trna synthetase (cyss) from coxiella burnetii. | 0.925 | 1 | 443 |
| 3tqo-assembly1.cif.gz_A | structure of the cysteinyl-trna synthetase (cyss) from coxiella burnetii. | 0.9158 | 1 | 443 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G2M6_1_304_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9598 | 4 | 329 | 3.40.50.620 |
| af_Q2G2M6_1_304_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9536 | 4 | 329 | 3.40.50.620 |
| 3sp1A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9493 | 2 | 329 | 3.40.50.620 |
| 1li7A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.947 | 19 | 329 | 3.40.50.620 |
| 3sp1A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9459 | 2 | 329 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-E1KPC7-F1-model_v4 | Cysteine--tRNA ligase (EC 6.1.1.16) | 0.9727 | 1 | 284 |
GO:0004817
GO:0005524 GO:0005829 GO:0006423 |
| AF-A0A136LT41-F1-model_v4 | Cysteinyl-tRNA synthetase (EC 6.1.1.16) | 0.9725 | 2 | 282 |
GO:0004817
GO:0005524 GO:0005829 GO:0006423 |
| AF-A0A3D1E653-F1-model_v4 | Cysteine--tRNA ligase | 0.9723 | 103 | 328 |
GO:0004817
GO:0005524 GO:0005829 GO:0006423 |
| AF-A0A3D0FKY0-F1-model_v4 | Cysteine--tRNA ligase (EC 6.1.1.16) | 0.9689 | 4 | 315 |
GO:0004817
GO:0005524 GO:0005829 GO:0006423 |
| AF-A0A7C6TTM2-F1-model_v4 | Class I tRNA ligase family protein | 0.9682 | 1 | 252 |
GO:0004817
GO:0005524 GO:0005829 GO:0006423 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar