F484070

General Info

Members Datasets Scaffolds Average Seq Length
868 366 822 496

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10006895|Ga0065712_100068951
Length 560
Sequence LICNIYVIRVLXKLNRFDTAQVSNLRGEAANWQQQAMIVAQKLITKKVEEIASPDFIGIANKIMSELKIHNSYSRQKEVFKSITPGHVGMYVCGPTVSGESHLGHARPYITFDVIYRYLVHLGNKVRYVRNITDAGHFEEEGREAEDKISKKAILEKLEPMELVQKYTNLYHWAMEQFNTLKPTIEPTATGHIVEQIGMIEEIIKAGYAYEVNGSVYFDVKKYAASHDYGKLSGRVIDDLLETTRDLEGQEEKRDTADFALWKNAAPEXIMRWKSPWGVGFPGWHIECSAMATKYLGAQXDIHGGGMDLLFPHHESEIAQSTICNHVAPVRYWIHNNMITINGKKMGKSYNNVIKLTELFSGDHPALEKAYHPMVVRFFILQTHYRSTLDFGNEALQAAEKGLKRLWEAYEKLSQLAVGSEQSAVDTELDSKVKKLIAEFDEFMDDDFSTAKVMANMFELVPVINSMRDKTIPVSALSKETFELLQKQMKAYIENILGLKSVTEADNEKLKGVMDLLIDIRKEAKGKKDFTTSDKIRNQLTRLGISLKDEKDGGMSWNIE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2738541278 Niastella sp. CF465 Isolate Unclassified
4 2738541284 Pedobacter sp. YR016 Isolate Unclassified
5 2738541302 Pedobacter sp. CF074 Isolate Unclassified
6 2739367651 Pedobacter sp. OK291 Isolate Unclassified
7 2739367656 Pedobacter sp. CF523 Isolate Unclassified
8 2739367663 Pedobacter sp. YR510 Isolate Unclassified
9 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
10 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
11 2818991437 Pedobacter terrae 518 Isolate Unclassified
12 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
13 2818991444 Filimonas endophytica 3197 Isolate Unclassified
14 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
15 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
16 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
17 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
18 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
19 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
20 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
21 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
22 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
23 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
24 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
25 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
26 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
27 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
28 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
29 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
30 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
31 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
32 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
33 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
34 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
35 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
36 2914759650 Rhizosphaericola mali Isolate Rhizosphere
37 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
38 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
39 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
40 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
41 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
42 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
43 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
44 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
45 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
46 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
47 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
48 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
49 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
50 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
51 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
53 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
54 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
55 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
56 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
57 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
58 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
59 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
60 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
61 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
62 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
63 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
64 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
65 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
66 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
67 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
68 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
69 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
70 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
71 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
72 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
73 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
74 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
75 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
76 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
77 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
78 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
79 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
80 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
81 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
82 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
83 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
84 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
85 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
86 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
87 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
88 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
89 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
90 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
91 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
92 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
93 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
94 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
95 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
96 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
97 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
98 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
99 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
100 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
101 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
102 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
106 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
107 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
108 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
109 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
110 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
111 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
112 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
113 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
114 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
115 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
117 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
118 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
119 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
120 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
121 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
122 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
131 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
137 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
146 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
147 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
148 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
152 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
155 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
156 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
158 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
159 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
165 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
217 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
221 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
222 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
223 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
224 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
225 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
226 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
227 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
228 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
229 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
230 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
231 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
232 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
233 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
234 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
235 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
236 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
237 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
238 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
239 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
240 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
241 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
242 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
243 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
244 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
246 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
249 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
250 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
251 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
252 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
253 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
254 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
255 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
256 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
257 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
258 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
259 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
260 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
261 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
262 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
263 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
264 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
265 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
266 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
267 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
268 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
269 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
270 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
271 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
272 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
273 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
274 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
275 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
276 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
277 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
278 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
279 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
280 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
281 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
282 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
283 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
284 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
285 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
286 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
287 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
288 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
289 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
290 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
291 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
292 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
293 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
294 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
295 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
296 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
297 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
298 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
299 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
300 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
301 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
302 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
305 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
313 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
314 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
315 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
316 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
317 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
318 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
319 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
320 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
321 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
322 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
323 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
324 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
325 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
326 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
327 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
328 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
329 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
330 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
331 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
332 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
333 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
334 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
335 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
336 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
337 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
339 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
340 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
341 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
342 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
343 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
344 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
345 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
346 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
347 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
348 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
349 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
350 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
351 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
352 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
353 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
354 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
355 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
356 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
357 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
358 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
359 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
360 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
361 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
362 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
363 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
364 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
365 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
366 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.35
Metatranscriptomes 0.35
Isolates 5.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.65
Nodule 0
Rhizoplane 0.58
Rhizosphere 87.79
Stem 0
Stem Tuber 0
Unclassified 5.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_577364 2162886007 Bacteria 146603
2 MBSR1b_contig_4329513 2162886012 Unclassified 2169
3 JGI24739J22299_10000004 3300001989 Bacteria 75936
4 JGI24744J21845_10002391 3300002077 Bacteria 3826
5 JGI24751J29686_10001711 3300002459 Bacteria 4513
6 JGI25406J46586_10009223 3300003203 Bacteria 4424
7 JGI25153J46596_10000276 3300003215 Bacteria 40180
8 rootH1_10036148 3300003316 Bacteria 3346
9 rootH2_10006463 3300003320 Bacteria 45674
10 rootH2_10043903 3300003320 Bacteria 12034
11 rootL2_10005908 3300003322 Bacteria 1883
12 rootH1_10007795 3300003323 Bacteria 36145
13 JGI25160J50197_1005967 3300003354 Bacteria 5001
14 JGI25160J50197_1015689 3300003354 Bacteria 2477
15 Ga0055528_1000785 3300003790 Bacteria 22113
16 Ga0055530_10000102 3300003791 Bacteria 72819
17 Ga0055531_10000173 3300003794 Bacteria 72625
18 Ga0055531_10030395 3300003794 Bacteria 1815
19 Ga0065165_1000027 3300005262 Bacteria 228507
20 Ga0065704_10070133 3300005289 Bacteria 1266035
21 Ga0065704_10077065 3300005289 Bacteria 4866
22 Ga0065704_10104076 3300005289 Bacteria 2152
23 Ga0065712_10006895 3300005290 Bacteria 3530
24 Ga0065712_10083528 3300005290 Bacteria 2815
25 Ga0070676_10000167 3300005328 Bacteria 26643
26 Ga0070676_10002364 3300005328 Bacteria 9661
27 Ga0070676_10047244 3300005328 Bacteria 2513
28 Ga0070683_100006129 3300005329 Bacteria 10082
29 Ga0070683_100038887 3300005329 Bacteria 4363
30 Ga0070683_100039857 3300005329 Bacteria 4315
31 Ga0070683_100128293 3300005329 Bacteria 2399
32 Ga0070683_100134817 3300005329 Bacteria 2338
33 Ga0070670_100024005 3300005331 Bacteria 5245
34 Ga0070670_100028223 3300005331 Bacteria 4830
35 Ga0070670_100049693 3300005331 Bacteria 3605
36 Ga0070670_100071766 3300005331 Unclassified 2973
37 Ga0070670_100073374 3300005331 Bacteria 2939
38 Ga0070670_100180796 3300005331 Bacteria 1831
39 Ga0068869_100004707 3300005334 Bacteria 8514
40 Ga0068869_100005758 3300005334 Bacteria 7820
41 Ga0068869_100011463 3300005334 Bacteria 5813
42 Ga0068869_100011750 3300005334 Bacteria 5757
43 Ga0068869_100100643 3300005334 Bacteria 2185
44 Ga0068869_100100888 3300005334 Bacteria 2183
45 Ga0070666_10000064 3300005335 Bacteria 79823
46 Ga0070666_10000512 3300005335 Bacteria 23407
47 Ga0070666_10009089 3300005335 Bacteria 6197
48 Ga0070666_10033872 3300005335 Bacteria 3384
49 Ga0070666_10044594 3300005335 Bacteria 2971
50 Ga0070680_100012373 3300005336 Bacteria 6625
51 Ga0070680_100043915 3300005336 Bacteria 3631
52 Ga0070680_100058207 3300005336 Bacteria 3161
53 Ga0070680_100060917 3300005336 Bacteria 3088
54 Ga0070682_100000012 3300005337 Bacteria 265658
55 Ga0070682_100005414 3300005337 Bacteria 7109
56 Ga0070682_100009425 3300005337 Bacteria 5525
57 Ga0070682_100052324 3300005337 Bacteria 2555
58 Ga0068868_100002356 3300005338 Bacteria 13082
59 Ga0068868_100108198 3300005338 Bacteria 2256
60 Ga0068868_100121563 3300005338 Bacteria 2130
61 Ga0068868_100175865 3300005338 Unclassified 1774
62 Ga0070660_100000295 3300005339 Bacteria 33225
63 Ga0070660_100005708 3300005339 Bacteria 8619
64 Ga0070660_100024047 3300005339 Bacteria 4519
65 Ga0070689_100002022 3300005340 Bacteria 13155
66 Ga0070689_100018308 3300005340 Bacteria 5158
67 Ga0070689_100022450 3300005340 Bacteria 4710
68 Ga0070689_100028005 3300005340 Bacteria 4255
69 Ga0070689_100039902 3300005340 Bacteria 3597
70 Ga0070687_100015694 3300005343 Bacteria 3432
71 Ga0070661_100000394 3300005344 Bacteria 33858
72 Ga0070661_100009290 3300005344 Bacteria 6800
73 Ga0070668_100000736 3300005347 Bacteria 22377
74 Ga0070668_100037275 3300005347 Bacteria 3712
75 Ga0070669_100001547 3300005353 Bacteria 16634
76 Ga0070675_100002115 3300005354 Bacteria 14665
77 Ga0070675_100032708 3300005354 Bacteria 4210
78 Ga0070675_100091999 3300005354 Bacteria 2542
79 Ga0070675_100099032 3300005354 Bacteria 2453
80 Ga0070671_100020931 3300005355 Bacteria 5336
81 Ga0070671_100079615 3300005355 Bacteria 2739
82 Ga0070674_100016973 3300005356 Bacteria 4569
83 Ga0070674_100031799 3300005356 Bacteria 3500
84 Ga0070673_100001051 3300005364 Bacteria 15685
85 Ga0070673_100043716 3300005364 Bacteria 3464
86 Ga0070673_100077212 3300005364 Bacteria 2691
87 Ga0070688_100011565 3300005365 Bacteria 4908
88 Ga0070688_100019853 3300005365 Bacteria 3898
89 Ga0070659_100005182 3300005366 Bacteria 9355
90 Ga0070659_100007270 3300005366 Bacteria 8040
91 Ga0070659_100030890 3300005366 Bacteria 4147
92 Ga0070667_100002471 3300005367 Bacteria 16141
93 Ga0070667_100016043 3300005367 Bacteria 6197
94 Ga0070667_100035635 3300005367 Bacteria 4170
95 Ga0070667_100060084 3300005367 Bacteria 3217
96 Ga0070701_10004865 3300005438 Bacteria 5494
97 Ga0070662_100024116 3300005457 Bacteria 4187
98 Ga0070681_10137639 3300005458 Bacteria 2372
99 Ga0068867_100000714 3300005459 Bacteria 22153
100 Ga0068867_100033400 3300005459 Bacteria 3726
101 Ga0068867_100049482 3300005459 Bacteria 3095
102 Ga0068867_100103341 3300005459 Bacteria 2179
103 Ga0068867_100119248 3300005459 Bacteria 2037
104 Ga0070698_100004403 3300005471 Bacteria 15475
105 Ga0070698_100013144 3300005471 Bacteria 8759
106 Ga0070698_100013999 3300005471 Bacteria 8484
107 Ga0070699_100048813 3300005518 Bacteria 3663
108 Ga0070679_100000174 3300005530 Bacteria 51897
109 Ga0070679_100000908 3300005530 Bacteria 25669
110 Ga0070679_100016542 3300005530 Bacteria 7120
111 Ga0070679_100070447 3300005530 Bacteria 3488
112 Ga0070684_100000214 3300005535 Bacteria 40555
113 Ga0070684_100003556 3300005535 Bacteria 11717
114 Ga0070684_100004375 3300005535 Bacteria 10739
115 Ga0070684_100010994 3300005535 Bacteria 7198
116 Ga0068853_100004391 3300005539 Bacteria 10920
117 Ga0068853_100004488 3300005539 Bacteria 10826
118 Ga0068853_100004926 3300005539 Bacteria 10394
119 Ga0068853_100009182 3300005539 Bacteria 7965
120 Ga0068853_100012524 3300005539 Bacteria 6901
121 Ga0068853_100016332 3300005539 Bacteria 6108
122 Ga0068853_100025540 3300005539 Bacteria 4958
123 Ga0068853_100028674 3300005539 Bacteria 4685
124 Ga0068853_100166001 3300005539 Bacteria 1995
125 Ga0070672_100042571 3300005543 Bacteria 3497
126 Ga0070672_100053372 3300005543 Bacteria 3160
127 Ga0070672_100060446 3300005543 Bacteria 2983
128 Ga0070686_100037082 3300005544 Bacteria 3022
129 Ga0070686_100079981 3300005544 Bacteria 2162
130 Ga0070693_100040142 3300005547 Bacteria 2626
131 Ga0070665_100000002 3300005548 Bacteria 849037
132 Ga0070665_100003228 3300005548 Bacteria 17524
133 Ga0070665_100091459 3300005548 Bacteria 3048
134 Ga0068855_100001122 3300005563 Bacteria 33246
135 Ga0068855_100002019 3300005563 Bacteria 25173
136 Ga0068855_100019121 3300005563 Bacteria 8231
137 Ga0068855_100026762 3300005563 Bacteria 6901
138 Ga0068855_100083156 3300005563 Bacteria 3708
139 Ga0070664_100002301 3300005564 Bacteria 15347
140 Ga0070664_100008829 3300005564 Bacteria 8167
141 Ga0070664_100047892 3300005564 Bacteria 3613
142 Ga0068857_100008115 3300005577 Bacteria 9064
143 Ga0068857_100036762 3300005577 Bacteria 4338
144 Ga0068857_100054563 3300005577 Bacteria 3546
145 Ga0068857_100101256 3300005577 Bacteria 2585
146 Ga0068857_100234524 3300005577 Bacteria 1679
147 Ga0068854_100016442 3300005578 Bacteria 4933
148 Ga0068854_100060534 3300005578 Bacteria 2740
149 Ga0068854_100123263 3300005578 Bacteria 1970
150 Ga0068856_100057374 3300005614 Bacteria 3844
151 Ga0068856_100079488 3300005614 Bacteria 3252
152 Ga0068852_100000391 3300005616 Bacteria 29415
153 Ga0068852_100000706 3300005616 Bacteria 21835
154 Ga0068852_100008114 3300005616 Bacteria 7707
155 Ga0068852_100021900 3300005616 Bacteria 5114
156 Ga0068852_100053313 3300005616 Bacteria 3481
157 Ga0068852_100065192 3300005616 Bacteria 3177
158 Ga0068859_100000003 3300005617 Bacteria 479218
159 Ga0068859_100004846 3300005617 Bacteria 13695
160 Ga0068859_100014150 3300005617 Bacteria 8001
161 Ga0068859_100090517 3300005617 Bacteria 3110
162 Ga0068859_100112370 3300005617 Bacteria 2787
163 Ga0068864_100004147 3300005618 Bacteria 11896
164 Ga0068864_100006628 3300005618 Bacteria 9477
165 Ga0068864_100097951 3300005618 Bacteria 2597
166 Ga0068861_100005751 3300005719 Bacteria 8412
167 Ga0068861_100061699 3300005719 Bacteria 2878
168 Ga0068861_100094417 3300005719 Bacteria 2367
169 Ga0068851_10010183 3300005834 Bacteria 4383
170 Ga0068851_10021134 3300005834 Bacteria 3159
171 Ga0068870_10009295 3300005840 Bacteria 4465
172 Ga0068863_100003550 3300005841 Bacteria 15382
173 Ga0068863_100007919 3300005841 Bacteria 10387
174 Ga0068863_100018993 3300005841 Bacteria 6578
175 Ga0068863_100069003 3300005841 Bacteria 3343
176 Ga0068863_100192024 3300005841 Bacteria 1963
177 Ga0068858_100002928 3300005842 Bacteria 17176
178 Ga0068858_100004188 3300005842 Bacteria 14197
179 Ga0068858_100115260 3300005842 Bacteria 2510
180 Ga0068858_100132931 3300005842 Bacteria 2334
181 Ga0068858_100221747 3300005842 Bacteria 1791
182 Ga0068860_100000003 3300005843 Bacteria 575741
183 Ga0068860_100002264 3300005843 Bacteria 20238
184 Ga0068860_100003019 3300005843 Bacteria 17387
185 Ga0068860_100004200 3300005843 Bacteria 14762
186 Ga0068860_100010703 3300005843 Bacteria 9060
187 Ga0068860_100033177 3300005843 Bacteria 4956
188 Ga0068860_100035838 3300005843 Bacteria 4757
189 Ga0068862_100002255 3300005844 Bacteria 17251
190 Ga0068862_100016622 3300005844 Bacteria 6126
191 Ga0068862_100071433 3300005844 Bacteria 2997
192 Ga0068862_100080426 3300005844 Bacteria 2826
193 Ga0068862_100194413 3300005844 Bacteria 1827
194 Ga0081539_10000042 3300005985 Bacteria 289955
195 Ga0081539_10010380 3300005985 Bacteria 7573
196 Ga0075366_10004372 3300006195 Bacteria 7580
197 Ga0097621_100003013 3300006237 Bacteria 11572
198 Ga0097621_100003397 3300006237 Bacteria 10963
199 Ga0097621_100005389 3300006237 Bacteria 9017
200 Ga0097621_100024637 3300006237 Bacteria 4701
201 Ga0068871_100002146 3300006358 Bacteria 13383
202 Ga0068871_100033509 3300006358 Bacteria 4068
203 Ga0068871_100043443 3300006358 Bacteria 3610
204 Ga0068871_100099703 3300006358 Bacteria 2432
205 Ga0068871_100209613 3300006358 Bacteria 1685
206 Ga0075428_100014704 3300006844 Bacteria 8692
207 Ga0075428_100038397 3300006844 Bacteria 5269
208 Ga0075430_100044628 3300006846 Bacteria 3747
209 Ga0075430_100109755 3300006846 Bacteria 2301
210 Ga0075431_100008461 3300006847 Bacteria 10303
211 Ga0075431_100011173 3300006847 Bacteria 9040
212 Ga0075431_100067224 3300006847 Bacteria 3700
213 Ga0075429_100001064 3300006880 Bacteria 21975
214 Ga0068865_100007946 3300006881 Bacteria 6550
215 Ga0068865_100026788 3300006881 Bacteria 3803
216 Ga0097620_100000003 3300006931 Bacteria 479218
217 Ga0097620_100004846 3300006931 Bacteria 13695
218 Ga0097620_100014150 3300006931 Bacteria 8001
219 Ga0097620_100090518 3300006931 Bacteria 3110
220 Ga0097620_100112367 3300006931 Bacteria 2787
221 Ga0105240_10000011 3300009093 Bacteria 523646
222 Ga0105240_10000664 3300009093 Bacteria 63206
223 Ga0105240_10003002 3300009093 Bacteria 26548
224 Ga0105240_10003432 3300009093 Bacteria 24627
225 Ga0105240_10006894 3300009093 Bacteria 16604
226 Ga0105240_10012199 3300009093 Bacteria 11885
227 Ga0105240_10015806 3300009093 Bacteria 10241
228 Ga0105240_10028575 3300009093 Bacteria 7280
229 Ga0105240_10032147 3300009093 Bacteria 6796
230 Ga0105240_10034353 3300009093 Bacteria 6540
231 Ga0105240_10069783 3300009093 Bacteria 4349
232 Ga0111539_10002241 3300009094 Bacteria 25812
233 Ga0105245_10095714 3300009098 Bacteria 2740
234 Ga0105247_10016750 3300009101 Bacteria 4395
235 Ga0105247_10072797 3300009101 Bacteria 2152
236 Ga0114129_10011797 3300009147 Bacteria 12432
237 Ga0114129_10028251 3300009147 Bacteria 7948
238 Ga0114129_10115042 3300009147 Bacteria 3708
239 Ga0105241_10000543 3300009174 Bacteria 28453
240 Ga0105241_10002666 3300009174 Bacteria 13368
241 Ga0105241_10006184 3300009174 Bacteria 8832
242 Ga0105241_10016655 3300009174 Bacteria 5394
243 Ga0105241_10126068 3300009174 Bacteria 2067
244 Ga0105242_10034224 3300009176 Bacteria 4073
245 Ga0105242_10073754 3300009176 Bacteria 2838
246 Ga0105242_10160235 3300009176 Bacteria 1969
247 Ga0105248_10036272 3300009177 Bacteria 5514
248 Ga0105248_10110662 3300009177 Bacteria 3097
249 Ga0105237_10000144 3300009545 Bacteria 100105
250 Ga0105237_10009785 3300009545 Bacteria 10250
251 Ga0105237_10015222 3300009545 Bacteria 8014
252 Ga0105237_10015997 3300009545 Bacteria 7801
253 Ga0105237_10032931 3300009545 Bacteria 5248
254 Ga0105237_10034202 3300009545 Bacteria 5147
255 Ga0105237_10034915 3300009545 Bacteria 5089
256 Ga0105237_10040928 3300009545 Bacteria 4674
257 Ga0105237_10141893 3300009545 Bacteria 2396
258 Ga0105237_10173320 3300009545 Bacteria 2158
259 Ga0105238_10088408 3300009551 Bacteria 3084
260 Ga0105249_10003454 3300009553 Bacteria 13686
261 Ga0105249_10011067 3300009553 Bacteria 7927
262 Ga0105249_10021119 3300009553 Bacteria 5828
263 Ga0105249_10025790 3300009553 Bacteria 5294
264 Ga0105249_10042876 3300009553 Bacteria 4116
265 Ga0105249_10116875 3300009553 Bacteria 2529
266 Ga0105239_10000122 3300010375 Bacteria 109167
267 Ga0105239_10000488 3300010375 Bacteria 57554
268 Ga0105239_10000925 3300010375 Bacteria 41596
269 Ga0105239_10001910 3300010375 Bacteria 27144
270 Ga0105239_10008508 3300010375 Bacteria 11666
271 Ga0105239_10009963 3300010375 Bacteria 10670
272 Ga0105239_10010365 3300010375 Bacteria 10433
273 Ga0105239_10021156 3300010375 Bacteria 7174
274 Ga0105239_10030991 3300010375 Bacteria 5883
275 Ga0105239_10059960 3300010375 Bacteria 4175
276 Ga0105239_10174428 3300010375 Bacteria 2405
277 Ga0105239_10183270 3300010375 Bacteria 2343
278 Ga0105239_10346907 3300010375 Bacteria 1676
279 Ga0105246_10014719 3300011119 Bacteria 4925
280 Ga0157373_10002582 3300013100 Bacteria 13751
281 Ga0157373_10006643 3300013100 Bacteria 8616
282 Ga0157373_10008723 3300013100 Bacteria 7517
283 Ga0157373_10031516 3300013100 Bacteria 3816
284 Ga0157373_10077004 3300013100 Bacteria 2353
285 Ga0157371_10002131 3300013102 Bacteria 19255
286 Ga0157371_10003413 3300013102 Bacteria 14431
287 Ga0157371_10004222 3300013102 Bacteria 12636
288 Ga0157371_10005032 3300013102 Bacteria 11316
289 Ga0157371_10005838 3300013102 Bacteria 10296
290 Ga0157371_10018901 3300013102 Bacteria 5090
291 Ga0157371_10020420 3300013102 Unclassified 4874
292 Ga0157371_10021501 3300013102 Bacteria 4735
293 Ga0157371_10078366 3300013102 Bacteria 2340
294 Ga0157371_10123275 3300013102 Bacteria 1843
295 Ga0157370_10000945 3300013104 Bacteria 36860
296 Ga0157370_10001484 3300013104 Bacteria 29041
297 Ga0157370_10001848 3300013104 Bacteria 26098
298 Ga0157370_10048874 3300013104 Bacteria 4052
299 Ga0157370_10175507 3300013104 Bacteria 1992
300 Ga0157370_10183259 3300013104 Bacteria 1945
301 Ga0157369_10036810 3300013105 Bacteria 5360
302 Ga0157369_10218046 3300013105 Bacteria 1998
303 Ga0157374_10000013 3300013296 Bacteria 461240
304 Ga0157374_10021281 3300013296 Bacteria 5768
305 Ga0157374_10028110 3300013296 Bacteria 5079
306 Ga0157374_10029675 3300013296 Bacteria 4957
307 Ga0157374_10056656 3300013296 Bacteria 3659
308 Ga0157374_10204341 3300013296 Bacteria 1935
309 Ga0157378_10082331 3300013297 Bacteria 2910
310 Ga0157378_10175329 3300013297 Bacteria 2013
311 Ga0163162_10000725 3300013306 Bacteria 30582
312 Ga0163162_10001229 3300013306 Bacteria 23943
313 Ga0163162_10002095 3300013306 Bacteria 18722
314 Ga0163162_10009682 3300013306 Bacteria 9375
315 Ga0163162_10010213 3300013306 Bacteria 9122
316 Ga0163162_10014151 3300013306 Bacteria 7796
317 Ga0163162_10032847 3300013306 Bacteria 5154
318 Ga0163162_10066875 3300013306 Bacteria 3643
319 Ga0163162_10078034 3300013306 Bacteria 3377
320 Ga0163162_10188543 3300013306 Bacteria 2189
321 Ga0163162_10230478 3300013306 Bacteria 1982
322 Ga0157372_10000747 3300013307 Bacteria 35352
323 Ga0157372_10002589 3300013307 Bacteria 19570
324 Ga0157372_10007573 3300013307 Bacteria 11545
325 Ga0157372_10007754 3300013307 Bacteria 11407
326 Ga0157372_10009489 3300013307 Bacteria 10348
327 Ga0157372_10011748 3300013307 Bacteria 9325
328 Ga0157372_10017972 3300013307 Bacteria 7599
329 Ga0157372_10022870 3300013307 Bacteria 6769
330 Ga0157372_10025595 3300013307 Bacteria 6419
331 Ga0157372_10034861 3300013307 Bacteria 5537
332 Ga0157372_10062158 3300013307 Bacteria 4183
333 Ga0157372_10133588 3300013307 Bacteria 2857
334 Ga0157372_10187581 3300013307 Bacteria 2395
335 Ga0157372_10253229 3300013307 Bacteria 2044
336 Ga0157375_10000422 3300013308 Bacteria 38347
337 Ga0157375_10005771 3300013308 Bacteria 10770
338 Ga0157375_10009510 3300013308 Bacteria 8534
339 Ga0157375_10011400 3300013308 Bacteria 7847
340 Ga0157375_10045028 3300013308 Bacteria 4292
341 Ga0157375_10059483 3300013308 Bacteria 3786
342 Ga0157375_10200208 3300013308 Bacteria 2153
343 Ga0163163_10000526 3300014325 Bacteria 34147
344 Ga0163163_10000952 3300014325 Bacteria 24583
345 Ga0163163_10001180 3300014325 Bacteria 22130
346 Ga0163163_10022474 3300014325 Bacteria 5974
347 Ga0163163_10039539 3300014325 Bacteria 4603
348 Ga0163163_10175547 3300014325 Bacteria 2189
349 Ga0157380_10000358 3300014326 Bacteria 27356
350 Ga0157380_10004013 3300014326 Bacteria 10163
351 Ga0182008_10032437 3300014497 Bacteria 2625
352 Ga0157377_10002055 3300014745 Bacteria 8826
353 Ga0157377_10004188 3300014745 Bacteria 6594
354 Ga0157377_10009714 3300014745 Bacteria 4734
355 Ga0157377_10016310 3300014745 Bacteria 3819
356 Ga0157379_10001164 3300014968 Bacteria 21405
357 Ga0157379_10002405 3300014968 Bacteria 15634
358 Ga0157379_10022586 3300014968 Bacteria 5573
359 Ga0157379_10072422 3300014968 Bacteria 3082
360 Ga0157379_10125516 3300014968 Bacteria 2309
361 Ga0157376_10000878 3300014969 Bacteria 19713
362 Ga0157376_10001116 3300014969 Bacteria 17609
363 Ga0157376_10006585 3300014969 Bacteria 8221
364 Ga0157376_10025879 3300014969 Bacteria 4628
365 Ga0157376_10028697 3300014969 Bacteria 4426
366 Ga0157376_10089346 3300014969 Bacteria 2664
367 Ga0182006_1007082 3300015261 Bacteria 5161
368 Ga0182005_1000043 3300015265 Bacteria 140285
369 Ga0163161_10002456 3300017792 Bacteria 13233
370 Ga0163161_10039613 3300017792 Bacteria 3383
371 Ga0163161_10120223 3300017792 Bacteria 1973
372 Ga0213876_10000885 3300021384 Bacteria 20042
373 Ga0209436_106139 3300025208 Bacteria 2669
374 Ga0209258_100032 3300025242 Bacteria 452764
375 Ga0209646_1000004 3300025246 Bacteria 786587
376 Ga0209026_1000095 3300025250 Bacteria 164309
377 Ga0209148_1000131 3300025254 Bacteria 174079
378 Ga0209673_1000078 3300025273 Bacteria 227727
379 Ga0209130_1001858 3300025284 Bacteria 12106
380 Ga0209758_1000834 3300025297 Bacteria 43015
381 Ga0209758_1008970 3300025297 Bacteria 6334
382 Ga0209758_1010247 3300025297 Bacteria 5647
383 Ga0209050_1000097 3300025298 Bacteria 239919
384 Ga0207426_1000033 3300025302 Bacteria 455976
385 Ga0207426_1000105 3300025302 Bacteria 247269
386 Ga0207426_1000456 3300025302 Bacteria 64765
387 Ga0207426_1001120 3300025302 Bacteria 24512
388 Ga0209257_1000070 3300025304 Bacteria 336454
389 Ga0209257_1001349 3300025304 Bacteria 29771
390 Ga0207697_10027713 3300025315 Bacteria 2316
391 Ga0207697_10029676 3300025315 Bacteria 2239
392 Ga0207656_10000333 3300025321 Bacteria 16102
393 Ga0207656_10005711 3300025321 Bacteria 4421
394 Ga0207656_10013289 3300025321 Bacteria 3144
395 Ga0207710_10001920 3300025900 Bacteria 9955
396 Ga0207680_10000388 3300025903 Bacteria 21000
397 Ga0207680_10046689 3300025903 Bacteria 2562
398 Ga0207647_10000131 3300025904 Bacteria 58960
399 Ga0207647_10018700 3300025904 Bacteria 4679
400 Ga0207647_10047794 3300025904 Bacteria 2660
401 Ga0207645_10001118 3300025907 Bacteria 22193
402 Ga0207645_10002926 3300025907 Bacteria 13197
403 Ga0207645_10007440 3300025907 Bacteria 7733
404 Ga0207645_10030160 3300025907 Bacteria 3494
405 Ga0207645_10032122 3300025907 Bacteria 3375
406 Ga0207643_10017131 3300025908 Bacteria 3957
407 Ga0207643_10039838 3300025908 Bacteria 2643
408 Ga0207705_10005067 3300025909 Bacteria 9877
409 Ga0207705_10032789 3300025909 Bacteria 3712
410 Ga0207705_10053943 3300025909 Bacteria 2897
411 Ga0207705_10107177 3300025909 Bacteria 2061
412 Ga0207705_10141297 3300025909 Bacteria 1798
413 Ga0207654_10001481 3300025911 Bacteria 12399
414 Ga0207654_10124553 3300025911 Bacteria 1623
415 Ga0207707_10024994 3300025912 Bacteria 5226
416 Ga0207707_10092500 3300025912 Bacteria 2643
417 Ga0207695_10000010 3300025913 Bacteria 981919
418 Ga0207695_10001317 3300025913 Bacteria 42084
419 Ga0207695_10001383 3300025913 Bacteria 41051
420 Ga0207695_10002258 3300025913 Bacteria 28855
421 Ga0207695_10008072 3300025913 Bacteria 13242
422 Ga0207695_10017403 3300025913 Bacteria 8364
423 Ga0207695_10021984 3300025913 Bacteria 7259
424 Ga0207695_10032855 3300025913 Bacteria 5672
425 Ga0207695_10181482 3300025913 Bacteria 2026
426 Ga0207695_10203740 3300025913 Bacteria 1892
427 Ga0207671_10000126 3300025914 Bacteria 118967
428 Ga0207671_10001848 3300025914 Bacteria 23634
429 Ga0207671_10006294 3300025914 Bacteria 10604
430 Ga0207671_10008066 3300025914 Bacteria 8997
431 Ga0207671_10113076 3300025914 Bacteria 2068
432 Ga0207660_10008378 3300025917 Bacteria 6687
433 Ga0207660_10157829 3300025917 Bacteria 1748
434 Ga0207657_10002329 3300025919 Bacteria 20592
435 Ga0207657_10002631 3300025919 Bacteria 19391
436 Ga0207657_10079840 3300025919 Bacteria 2752
437 Ga0207649_10004740 3300025920 Bacteria 7362
438 Ga0207649_10073468 3300025920 Bacteria 2191
439 Ga0207652_10000035 3300025921 Bacteria 138263
440 Ga0207652_10000132 3300025921 Bacteria 80345
441 Ga0207652_10021939 3300025921 Bacteria 5276
442 Ga0207652_10022399 3300025921 Bacteria 5226
443 Ga0207652_10027902 3300025921 Bacteria 4708
444 Ga0207652_10038378 3300025921 Bacteria 4060
445 Ga0207652_10090593 3300025921 Bacteria 2688
446 Ga0207681_10002654 3300025923 Bacteria 11336
447 Ga0207650_10000813 3300025925 Bacteria 23983
448 Ga0207650_10007657 3300025925 Bacteria 7357
449 Ga0207650_10054602 3300025925 Bacteria 2964
450 Ga0207659_10056737 3300025926 Bacteria 2806
451 Ga0207659_10086518 3300025926 Bacteria 2331
452 Ga0207687_10122252 3300025927 Bacteria 1948
453 Ga0207644_10009272 3300025931 Bacteria 6457
454 Ga0207644_10032638 3300025931 Bacteria 3634
455 Ga0207690_10002315 3300025932 Bacteria 11612
456 Ga0207690_10047766 3300025932 Bacteria 2842
457 Ga0207690_10100658 3300025932 Bacteria 2063
458 Ga0207686_10001307 3300025934 Bacteria 14268
459 Ga0207686_10030919 3300025934 Bacteria 3176
460 Ga0207686_10131598 3300025934 Bacteria 1716
461 Ga0207670_10055422 3300025936 Bacteria 2679
462 Ga0207670_10076591 3300025936 Bacteria 2328
463 Ga0207669_10061180 3300025937 Bacteria 2313
464 Ga0207704_10061292 3300025938 Bacteria 2332
465 Ga0207665_10039567 3300025939 Bacteria 3144
466 Ga0207691_10000234 3300025940 Bacteria 54055
467 Ga0207691_10015441 3300025940 Bacteria 7262
468 Ga0207691_10024604 3300025940 Bacteria 5663
469 Ga0207691_10055070 3300025940 Bacteria 3627
470 Ga0207691_10076955 3300025940 Bacteria 3006
471 Ga0207691_10152709 3300025940 Bacteria 2029
472 Ga0207691_10164640 3300025940 Bacteria 1944
473 Ga0207691_10178365 3300025940 Bacteria 1857
474 Ga0207711_10045385 3300025941 Bacteria 3756
475 Ga0207689_10001731 3300025942 Bacteria 20624
476 Ga0207689_10002903 3300025942 Bacteria 15819
477 Ga0207689_10009247 3300025942 Bacteria 8520
478 Ga0207689_10009943 3300025942 Bacteria 8205
479 Ga0207689_10013291 3300025942 Bacteria 7022
480 Ga0207689_10022012 3300025942 Bacteria 5360
481 Ga0207689_10076912 3300025942 Bacteria 2744
482 Ga0207661_10008794 3300025944 Bacteria 7226
483 Ga0207661_10011866 3300025944 Bacteria 6329
484 Ga0207661_10053266 3300025944 Bacteria 3237
485 Ga0207661_10094061 3300025944 Bacteria 2503
486 Ga0207661_10121104 3300025944 Bacteria 2228
487 Ga0207679_10002212 3300025945 Bacteria 12010
488 Ga0207679_10005363 3300025945 Bacteria 8038
489 Ga0207679_10011951 3300025945 Bacteria 5642
490 Ga0207679_10026650 3300025945 Bacteria 3988
491 Ga0207679_10033867 3300025945 Bacteria 3598
492 Ga0207667_10001836 3300025949 Bacteria 26673
493 Ga0207667_10001839 3300025949 Bacteria 26648
494 Ga0207667_10009289 3300025949 Bacteria 11600
495 Ga0207667_10009325 3300025949 Bacteria 11574
496 Ga0207667_10009593 3300025949 Bacteria 11391
497 Ga0207667_10124347 3300025949 Bacteria 2657
498 Ga0207667_10157962 3300025949 Bacteria 2333
499 Ga0207651_10034033 3300025960 Bacteria 3294
500 Ga0207651_10035779 3300025960 Bacteria 3234
501 Ga0207712_10001902 3300025961 Bacteria 13729
502 Ga0207712_10005835 3300025961 Bacteria 7759
503 Ga0207712_10008201 3300025961 Bacteria 6603
504 Ga0207712_10018213 3300025961 Bacteria 4571
505 Ga0207712_10044296 3300025961 Bacteria 3074
506 Ga0207668_10000432 3300025972 Bacteria 26449
507 Ga0207668_10046555 3300025972 Bacteria 2964
508 Ga0207668_10082096 3300025972 Bacteria 2340
509 Ga0207640_10099570 3300025981 Bacteria 2035
510 Ga0207658_10024873 3300025986 Bacteria 4189
511 Ga0207658_10036299 3300025986 Bacteria 3533
512 Ga0207658_10048778 3300025986 Bacteria 3107
513 Ga0207658_10083697 3300025986 Bacteria 2453
514 Ga0207677_10010228 3300026023 Bacteria 5302
515 Ga0207677_10036891 3300026023 Bacteria 3190
516 Ga0207677_10042459 3300026023 Bacteria 3015
517 Ga0207677_10186850 3300026023 Bacteria 1635
518 Ga0207703_10013593 3300026035 Bacteria 6344
519 Ga0207703_10150063 3300026035 Bacteria 2031
520 Ga0207639_10003843 3300026041 Bacteria 10119
521 Ga0207639_10012382 3300026041 Bacteria 5939
522 Ga0207639_10063591 3300026041 Bacteria 2858
523 Ga0207639_10067763 3300026041 Bacteria 2778
524 Ga0207639_10075856 3300026041 Bacteria 2646
525 Ga0207639_10081919 3300026041 Bacteria 2557
526 Ga0207639_10150960 3300026041 Bacteria 1946
527 Ga0207678_10038315 3300026067 Bacteria 4165
528 Ga0207702_10028372 3300026078 Bacteria 4652
529 Ga0207702_10040370 3300026078 Bacteria 3913
530 Ga0207702_10053768 3300026078 Bacteria 3410
531 Ga0207641_10000026 3300026088 Bacteria 245091
532 Ga0207641_10000422 3300026088 Bacteria 49394
533 Ga0207641_10060156 3300026088 Bacteria 3237
534 Ga0207641_10270577 3300026088 Bacteria 1594
535 Ga0207641_10276628 3300026088 Bacteria 1577
536 Ga0207648_10000768 3300026089 Bacteria 36105
537 Ga0207648_10003325 3300026089 Bacteria 16891
538 Ga0207648_10015205 3300026089 Bacteria 7082
539 Ga0207648_10029956 3300026089 Bacteria 4827
540 Ga0207648_10047742 3300026089 Bacteria 3751
541 Ga0207648_10049961 3300026089 Bacteria 3658
542 Ga0207648_10106411 3300026089 Bacteria 2461
543 Ga0207648_10125080 3300026089 Bacteria 2261
544 Ga0207676_10003977 3300026095 Bacteria 10429
545 Ga0207676_10063950 3300026095 Bacteria 2923
546 Ga0207676_10083732 3300026095 Bacteria 2598
547 Ga0207674_10001969 3300026116 Bacteria 26000
548 Ga0207674_10015924 3300026116 Bacteria 8239
549 Ga0207674_10022101 3300026116 Bacteria 6837
550 Ga0207674_10042154 3300026116 Bacteria 4716
551 Ga0207674_10091641 3300026116 Bacteria 3029
552 Ga0207674_10118979 3300026116 Bacteria 2611
553 Ga0207674_10137700 3300026116 Unclassified 2402
554 Ga0207674_10184078 3300026116 Bacteria 2039
555 Ga0207675_100000144 3300026118 Bacteria 61517
556 Ga0207675_100020719 3300026118 Bacteria 6130
557 Ga0207675_100022457 3300026118 Bacteria 5876
558 Ga0207675_100025828 3300026118 Bacteria 5464
559 Ga0207683_10017481 3300026121 Bacteria 6112
560 Ga0207683_10084988 3300026121 Bacteria 2813
561 Ga0207683_10130854 3300026121 Bacteria 2257
562 Ga0207698_10039715 3300026142 Bacteria 3489
563 Ga0207698_10054329 3300026142 Bacteria 3081
564 Ga0207698_10071168 3300026142 Bacteria 2759
565 Ga0207698_10103946 3300026142 Bacteria 2362
566 Ga0207698_10154109 3300026142 Bacteria 1999
567 Ga0207698_10194199 3300026142 Bacteria 1812
568 Ga0207428_10031022 3300027907 Bacteria 4415
569 Ga0268266_10000169 3300028379 Bacteria 119437
570 Ga0268265_10006981 3300028380 Bacteria 7639
571 Ga0268265_10011311 3300028380 Bacteria 6034
572 Ga0268265_10073664 3300028380 Bacteria 2668
573 Ga0268265_10084602 3300028380 Bacteria 2515
574 Ga0268264_10000063 3300028381 Bacteria 301702
575 Ga0268264_10001719 3300028381 Bacteria 20165
576 Ga0268264_10001931 3300028381 Bacteria 18678
577 Ga0268264_10018882 3300028381 Bacteria 5637
578 Ga0268264_10026822 3300028381 Bacteria 4707
579 Ga0268264_10074753 3300028381 Bacteria 2879
580 Ga0307517_10000487 3300028786 Bacteria 68165
581 Ga0307515_10000001 3300028794 Bacteria 4259510
582 Ga0307515_10000031 3300028794 Bacteria 358648
583 Ga0307511_10000409 3300030521 Bacteria 45829
584 Ga0316177_1169895 3300030731 Bacteria 24080
585 Ga0316183_1210954 3300030742 Bacteria 30051
586 Ga0316181_1117584 3300030744 Bacteria 7603
587 Ga0265327_10000022 3300031251 Bacteria 402724
588 Ga0265327_10000024 3300031251 Bacteria 382499
589 Ga0265327_10000098 3300031251 Bacteria 190693
590 Ga0265327_10000115 3300031251 Bacteria 173854
591 Ga0265327_10010626 3300031251 Bacteria 6445
592 Ga0265327_10033672 3300031251 Bacteria 2852
593 Ga0307509_10125570 3300031507 Bacteria 2532
594 Ga0307408_100013503 3300031548 Bacteria 5422
595 Ga0307508_10000990 3300031616 Bacteria 33005
596 Ga0316575_10045977 3300031665 Bacteria 1733
597 Ga0316579_10000254 3300031691 Bacteria 16325
598 Ga0316579_10029177 3300031691 Bacteria 2516
599 Ga0265314_10013970 3300031711 Bacteria 6456
600 Ga0316576_10000606 3300031727 Bacteria 17198
601 Ga0316576_10014694 3300031727 Bacteria 5235
602 Ga0316576_10115726 3300031727 Bacteria 2012
603 Ga0316578_10000170 3300031728 Bacteria 17695
604 Ga0316578_10006539 3300031728 Bacteria 5763
605 Ga0316578_10013340 3300031728 Bacteria 4357
606 Ga0316578_10022524 3300031728 Bacteria 3513
607 Ga0316578_10048839 3300031728 Bacteria 2472
608 Ga0307516_10000384 3300031730 Bacteria 57633
609 Ga0316577_10000544 3300031733 Bacteria 15259
610 Ga0316577_10007819 3300031733 Bacteria 5711
611 Ga0307413_10003715 3300031824 Bacteria 6491
612 Ga0307413_10091415 3300031824 Bacteria 1983
613 Ga0307410_10006996 3300031852 Bacteria 6139
614 Ga0307410_10009417 3300031852 Bacteria 5478
615 Ga0307416_100013580 3300032002 Bacteria 5543
616 Ga0307416_100034718 3300032002 Bacteria 3842
617 Ga0307414_10000265 3300032004 Bacteria 32893
618 Ga0307414_10001628 3300032004 Bacteria 11692
619 Ga0307414_10006160 3300032004 Bacteria 6666
620 Ga0307414_10030112 3300032004 Bacteria 3542
621 Ga0307415_100001814 3300032126 Bacteria 10459
622 Ga0316585_10000090 3300032137 Bacteria 15919
623 Ga0316585_10001471 3300032137 Bacteria 6234
624 Ga0316585_10005628 3300032137 Bacteria 3544
625 Ga0316580_10000022 3300032139 Bacteria 24359
626 Ga0316580_10023244 3300032139 Bacteria 1914
627 Ga0316593_10007337 3300032168 Bacteria 3024
628 Ga0307507_10077837 3300033179 Bacteria 2945
629 Ga0316592_1001868 3300033524 Bacteria 3524
630 Ga0316596_1001179 3300033541 Bacteria 5140
631 Ga0316574_0000475 3300035398 Bacteria 16212
632 Ga0373937_0066181 3300036401 Bacteria 3327
633 Ga0373937_0090256 3300036401 Bacteria 2838
634 Ga0373937_0162063 3300036401 Bacteria 2097
635 Ga0316582_0000433 3300036647 Bacteria 15355
636 Ga0316582_0006556 3300036647 Bacteria 6127
637 Ga0316582_0014502 3300036647 Bacteria 4473
638 Ga0316582_0164071 3300036647 Bacteria 1506
639 Ga0316584_0000285 3300036712 Bacteria 25979
640 Ga0316584_0007080 3300036712 Bacteria 7642
641 Ga0316584_0058296 3300036712 Bacteria 2891
642 Ga0316584_0134144 3300036712 Bacteria 1849
643 Ga0395899_0015284 3300037312 Bacteria 5849
644 Ga0395899_0135775 3300037312 Bacteria 1753
645 Ga0395900_0008860 3300037418 Bacteria 10332
646 Ga0395900_0012723 3300037418 Bacteria 8600
647 Ga0395900_0018392 3300037418 Bacteria 7126
648 Ga0395900_0038660 3300037418 Bacteria 4918
649 Ga0395900_0142031 3300037418 Bacteria 2458
650 Ga0395900_0154886 3300037418 Bacteria 2340
651 Ga0395898_0007992 3300037466 Bacteria 11222
652 Ga0395898_0011506 3300037466 Bacteria 9188
653 Ga0395898_0018041 3300037466 Bacteria 7199
654 Ga0395898_0050747 3300037466 Bacteria 4059
655 Ga0395898_0080524 3300037466 Bacteria 3140
656 Ga0395905_0000001 3300037471 Bacteria 2037079
657 Ga0395905_0026934 3300037471 Bacteria 5421
658 Ga0395905_0075898 3300037471 Bacteria 3150
659 Ga0395905_0142123 3300037471 Bacteria 2258
660 Ga0316581_0000064 3300037588 Bacteria 12767
661 Ga0395901_0002694 3300038443 Bacteria 17900
662 Ga0395901_0004549 3300038443 Bacteria 13997
663 Ga0395901_0005612 3300038443 Bacteria 12699
664 Ga0395901_0014329 3300038443 Bacteria 8074
665 Ga0395901_0130252 3300038443 Bacteria 2643
666 Ga0395901_0145178 3300038443 Bacteria 2494
667 Ga0400484_39394 3300038725 Bacteria 11243
668 Ga0400490_23680 3300038726 Bacteria 4839
669 Ga0400486_05096 3300038742 Bacteria 1674
670 Ga0436365_1933142 3300039437 Bacteria 64226
671 Ga0439465_0023158 3300041413 Bacteria 1954
672 Ga0451849_1391693 3300041505 Bacteria 1468
673 Ga0451853_2497079 3300041512 Bacteria 2586
674 Ga0439431_0006689 3300041997 Bacteria 2556
675 Ga0439431_0009752 3300041997 Bacteria 2172
676 Ga0439449_0049712 3300042007 Bacteria 1551
677 Ga0439434_0012643 3300042435 Bacteria 2498
678 Ga0451577_0088718 3300042876 Unclassified 2759
679 Ga0451577_0097971 3300042876 Bacteria 2619
680 Ga0466972_0000001 3300044658 Bacteria 412457
681 Ga0466972_0000009 3300044658 Bacteria 256374
682 Ga0466972_0016018 3300044658 Bacteria 3747
683 Ga0466972_0044812 3300044658 Bacteria 2144
684 Ga0466966_0007506 3300044684 Bacteria 7221
685 Ga0453684_0000310 3300044712 Bacteria 206883
686 Ga0453684_0010921 3300044712 Bacteria 15366
687 Ga0453684_0070018 3300044712 Bacteria 4445
688 Ga0453684_0087334 3300044712 Bacteria 3865
689 Ga0466971_0011942 3300044719 Bacteria 3805
690 Ga0466968_0030723 3300044735 Bacteria 2226
691 Ga0466970_0014643 3300044765 Bacteria 4028
692 Ga0466957_0000378 3300044842 Bacteria 21778
693 Ga0466957_0016025 3300044842 Bacteria 4381
694 Ga0466960_0089080 3300044901 Bacteria 1570
695 Ga0466959_0000003 3300045049 Bacteria 285164
696 Ga0451576_0006077 3300045051 Bacteria 14888
697 Ga0451576_0009193 3300045051 Bacteria 11482
698 Ga0451576_0101877 3300045051 Bacteria 2986
699 Ga0451576_0239037 3300045051 Bacteria 1897
700 Ga0466967_0210447 3300045976 Bacteria 1844
701 Ga0495627_002110 3300046453 Bacteria 10063
702 Ga0495592_0023551 3300046454 Bacteria 4684
703 Ga0495650_0041526 3300046471 Bacteria 1966
704 Ga0495594_0022025 3300046499 Bacteria 3407
705 Ga0495630_0065621 3300046517 Unclassified 2728
706 Ga0495648_0017034 3300046524 Bacteria 5214
707 Ga0495640_0125217 3300046533 Bacteria 1667
708 Ga0495645_0062993 3300046543 Unclassified 2686
709 Ga0495633_0000133 3300046558 Bacteria 100207
710 Ga0495668_0000082 3300046616 Bacteria 154982
711 Ga0495668_0000419 3300046616 Bacteria 55322
712 Ga0495668_0004630 3300046616 Bacteria 9663
713 Ga0495611_0000061 3300046648 Bacteria 77533
714 Ga0495658_0040755 3300046683 Unclassified 2583
715 Ga0495670_0016896 3300046691 Bacteria 3587
716 Ga0495636_0000022 3300047318 Bacteria 72235
717 Ga0495672_0015419 3300047320 Bacteria 5189
718 Ga0495672_0052004 3300047320 Bacteria 2409
719 Ga0495687_001475 3300047443 Bacteria 21512
720 Ga0495675_0087728 3300047444 Unclassified 1955
721 Ga0495686_0000010 3300047472 Bacteria 573229
722 Ga0495686_0000230 3300047472 Bacteria 102747
723 Ga0495686_0044521 3300047472 Bacteria 2810
724 Ga0495686_0119367 3300047472 Bacteria 1573
725 Ga0496104_0230964 3300048907 Bacteria 1762
726 Ga0496105_0098991 3300048908 Bacteria 2408
727 Ga0496109_0139217 3300048912 Bacteria 2269
728 Ga0496115_0011125 3300048918 Bacteria 6742
729 Ga0496115_0084779 3300048918 Bacteria 2584
730 Ga0496121_0000086 3300048924 Bacteria 223703
731 Ga0496126_0015448 3300048929 Bacteria 7678
732 Ga0501292_004534 3300049515 Bacteria 1903
733 Ga0501031_0028370 3300049568 Bacteria 3648
734 Ga0501033_0054738 3300049570 Bacteria 2951
735 Ga0501033_0073860 3300049570 Bacteria 2504
736 Ga0501034_0000152 3300049571 Bacteria 130576
737 Ga0501034_0007368 3300049571 Bacteria 11721
738 Ga0501034_0017493 3300049571 Bacteria 7352
739 Ga0501034_0023796 3300049571 Bacteria 6237
740 Ga0501034_0058492 3300049571 Bacteria 3874
741 Ga0501034_0149415 3300049571 Bacteria 2312
742 Ga0501034_0333117 3300049571 Bacteria 1449
743 Ga0501036_0001672 3300049572 Bacteria 17196
744 Ga0501043_0021684 3300049579 Bacteria 5036
745 Ga0501043_0031114 3300049579 Bacteria 4196
746 Ga0501046_0060233 3300049580 Bacteria 2971
747 Ga0501046_0068687 3300049580 Bacteria 2757
748 Ga0501047_0037558 3300049581 Bacteria 4683
749 Ga0501068_0025540 3300049584 Bacteria 3475
750 Ga0501073_0008525 3300049589 Bacteria 7599
751 Ga0501073_0062855 3300049589 Bacteria 2589
752 Ga0501074_0004127 3300049590 Bacteria 10369
753 Ga0501077_0038341 3300049593 Bacteria 3051
754 Ga0501198_000923 3300049649 Bacteria 3704
755 Ga0501201_002174 3300049651 Bacteria 1797
756 Ga0501202_000366 3300049652 Bacteria 6277
757 Ga0501202_000861 3300049652 Bacteria 4615
758 Ga0501206_001276 3300049653 Bacteria 3151
759 Ga0501207_000033 3300049654 Bacteria 9861
760 Ga0501217_000032 3300049661 Bacteria 15163
761 Ga0501222_001790 3300049662 Bacteria 2977
762 Ga0501223_001089 3300049663 Bacteria 6399
763 Ga0501224_000552 3300049664 Bacteria 4600
764 Ga0501224_001773 3300049664 Bacteria 2904
765 Ga0501233_000698 3300049668 Bacteria 5540
766 Ga0501235_001149 3300049669 Bacteria 5562
767 Ga0501243_001994 3300049675 Bacteria 2968
768 Ga0501252_000123 3300049682 Bacteria 4539
769 Ga0501259_000354 3300049688 Bacteria 7179
770 Ga0501219_000135 3300049703 Bacteria 13063
771 Ga0501221_000193 3300049704 Bacteria 8546
772 Ga0501221_003634 3300049704 Bacteria 2541
773 Ga0501221_011529 3300049704 Bacteria 1593
774 Ga0501225_0003023 3300049705 Bacteria 5136
775 Ga0501225_0008552 3300049705 Bacteria 2933
776 Ga0501234_000488 3300049707 Bacteria 6078
777 Ga0501245_000726 3300049708 Bacteria 4079
778 Ga0501245_001563 3300049708 Bacteria 2979
779 Ga0501080_0098250 3300049742 Bacteria 2718
780 Ga0501266_000438 3300049763 Bacteria 5487
781 Ga0501035_0006854 3300049822 Bacteria 10640
782 Ga0501035_0093095 3300049822 Bacteria 2652
783 Ga0501044_0036368 3300049823 Bacteria 5152
784 Ga0501044_0047734 3300049823 Bacteria 4428
785 Ga0501284_00001 3300050005 Bacteria 261916
786 nmdc:mga0k408_109559_c1 3300050493 Bacteria 1632
787 nmdc:mga0k408_111924_c1 3300050493 Bacteria 1614
788 nmdc:mga0k408_22621_c1 3300050493 Bacteria 3540
789 nmdc:mga0k408_3446_c2 3300050493 Bacteria 6350
790 nmdc:mga05p37_135272_c1 3300050507 Bacteria 3023
791 nmdc:mga05p37_1394_c1 3300050507 Bacteria 28114
792 nmdc:mga09592_14999_c1 3300050508 Bacteria 6330
793 nmdc:mga09592_85275_c1 3300050508 Bacteria 2695
794 nmdc:mga0qj67_7275_c1 3300050509 Bacteria 8178
795 nmdc:mga06r32_24207_c1 3300050510 Bacteria 5631
796 nmdc:mga06r32_29407_c1 3300050510 Bacteria 5149
797 nmdc:mga08y16_18928_c1 3300050511 Bacteria 7251
798 nmdc:mga08y16_86406_c1 3300050511 Bacteria 3268
799 Ga0495619_0090403 3300053085 Bacteria 2073
800 Ga0500578_0000920 3300053086 Bacteria 33032
801 Ga0500644_0000280 3300053088 Bacteria 28313
802 Ga0500646_0006025 3300053090 Bacteria 3076
803 Ga0500583_0002427 3300053092 Bacteria 5600
804 Ga0500583_0006290 3300053092 Bacteria 4071
805 Ga0500562_000024 3300053108 Bacteria 105996
806 Ga0500642_0003936 3300053130 Bacteria 4578
807 Ga0500561_0001063 3300053137 Bacteria 4414
808 Ga0500568_0004057 3300053139 Bacteria 7928
809 Ga0500577_0000645 3300053142 Bacteria 8942
810 Ga0500604_0000475 3300053151 Bacteria 11057
811 Ga0500616_0001228 3300053153 Bacteria 25762
812 Ga0500616_0002857 3300053153 Bacteria 13857
813 Ga0500622_0000157 3300053156 Bacteria 71381
814 Ga0500622_0000353 3300053156 Bacteria 44849
815 Ga0500622_0002409 3300053156 Bacteria 13517
816 Ga0500627_0020614 3300053158 Bacteria 2646
817 Ga0500633_0001976 3300053160 Bacteria 4078
818 Ga0500637_0013682 3300053178 Bacteria 4263
819 Ga0500611_000001 3300053727 Bacteria 385744
820 Ga0501084_0012779 3300054114 Bacteria 6957
821 Ga0500661_001032 3300055283 Bacteria 5252
822 Ga0466962_0006769 3300061719 Bacteria 5499

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036712 Ga0316584_0134144 Ga0316584_0134144_20_1243 398
2 3300046533 Ga0495640_0125217 Ga0495640_0125217_368_1630 410
3 3300041505 Ga0451849_1391693 Ga0451849_1391693_16_1278 417
4 3300036647 Ga0316582_0014502 Ga0316582_0014502_3126_4424 426
5 3300031691 Ga0316579_10029177 Ga0316579_100291772 427
6 3300036647 Ga0316582_0006556 Ga0316582_0006556_547_2016 427
7 3300036712 Ga0316584_0058296 Ga0316584_0058296_597_2066 430
8 3300032137 Ga0316585_10001471 Ga0316585_100014712 435
9 3300032139 Ga0316580_10023244 Ga0316580_100232441 435
10 3300044901 Ga0466960_0089080 Ga0466960_0089080_23_1369 444
11 3300025938 Ga0207704_10061292 Ga0207704_100612921 446
12 3300037418 Ga0395900_0012723 Ga0395900_0012723_2279_3682 446
13 3300037466 Ga0395898_0050747 Ga0395898_0050747_563_1966 446
14 3300038443 Ga0395901_0002694 Ga0395901_0002694_6845_8248 446
15 3300005331 Ga0070670_100071766 Ga0070670_1000717662 447
16 3300032002 Ga0307416_100013580 Ga0307416_1000135802 449
17 3300038725 Ga0400484_39394 Ga0400484_39394_132_1574 449
18 3300038726 Ga0400490_23680 Ga0400490_23680_2198_3640 449
19 3300044658 Ga0466972_0000001 Ga0466972_0000001_177600_179033 449
20 3300044765 Ga0466970_0014643 Ga0466970_0014643_1976_3409 449
21 3300005518 Ga0070699_100048813 Ga0070699_1000488132 451
22 3300038443 Ga0395901_0130252 Ga0395901_0130252_164_1555 451
23 3300037418 Ga0395900_0018392 Ga0395900_0018392_3612_5015 454
24 3300037471 Ga0395905_0026934 Ga0395905_0026934_2730_4133 454
25 3300038443 Ga0395901_0014329 Ga0395901_0014329_805_2208 454
26 3300041997 Ga0439431_0009752 Ga0439431_0009752_688_2064 454
27 3300036647 Ga0316582_0164071 Ga0316582_0164071_56_1444 456
28 3300009545 Ga0105237_10173320 Ga0105237_101733202 460
29 3300038742 Ga0400486_05096 Ga0400486_05096_11_1453 461
30 3300049704 Ga0501221_011529 Ga0501221_011529_113_1576 461
31 3300049571 Ga0501034_0333117 Ga0501034_0333117_26_1435 462
32 3300025932 Ga0207690_10100658 Ga0207690_101006582 463
33 3300005340 Ga0070689_100018308 Ga0070689_1000183085 464
34 3300025936 Ga0207670_10076591 Ga0207670_100765912 464
35 3300047318 Ga0495636_0000022 Ga0495636_0000022_29512_30906 464
36 3300009545 Ga0105237_10040928 Ga0105237_100409282 467
37 3300025940 Ga0207691_10164640 Ga0207691_101646401 467
38 3300031548 Ga0307408_100013503 Ga0307408_1000135034 467
39 3300031824 Ga0307413_10003715 Ga0307413_100037156 467
40 3300031852 Ga0307410_10006996 Ga0307410_100069961 467
41 3300032002 Ga0307416_100034718 Ga0307416_1000347183 467
42 3300032126 Ga0307415_100001814 Ga0307415_1000018144 467
43 3300044658 Ga0466972_0016018 Ga0466972_0016018_1014_2447 467
44 3300044735 Ga0466968_0030723 Ga0466968_0030723_382_1815 467
45 3300049651 Ga0501201_002174 Ga0501201_002174_71_1570 467
46 3300049652 Ga0501202_000366 Ga0501202_000366_256_1755 467
47 3300049664 Ga0501224_000552 Ga0501224_000552_642_2141 467
48 3300049675 Ga0501243_001994 Ga0501243_001994_82_1581 467
49 3300049704 Ga0501221_003634 Ga0501221_003634_334_1833 467
50 3300049705 Ga0501225_0008552 Ga0501225_0008552_430_1929 467
51 3300049708 Ga0501245_001563 Ga0501245_001563_1300_2799 467
52 3300053142 Ga0500577_0000645 Ga0500577_0000645_7450_8868 467
53 3300009093 Ga0105240_10003432 Ga0105240_1000343222 468
54 3300009553 Ga0105249_10042876 Ga0105249_100428765 468
55 3300013306 Ga0163162_10009682 Ga0163162_100096825 468
56 3300025284 Ga0209130_1001858 Ga0209130_10018583 468
57 3300025302 Ga0207426_1000033 Ga0207426_100003383 468
58 3300025913 Ga0207695_10001383 Ga0207695_1000138329 468
59 3300025913 Ga0207695_10181482 Ga0207695_101814821 468
60 3300041997 Ga0439431_0006689 Ga0439431_0006689_1022_2446 468
61 3300042007 Ga0439449_0049712 Ga0439449_0049712_44_1468 468
62 3300047472 Ga0495686_0000010 Ga0495686_0000010_506035_507471 468
63 3300047472 Ga0495686_0119367 Ga0495686_0119367_62_1498 468
64 3300048929 Ga0496126_0015448 Ga0496126_0015448_5852_7273 468
65 3300050493 nmdc:mga0k408_109559_c1 nmdc:mga0k408_109559_c1_193_1608 468
66 3300050511 nmdc:mga08y16_86406_c1 nmdc:mga08y16_86406_c1_593_2008 468
67 3300053156 Ga0500622_0000157 Ga0500622_0000157_24984_26408 468
68 3300005336 Ga0070680_100058207 Ga0070680_1000582073 469
69 3300005530 Ga0070679_100000908 Ga0070679_10000090817 469
70 3300010375 Ga0105239_10000488 Ga0105239_1000048837 469
71 3300025909 Ga0207705_10107177 Ga0207705_101071772 469
72 3300025919 Ga0207657_10079840 Ga0207657_100798402 469
73 3300025921 Ga0207652_10027902 Ga0207652_100279021 469
74 3300009093 Ga0105240_10003002 Ga0105240_100030023 471
75 3300009545 Ga0105237_10141893 Ga0105237_101418931 471
76 3300025913 Ga0207695_10001317 Ga0207695_1000131712 471
77 3300031665 Ga0316575_10045977 Ga0316575_100459771 471
78 3300031691 Ga0316579_10000254 Ga0316579_100002549 471
79 3300031727 Ga0316576_10000606 Ga0316576_100006069 471
80 3300031727 Ga0316576_10014694 Ga0316576_100146943 471
81 3300031728 Ga0316578_10000170 Ga0316578_1000017010 471
82 3300031728 Ga0316578_10022524 Ga0316578_100225243 471
83 3300031733 Ga0316577_10000544 Ga0316577_1000054410 471
84 3300032137 Ga0316585_10000090 Ga0316585_100000908 471
85 3300032139 Ga0316580_10000022 Ga0316580_100000228 471
86 3300032168 Ga0316593_10007337 Ga0316593_100073372 471
87 3300033524 Ga0316592_1001868 Ga0316592_10018682 471
88 3300033541 Ga0316596_1001179 Ga0316596_10011794 471
89 3300035398 Ga0316574_0000475 Ga0316574_0000475_4362_5804 471
90 3300036647 Ga0316582_0000433 Ga0316582_0000433_8848_10290 471
91 3300036712 Ga0316584_0000285 Ga0316584_0000285_7185_8627 471
92 3300037588 Ga0316581_0000064 Ga0316581_0000064_10770_12212 471
93 3300006847 Ga0075431_100008461 Ga0075431_1000084613 472
94 3300009147 Ga0114129_10028251 Ga0114129_100282515 472
95 3300031251 Ga0265327_10010626 Ga0265327_100106266 472
96 3300044712 Ga0453684_0070018 Ga0453684_0070018_2231_3727 472
97 3300044712 Ga0453684_0087334 Ga0453684_0087334_260_1729 472
98 3300045051 Ga0451576_0239037 Ga0451576_0239037_167_1636 472
99 3300050507 nmdc:mga05p37_135272_c1 nmdc:mga05p37_135272_c1_1275_2720 472
100 3300050510 nmdc:mga06r32_24207_c1 nmdc:mga06r32_24207_c1_2912_4357 472
101 3300005337 Ga0070682_100000012 Ga0070682_100000012201 475
102 3300036401 Ga0373937_0066181 Ga0373937_0066181_32_1492 476
103 3300025940 Ga0207691_10152709 Ga0207691_101527092 478
104 3300028794 Ga0307515_10000031 Ga0307515_1000003146 478
105 3300005335 Ga0070666_10033872 Ga0070666_100338722 479
106 3300005544 Ga0070686_100079981 Ga0070686_1000799812 479
107 3300013306 Ga0163162_10188543 Ga0163162_101885432 479
108 3300025909 Ga0207705_10032789 Ga0207705_100327892 479
109 3300026023 Ga0207677_10036891 Ga0207677_100368912 479
110 3300013100 Ga0157373_10077004 Ga0157373_100770042 480
111 3300013102 Ga0157371_10123275 Ga0157371_101232752 480
112 3300037471 Ga0395905_0142123 Ga0395905_0142123_529_2025 480
113 3300046454 Ga0495592_0023551 Ga0495592_0023551_1083_2564 480
114 3300013307 Ga0157372_10025595 Ga0157372_100255958 481
115 3300025908 Ga0207643_10039838 Ga0207643_100398382 481
116 3300025939 Ga0207665_10039567 Ga0207665_100395672 481
117 3300032004 Ga0307414_10030112 Ga0307414_100301122 481
118 3300042876 Ga0451577_0088718 Ga0451577_0088718_1017_2489 481
119 3300044712 Ga0453684_0000310 Ga0453684_0000310_156776_158248 481
120 3300047320 Ga0495672_0015419 Ga0495672_0015419_980_2473 481
121 iso_pu_bacteria 2738541284 2738762007 481
122 iso_pu_bacteria 2738541302 2738854277 481
123 iso_pu_bacteria 2739367651 2739587381 481
124 iso_pu_bacteria 2739367656 2739614459 481
125 iso_pu_bacteria 2739367663 2739646575 481
126 iso_pu_bacteria 2775506987 2776615348 481
127 iso_pu_bacteria 2818991437 2819550223 481
128 iso_pu_bacteria 2842722452 2842726829 481
129 iso_pu_bacteria 2842903701 2842904907 481
130 iso_pu_bacteria 2842909656 2842911668 481
131 iso_pu_bacteria 2849281842 2849285068 481
132 iso_pu_bacteria 2852627209 2852628920 481
133 iso_pu_bacteria 2857627736 2857632591 481
134 iso_pu_bacteria 2902048731 2902050894 481
135 iso_pu_bacteria 2904445276 2904448882 481
136 iso_pu_bacteria 2919186247 2919188973 481
137 iso_pu_bacteria 2939664404 2939666872 481
138 iso_pu_bacteria 2945997725 2946002853 481
139 iso_pu_bacteria 2954016120 2954019716 481
140 3300031727 Ga0316576_10115726 Ga0316576_101157262 482
141 3300031728 Ga0316578_10006539 Ga0316578_100065395 482
142 3300031728 Ga0316578_10013340 Ga0316578_100133402 482
143 3300031728 Ga0316578_10048839 Ga0316578_100488392 482
144 3300031733 Ga0316577_10007819 Ga0316577_100078194 482
145 3300031824 Ga0307413_10091415 Ga0307413_100914152 482
146 3300032137 Ga0316585_10005628 Ga0316585_100056281 482
147 3300036712 Ga0316584_0007080 Ga0316584_0007080_2838_4307 482
148 3300042876 Ga0451577_0097971 Ga0451577_0097971_782_2251 482
149 3300044712 Ga0453684_0010921 Ga0453684_0010921_7082_8551 482
150 3300045051 Ga0451576_0006077 Ga0451576_0006077_8077_9546 482
151 3300045051 Ga0451576_0009193 Ga0451576_0009193_3346_4815 482
152 iso_pu_bacteria 3003233435 3003236954 482
153 3300045051 Ga0451576_0101877 Ga0451576_0101877_1133_2599 483
154 iso_pu_bacteria 2890737413 2890738020 483
155 iso_pu_bacteria 2896317667 2896321101 483
156 iso_pu_bacteria 2898713307 2898713591 483
157 3300005614 Ga0068856_100057374 Ga0068856_1000573743 484
158 3300013307 Ga0157372_10062158 Ga0157372_100621583 484
159 3300014326 Ga0157380_10000358 Ga0157380_1000035813 484
160 3300014497 Ga0182008_10032437 Ga0182008_100324372 484
161 3300026078 Ga0207702_10040370 Ga0207702_100403703 484
162 3300030731 Ga0316177_1169895 Ga0316177_11698957 484
163 3300030742 Ga0316183_1210954 Ga0316183_12109542 484
164 3300030744 Ga0316181_1117584 Ga0316181_11175843 484
165 3300032004 Ga0307414_10000265 Ga0307414_1000026511 484
166 3300032004 Ga0307414_10006160 Ga0307414_100061601 484
167 3300049570 Ga0501033_0073860 Ga0501033_0073860_1001_2461 484
168 3300005616 Ga0068852_100021900 Ga0068852_1000219005 485
169 iso_pu_bacteria 2739367866 2740031603 485
170 3300003322 rootL2_10005908 rootL2_100059081 486
171 3300015261 Ga0182006_1007082 Ga0182006_10070824 486
172 3300037471 Ga0395905_0000001 Ga0395905_0000001_868628_870112 486
173 3300006844 Ga0075428_100038397 Ga0075428_1000383976 487
174 3300006846 Ga0075430_100044628 Ga0075430_1000446284 487
175 3300006847 Ga0075431_100067224 Ga0075431_1000672244 487
176 3300009147 Ga0114129_10115042 Ga0114129_101150421 487
177 3300050508 nmdc:mga09592_85275_c1 nmdc:mga09592_85275_c1_295_1800 487
178 3300050509 nmdc:mga0qj67_7275_c1 nmdc:mga0qj67_7275_c1_43_1548 487
179 iso_pu_bacteria 2839989709 2839991706 488
180 iso_pu_bacteria 2910245624 2910246108 488
181 3300028794 Ga0307515_10000001 Ga0307515_100000012893 489
182 iso_pu_bacteria 2818991442 2819574847 489
183 iso_pu_bacteria 2821136567 2821140946 489
184 iso_pu_bacteria 2904467357 2904471446 489
185 3300005719 Ga0068861_100094417 Ga0068861_1000944173 490
186 3300005841 Ga0068863_100018993 Ga0068863_1000189932 490
187 3300006237 Ga0097621_100024637 Ga0097621_1000246373 490
188 3300013297 Ga0157378_10082331 Ga0157378_100823312 490
189 3300025942 Ga0207689_10009247 Ga0207689_100092474 490
190 3300026118 Ga0207675_100025828 Ga0207675_1000258282 490
191 3300046471 Ga0495650_0041526 Ga0495650_0041526_66_1616 490
192 3300049571 Ga0501034_0000152 Ga0501034_0000152_48405_49898 490
193 3300049652 Ga0501202_000861 Ga0501202_000861_216_1709 490
194 3300049653 Ga0501206_001276 Ga0501206_001276_852_2345 490
195 3300049664 Ga0501224_001773 Ga0501224_001773_1015_2508 490
196 3300049688 Ga0501259_000354 Ga0501259_000354_3837_5330 490
197 3300049708 Ga0501245_000726 Ga0501245_000726_849_2342 490
198 iso_pu_bacteria 2818991460 2819676773 490
199 iso_pu_bacteria 2840677318 2840678917 490
200 iso_pu_bacteria 2883068021 2883070411 490
201 iso_pu_bacteria 2884791551 2884796630 490
202 iso_pu_bacteria 2896085136 2896086732 490
203 iso_pu_bacteria 2896109856 2896112929 490
204 iso_pu_bacteria 2929177148 2929177845 490
205 iso_pu_bacteria 2929239360 2929240200 490
206 iso_pu_bacteria 2929921140 2929921928 490
207 iso_pu_bacteria 2945977869 2945980195 490
208 iso_pu_bacteria 2946013367 2946013941 490
209 iso_pu_bacteria 8003151029 8003155849 490
210 3300002077 JGI24744J21845_10002391 JGI24744J21845_100023916 491
211 3300003316 rootH1_10036148 rootH1_100361481 491
212 3300013307 Ga0157372_10187581 Ga0157372_101875812 491
213 3300046616 Ga0495668_0000082 Ga0495668_0000082_49301_50785 491
214 3300049515 Ga0501292_004534 Ga0501292_004534_254_1753 491
215 3300049649 Ga0501198_000923 Ga0501198_000923_707_2206 491
216 3300049654 Ga0501207_000033 Ga0501207_000033_6280_7779 491
217 3300049661 Ga0501217_000032 Ga0501217_000032_1993_3492 491
218 3300049662 Ga0501222_001790 Ga0501222_001790_92_1591 491
219 3300049663 Ga0501223_001089 Ga0501223_001089_1962_3461 491
220 3300049668 Ga0501233_000698 Ga0501233_000698_2305_3804 491
221 3300049669 Ga0501235_001149 Ga0501235_001149_1768_3267 491
222 3300049682 Ga0501252_000123 Ga0501252_000123_632_2131 491
223 3300049704 Ga0501221_000193 Ga0501221_000193_4019_5518 491
224 3300049705 Ga0501225_0003023 Ga0501225_0003023_1069_2568 491
225 3300049707 Ga0501234_000488 Ga0501234_000488_97_1596 491
226 iso_pu_bacteria 2914759650 2914763271 491
227 iso_pu_bacteria 2929154850 2929159277 491
228 3300005331 Ga0070670_100180796 Ga0070670_1001807961 492
229 3300005334 Ga0068869_100011463 Ga0068869_1000114633 492
230 3300005336 Ga0070680_100012373 Ga0070680_1000123732 492
231 3300005337 Ga0070682_100009425 Ga0070682_1000094255 492
232 3300005338 Ga0068868_100175865 Ga0068868_1001758651 492
233 3300005339 Ga0070660_100024047 Ga0070660_1000240472 492
234 3300005366 Ga0070659_100007270 Ga0070659_1000072702 492
235 3300005366 Ga0070659_100030890 Ga0070659_1000308902 492
236 3300005530 Ga0070679_100000174 Ga0070679_10000017439 492
237 3300005530 Ga0070679_100070447 Ga0070679_1000704472 492
238 3300005535 Ga0070684_100004375 Ga0070684_1000043757 492
239 3300005539 Ga0068853_100004391 Ga0068853_1000043919 492
240 3300005539 Ga0068853_100012524 Ga0068853_1000125244 492
241 3300005539 Ga0068853_100025540 Ga0068853_1000255402 492
242 3300005563 Ga0068855_100001122 Ga0068855_10000112213 492
243 3300005563 Ga0068855_100019121 Ga0068855_1000191218 492
244 3300005563 Ga0068855_100083156 Ga0068855_1000831563 492
245 3300005564 Ga0070664_100002301 Ga0070664_1000023017 492
246 3300005614 Ga0068856_100079488 Ga0068856_1000794884 492
247 3300005616 Ga0068852_100000706 Ga0068852_10000070610 492
248 3300005616 Ga0068852_100065192 Ga0068852_1000651923 492
249 3300005617 Ga0068859_100112370 Ga0068859_1001123702 492
250 3300005834 Ga0068851_10021134 Ga0068851_100211342 492
251 3300005843 Ga0068860_100002264 Ga0068860_1000022644 492
252 3300005844 Ga0068862_100002255 Ga0068862_10000225512 492
253 3300005844 Ga0068862_100071433 Ga0068862_1000714333 492
254 3300006931 Ga0097620_100112367 Ga0097620_1001123672 492
255 3300009093 Ga0105240_10000664 Ga0105240_100006644 492
256 3300009093 Ga0105240_10034353 Ga0105240_100343536 492
257 3300009101 Ga0105247_10016750 Ga0105247_100167502 492
258 3300009174 Ga0105241_10000543 Ga0105241_100005437 492
259 3300009174 Ga0105241_10006184 Ga0105241_100061844 492
260 3300009545 Ga0105237_10032931 Ga0105237_100329314 492
261 3300010375 Ga0105239_10009963 Ga0105239_100099638 492
262 3300010375 Ga0105239_10030991 Ga0105239_100309915 492
263 3300013100 Ga0157373_10002582 Ga0157373_100025823 492
264 3300013100 Ga0157373_10006643 Ga0157373_100066432 492
265 3300013100 Ga0157373_10008723 Ga0157373_100087237 492
266 3300013100 Ga0157373_10031516 Ga0157373_100315163 492
267 3300013102 Ga0157371_10002131 Ga0157371_100021316 492
268 3300013102 Ga0157371_10003413 Ga0157371_100034133 492
269 3300013102 Ga0157371_10004222 Ga0157371_100042229 492
270 3300013102 Ga0157371_10005032 Ga0157371_100050322 492
271 3300013102 Ga0157371_10005838 Ga0157371_100058382 492
272 3300013102 Ga0157371_10018901 Ga0157371_100189014 492
273 3300013102 Ga0157371_10020420 Ga0157371_100204201 492
274 3300013102 Ga0157371_10021501 Ga0157371_100215015 492
275 3300013102 Ga0157371_10078366 Ga0157371_100783662 492
276 3300013104 Ga0157370_10000945 Ga0157370_100009457 492
277 3300013104 Ga0157370_10001848 Ga0157370_100018485 492
278 3300013104 Ga0157370_10183259 Ga0157370_101832591 492
279 3300013105 Ga0157369_10036810 Ga0157369_100368103 492
280 3300013296 Ga0157374_10028110 Ga0157374_100281103 492
281 3300013307 Ga0157372_10011748 Ga0157372_100117486 492
282 3300013307 Ga0157372_10022870 Ga0157372_100228702 492
283 3300013307 Ga0157372_10034861 Ga0157372_100348611 492
284 3300013307 Ga0157372_10133588 Ga0157372_101335883 492
285 3300013307 Ga0157372_10253229 Ga0157372_102532291 492
286 3300014325 Ga0163163_10022474 Ga0163163_100224747 492
287 3300021384 Ga0213876_10000885 Ga0213876_1000088519 492
288 3300025321 Ga0207656_10013289 Ga0207656_100132892 492
289 3300025900 Ga0207710_10001920 Ga0207710_100019207 492
290 3300025904 Ga0207647_10000131 Ga0207647_1000013156 492
291 3300025909 Ga0207705_10005067 Ga0207705_100050671 492
292 3300025909 Ga0207705_10053943 Ga0207705_100539433 492
293 3300025909 Ga0207705_10141297 Ga0207705_101412971 492
294 3300025913 Ga0207695_10017403 Ga0207695_100174034 492
295 3300025913 Ga0207695_10021984 Ga0207695_100219846 492
296 3300025917 Ga0207660_10157829 Ga0207660_101578291 492
297 3300025920 Ga0207649_10073468 Ga0207649_100734682 492
298 3300025921 Ga0207652_10000035 Ga0207652_1000003569 492
299 3300025921 Ga0207652_10000132 Ga0207652_1000013212 492
300 3300025921 Ga0207652_10021939 Ga0207652_100219392 492
301 3300025921 Ga0207652_10038378 Ga0207652_100383781 492
302 3300025921 Ga0207652_10090593 Ga0207652_100905932 492
303 3300025925 Ga0207650_10000813 Ga0207650_1000081319 492
304 3300025932 Ga0207690_10002315 Ga0207690_100023152 492
305 3300025942 Ga0207689_10013291 Ga0207689_100132915 492
306 3300025944 Ga0207661_10121104 Ga0207661_101211042 492
307 3300025945 Ga0207679_10011951 Ga0207679_100119512 492
308 3300025949 Ga0207667_10001836 Ga0207667_1000183615 492
309 3300025949 Ga0207667_10009593 Ga0207667_100095933 492
310 3300025949 Ga0207667_10124347 Ga0207667_101243471 492
311 3300026041 Ga0207639_10003843 Ga0207639_100038437 492
312 3300026041 Ga0207639_10067763 Ga0207639_100677631 492
313 3300026078 Ga0207702_10053768 Ga0207702_100537682 492
314 3300026116 Ga0207674_10137700 Ga0207674_101377002 492
315 3300026142 Ga0207698_10039715 Ga0207698_100397153 492
316 3300026142 Ga0207698_10054329 Ga0207698_100543293 492
317 3300026142 Ga0207698_10154109 Ga0207698_101541091 492
318 3300028380 Ga0268265_10011311 Ga0268265_100113114 492
319 3300028381 Ga0268264_10018882 Ga0268264_100188824 492
320 3300031711 Ga0265314_10013970 Ga0265314_100139704 492
321 3300037312 Ga0395899_0015284 Ga0395899_0015284_2750_4237 492
322 3300037312 Ga0395899_0135775 Ga0395899_0135775_72_1559 492
323 3300037418 Ga0395900_0008860 Ga0395900_0008860_886_2373 492
324 3300037418 Ga0395900_0038660 Ga0395900_0038660_2256_3743 492
325 3300037418 Ga0395900_0154886 Ga0395900_0154886_186_1673 492
326 3300037466 Ga0395898_0007992 Ga0395898_0007992_8292_9779 492
327 3300037466 Ga0395898_0011506 Ga0395898_0011506_7338_8825 492
328 3300037466 Ga0395898_0018041 Ga0395898_0018041_675_2162 492
329 3300037466 Ga0395898_0080524 Ga0395898_0080524_1383_2870 492
330 3300037471 Ga0395905_0075898 Ga0395905_0075898_667_2154 492
331 3300038443 Ga0395901_0004549 Ga0395901_0004549_9756_11243 492
332 3300038443 Ga0395901_0005612 Ga0395901_0005612_8797_10284 492
333 3300038443 Ga0395901_0145178 Ga0395901_0145178_574_2061 492
334 3300039437 Ga0436365_1933142 Ga0436365_1933142_15693_17195 492
335 3300047320 Ga0495672_0052004 Ga0495672_0052004_588_2075 492
336 3300049823 Ga0501044_0036368 Ga0501044_0036368_2190_3677 492
337 iso_pu_bacteria 2738541278 2738725081 492
338 iso_pu_bacteria 2818991444 2819585955 492
339 3300005289 Ga0065704_10104076 Ga0065704_101040762 493
340 3300005328 Ga0070676_10000167 Ga0070676_100001672 493
341 3300005329 Ga0070683_100134817 Ga0070683_1001348172 493
342 3300005331 Ga0070670_100073374 Ga0070670_1000733742 493
343 3300005335 Ga0070666_10000512 Ga0070666_1000051215 493
344 3300005335 Ga0070666_10009089 Ga0070666_100090893 493
345 3300005336 Ga0070680_100043915 Ga0070680_1000439152 493
346 3300005336 Ga0070680_100060917 Ga0070680_1000609172 493
347 3300005337 Ga0070682_100005414 Ga0070682_1000054145 493
348 3300005338 Ga0068868_100108198 Ga0068868_1001081982 493
349 3300005339 Ga0070660_100000295 Ga0070660_10000029535 493
350 3300005339 Ga0070660_100005708 Ga0070660_1000057082 493
351 3300005344 Ga0070661_100009290 Ga0070661_1000092902 493
352 3300005347 Ga0070668_100000736 Ga0070668_10000073624 493
353 3300005354 Ga0070675_100002115 Ga0070675_10000211511 493
354 3300005356 Ga0070674_100016973 Ga0070674_1000169733 493
355 3300005364 Ga0070673_100077212 Ga0070673_1000772122 493
356 3300005367 Ga0070667_100002471 Ga0070667_10000247118 493
357 3300005457 Ga0070662_100024116 Ga0070662_1000241163 493
358 3300005458 Ga0070681_10137639 Ga0070681_101376392 493
359 3300005459 Ga0068867_100000714 Ga0068867_10000071420 493
360 3300005530 Ga0070679_100016542 Ga0070679_1000165425 493
361 3300005539 Ga0068853_100016332 Ga0068853_1000163323 493
362 3300005539 Ga0068853_100028674 Ga0068853_1000286742 493
363 3300005543 Ga0070672_100060446 Ga0070672_1000604462 493
364 3300005547 Ga0070693_100040142 Ga0070693_1000401422 493
365 3300005548 Ga0070665_100000002 Ga0070665_100000002674 493
366 3300005548 Ga0070665_100003228 Ga0070665_1000032285 493
367 3300005577 Ga0068857_100234524 Ga0068857_1002345241 493
368 3300005578 Ga0068854_100016442 Ga0068854_1000164422 493
369 3300005578 Ga0068854_100123263 Ga0068854_1001232631 493
370 3300005616 Ga0068852_100000391 Ga0068852_1000003911 493
371 3300005616 Ga0068852_100008114 Ga0068852_1000081142 493
372 3300005616 Ga0068852_100053313 Ga0068852_1000533132 493
373 3300005617 Ga0068859_100014150 Ga0068859_1000141509 493
374 3300005618 Ga0068864_100004147 Ga0068864_1000041479 493
375 3300005841 Ga0068863_100007919 Ga0068863_1000079193 493
376 3300005842 Ga0068858_100004188 Ga0068858_1000041882 493
377 3300005842 Ga0068858_100221747 Ga0068858_1002217472 493
378 3300005843 Ga0068860_100000003 Ga0068860_100000003293 493
379 3300005843 Ga0068860_100010703 Ga0068860_1000107036 493
380 3300005843 Ga0068860_100033177 Ga0068860_1000331773 493
381 3300006237 Ga0097621_100003013 Ga0097621_10000301311 493
382 3300006237 Ga0097621_100003397 Ga0097621_1000033977 493
383 3300006358 Ga0068871_100099703 Ga0068871_1000997032 493
384 3300006931 Ga0097620_100014150 Ga0097620_1000141509 493
385 3300009093 Ga0105240_10006894 Ga0105240_100068949 493
386 3300009093 Ga0105240_10012199 Ga0105240_100121998 493
387 3300009093 Ga0105240_10028575 Ga0105240_100285754 493
388 3300009093 Ga0105240_10032147 Ga0105240_100321475 493
389 3300009093 Ga0105240_10069783 Ga0105240_100697833 493
390 3300009098 Ga0105245_10095714 Ga0105245_100957142 493
391 3300009101 Ga0105247_10072797 Ga0105247_100727972 493
392 3300009174 Ga0105241_10016655 Ga0105241_100166554 493
393 3300009174 Ga0105241_10126068 Ga0105241_101260681 493
394 3300009545 Ga0105237_10000144 Ga0105237_1000014458 493
395 3300009545 Ga0105237_10015222 Ga0105237_100152222 493
396 3300009545 Ga0105237_10034202 Ga0105237_100342024 493
397 3300009551 Ga0105238_10088408 Ga0105238_100884082 493
398 3300009553 Ga0105249_10011067 Ga0105249_100110673 493
399 3300010375 Ga0105239_10008508 Ga0105239_100085082 493
400 3300010375 Ga0105239_10174428 Ga0105239_101744282 493
401 3300013104 Ga0157370_10001484 Ga0157370_1000148412 493
402 3300013104 Ga0157370_10175507 Ga0157370_101755072 493
403 3300013296 Ga0157374_10021281 Ga0157374_100212816 493
404 3300013306 Ga0163162_10000725 Ga0163162_1000072522 493
405 3300013306 Ga0163162_10001229 Ga0163162_1000122923 493
406 3300013306 Ga0163162_10002095 Ga0163162_1000209518 493
407 3300013306 Ga0163162_10066875 Ga0163162_100668752 493
408 3300013307 Ga0157372_10000747 Ga0157372_1000074710 493
409 3300013307 Ga0157372_10017972 Ga0157372_100179726 493
410 3300013308 Ga0157375_10009510 Ga0157375_100095105 493
411 3300014325 Ga0163163_10000526 Ga0163163_1000052627 493
412 3300014968 Ga0157379_10001164 Ga0157379_100011647 493
413 3300014969 Ga0157376_10006585 Ga0157376_100065855 493
414 3300014969 Ga0157376_10025879 Ga0157376_100258793 493
415 3300014969 Ga0157376_10028697 Ga0157376_100286972 493
416 3300015265 Ga0182005_1000043 Ga0182005_100004378 493
417 3300025208 Ga0209436_106139 Ga0209436_1061392 493
418 3300025242 Ga0209258_100032 Ga0209258_100032396 493
419 3300025254 Ga0209148_1000131 Ga0209148_100013198 493
420 3300025321 Ga0207656_10000333 Ga0207656_100003335 493
421 3300025907 Ga0207645_10007440 Ga0207645_100074406 493
422 3300025911 Ga0207654_10124553 Ga0207654_101245531 493
423 3300025912 Ga0207707_10024994 Ga0207707_100249943 493
424 3300025912 Ga0207707_10092500 Ga0207707_100925003 493
425 3300025913 Ga0207695_10032855 Ga0207695_100328555 493
426 3300025913 Ga0207695_10203740 Ga0207695_102037402 493
427 3300025914 Ga0207671_10006294 Ga0207671_100062947 493
428 3300025914 Ga0207671_10008066 Ga0207671_100080664 493
429 3300025917 Ga0207660_10008378 Ga0207660_100083784 493
430 3300025919 Ga0207657_10002329 Ga0207657_1000232912 493
431 3300025919 Ga0207657_10002631 Ga0207657_1000263110 493
432 3300025921 Ga0207652_10022399 Ga0207652_100223992 493
433 3300025925 Ga0207650_10054602 Ga0207650_100546022 493
434 3300025927 Ga0207687_10122252 Ga0207687_101222522 493
435 3300025932 Ga0207690_10047766 Ga0207690_100477662 493
436 3300025937 Ga0207669_10061180 Ga0207669_100611802 493
437 3300025940 Ga0207691_10000234 Ga0207691_1000023443 493
438 3300025940 Ga0207691_10024604 Ga0207691_100246044 493
439 3300025945 Ga0207679_10026650 Ga0207679_100266502 493
440 3300025949 Ga0207667_10001839 Ga0207667_1000183913 493
441 3300025949 Ga0207667_10157962 Ga0207667_101579622 493
442 3300025960 Ga0207651_10034033 Ga0207651_100340332 493
443 3300025961 Ga0207712_10005835 Ga0207712_100058356 493
444 3300025972 Ga0207668_10000432 Ga0207668_100004325 493
445 3300025981 Ga0207640_10099570 Ga0207640_100995702 493
446 3300025986 Ga0207658_10048778 Ga0207658_100487782 493
447 3300026023 Ga0207677_10010228 Ga0207677_100102285 493
448 3300026035 Ga0207703_10013593 Ga0207703_100135935 493
449 3300026041 Ga0207639_10081919 Ga0207639_100819192 493
450 3300026041 Ga0207639_10150960 Ga0207639_101509602 493
451 3300026088 Ga0207641_10276628 Ga0207641_102766281 493
452 3300026089 Ga0207648_10000768 Ga0207648_1000076833 493
453 3300026089 Ga0207648_10106411 Ga0207648_101064112 493
454 3300026095 Ga0207676_10063950 Ga0207676_100639502 493
455 3300026116 Ga0207674_10001969 Ga0207674_1000196917 493
456 3300026116 Ga0207674_10184078 Ga0207674_101840782 493
457 3300026121 Ga0207683_10017481 Ga0207683_100174812 493
458 3300026121 Ga0207683_10130854 Ga0207683_101308542 493
459 3300026142 Ga0207698_10071168 Ga0207698_100711682 493
460 3300026142 Ga0207698_10103946 Ga0207698_101039462 493
461 3300028379 Ga0268266_10000169 Ga0268266_1000016977 493
462 3300028381 Ga0268264_10000063 Ga0268264_10000063210 493
463 3300028381 Ga0268264_10001719 Ga0268264_100017195 493
464 3300028381 Ga0268264_10026822 Ga0268264_100268223 493
465 3300028786 Ga0307517_10000487 Ga0307517_100004873 493
466 3300030521 Ga0307511_10000409 Ga0307511_1000040928 493
467 3300031730 Ga0307516_10000384 Ga0307516_1000038411 493
468 3300036401 Ga0373937_0090256 Ga0373937_0090256_1133_2626 493
469 3300044842 Ga0466957_0016025 Ga0466957_0016025_384_1949 493
470 3300045976 Ga0466967_0210447 Ga0466967_0210447_324_1826 493
471 3300046524 Ga0495648_0017034 Ga0495648_0017034_1915_3411 493
472 3300046543 Ga0495645_0062993 Ga0495645_0062993_935_2425 493
473 3300046683 Ga0495658_0040755 Ga0495658_0040755_1045_2535 493
474 3300046691 Ga0495670_0016896 Ga0495670_0016896_184_1686 493
475 3300047443 Ga0495687_001475 Ga0495687_001475_2002_3498 493
476 3300048907 Ga0496104_0230964 Ga0496104_0230964_167_1657 493
477 3300048908 Ga0496105_0098991 Ga0496105_0098991_563_2053 493
478 3300048912 Ga0496109_0139217 Ga0496109_0139217_606_2096 493
479 3300048924 Ga0496121_0000086 Ga0496121_0000086_212056_213555 493
480 3300049571 Ga0501034_0058492 Ga0501034_0058492_257_1753 493
481 3300049589 Ga0501073_0062855 Ga0501073_0062855_515_2005 493
482 3300053085 Ga0495619_0090403 Ga0495619_0090403_467_1957 493
483 3300053088 Ga0500644_0000280 Ga0500644_0000280_14257_15753 493
484 3300053090 Ga0500646_0006025 Ga0500646_0006025_289_1779 493
485 3300053092 Ga0500583_0002427 Ga0500583_0002427_805_2301 493
486 3300053092 Ga0500583_0006290 Ga0500583_0006290_846_2339 493
487 3300053137 Ga0500561_0001063 Ga0500561_0001063_2756_4252 493
488 3300053156 Ga0500622_0002409 Ga0500622_0002409_3595_5091 493
489 3300053160 Ga0500633_0001976 Ga0500633_0001976_545_2041 493
490 3300053178 Ga0500637_0013682 Ga0500637_0013682_569_2059 493
491 3300054114 Ga0501084_0012779 Ga0501084_0012779_2880_4370 493
492 iso_pu_bacteria 2881955468 2881958326 493
493 2162886012 MBSR1b_contig_4329513 MBSR1b_0376.00005560 494
494 3300001989 JGI24739J22299_10000004 JGI24739J22299_1000000423 494
495 3300003215 JGI25153J46596_10000276 JGI25153J46596_1000027624 494
496 3300003320 rootH2_10043903 rootH2_1004390313 494
497 3300003323 rootH1_10007795 rootH1_1000779529 494
498 3300003354 JGI25160J50197_1005967 JGI25160J50197_10059674 494
499 3300003354 JGI25160J50197_1015689 JGI25160J50197_10156891 494
500 3300003790 Ga0055528_1000785 Ga0055528_10007859 494
501 3300003791 Ga0055530_10000102 Ga0055530_1000010220 494
502 3300003794 Ga0055531_10000173 Ga0055531_1000017364 494
503 3300003794 Ga0055531_10030395 Ga0055531_100303951 494
504 3300005262 Ga0065165_1000027 Ga0065165_100002723 494
505 3300005290 Ga0065712_10006895 Ga0065712_100068951 494
506 3300005290 Ga0065712_10083528 Ga0065712_100835281 494
507 3300005328 Ga0070676_10002364 Ga0070676_1000236410 494
508 3300005328 Ga0070676_10047244 Ga0070676_100472442 494
509 3300005329 Ga0070683_100039857 Ga0070683_1000398574 494
510 3300005329 Ga0070683_100128293 Ga0070683_1001282932 494
511 3300005331 Ga0070670_100024005 Ga0070670_1000240052 494
512 3300005331 Ga0070670_100028223 Ga0070670_1000282232 494
513 3300005331 Ga0070670_100049693 Ga0070670_1000496932 494
514 3300005334 Ga0068869_100004707 Ga0068869_1000047072 494
515 3300005334 Ga0068869_100005758 Ga0068869_1000057582 494
516 3300005334 Ga0068869_100100643 Ga0068869_1001006431 494
517 3300005334 Ga0068869_100100888 Ga0068869_1001008882 494
518 3300005335 Ga0070666_10044594 Ga0070666_100445941 494
519 3300005338 Ga0068868_100002356 Ga0068868_1000023563 494
520 3300005338 Ga0068868_100121563 Ga0068868_1001215632 494
521 3300005340 Ga0070689_100002022 Ga0070689_1000020226 494
522 3300005340 Ga0070689_100022450 Ga0070689_1000224505 494
523 3300005340 Ga0070689_100028005 Ga0070689_1000280052 494
524 3300005340 Ga0070689_100039902 Ga0070689_1000399022 494
525 3300005347 Ga0070668_100037275 Ga0070668_1000372752 494
526 3300005353 Ga0070669_100001547 Ga0070669_1000015473 494
527 3300005354 Ga0070675_100091999 Ga0070675_1000919992 494
528 3300005354 Ga0070675_100099032 Ga0070675_1000990322 494
529 3300005356 Ga0070674_100031799 Ga0070674_1000317992 494
530 3300005364 Ga0070673_100001051 Ga0070673_1000010512 494
531 3300005364 Ga0070673_100043716 Ga0070673_1000437162 494
532 3300005365 Ga0070688_100011565 Ga0070688_1000115653 494
533 3300005365 Ga0070688_100019853 Ga0070688_1000198533 494
534 3300005367 Ga0070667_100060084 Ga0070667_1000600843 494
535 3300005438 Ga0070701_10004865 Ga0070701_100048653 494
536 3300005459 Ga0068867_100033400 Ga0068867_1000334003 494
537 3300005459 Ga0068867_100049482 Ga0068867_1000494822 494
538 3300005459 Ga0068867_100103341 Ga0068867_1001033411 494
539 3300005459 Ga0068867_100119248 Ga0068867_1001192481 494
540 3300005471 Ga0070698_100004403 Ga0070698_1000044037 494
541 3300005471 Ga0070698_100013144 Ga0070698_1000131443 494
542 3300005471 Ga0070698_100013999 Ga0070698_1000139995 494
543 3300005535 Ga0070684_100003556 Ga0070684_1000035568 494
544 3300005535 Ga0070684_100010994 Ga0070684_1000109942 494
545 3300005539 Ga0068853_100004488 Ga0068853_1000044883 494
546 3300005539 Ga0068853_100009182 Ga0068853_1000091826 494
547 3300005543 Ga0070672_100042571 Ga0070672_1000425713 494
548 3300005548 Ga0070665_100091459 Ga0070665_1000914592 494
549 3300005563 Ga0068855_100026762 Ga0068855_1000267625 494
550 3300005564 Ga0070664_100047892 Ga0070664_1000478923 494
551 3300005577 Ga0068857_100036762 Ga0068857_1000367622 494
552 3300005577 Ga0068857_100054563 Ga0068857_1000545632 494
553 3300005577 Ga0068857_100101256 Ga0068857_1001012562 494
554 3300005578 Ga0068854_100060534 Ga0068854_1000605342 494
555 3300005617 Ga0068859_100004846 Ga0068859_1000048464 494
556 3300005617 Ga0068859_100090517 Ga0068859_1000905173 494
557 3300005719 Ga0068861_100005751 Ga0068861_1000057518 494
558 3300005719 Ga0068861_100061699 Ga0068861_1000616992 494
559 3300005840 Ga0068870_10009295 Ga0068870_100092952 494
560 3300005841 Ga0068863_100069003 Ga0068863_1000690033 494
561 3300005841 Ga0068863_100192024 Ga0068863_1001920242 494
562 3300005842 Ga0068858_100132931 Ga0068858_1001329311 494
563 3300005843 Ga0068860_100035838 Ga0068860_1000358385 494
564 3300005844 Ga0068862_100016622 Ga0068862_1000166227 494
565 3300005844 Ga0068862_100194413 Ga0068862_1001944132 494
566 3300005985 Ga0081539_10010380 Ga0081539_100103802 494
567 3300006195 Ga0075366_10004372 Ga0075366_100043726 494
568 3300006358 Ga0068871_100033509 Ga0068871_1000335093 494
569 3300006847 Ga0075431_100011173 Ga0075431_1000111739 494
570 3300006881 Ga0068865_100007946 Ga0068865_1000079465 494
571 3300006881 Ga0068865_100026788 Ga0068865_1000267883 494
572 3300006931 Ga0097620_100004846 Ga0097620_1000048464 494
573 3300006931 Ga0097620_100090518 Ga0097620_1000905183 494
574 3300009093 Ga0105240_10015806 Ga0105240_100158068 494
575 3300009094 Ga0111539_10002241 Ga0111539_1000224111 494
576 3300009147 Ga0114129_10011797 Ga0114129_100117974 494
577 3300009176 Ga0105242_10160235 Ga0105242_101602351 494
578 3300009177 Ga0105248_10110662 Ga0105248_101106622 494
579 3300009553 Ga0105249_10025790 Ga0105249_100257903 494
580 3300009553 Ga0105249_10116875 Ga0105249_101168752 494
581 3300010375 Ga0105239_10000925 Ga0105239_100009255 494
582 3300010375 Ga0105239_10183270 Ga0105239_101832701 494
583 3300011119 Ga0105246_10014719 Ga0105246_100147192 494
584 3300013104 Ga0157370_10048874 Ga0157370_100488743 494
585 3300013296 Ga0157374_10000013 Ga0157374_10000013360 494
586 3300013296 Ga0157374_10056656 Ga0157374_100566562 494
587 3300013296 Ga0157374_10204341 Ga0157374_102043412 494
588 3300013306 Ga0163162_10032847 Ga0163162_100328474 494
589 3300013306 Ga0163162_10078034 Ga0163162_100780342 494
590 3300013307 Ga0157372_10002589 Ga0157372_1000258914 494
591 3300013307 Ga0157372_10007573 Ga0157372_100075733 494
592 3300013307 Ga0157372_10009489 Ga0157372_100094899 494
593 3300013308 Ga0157375_10005771 Ga0157375_100057717 494
594 3300013308 Ga0157375_10011400 Ga0157375_100114004 494
595 3300013308 Ga0157375_10059483 Ga0157375_100594833 494
596 3300013308 Ga0157375_10200208 Ga0157375_102002081 494
597 3300014325 Ga0163163_10001180 Ga0163163_100011807 494
598 3300014325 Ga0163163_10175547 Ga0163163_101755471 494
599 3300014326 Ga0157380_10004013 Ga0157380_100040139 494
600 3300014745 Ga0157377_10002055 Ga0157377_100020557 494
601 3300014745 Ga0157377_10004188 Ga0157377_100041885 494
602 3300014745 Ga0157377_10009714 Ga0157377_100097142 494
603 3300014968 Ga0157379_10022586 Ga0157379_100225862 494
604 3300014968 Ga0157379_10125516 Ga0157379_101255162 494
605 3300014969 Ga0157376_10001116 Ga0157376_1000111611 494
606 3300014969 Ga0157376_10089346 Ga0157376_100893462 494
607 3300017792 Ga0163161_10039613 Ga0163161_100396132 494
608 3300017792 Ga0163161_10120223 Ga0163161_101202231 494
609 3300025246 Ga0209646_1000004 Ga0209646_1000004400 494
610 3300025250 Ga0209026_1000095 Ga0209026_10000958 494
611 3300025273 Ga0209673_1000078 Ga0209673_1000078124 494
612 3300025297 Ga0209758_1000834 Ga0209758_100083434 494
613 3300025297 Ga0209758_1008970 Ga0209758_10089705 494
614 3300025297 Ga0209758_1010247 Ga0209758_10102471 494
615 3300025298 Ga0209050_1000097 Ga0209050_1000097138 494
616 3300025302 Ga0207426_1000456 Ga0207426_100045612 494
617 3300025302 Ga0207426_1001120 Ga0207426_100112012 494
618 3300025304 Ga0209257_1000070 Ga0209257_1000070112 494
619 3300025304 Ga0209257_1001349 Ga0209257_100134925 494
620 3300025315 Ga0207697_10027713 Ga0207697_100277132 494
621 3300025315 Ga0207697_10029676 Ga0207697_100296762 494
622 3300025903 Ga0207680_10046689 Ga0207680_100466891 494
623 3300025904 Ga0207647_10047794 Ga0207647_100477942 494
624 3300025907 Ga0207645_10001118 Ga0207645_1000111816 494
625 3300025907 Ga0207645_10002926 Ga0207645_1000292610 494
626 3300025907 Ga0207645_10032122 Ga0207645_100321223 494
627 3300025908 Ga0207643_10017131 Ga0207643_100171314 494
628 3300025913 Ga0207695_10002258 Ga0207695_1000225816 494
629 3300025923 Ga0207681_10002654 Ga0207681_100026546 494
630 3300025925 Ga0207650_10007657 Ga0207650_100076571 494
631 3300025926 Ga0207659_10056737 Ga0207659_100567372 494
632 3300025926 Ga0207659_10086518 Ga0207659_100865181 494
633 3300025934 Ga0207686_10001307 Ga0207686_100013073 494
634 3300025934 Ga0207686_10030919 Ga0207686_100309192 494
635 3300025934 Ga0207686_10131598 Ga0207686_101315981 494
636 3300025936 Ga0207670_10055422 Ga0207670_100554223 494
637 3300025940 Ga0207691_10055070 Ga0207691_100550703 494
638 3300025940 Ga0207691_10178365 Ga0207691_101783651 494
639 3300025942 Ga0207689_10001731 Ga0207689_1000173113 494
640 3300025942 Ga0207689_10009943 Ga0207689_100099436 494
641 3300025942 Ga0207689_10076912 Ga0207689_100769122 494
642 3300025944 Ga0207661_10053266 Ga0207661_100532663 494
643 3300025944 Ga0207661_10094061 Ga0207661_100940612 494
644 3300025945 Ga0207679_10033867 Ga0207679_100338672 494
645 3300025949 Ga0207667_10009289 Ga0207667_100092896 494
646 3300025960 Ga0207651_10035779 Ga0207651_100357793 494
647 3300025961 Ga0207712_10018213 Ga0207712_100182133 494
648 3300025961 Ga0207712_10044296 Ga0207712_100442962 494
649 3300025972 Ga0207668_10082096 Ga0207668_100820962 494
650 3300025986 Ga0207658_10036299 Ga0207658_100362992 494
651 3300025986 Ga0207658_10083697 Ga0207658_100836972 494
652 3300026023 Ga0207677_10042459 Ga0207677_100424591 494
653 3300026041 Ga0207639_10063591 Ga0207639_100635913 494
654 3300026041 Ga0207639_10075856 Ga0207639_100758562 494
655 3300026067 Ga0207678_10038315 Ga0207678_100383153 494
656 3300026088 Ga0207641_10000422 Ga0207641_100004226 494
657 3300026088 Ga0207641_10270577 Ga0207641_102705771 494
658 3300026089 Ga0207648_10003325 Ga0207648_1000332512 494
659 3300026089 Ga0207648_10015205 Ga0207648_100152055 494
660 3300026089 Ga0207648_10047742 Ga0207648_100477422 494
661 3300026089 Ga0207648_10125080 Ga0207648_101250803 494
662 3300026116 Ga0207674_10015924 Ga0207674_100159241 494
663 3300026116 Ga0207674_10022101 Ga0207674_100221014 494
664 3300026116 Ga0207674_10091641 Ga0207674_100916412 494
665 3300026118 Ga0207675_100000144 Ga0207675_10000014411 494
666 3300026118 Ga0207675_100020719 Ga0207675_1000207195 494
667 3300027907 Ga0207428_10031022 Ga0207428_100310222 494
668 3300028380 Ga0268265_10006981 Ga0268265_100069817 494
669 3300028380 Ga0268265_10073664 Ga0268265_100736642 494
670 3300028381 Ga0268264_10074753 Ga0268264_100747532 494
671 3300031251 Ga0265327_10000024 Ga0265327_1000002449 494
672 3300036401 Ga0373937_0162063 Ga0373937_0162063_182_1675 494
673 3300037418 Ga0395900_0142031 Ga0395900_0142031_409_1905 494
674 3300041413 Ga0439465_0023158 Ga0439465_0023158_59_1549 494
675 3300042435 Ga0439434_0012643 Ga0439434_0012643_562_2064 494
676 3300044719 Ga0466971_0011942 Ga0466971_0011942_1424_2929 494
677 3300046453 Ga0495627_002110 Ga0495627_002110_5219_6718 494
678 3300046499 Ga0495594_0022025 Ga0495594_0022025_1592_3085 494
679 3300046517 Ga0495630_0065621 Ga0495630_0065621_722_2224 494
680 3300046558 Ga0495633_0000133 Ga0495633_0000133_38915_40414 494
681 3300047444 Ga0495675_0087728 Ga0495675_0087728_440_1942 494
682 3300047472 Ga0495686_0044521 Ga0495686_0044521_1077_2570 494
683 3300049568 Ga0501031_0028370 Ga0501031_0028370_438_1934 494
684 3300049572 Ga0501036_0001672 Ga0501036_0001672_3827_5320 494
685 3300049579 Ga0501043_0021684 Ga0501043_0021684_2493_3989 494
686 3300049579 Ga0501043_0031114 Ga0501043_0031114_1614_3107 494
687 3300049580 Ga0501046_0060233 Ga0501046_0060233_1306_2802 494
688 3300049580 Ga0501046_0068687 Ga0501046_0068687_175_1668 494
689 3300049593 Ga0501077_0038341 Ga0501077_0038341_466_1959 494
690 3300049763 Ga0501266_000438 Ga0501266_000438_3259_4767 494
691 3300050493 nmdc:mga0k408_3446_c2 nmdc:mga0k408_3446_c2_2599_4092 494
692 3300050510 nmdc:mga06r32_29407_c1 nmdc:mga06r32_29407_c1_2515_4008 494
693 3300050511 nmdc:mga08y16_18928_c1 nmdc:mga08y16_18928_c1_3438_4940 494
694 3300053139 Ga0500568_0004057 Ga0500568_0004057_1928_3415 494
695 3300053153 Ga0500616_0002857 Ga0500616_0002857_2499_3992 494
696 3300055283 Ga0500661_001032 Ga0500661_001032_2400_3899 494
697 3300061719 Ga0466962_0006769 Ga0466962_0006769_1081_2586 494
698 3300002459 JGI24751J29686_10001711 JGI24751J29686_100017114 495
699 3300003203 JGI25406J46586_10009223 JGI25406J46586_100092234 495
700 3300005329 Ga0070683_100038887 Ga0070683_1000388873 495
701 3300005334 Ga0068869_100011750 Ga0068869_1000117505 495
702 3300005335 Ga0070666_10000064 Ga0070666_1000006468 495
703 3300005367 Ga0070667_100035635 Ga0070667_1000356352 495
704 3300005539 Ga0068853_100166001 Ga0068853_1001660011 495
705 3300005543 Ga0070672_100053372 Ga0070672_1000533722 495
706 3300005617 Ga0068859_100000003 Ga0068859_100000003153 495
707 3300005618 Ga0068864_100006628 Ga0068864_1000066289 495
708 3300005618 Ga0068864_100097951 Ga0068864_1000979512 495
709 3300005834 Ga0068851_10010183 Ga0068851_100101834 495
710 3300005841 Ga0068863_100003550 Ga0068863_1000035505 495
711 3300005842 Ga0068858_100002928 Ga0068858_10000292813 495
712 3300005843 Ga0068860_100003019 Ga0068860_10000301911 495
713 3300005843 Ga0068860_100004200 Ga0068860_1000042008 495
714 3300005844 Ga0068862_100080426 Ga0068862_1000804262 495
715 3300005985 Ga0081539_10000042 Ga0081539_100000425 495
716 3300006237 Ga0097621_100005389 Ga0097621_1000053894 495
717 3300006358 Ga0068871_100043443 Ga0068871_1000434432 495
718 3300006931 Ga0097620_100000003 Ga0097620_100000003153 495
719 3300009093 Ga0105240_10000011 Ga0105240_10000011139 495
720 3300009174 Ga0105241_10002666 Ga0105241_100026668 495
721 3300009545 Ga0105237_10009785 Ga0105237_100097858 495
722 3300009545 Ga0105237_10034915 Ga0105237_100349152 495
723 3300009553 Ga0105249_10003454 Ga0105249_100034548 495
724 3300009553 Ga0105249_10021119 Ga0105249_100211195 495
725 3300010375 Ga0105239_10000122 Ga0105239_10000122104 495
726 3300010375 Ga0105239_10010365 Ga0105239_100103655 495
727 3300010375 Ga0105239_10021156 Ga0105239_100211567 495
728 3300010375 Ga0105239_10059960 Ga0105239_100599603 495
729 3300013105 Ga0157369_10218046 Ga0157369_102180462 495
730 3300013296 Ga0157374_10029675 Ga0157374_100296753 495
731 3300013306 Ga0163162_10014151 Ga0163162_100141512 495
732 3300013308 Ga0157375_10045028 Ga0157375_100450284 495
733 3300014325 Ga0163163_10039539 Ga0163163_100395392 495
734 3300025302 Ga0207426_1000105 Ga0207426_100010530 495
735 3300025321 Ga0207656_10005711 Ga0207656_100057111 495
736 3300025903 Ga0207680_10000388 Ga0207680_1000038811 495
737 3300025911 Ga0207654_10001481 Ga0207654_100014812 495
738 3300025913 Ga0207695_10000010 Ga0207695_10000010527 495
739 3300025914 Ga0207671_10001848 Ga0207671_1000184815 495
740 3300025931 Ga0207644_10032638 Ga0207644_100326382 495
741 3300025940 Ga0207691_10076955 Ga0207691_100769553 495
742 3300025942 Ga0207689_10002903 Ga0207689_1000290311 495
743 3300025944 Ga0207661_10011866 Ga0207661_100118664 495
744 3300025961 Ga0207712_10001902 Ga0207712_100019022 495
745 3300025961 Ga0207712_10008201 Ga0207712_100082015 495
746 3300025972 Ga0207668_10046555 Ga0207668_100465552 495
747 3300025986 Ga0207658_10024873 Ga0207658_100248733 495
748 3300026088 Ga0207641_10000026 Ga0207641_10000026138 495
749 3300026088 Ga0207641_10060156 Ga0207641_100601562 495
750 3300026089 Ga0207648_10049961 Ga0207648_100499613 495
751 3300026095 Ga0207676_10003977 Ga0207676_100039775 495
752 3300026095 Ga0207676_10083732 Ga0207676_100837322 495
753 3300026142 Ga0207698_10194199 Ga0207698_101941992 495
754 3300028380 Ga0268265_10084602 Ga0268265_100846022 495
755 3300028381 Ga0268264_10001931 Ga0268264_1000193118 495
756 3300031616 Ga0307508_10000990 Ga0307508_1000099025 495
757 3300031852 Ga0307410_10009417 Ga0307410_100094172 495
758 3300033179 Ga0307507_10077837 Ga0307507_100778372 495
759 3300049570 Ga0501033_0054738 Ga0501033_0054738_1164_2675 495
760 3300049571 Ga0501034_0007368 Ga0501034_0007368_4319_5830 495
761 3300049571 Ga0501034_0017493 Ga0501034_0017493_3886_5397 495
762 3300049742 Ga0501080_0098250 Ga0501080_0098250_1119_2630 495
763 3300049823 Ga0501044_0047734 Ga0501044_0047734_1196_2707 495
764 3300053108 Ga0500562_000024 Ga0500562_000024_71165_72673 495
765 3300053156 Ga0500622_0000353 Ga0500622_0000353_35089_36597 495
766 3300005329 Ga0070683_100006129 Ga0070683_1000061299 496
767 3300005337 Ga0070682_100052324 Ga0070682_1000523241 496
768 3300005343 Ga0070687_100015694 Ga0070687_1000156942 496
769 3300005344 Ga0070661_100000394 Ga0070661_1000003947 496
770 3300005354 Ga0070675_100032708 Ga0070675_1000327082 496
771 3300005355 Ga0070671_100079615 Ga0070671_1000796152 496
772 3300005366 Ga0070659_100005182 Ga0070659_1000051823 496
773 3300005535 Ga0070684_100000214 Ga0070684_1000002146 496
774 3300005539 Ga0068853_100004926 Ga0068853_1000049265 496
775 3300005564 Ga0070664_100008829 Ga0070664_1000088295 496
776 3300005577 Ga0068857_100008115 Ga0068857_1000081152 496
777 3300005842 Ga0068858_100115260 Ga0068858_1001152602 496
778 3300006358 Ga0068871_100209613 Ga0068871_1002096131 496
779 3300006844 Ga0075428_100014704 Ga0075428_1000147047 496
780 3300006846 Ga0075430_100109755 Ga0075430_1001097551 496
781 3300006880 Ga0075429_100001064 Ga0075429_10000106410 496
782 3300009176 Ga0105242_10073754 Ga0105242_100737542 496
783 3300013297 Ga0157378_10175329 Ga0157378_101753292 496
784 3300014745 Ga0157377_10016310 Ga0157377_100163102 496
785 3300025907 Ga0207645_10030160 Ga0207645_100301602 496
786 3300025920 Ga0207649_10004740 Ga0207649_100047403 496
787 3300025940 Ga0207691_10015441 Ga0207691_100154416 496
788 3300025942 Ga0207689_10022012 Ga0207689_100220125 496
789 3300025944 Ga0207661_10008794 Ga0207661_100087949 496
790 3300025945 Ga0207679_10002212 Ga0207679_100022127 496
791 3300025945 Ga0207679_10005363 Ga0207679_100053634 496
792 3300026023 Ga0207677_10186850 Ga0207677_101868501 496
793 3300026035 Ga0207703_10150063 Ga0207703_101500631 496
794 3300026041 Ga0207639_10012382 Ga0207639_100123823 496
795 3300026089 Ga0207648_10029956 Ga0207648_100299562 496
796 3300026116 Ga0207674_10118979 Ga0207674_101189792 496
797 3300026118 Ga0207675_100022457 Ga0207675_1000224573 496
798 3300031251 Ga0265327_10000115 Ga0265327_10000115133 496
799 3300031251 Ga0265327_10033672 Ga0265327_100336721 496
800 3300032004 Ga0307414_10001628 Ga0307414_100016289 496
801 3300041512 Ga0451853_2497079 Ga0451853_2497079_333_1829 496
802 3300044658 Ga0466972_0000009 Ga0466972_0000009_227040_228536 496
803 3300044658 Ga0466972_0044812 Ga0466972_0044812_27_1523 496
804 3300044684 Ga0466966_0007506 Ga0466966_0007506_2826_4325 496
805 3300044842 Ga0466957_0000378 Ga0466957_0000378_12035_13534 496
806 3300045049 Ga0466959_0000003 Ga0466959_0000003_230897_232396 496
807 3300048918 Ga0496115_0011125 Ga0496115_0011125_4826_6319 496
808 3300049571 Ga0501034_0023796 Ga0501034_0023796_2982_4496 496
809 3300049571 Ga0501034_0149415 Ga0501034_0149415_284_1786 496
810 3300049581 Ga0501047_0037558 Ga0501047_0037558_1826_3328 496
811 3300049584 Ga0501068_0025540 Ga0501068_0025540_1498_3012 496
812 3300049589 Ga0501073_0008525 Ga0501073_0008525_4801_6315 496
813 3300049590 Ga0501074_0004127 Ga0501074_0004127_1614_3128 496
814 3300049703 Ga0501219_000135 Ga0501219_000135_3171_4664 496
815 3300049822 Ga0501035_0006854 Ga0501035_0006854_9091_10605 496
816 3300050005 Ga0501284_00001 Ga0501284_00001_50548_52041 496
817 3300050493 nmdc:mga0k408_111924_c1 nmdc:mga0k408_111924_c1_23_1522 496
818 3300050493 nmdc:mga0k408_22621_c1 nmdc:mga0k408_22621_c1_788_2284 496
819 3300050507 nmdc:mga05p37_1394_c1 nmdc:mga05p37_1394_c1_11498_12997 496
820 3300050508 nmdc:mga09592_14999_c1 nmdc:mga09592_14999_c1_3851_5428 496
821 3300053086 Ga0500578_0000920 Ga0500578_0000920_11542_13038 496
822 3300053727 Ga0500611_000001 Ga0500611_000001_278096_279661 496
823 2162886007 SwRhRL2b_contig_577364 SwRhRL2b_0794.00000170 497
824 3300003320 rootH2_10006463 rootH2_1000646318 497
825 3300005289 Ga0065704_10070133 Ga0065704_10070133635 497
826 3300005289 Ga0065704_10077065 Ga0065704_100770653 497
827 3300005355 Ga0070671_100020931 Ga0070671_1000209315 497
828 3300005367 Ga0070667_100016043 Ga0070667_1000160434 497
829 3300005544 Ga0070686_100037082 Ga0070686_1000370822 497
830 3300005563 Ga0068855_100002019 Ga0068855_1000020199 497
831 3300006358 Ga0068871_100002146 Ga0068871_1000021465 497
832 3300009176 Ga0105242_10034224 Ga0105242_100342244 497
833 3300009177 Ga0105248_10036272 Ga0105248_100362723 497
834 3300009545 Ga0105237_10015997 Ga0105237_100159976 497
835 3300010375 Ga0105239_10001910 Ga0105239_1000191015 497
836 3300010375 Ga0105239_10346907 Ga0105239_103469071 497
837 3300013306 Ga0163162_10010213 Ga0163162_100102132 497
838 3300013306 Ga0163162_10230478 Ga0163162_102304781 497
839 3300013307 Ga0157372_10007754 Ga0157372_100077542 497
840 3300013308 Ga0157375_10000422 Ga0157375_100004228 497
841 3300014325 Ga0163163_10000952 Ga0163163_1000095220 497
842 3300014968 Ga0157379_10002405 Ga0157379_100024058 497
843 3300014968 Ga0157379_10072422 Ga0157379_100724223 497
844 3300014969 Ga0157376_10000878 Ga0157376_100008782 497
845 3300017792 Ga0163161_10002456 Ga0163161_100024567 497
846 3300025904 Ga0207647_10018700 Ga0207647_100187004 497
847 3300025913 Ga0207695_10008072 Ga0207695_100080728 497
848 3300025914 Ga0207671_10000126 Ga0207671_1000012625 497
849 3300025914 Ga0207671_10113076 Ga0207671_101130762 497
850 3300025931 Ga0207644_10009272 Ga0207644_100092726 497
851 3300025941 Ga0207711_10045385 Ga0207711_100453855 497
852 3300025949 Ga0207667_10009325 Ga0207667_100093259 497
853 3300026078 Ga0207702_10028372 Ga0207702_100283722 497
854 3300026116 Ga0207674_10042154 Ga0207674_100421543 497
855 3300026121 Ga0207683_10084988 Ga0207683_100849882 497
856 3300031251 Ga0265327_10000022 Ga0265327_1000002283 497
857 3300031251 Ga0265327_10000098 Ga0265327_1000009833 497
858 3300031507 Ga0307509_10125570 Ga0307509_101255702 497
859 3300046616 Ga0495668_0000419 Ga0495668_0000419_34508_36001 497
860 3300046616 Ga0495668_0004630 Ga0495668_0004630_7271_8773 497
861 3300046648 Ga0495611_0000061 Ga0495611_0000061_13432_14973 497
862 3300047472 Ga0495686_0000230 Ga0495686_0000230_89290_90783 497
863 3300048918 Ga0496115_0084779 Ga0496115_0084779_987_2480 497
864 3300049822 Ga0501035_0093095 Ga0501035_0093095_936_2429 497
865 3300053130 Ga0500642_0003936 Ga0500642_0003936_973_2466 497
866 3300053151 Ga0500604_0000475 Ga0500604_0000475_6881_8383 497
867 3300053153 Ga0500616_0001228 Ga0500616_0001228_11777_13270 497
868 3300053158 Ga0500627_0020614 Ga0500627_0020614_530_2023 497

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09190

DALR_2

DALR domain

439

501

0.95

PF01406

tRNA-synt_1e

tRNA synthetases class I (C) catalytic domain

79

401

0.92

PF09334

tRNA-synt_1g

tRNA synthetases class I (M)

92

228

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ujd-assembly1.cif.gz_A-2 crystal structure of cysteine-trna ligase from elizabethkingia sp. 0.9335 2 440
6ujd-assembly1.cif.gz_A-2 crystal structure of cysteine-trna ligase from elizabethkingia sp. 0.9313 2 440
8qhp-assembly1.cif.gz_B cysteine trna ligase homodimer 0.9301 2 435
3tqo-assembly1.cif.gz_A structure of the cysteinyl-trna synthetase (cyss) from coxiella burnetii. 0.925 1 443
3tqo-assembly1.cif.gz_A structure of the cysteinyl-trna synthetase (cyss) from coxiella burnetii. 0.9158 1 443
ID Description Score Start End Superfamily
af_Q2G2M6_1_304_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9598 4 329 3.40.50.620
af_Q2G2M6_1_304_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9536 4 329 3.40.50.620
3sp1A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9493 2 329 3.40.50.620
1li7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.947 19 329 3.40.50.620
3sp1A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9459 2 329 3.40.50.620
ID Description Score Start End GO Terms
AF-E1KPC7-F1-model_v4 Cysteine--tRNA ligase (EC 6.1.1.16) 0.9727 1 284 GO:0004817
GO:0005524
GO:0005829
GO:0006423
AF-A0A136LT41-F1-model_v4 Cysteinyl-tRNA synthetase (EC 6.1.1.16) 0.9725 2 282 GO:0004817
GO:0005524
GO:0005829
GO:0006423
AF-A0A3D1E653-F1-model_v4 Cysteine--tRNA ligase 0.9723 103 328 GO:0004817
GO:0005524
GO:0005829
GO:0006423
AF-A0A3D0FKY0-F1-model_v4 Cysteine--tRNA ligase (EC 6.1.1.16) 0.9689 4 315 GO:0004817
GO:0005524
GO:0005829
GO:0006423
AF-A0A7C6TTM2-F1-model_v4 Class I tRNA ligase family protein 0.9682 1 252 GO:0004817
GO:0005524
GO:0005829
GO:0006423

Feature Viewer

pLDDT pTM Quality
91.74 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map