F484071

General Info

Members Datasets Scaffolds Average Seq Length
868 448 1736 235

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10146194|Ga0070658_101461942
Length 261
Sequence MSSTLVASRTALPSEGEPTPVRGSGGSGAAEMLRIEGLNAWYGESHILHGVDLAVQEGEVVCLLGRNGAGRTTTLRAIVGLTGARKGSIRIRGQEAIRLPPHRVARLGVGYCPEERGIFSTLSAEENLRLPPVTAQGGMSIEEIYAMFPNLQERANSPGTRLSGGEQQMLAVARILRTGARLLLLDEISEGLAPVIVQKLAEMVTTLRAQGYTIVMVEQNFRFAAPLADRFLVMEHGQVIQHFTQAELPSKLATLHEYLGV

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
130 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
131 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
136 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
137 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
138 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
141 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
142 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
152 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
155 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
215 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
217 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
222 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
223 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
224 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
225 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
226 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
227 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
230 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
231 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
232 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
233 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
234 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
235 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
236 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
237 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
238 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
239 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
240 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
241 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
242 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
243 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
244 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
245 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
246 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
247 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
248 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
249 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
251 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
252 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
253 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
254 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
255 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
256 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
257 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
258 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
259 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
261 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
262 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
263 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
264 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
265 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
266 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
267 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
268 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
269 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
270 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
271 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
272 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
273 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
274 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
275 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
276 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
277 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
278 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
279 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
280 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
281 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
282 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
283 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
284 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
285 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
286 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
287 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
288 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
289 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
290 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
291 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
292 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
293 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
294 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
295 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
296 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
297 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
298 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
299 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
300 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
301 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
302 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
303 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
304 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
305 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
306 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
307 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
308 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
309 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
310 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
311 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
312 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
313 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
314 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
315 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
316 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
317 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
318 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
319 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
320 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
321 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
322 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
323 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
324 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
325 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
326 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
327 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
328 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
329 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
330 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
331 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
332 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
333 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
334 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
335 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
336 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
337 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
338 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
339 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
340 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
341 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
342 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
343 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
344 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
345 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
346 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
347 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
348 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
349 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
350 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
351 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
352 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
353 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
354 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
355 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
356 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
357 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
358 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
359 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
360 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
361 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
362 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
363 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
364 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
365 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
366 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
367 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
368 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
369 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
370 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
371 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
372 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
373 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
374 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
375 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
376 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
377 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
378 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
379 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
380 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
381 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
382 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
383 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
384 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
390 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
391 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
392 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
393 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
394 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
396 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
397 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
398 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
399 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
400 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
401 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
402 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
403 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
404 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
405 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
406 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
407 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
408 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
409 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
410 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
411 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
412 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
413 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
414 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
415 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
416 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
417 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
418 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
419 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
420 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
421 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
422 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
423 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
424 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
425 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
426 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
427 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
428 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
429 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
430 2511231021 Pseudomonas sp. GM78 Isolate Nodule
431 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
432 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
433 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
434 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
435 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
436 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
437 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
438 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
439 2738541277 Variovorax sp. GV051 Isolate Unclassified
440 2738543019 Variovorax sp. GV040 Isolate Unclassified
441 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
442 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
443 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
444 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
445 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
446 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
447 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
448 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.47
Metatranscriptomes 0.23
Isolates 2.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.66
Nodule 0.46
Rhizoplane 3.23
Rhizosphere 70.39
Stem 0
Stem Tuber 0
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10146194 3300005327 Bacteria 1977
2 LJNas_1012990 3300000546 Bacteria 887
3 JGI25155J39150_1000035 3300002704 Bacteria 99118
4 JGI25156J39149_1000012 3300002705 Bacteria 194393
5 JGI25154J39366_1000029 3300002738 Bacteria 194393
6 JGI25154J39366_1001259 3300002738 Bacteria 9494
7 JGI25157J39369_1000014 3300002741 Bacteria 194393
8 JGI25157J39369_1000179 3300002741 Bacteria 53655
9 JGI25159J45721_1000334 3300002987 Bacteria 21726
10 JGI25159J45721_1003179 3300002987 Bacteria 5896
11 JGI25151J46595_10008323 3300003187 Bacteria 4996
12 JGI25151J46595_10008820 3300003187 Bacteria 4819
13 JGI25160J50197_1000303 3300003354 Bacteria 34764
14 JGI25160J50197_1044611 3300003354 Bacteria 987
15 JGI25161J50226_1000094 3300003374 Bacteria 72451
16 Ga0055539_1000509 3300003752 Bacteria 11986
17 Ga0055539_1001998 3300003752 Bacteria 3362
18 Ga0055533_1000008 3300003756 Bacteria 575861
19 Ga0055535_1000346 3300003761 Bacteria 46216
20 Ga0055535_1000467 3300003761 Bacteria 37033
21 Ga0055535_1007880 3300003761 Bacteria 1978
22 Ga0055529_1000156 3300003763 Bacteria 93167
23 Ga0055526_1000854 3300003771 Bacteria 22695
24 Ga0055526_1004656 3300003771 Bacteria 8159
25 Ga0055537_1000092 3300003773 Bacteria 66301
26 Ga0055524_1000306 3300003775 Bacteria 46611
27 Ga0055536_1020051 3300003781 Bacteria 2078
28 Ga0055534_1006822 3300003784 Bacteria 2817
29 Ga0055528_1000480 3300003790 Bacteria 31747
30 Ga0055530_10000863 3300003791 Bacteria 24942
31 Ga0055540_1000449 3300003792 Bacteria 32166
32 Ga0055540_1006320 3300003792 Bacteria 4732
33 Ga0055531_10002683 3300003794 Bacteria 11722
34 Ga0055531_10002832 3300003794 Bacteria 11351
35 Ga0055543_1000780 3300004625 Bacteria 15806
36 Ga0065165_1001186 3300005262 Bacteria 30210
37 Ga0065714_10018971 3300005288 Bacteria 2440
38 Ga0065707_10176353 3300005295 Bacteria 1448
39 Ga0070658_10115923 3300005327 Bacteria 2222
40 Ga0070658_10589056 3300005327 Bacteria 963
41 Ga0070676_10006298 3300005328 Bacteria 6338
42 Ga0070683_100040327 3300005329 Bacteria 4293
43 Ga0070683_100065230 3300005329 Bacteria 3390
44 Ga0070690_100062871 3300005330 Bacteria 2394
45 Ga0070670_100040562 3300005331 Bacteria 4002
46 Ga0070670_100042619 3300005331 Bacteria 3902
47 Ga0070670_100409341 3300005331 Bacteria 1198
48 Ga0070670_100512908 3300005331 Bacteria 1067
49 Ga0070677_10067027 3300005333 Bacteria 1498
50 Ga0068869_100108125 3300005334 Bacteria 2112
51 Ga0070680_100462302 3300005336 Bacteria 1084
52 Ga0070682_100104091 3300005337 Bacteria 1879
53 Ga0068868_100011018 3300005338 Bacteria 6571
54 Ga0068868_100015797 3300005338 Bacteria 5593
55 Ga0068868_100555220 3300005338 Bacteria 1012
56 Ga0070660_100025973 3300005339 Bacteria 4358
57 Ga0070660_100061955 3300005339 Bacteria 2905
58 Ga0070660_100140920 3300005339 Bacteria 1934
59 Ga0070689_100128466 3300005340 Bacteria 2031
60 Ga0070661_100112646 3300005344 Bacteria 2032
61 Ga0070668_100004185 3300005347 Bacteria 10693
62 Ga0070669_100025707 3300005353 Bacteria 4229
63 Ga0070669_100455366 3300005353 Bacteria 1055
64 Ga0070675_100009133 3300005354 Bacteria 7700
65 Ga0070675_100080463 3300005354 Bacteria 2716
66 Ga0070671_100113696 3300005355 Bacteria 2275
67 Ga0070671_100531978 3300005355 Bacteria 1013
68 Ga0070674_100019585 3300005356 Bacteria 4302
69 Ga0070674_100088035 3300005356 Bacteria 2234
70 Ga0070674_100321063 3300005356 Bacteria 1241
71 Ga0070659_100067511 3300005366 Bacteria 2836
72 Ga0070659_100176025 3300005366 Bacteria 1754
73 Ga0070667_100260497 3300005367 Bacteria 1553
74 Ga0070701_10160769 3300005438 Bacteria 1301
75 Ga0070700_100020552 3300005441 Bacteria 3826
76 Ga0070694_100240688 3300005444 Bacteria 1365
77 Ga0070708_100246996 3300005445 Bacteria 1676
78 Ga0070663_100008867 3300005455 Bacteria 6208
79 Ga0070662_100004805 3300005457 Bacteria 8563
80 Ga0070662_100094281 3300005457 Bacteria 2253
81 Ga0070681_10031139 3300005458 Bacteria 5355
82 Ga0070681_10732200 3300005458 Bacteria 905
83 Ga0068867_100058847 3300005459 Bacteria 2847
84 Ga0068867_100408129 3300005459 Bacteria 1147
85 Ga0070706_100000367 3300005467 Bacteria 54314
86 Ga0070698_100139972 3300005471 Bacteria 2372
87 Ga0070679_100004721 3300005530 Bacteria 12564
88 Ga0070679_100134851 3300005530 Bacteria 2450
89 Ga0070679_100230597 3300005530 Bacteria 1811
90 Ga0070684_100131782 3300005535 Bacteria 2255
91 Ga0068853_100031519 3300005539 Bacteria 4484
92 Ga0068853_100063215 3300005539 Bacteria 3206
93 Ga0068853_100095812 3300005539 Bacteria 2617
94 Ga0068853_100315396 3300005539 Bacteria 1448
95 Ga0068853_100490830 3300005539 Bacteria 1159
96 Ga0070672_100021949 3300005543 Bacteria 4680
97 Ga0070672_100100367 3300005543 Bacteria 2347
98 Ga0070686_100334627 3300005544 Bacteria 1133
99 Ga0070696_100264630 3300005546 Bacteria 1305
100 Ga0070693_100052404 3300005547 Bacteria 2339
101 Ga0070693_100101508 3300005547 Bacteria 1753
102 Ga0070665_100033015 3300005548 Bacteria 5208
103 Ga0070665_100501096 3300005548 Bacteria 1225
104 Ga0070665_100625402 3300005548 Bacteria 1090
105 Ga0068855_100024131 3300005563 Bacteria 7279
106 Ga0068855_100173573 3300005563 Bacteria 2440
107 Ga0068855_100189798 3300005563 Bacteria 2318
108 Ga0068855_100255777 3300005563 Bacteria 1953
109 Ga0070664_100057283 3300005564 Bacteria 3312
110 Ga0070664_100263031 3300005564 Bacteria 1552
111 Ga0070664_100366849 3300005564 Bacteria 1312
112 Ga0068857_100023783 3300005577 Bacteria 5394
113 Ga0068857_100087284 3300005577 Bacteria 2790
114 Ga0068857_100268815 3300005577 Bacteria 1566
115 Ga0068854_100026160 3300005578 Bacteria 4008
116 Ga0068854_100206692 3300005578 Bacteria 1546
117 Ga0068854_100206956 3300005578 Bacteria 1545
118 Ga0068856_100012272 3300005614 Bacteria 8299
119 Ga0068856_100021189 3300005614 Bacteria 6313
120 Ga0068856_100083459 3300005614 Bacteria 3173
121 Ga0068856_100275801 3300005614 Bacteria 1698
122 Ga0068856_100392910 3300005614 Bacteria 1406
123 Ga0068856_100583872 3300005614 Bacteria 1139
124 Ga0070702_100184225 3300005615 Bacteria 1369
125 Ga0070702_100241977 3300005615 Bacteria 1218
126 Ga0070702_100577765 3300005615 Bacteria 839
127 Ga0068852_100032795 3300005616 Bacteria 4304
128 Ga0068852_100324762 3300005616 Bacteria 1495
129 Ga0068852_100331606 3300005616 Bacteria 1481
130 Ga0068852_100364378 3300005616 Bacteria 1414
131 Ga0068859_100019359 3300005617 Bacteria 6839
132 Ga0068859_100442113 3300005617 Bacteria 1397
133 Ga0068864_100009062 3300005618 Bacteria 8203
134 Ga0068864_100011997 3300005618 Bacteria 7155
135 Ga0068864_100017095 3300005618 Bacteria 6047
136 Ga0068866_10073079 3300005718 Bacteria 1818
137 Ga0068861_100001656 3300005719 Bacteria 14245
138 Ga0068861_100019378 3300005719 Bacteria 4860
139 Ga0068861_100045356 3300005719 Bacteria 3310
140 Ga0068851_10032935 3300005834 Bacteria 2580
141 Ga0068851_10089997 3300005834 Bacteria 1614
142 Ga0068863_100463299 3300005841 Bacteria 1245
143 Ga0068858_100002470 3300005842 Bacteria 18659
144 Ga0068858_100008215 3300005842 Bacteria 10036
145 Ga0068858_100175626 3300005842 Bacteria 2021
146 Ga0068858_100259239 3300005842 Bacteria 1652
147 Ga0068860_100001365 3300005843 Bacteria 26507
148 Ga0068860_100103887 3300005843 Bacteria 2712
149 Ga0068862_100538947 3300005844 Bacteria 1113
150 Ga0081539_10017388 3300005985 Bacteria 5052
151 Ga0075365_10013289 3300006038 Bacteria 4915
152 Ga0075365_10016664 3300006038 Bacteria 4475
153 Ga0075365_10087742 3300006038 Bacteria 2115
154 Ga0075365_10096082 3300006038 Bacteria 2025
155 Ga0075368_10040676 3300006042 Bacteria 1825
156 Ga0075363_100080638 3300006048 Bacteria 1780
157 Ga0075363_100086368 3300006048 Bacteria 1722
158 Ga0075364_10022311 3300006051 Bacteria 3996
159 Ga0075364_10049231 3300006051 Bacteria 2747
160 Ga0075432_10006527 3300006058 Bacteria 3973
161 Ga0075432_10016456 3300006058 Bacteria 2524
162 Ga0070716_100168069 3300006173 Bacteria 1429
163 Ga0075362_10032249 3300006177 Bacteria 2272
164 Ga0075362_10080073 3300006177 Bacteria 1505
165 Ga0075362_10081004 3300006177 Bacteria 1496
166 Ga0075362_10160324 3300006177 Bacteria 1083
167 Ga0075367_10015436 3300006178 Bacteria 4151
168 Ga0075367_10018865 3300006178 Bacteria 3813
169 Ga0075367_10043243 3300006178 Bacteria 2638
170 Ga0075367_10094747 3300006178 Bacteria 1820
171 Ga0075369_10014645 3300006186 Bacteria 3137
172 Ga0075366_10007983 3300006195 Bacteria 5861
173 Ga0075366_10015005 3300006195 Bacteria 4430
174 Ga0075366_10041892 3300006195 Bacteria 2711
175 Ga0075366_10043723 3300006195 Bacteria 2654
176 Ga0075366_10091374 3300006195 Bacteria 1823
177 Ga0097621_100020754 3300006237 Bacteria 5068
178 Ga0097621_100078702 3300006237 Bacteria 2739
179 Ga0097621_100085195 3300006237 Bacteria 2635
180 Ga0097621_100842200 3300006237 Bacteria 851
181 Ga0075370_10000151 3300006353 Bacteria 23643
182 Ga0075370_10002757 3300006353 Bacteria 8231
183 Ga0075370_10003232 3300006353 Bacteria 7714
184 Ga0075370_10003626 3300006353 Bacteria 7385
185 Ga0075370_10346862 3300006353 Bacteria 887
186 Ga0068871_100054136 3300006358 Bacteria 3254
187 Ga0068871_100096935 3300006358 Bacteria 2464
188 Ga0075428_100406219 3300006844 Bacteria 1459
189 Ga0075428_101159703 3300006844 Bacteria 815
190 Ga0075430_100221789 3300006846 Bacteria 1569
191 Ga0075431_100155082 3300006847 Bacteria 2356
192 Ga0075431_100555548 3300006847 Bacteria 1135
193 Ga0075429_100008410 3300006880 Bacteria 8980
194 Ga0097620_100019361 3300006931 Bacteria 6839
195 Ga0097620_100442089 3300006931 Bacteria 1397
196 Ga0099795_10017584 3300007788 Bacteria 2282
197 Ga0105240_10009978 3300009093 Bacteria 13386
198 Ga0105240_10016101 3300009093 Bacteria 10132
199 Ga0105240_10429932 3300009093 Bacteria 1482
200 Ga0105240_10682907 3300009093 Bacteria 1122
201 Ga0111539_10405288 3300009094 Bacteria 1588
202 Ga0105245_10114171 3300009098 Bacteria 2515
203 Ga0105245_10189923 3300009098 Bacteria 1967
204 Ga0105245_11182731 3300009098 Bacteria 812
205 Ga0105247_10532069 3300009101 Bacteria 861
206 Ga0114129_10058968 3300009147 Bacteria 5368
207 Ga0105243_10119990 3300009148 Bacteria 2215
208 Ga0105243_10140765 3300009148 Bacteria 2058
209 Ga0105241_10066756 3300009174 Bacteria 2783
210 Ga0105248_10025188 3300009177 Bacteria 6613
211 Ga0105248_10034909 3300009177 Bacteria 5628
212 Ga0105248_10071563 3300009177 Bacteria 3896
213 Ga0105248_10098068 3300009177 Bacteria 3302
214 Ga0105237_10008751 3300009545 Bacteria 10924
215 Ga0105237_10010803 3300009545 Bacteria 9691
216 Ga0105237_10015804 3300009545 Bacteria 7851
217 Ga0105237_10489490 3300009545 Bacteria 1236
218 Ga0105237_10723080 3300009545 Bacteria 1002
219 Ga0105238_10016417 3300009551 Bacteria 7496
220 Ga0105238_10020457 3300009551 Bacteria 6737
221 Ga0105238_10086366 3300009551 Bacteria 3125
222 Ga0105238_10153244 3300009551 Bacteria 2280
223 Ga0105239_10001543 3300010375 Bacteria 30425
224 Ga0105239_10050326 3300010375 Bacteria 4570
225 Ga0105239_10506477 3300010375 Bacteria 1373
226 Ga0105239_10531343 3300010375 Bacteria 1339
227 Ga0105239_10640138 3300010375 Bacteria 1214
228 Ga0105239_11085710 3300010375 Bacteria 921
229 Ga0157373_10054846 3300013100 Bacteria 2832
230 Ga0157371_10271449 3300013102 Bacteria 1224
231 Ga0157370_10187911 3300013104 Bacteria 1918
232 Ga0157369_10092084 3300013105 Bacteria 3235
233 Ga0157369_10177351 3300013105 Bacteria 2243
234 Ga0157374_10576139 3300013296 Bacteria 1134
235 Ga0157378_10340944 3300013297 Bacteria 1461
236 Ga0157378_10653201 3300013297 Bacteria 1067
237 Ga0163162_10036736 3300013306 Bacteria 4884
238 Ga0163162_10437512 3300013306 Bacteria 1440
239 Ga0163162_10468804 3300013306 Bacteria 1391
240 Ga0157372_10206397 3300013307 Bacteria 2277
241 Ga0157372_10365023 3300013307 Bacteria 1682
242 Ga0157375_10157383 3300013308 Bacteria 2411
243 Ga0157375_10269437 3300013308 Bacteria 1865
244 Ga0157375_10402262 3300013308 Bacteria 1536
245 Ga0157375_10578590 3300013308 Bacteria 1283
246 Ga0163163_10286818 3300014325 Bacteria 1698
247 Ga0163163_10327258 3300014325 Bacteria 1587
248 Ga0157380_10075509 3300014326 Bacteria 2739
249 Ga0182008_10185237 3300014497 Bacteria 1055
250 Ga0157377_10001260 3300014745 Bacteria 10825
251 Ga0157379_10012658 3300014968 Bacteria 7373
252 Ga0157379_10196358 3300014968 Bacteria 1824
253 Ga0157376_10006493 3300014969 Bacteria 8266
254 Ga0157376_10035440 3300014969 Bacteria 4037
255 Ga0157376_11129019 3300014969 Bacteria 810
256 Ga0182007_10061376 3300015262 Bacteria 1232
257 Ga0182007_10118646 3300015262 Bacteria 884
258 Ga0213876_10043510 3300021384 Bacteria 2374
259 Ga0213875_10001372 3300021388 Bacteria 15985
260 Ga0209435_100002 3300025206 Bacteria 794178
261 Ga0209674_100015 3300025226 Bacteria 697299
262 Ga0209563_100017 3300025230 Bacteria 796449
263 Ga0209563_107053 3300025230 Bacteria 1876
264 Ga0207427_100989 3300025231 Bacteria 11980
265 Ga0209258_100025 3300025242 Bacteria 534777
266 Ga0209258_100557 3300025242 Bacteria 32937
267 Ga0207425_1003954 3300025245 Bacteria 4570
268 Ga0207425_1017783 3300025245 Bacteria 1554
269 Ga0209646_1000001 3300025246 Bacteria 3092932
270 Ga0209646_1000131 3300025246 Bacteria 128289
271 Ga0209026_1000038 3300025250 Bacteria 281227
272 Ga0209026_1000040 3300025250 Bacteria 277470
273 Ga0209677_100022 3300025253 Bacteria 410724
274 Ga0209677_100074 3300025253 Bacteria 133019
275 Ga0209677_100832 3300025253 Bacteria 15305
276 Ga0209148_1002620 3300025254 Bacteria 5873
277 Ga0209759_1000001 3300025256 Bacteria 2799452
278 Ga0209759_1000031 3300025256 Bacteria 281227
279 Ga0209759_1004903 3300025256 Bacteria 4845
280 Ga0209759_1007462 3300025256 Bacteria 3514
281 Ga0209129_1011540 3300025258 Bacteria 2101
282 Ga0209565_1000026 3300025263 Bacteria 365910
283 Ga0209565_1001255 3300025263 Bacteria 11855
284 Ga0209565_1005280 3300025263 Bacteria 3781
285 Ga0209565_1014193 3300025263 Bacteria 1838
286 Ga0207666_1001927 3300025271 Bacteria 2468
287 Ga0209455_1000089 3300025272 Bacteria 235612
288 Ga0209455_1012267 3300025272 Bacteria 2061
289 Ga0209673_1000009 3300025273 Bacteria 620735
290 Ga0209673_1000012 3300025273 Bacteria 579480
291 Ga0209673_1051404 3300025273 Bacteria 1088
292 Ga0209130_1000183 3300025284 Bacteria 87887
293 Ga0209130_1000644 3300025284 Bacteria 32528
294 Ga0209675_1000308 3300025291 Bacteria 44127
295 Ga0209675_1006996 3300025291 Bacteria 4409
296 Ga0209675_1012555 3300025291 Bacteria 2717
297 Ga0209675_1017411 3300025291 Bacteria 2053
298 Ga0209676_1000013 3300025292 Bacteria 816080
299 Ga0209676_1003161 3300025292 Bacteria 10492
300 Ga0209025_1005365 3300025294 Bacteria 10492
301 Ga0209025_1006206 3300025294 Bacteria 9380
302 Ga0209025_1031654 3300025294 Bacteria 2496
303 Ga0209564_1001304 3300025295 Bacteria 26859
304 Ga0209564_1004427 3300025295 Bacteria 8605
305 Ga0209564_1004860 3300025295 Bacteria 7983
306 Ga0209758_1000304 3300025297 Bacteria 95770
307 Ga0209758_1007970 3300025297 Bacteria 7015
308 Ga0209050_1000008 3300025298 Bacteria 1144179
309 Ga0209050_1000266 3300025298 Bacteria 111792
310 Ga0209050_1001933 3300025298 Bacteria 19735
311 Ga0209050_1006110 3300025298 Bacteria 7265
312 Ga0209050_1025810 3300025298 Bacteria 1986
313 Ga0209256_1000003 3300025299 Bacteria 1661127
314 Ga0209256_1000049 3300025299 Bacteria 310696
315 Ga0209256_1001148 3300025299 Bacteria 30046
316 Ga0207426_1000062 3300025302 Bacteria 362040
317 Ga0207426_1003042 3300025302 Bacteria 9688
318 Ga0209051_1000005 3300025303 Bacteria 1142353
319 Ga0209051_1000025 3300025303 Bacteria 415397
320 Ga0209051_1009298 3300025303 Bacteria 5078
321 Ga0209051_1042094 3300025303 Bacteria 1617
322 Ga0209257_1000039 3300025304 Bacteria 591694
323 Ga0209257_1000048 3300025304 Bacteria 455536
324 Ga0209257_1012197 3300025304 Bacteria 4012
325 Ga0207697_10098276 3300025315 Bacteria 1246
326 Ga0207656_10017653 3300025321 Bacteria 2798
327 Ga0207656_10322762 3300025321 Bacteria 767
328 Ga0207682_10024170 3300025893 Bacteria 2404
329 Ga0207688_10086801 3300025901 Bacteria 1793
330 Ga0207688_10120969 3300025901 Bacteria 1528
331 Ga0207680_10097179 3300025903 Bacteria 1885
332 Ga0207680_10100226 3300025903 Bacteria 1860
333 Ga0207680_10131443 3300025903 Bacteria 1650
334 Ga0207699_10000129 3300025906 Bacteria 52416
335 Ga0207645_10008065 3300025907 Bacteria 7387
336 Ga0207645_10022328 3300025907 Bacteria 4119
337 Ga0207645_10023553 3300025907 Bacteria 4001
338 Ga0207645_10111785 3300025907 Bacteria 1769
339 Ga0207705_10145984 3300025909 Bacteria 1770
340 Ga0207684_10005313 3300025910 Bacteria 11914
341 Ga0207654_10030295 3300025911 Bacteria 2969
342 Ga0207654_10035373 3300025911 Bacteria 2783
343 Ga0207654_10128404 3300025911 Bacteria 1601
344 Ga0207707_10022477 3300025912 Bacteria 5513
345 Ga0207707_10178613 3300025912 Bacteria 1854
346 Ga0207707_10683737 3300025912 Bacteria 863
347 Ga0207695_10014227 3300025913 Bacteria 9438
348 Ga0207695_10065783 3300025913 Bacteria 3726
349 Ga0207695_10197632 3300025913 Bacteria 1926
350 Ga0207671_10010930 3300025914 Bacteria 7438
351 Ga0207671_10022450 3300025914 Bacteria 4772
352 Ga0207671_10064598 3300025914 Bacteria 2721
353 Ga0207671_10088141 3300025914 Bacteria 2334
354 Ga0207660_10169553 3300025917 Bacteria 1689
355 Ga0207662_10021765 3300025918 Bacteria 3668
356 Ga0207657_10010934 3300025919 Bacteria 9027
357 Ga0207657_10074502 3300025919 Bacteria 2866
358 Ga0207657_10112162 3300025919 Bacteria 2251
359 Ga0207657_10188518 3300025919 Bacteria 1665
360 Ga0207649_10235302 3300025920 Bacteria 1312
361 Ga0207652_10022385 3300025921 Bacteria 5228
362 Ga0207652_10049913 3300025921 Bacteria 3584
363 Ga0207681_10023814 3300025923 Bacteria 3921
364 Ga0207681_10191883 3300025923 Bacteria 1563
365 Ga0207681_10564861 3300025923 Bacteria 937
366 Ga0207694_10061758 3300025924 Bacteria 2916
367 Ga0207694_10135696 3300025924 Bacteria 1976
368 Ga0207694_10183779 3300025924 Bacteria 1696
369 Ga0207694_10428311 3300025924 Bacteria 1103
370 Ga0207694_10732629 3300025924 Bacteria 834
371 Ga0207650_10023362 3300025925 Bacteria 4382
372 Ga0207650_10060524 3300025925 Bacteria 2826
373 Ga0207650_10101250 3300025925 Bacteria 2218
374 Ga0207659_10022700 3300025926 Bacteria 4180
375 Ga0207687_10024102 3300025927 Bacteria 4062
376 Ga0207687_10033528 3300025927 Bacteria 3483
377 Ga0207687_10358276 3300025927 Bacteria 1190
378 Ga0207687_10460726 3300025927 Bacteria 1056
379 Ga0207644_10032713 3300025931 Bacteria 3630
380 Ga0207644_10423898 3300025931 Bacteria 1090
381 Ga0207690_10126632 3300025932 Bacteria 1863
382 Ga0207690_10288059 3300025932 Bacteria 1281
383 Ga0207690_10439131 3300025932 Bacteria 1047
384 Ga0207706_10001995 3300025933 Bacteria 19971
385 Ga0207706_10119541 3300025933 Bacteria 2317
386 Ga0207706_10170119 3300025933 Bacteria 1915
387 Ga0207706_10509612 3300025933 Bacteria 1038
388 Ga0207709_10050782 3300025935 Bacteria 2538
389 Ga0207709_10133921 3300025935 Bacteria 1693
390 Ga0207670_10145065 3300025936 Bacteria 1755
391 Ga0207669_10099865 3300025937 Bacteria 1915
392 Ga0207669_10137672 3300025937 Bacteria 1689
393 Ga0207669_10684543 3300025937 Bacteria 841
394 Ga0207704_10111724 3300025938 Bacteria 1849
395 Ga0207691_10004985 3300025940 Bacteria 12806
396 Ga0207691_10027031 3300025940 Bacteria 5384
397 Ga0207711_10009070 3300025941 Bacteria 8311
398 Ga0207711_10011255 3300025941 Bacteria 7434
399 Ga0207711_10046878 3300025941 Bacteria 3693
400 Ga0207711_10060141 3300025941 Bacteria 3273
401 Ga0207711_10463249 3300025941 Bacteria 1180
402 Ga0207689_10000996 3300025942 Bacteria 27158
403 Ga0207689_10011569 3300025942 Bacteria 7560
404 Ga0207689_10198912 3300025942 Bacteria 1654
405 Ga0207661_10043857 3300025944 Bacteria 3531
406 Ga0207661_10180601 3300025944 Bacteria 1843
407 Ga0207679_10015982 3300025945 Bacteria 4974
408 Ga0207679_10122608 3300025945 Bacteria 2072
409 Ga0207667_10021835 3300025949 Bacteria 7084
410 Ga0207667_10453804 3300025949 Bacteria 1302
411 Ga0207651_10030894 3300025960 Bacteria 3417
412 Ga0207651_10134764 3300025960 Bacteria 1897
413 Ga0207712_10233178 3300025961 Bacteria 1479
414 Ga0207668_10090770 3300025972 Bacteria 2243
415 Ga0207640_10221288 3300025981 Bacteria 1450
416 Ga0207640_10345284 3300025981 Bacteria 1194
417 Ga0207658_10012023 3300025986 Bacteria 5904
418 Ga0207658_10073606 3300025986 Bacteria 2593
419 Ga0207658_10583726 3300025986 Bacteria 1003
420 Ga0207677_10000853 3300026023 Bacteria 17454
421 Ga0207677_10057976 3300026023 Bacteria 2663
422 Ga0207703_10003620 3300026035 Bacteria 12891
423 Ga0207703_10009640 3300026035 Bacteria 7581
424 Ga0207703_10044880 3300026035 Bacteria 3553
425 Ga0207703_10214019 3300026035 Bacteria 1720
426 Ga0207639_10006133 3300026041 Bacteria 8160
427 Ga0207639_10272831 3300026041 Bacteria 1484
428 Ga0207639_10273608 3300026041 Bacteria 1482
429 Ga0207678_10062737 3300026067 Bacteria 3194
430 Ga0207678_10103777 3300026067 Bacteria 2426
431 Ga0207708_10019046 3300026075 Bacteria 5168
432 Ga0207708_10043438 3300026075 Bacteria 3425
433 Ga0207708_10185426 3300026075 Bacteria 1653
434 Ga0207702_10004240 3300026078 Bacteria 12805
435 Ga0207702_10014759 3300026078 Bacteria 6480
436 Ga0207702_10087741 3300026078 Bacteria 2717
437 Ga0207641_10139494 3300026088 Bacteria 2185
438 Ga0207641_10333084 3300026088 Bacteria 1442
439 Ga0207648_10129602 3300026089 Bacteria 2220
440 Ga0207648_10408558 3300026089 Bacteria 1231
441 Ga0207648_10691485 3300026089 Bacteria 945
442 Ga0207648_10949846 3300026089 Bacteria 804
443 Ga0207676_10003408 3300026095 Bacteria 11239
444 Ga0207676_10028197 3300026095 Bacteria 4192
445 Ga0207676_10029223 3300026095 Bacteria 4125
446 Ga0207674_10021307 3300026116 Bacteria 6984
447 Ga0207674_10022527 3300026116 Bacteria 6763
448 Ga0207674_10031102 3300026116 Bacteria 5608
449 Ga0207674_10257168 3300026116 Bacteria 1693
450 Ga0207674_10643093 3300026116 Bacteria 1024
451 Ga0207675_100002360 3300026118 Bacteria 18687
452 Ga0207675_100090758 3300026118 Bacteria 2873
453 Ga0207675_100262784 3300026118 Bacteria 1673
454 Ga0207683_10009600 3300026121 Bacteria 8247
455 Ga0207698_10020822 3300026142 Bacteria 4522
456 Ga0207698_10027402 3300026142 Bacteria 4044
457 Ga0207698_10065102 3300026142 Bacteria 2861
458 Ga0207698_11071726 3300026142 Bacteria 818
459 Ga0207698_11078538 3300026142 Bacteria 815
460 Ga0209995_1000160 3300027471 Bacteria 10708
461 Ga0209982_1021798 3300027552 Bacteria 987
462 Ga0209998_10015322 3300027717 Bacteria 1604
463 Ga0209813_10063458 3300027866 Bacteria 1185
464 Ga0209974_10003807 3300027876 Bacteria 5407
465 Ga0207428_10152541 3300027907 Bacteria 1758
466 Ga0265354_1002175 3300028016 Bacteria 2508
467 Ga0268266_10117960 3300028379 Bacteria 2359
468 Ga0268265_10792347 3300028380 Bacteria 923
469 Ga0268265_10891596 3300028380 Bacteria 873
470 Ga0268264_10011726 3300028381 Bacteria 7228
471 Ga0268264_10068442 3300028381 Bacteria 3000
472 Ga0265336_10000029 3300028666 Bacteria 178897
473 Ga0307517_10297086 3300028786 Bacteria 908
474 Ga0307515_10000123 3300028794 Bacteria 186601
475 Ga0307515_10001456 3300028794 Bacteria 53165
476 Ga0307515_10002728 3300028794 Bacteria 37759
477 Ga0307515_10009581 3300028794 Bacteria 18707
478 Ga0307515_10175757 3300028794 Bacteria 2113
479 Ga0307515_10424713 3300028794 Bacteria 949
480 Ga0265324_10000326 3300029957 Bacteria 34966
481 Ga0307511_10000092 3300030521 Bacteria 76188
482 Ga0307511_10059059 3300030521 Bacteria 2955
483 Ga0307512_10090121 3300030522 Bacteria 2141
484 Ga0307512_10114850 3300030522 Bacteria 1756
485 Ga0265763_1001692 3300030763 Bacteria 1608
486 Ga0265770_1001763 3300030878 Bacteria 2952
487 Ga0265330_10037955 3300031235 Bacteria 2142
488 Ga0265325_10004429 3300031241 Bacteria 8878
489 Ga0265325_10029087 3300031241 Bacteria 2972
490 Ga0265329_10060855 3300031242 Bacteria 1196
491 Ga0265327_10000049 3300031251 Bacteria 268046
492 Ga0265327_10113012 3300031251 Bacteria 1295
493 Ga0265316_10038848 3300031344 Bacteria 3829
494 Ga0265316_10054144 3300031344 Bacteria 3142
495 Ga0307513_10000057 3300031456 Bacteria 146564
496 Ga0307513_10041778 3300031456 Bacteria 5056
497 Ga0307513_10240657 3300031456 Bacteria 1615
498 Ga0307509_10069245 3300031507 Bacteria 3689
499 Ga0307408_100062798 3300031548 Bacteria 2716
500 Ga0307408_100148179 3300031548 Bacteria 1850
501 Ga0265313_10142367 3300031595 Bacteria 1030
502 Ga0307508_10008033 3300031616 Bacteria 9780
503 Ga0307508_10298811 3300031616 Bacteria 1203
504 Ga0307508_10363596 3300031616 Bacteria 1038
505 Ga0307514_10008631 3300031649 Bacteria 8644
506 Ga0265314_10002601 3300031711 Bacteria 18259
507 Ga0265314_10023252 3300031711 Bacteria 4730
508 Ga0265314_10313544 3300031711 Bacteria 875
509 Ga0307516_10000017 3300031730 Bacteria 202506
510 Ga0307516_10005729 3300031730 Bacteria 14730
511 Ga0307516_10016806 3300031730 Bacteria 7641
512 Ga0307516_10021030 3300031730 Bacteria 6728
513 Ga0307516_10176861 3300031730 Bacteria 1870
514 Ga0307516_10400243 3300031730 Bacteria 1032
515 Ga0307406_10537104 3300031901 Bacteria 954
516 Ga0307412_10264747 3300031911 Bacteria 1342
517 Ga0307412_10369013 3300031911 Bacteria 1158
518 Ga0307507_10040352 3300033179 Bacteria 4690
519 Ga0307507_10040381 3300033179 Bacteria 4688
520 Ga0373959_0053251 3300034820 Bacteria 879
521 Ga0373926_0030127 3300035083 Bacteria 1909
522 Ga0373944_0007686 3300035089 Bacteria 2895
523 Ga0373952_0020702 3300035092 Bacteria 1381
524 Ga0373923_0016948 3300035111 Bacteria 2779
525 Ga0373936_0042331 3300035113 Bacteria 1828
526 Ga0373936_0189988 3300035113 Bacteria 904
527 Ga0373945_0000417 3300035116 Bacteria 12078
528 Ga0373945_0062883 3300035116 Bacteria 1389
529 Ga0373954_0029214 3300035118 Bacteria 2538
530 Ga0373954_0089060 3300035118 Bacteria 1481
531 Ga0373943_0000245 3300035170 Bacteria 22472
532 Ga0373955_0432428 3300035172 Bacteria 801
533 Ga0373931_0011040 3300035691 Bacteria 4355
534 Ga0373935_0001774 3300035692 Bacteria 12135
535 Ga0373927_0000215 3300035695 Bacteria 46040
536 Ga0373927_0278597 3300035695 Bacteria 1100
537 Ga0373927_0356018 3300035695 Bacteria 965
538 Ga0373947_0000242 3300035725 Bacteria 30738
539 Ga0373937_0196091 3300036401 Bacteria 1898
540 Ga0373937_0233384 3300036401 Bacteria 1733
541 Ga0373925_0000700 3300037068 Bacteria 31392
542 Ga0373925_0177241 3300037068 Bacteria 1685
543 Ga0395899_0002984 3300037312 Bacteria 13533
544 Ga0395899_0004579 3300037312 Bacteria 10775
545 Ga0395900_0000387 3300037418 Bacteria 63605
546 Ga0395900_0006516 3300037418 Bacteria 12165
547 Ga0395900_0010859 3300037418 Bacteria 9314
548 Ga0395900_0020030 3300037418 Bacteria 6821
549 Ga0395900_0044597 3300037418 Bacteria 4568
550 Ga0395900_0267418 3300037418 Bacteria 1705
551 Ga0395898_0000958 3300037466 Bacteria 45958
552 Ga0395898_0002933 3300037466 Bacteria 19401
553 Ga0395898_0010476 3300037466 Bacteria 9691
554 Ga0395898_0012459 3300037466 Bacteria 8791
555 Ga0395898_0028246 3300037466 Bacteria 5625
556 Ga0395905_0002575 3300037471 Bacteria 19972
557 Ga0395905_0004104 3300037471 Bacteria 15258
558 Ga0395905_0005907 3300037471 Bacteria 12410
559 Ga0395905_0006007 3300037471 Bacteria 12291
560 Ga0395905_0007574 3300037471 Bacteria 10789
561 Ga0395905_0009071 3300037471 Bacteria 9755
562 Ga0395905_0023096 3300037471 Bacteria 5879
563 Ga0395905_0104621 3300037471 Bacteria 2657
564 Ga0395905_0105356 3300037471 Bacteria 2648
565 Ga0395905_0112958 3300037471 Bacteria 2552
566 Ga0395905_0113088 3300037471 Bacteria 2550
567 Ga0395905_0139673 3300037471 Bacteria 2279
568 Ga0395905_0190377 3300037471 Bacteria 1924
569 Ga0395905_0198583 3300037471 Bacteria 1881
570 Ga0395905_0348044 3300037471 Unclassified 1374
571 Ga0436364_0252687 3300037853 Bacteria 823
572 Ga0395901_0003137 3300038443 Bacteria 16603
573 Ga0395901_0038125 3300038443 Bacteria 4971
574 Ga0395901_0144544 3300038443 Bacteria 2500
575 Ga0395901_0250782 3300038443 Bacteria 1844
576 Ga0395901_0424467 3300038443 Bacteria 1363
577 Ga0395901_0679900 3300038443 Bacteria 1029
578 Ga0237819_05419 3300038705 Bacteria 2005
579 Ga0436365_1382513 3300039437 Bacteria 6411
580 Ga0436361_0010685 3300039447 Bacteria 1105
581 Ga0436363_0491254 3300039450 Bacteria 1420
582 Ga0436363_1157161 3300039450 Bacteria 7889
583 Ga0439447_005815 3300041407 Bacteria 4065
584 Ga0439453_0029934 3300041408 Bacteria 1027
585 Ga0439465_0126018 3300041413 Bacteria 901
586 Ga0451789_0890581 3300041443 Bacteria 1569
587 Ga0451798_0006129 3300041458 Bacteria 2028
588 Ga0451800_1231896 3300041459 Bacteria 2598
589 Ga0439431_0006681 3300041997 Bacteria 2557
590 Ga0439433_0009143 3300041999 Bacteria 2157
591 Ga0439449_0012132 3300042007 Bacteria 3239
592 Ga0439450_016327 3300042008 Bacteria 1534
593 Ga0439451_013034 3300042009 Bacteria 1679
594 Ga0439456_020582 3300042013 Bacteria 1392
595 Ga0439457_057648 3300042014 Bacteria 877
596 Ga0439462_0009145 3300042015 Bacteria 2505
597 Ga0450898_009171 3300042134 Bacteria 1577
598 Ga0450902_008026 3300042137 Bacteria 1641
599 Ga0450903_001354 3300042138 Bacteria 4584
600 Ga0450903_002112 3300042138 Bacteria 3571
601 Ga0450905_010419 3300042142 Bacteria 1287
602 Ga0439446_0012973 3300042156 Bacteria 2281
603 Ga0439446_0019921 3300042156 Bacteria 1887
604 Ga0450908_007790 3300042184 Bacteria 2013
605 Ga0439434_0047294 3300042435 Bacteria 1329
606 Ga0439460_0033721 3300042461 Bacteria 1472
607 Ga0451577_0001028 3300042876 Bacteria 40476
608 Ga0451577_0027391 3300042876 Bacteria 5159
609 Ga0451577_0178976 3300042876 Bacteria 1911
610 Ga0466969_0000009 3300044656 Bacteria 125464
611 Ga0466969_0013911 3300044656 Bacteria 4235
612 Ga0466969_0032818 3300044656 Bacteria 2638
613 Ga0466969_0036236 3300044656 Bacteria 2493
614 Ga0453683_0012323 3300044673 Bacteria 5605
615 Ga0453683_0068463 3300044673 Bacteria 2220
616 Ga0466965_0003719 3300044683 Bacteria 6735
617 Ga0466966_0000818 3300044684 Bacteria 19809
618 Ga0466966_0021372 3300044684 Bacteria 4249
619 Ga0466966_0228245 3300044684 Bacteria 1123
620 Ga0466961_0038195 3300044693 Bacteria 3079
621 Ga0466961_0111823 3300044693 Bacteria 1718
622 Ga0466961_0168319 3300044693 Bacteria 1363
623 Ga0466961_0217074 3300044693 Bacteria 1179
624 Ga0466963_0050472 3300044694 Bacteria 2753
625 Ga0466963_0121342 3300044694 Bacteria 1799
626 Ga0466963_0410234 3300044694 Bacteria 955
627 Ga0466964_0004255 3300044706 Bacteria 5272
628 Ga0453684_0000280 3300044712 Bacteria 219955
629 Ga0453684_0030004 3300044712 Bacteria 7698
630 Ga0453684_0492545 3300044712 Bacteria 1358
631 Ga0453684_0501604 3300044712 Bacteria 1344
632 Ga0466971_0009634 3300044719 Bacteria 4216
633 Ga0466968_0018776 3300044735 Bacteria 2775
634 Ga0466968_0024344 3300044735 Bacteria 2472
635 Ga0466970_0166066 3300044765 Bacteria 1222
636 Ga0466957_0003611 3300044842 Bacteria 8522
637 Ga0466957_0044811 3300044842 Bacteria 2681
638 Ga0466957_0076160 3300044842 Bacteria 2082
639 Ga0466960_0093818 3300044901 Bacteria 1534
640 Ga0466959_0005772 3300045049 Bacteria 8522
641 Ga0466959_0009501 3300045049 Bacteria 6919
642 Ga0466959_0023548 3300045049 Bacteria 4556
643 Ga0466959_0041525 3300045049 Bacteria 3395
644 Ga0466959_0064165 3300045049 Bacteria 2666
645 Ga0466959_0173392 3300045049 Bacteria 1512
646 Ga0451576_0003797 3300045051 Bacteria 20361
647 Ga0451576_0004140 3300045051 Bacteria 19114
648 Ga0451576_0027493 3300045051 Bacteria 6109
649 Ga0451576_0309203 3300045051 Bacteria 1653
650 Ga0451576_0343726 3300045051 Bacteria 1562
651 Ga0451576_0406597 3300045051 Bacteria 1427
652 Ga0451576_0543329 3300045051 Bacteria 1221
653 Ga0466958_0032521 3300045836 Bacteria 3103
654 Ga0466958_0037418 3300045836 Bacteria 2907
655 Ga0466958_0098498 3300045836 Bacteria 1815
656 Ga0466967_0016859 3300045976 Bacteria 5776
657 Ga0466967_0021050 3300045976 Bacteria 5283
658 Ga0466967_0312674 3300045976 Bacteria 1513
659 Ga0495592_0001331 3300046454 Bacteria 17151
660 Ga0495592_0350457 3300046454 Bacteria 947
661 Ga0495603_0034923 3300046455 Bacteria 3022
662 Ga0495590_0000939 3300046457 Bacteria 12918
663 Ga0495590_0015656 3300046457 Bacteria 2748
664 Ga0495638_0000224 3300046460 Bacteria 77870
665 Ga0495638_0002166 3300046460 Bacteria 16488
666 Ga0495638_0002585 3300046460 Bacteria 14627
667 Ga0495580_0000118 3300046472 Bacteria 54013
668 Ga0495580_0003172 3300046472 Bacteria 14094
669 Ga0495580_0404365 3300046472 Bacteria 920
670 Ga0495582_0226193 3300046473 Bacteria 1071
671 Ga0495664_0187568 3300046477 Bacteria 1254
672 Ga0495594_0026445 3300046499 Bacteria 3122
673 Ga0495594_0304463 3300046499 Bacteria 908
674 Ga0495583_0000071 3300046506 Bacteria 183691
675 Ga0495583_0084614 3300046506 Bacteria 1374
676 Ga0495606_0000560 3300046507 Bacteria 59169
677 Ga0495608_0156099 3300046511 Bacteria 1453
678 Ga0495620_0050297 3300046515 Bacteria 1779
679 Ga0495620_0052557 3300046515 Bacteria 1730
680 Ga0495628_0005510 3300046516 Bacteria 11076
681 Ga0495630_0001053 3300046517 Bacteria 19016
682 Ga0495632_0011670 3300046519 Bacteria 5116
683 Ga0495632_0035966 3300046519 Bacteria 2522
684 Ga0495632_0050326 3300046519 Bacteria 2055
685 Ga0495632_0051520 3300046519 Bacteria 2026
686 Ga0495663_0014896 3300046525 Bacteria 2185
687 Ga0495666_0174275 3300046526 Bacteria 994
688 Ga0495642_0203357 3300046528 Bacteria 863
689 Ga0495652_0227862 3300046529 Bacteria 1396
690 Ga0495652_0251536 3300046529 Bacteria 1309
691 Ga0495654_0090777 3300046530 Bacteria 1418
692 Ga0495665_0007571 3300046531 Bacteria 5881
693 Ga0495665_0092298 3300046531 Bacteria 1591
694 Ga0495640_0011409 3300046533 Bacteria 6838
695 Ga0495640_0094616 3300046533 Bacteria 1968
696 Ga0495586_0033151 3300046535 Bacteria 2771
697 Ga0495586_0219923 3300046535 Bacteria 1079
698 Ga0495597_0012332 3300046542 Bacteria 4124
699 Ga0495667_0015443 3300046559 Bacteria 5159
700 Ga0495656_0021763 3300046615 Bacteria 2500
701 Ga0495656_0022579 3300046615 Bacteria 2466
702 Ga0495634_0016833 3300046642 Bacteria 5223
703 Ga0495625_0000990 3300046660 Bacteria 37644
704 Ga0495625_0013676 3300046660 Bacteria 6508
705 Ga0495635_0012723 3300046663 Bacteria 5900
706 Ga0495635_0136506 3300046663 Bacteria 1672
707 Ga0495635_0146342 3300046663 Bacteria 1608
708 Ga0495659_0104335 3300046664 Bacteria 1101
709 Ga0495588_0084029 3300046674 Bacteria 1663
710 Ga0495658_0030201 3300046683 Bacteria 2941
711 Ga0495613_0029473 3300046689 Bacteria 4080
712 Ga0495613_0561293 3300046689 Bacteria 763
713 Ga0495624_0003524 3300046690 Bacteria 11602
714 Ga0495670_0101905 3300046691 Bacteria 1479
715 Ga0495671_0042279 3300046692 Bacteria 2291
716 Ga0495649_0000144 3300046694 Bacteria 62066
717 Ga0495649_0001813 3300046694 Bacteria 15681
718 Ga0495589_0022802 3300046794 Bacteria 3192
719 Ga0495600_0103555 3300046809 Bacteria 1855
720 Ga0495660_0041610 3300046810 Bacteria 2542
721 Ga0495581_0012636 3300047315 Bacteria 4893
722 Ga0495604_0002984 3300047317 Bacteria 13551
723 Ga0495674_0050007 3300047319 Bacteria 3690
724 Ga0495674_0463555 3300047319 Bacteria 1017
725 Ga0495676_0053068 3300047321 Bacteria 3233
726 Ga0495680_0263007 3300047322 Bacteria 1220
727 Ga0495687_000454 3300047443 Bacteria 50500
728 Ga0495687_007504 3300047443 Bacteria 6410
729 Ga0495685_019184 3300047447 Bacteria 2349
730 Ga0495673_0070024 3300047469 Bacteria 1478
731 Ga0495673_0091723 3300047469 Bacteria 1241
732 Ga0495681_0164801 3300047470 Bacteria 921
733 Ga0495684_0004024 3300047471 Bacteria 11468
734 Ga0495684_0037777 3300047471 Bacteria 3704
735 Ga0495684_0437164 3300047471 Bacteria 912
736 Ga0495686_0001272 3300047472 Bacteria 28580
737 Ga0495593_0024039 3300047673 Bacteria 3380
738 Ga0495614_0160986 3300048089 Bacteria 1004
739 Ga0495626_0102388 3300048091 Bacteria 1247
740 Ga0496101_0099560 3300048904 Bacteria 2173
741 Ga0496102_0001271 3300048905 Bacteria 22770
742 Ga0496102_0027990 3300048905 Bacteria 5036
743 Ga0496102_0041644 3300048905 Bacteria 4160
744 Ga0496102_0910253 3300048905 Bacteria 801
745 Ga0496103_0095447 3300048906 Bacteria 1879
746 Ga0496104_0037358 3300048907 Bacteria 4542
747 Ga0496105_0307559 3300048908 Bacteria 1273
748 Ga0496106_0308786 3300048909 Bacteria 1269
749 Ga0496106_0411920 3300048909 Bacteria 1086
750 Ga0496107_0059744 3300048910 Bacteria 2759
751 Ga0496107_0468999 3300048910 Bacteria 935
752 Ga0496108_0154503 3300048911 Bacteria 1981
753 Ga0496108_0456468 3300048911 Bacteria 1116
754 Ga0496108_0475369 3300048911 Bacteria 1092
755 Ga0496109_0122282 3300048912 Bacteria 2425
756 Ga0496109_0359833 3300048912 Bacteria 1375
757 Ga0496109_0382153 3300048912 Bacteria 1330
758 Ga0496110_0030521 3300048913 Bacteria 4647
759 Ga0496111_0544345 3300048914 Bacteria 852
760 Ga0496113_0075019 3300048916 Bacteria 2580
761 Ga0496114_0019358 3300048917 Bacteria 5516
762 Ga0496114_0047036 3300048917 Bacteria 3587
763 Ga0496114_0155840 3300048917 Bacteria 1983
764 Ga0496115_0050330 3300048918 Bacteria 3337
765 Ga0496121_0002728 3300048924 Bacteria 26312
766 Ga0496122_0134255 3300048925 Bacteria 1564
767 Ga0496123_0235711 3300048926 Bacteria 912
768 Ga0496125_0297340 3300048928 Bacteria 991
769 Ga0496126_0137269 3300048929 Bacteria 2108
770 Ga0496126_0229384 3300048929 Bacteria 1556
771 Ga0501034_0000106 3300049571 Bacteria 153523
772 Ga0501034_0035657 3300049571 Bacteria 5042
773 Ga0501038_0115715 3300049574 Bacteria 2216
774 Ga0501043_0050928 3300049579 Bacteria 3255
775 Ga0501046_0007148 3300049580 Bacteria 9821
776 Ga0501046_0374205 3300049580 Bacteria 1032
777 Ga0501047_0028441 3300049581 Bacteria 5389
778 Ga0501071_0314737 3300049587 Bacteria 1188
779 Ga0501076_0278236 3300049592 Bacteria 1371
780 Ga0501198_000023 3300049649 Bacteria 69100
781 Ga0501222_000031 3300049662 Bacteria 56867
782 Ga0501080_0064774 3300049742 Bacteria 3399
783 Ga0501035_0018506 3300049822 Bacteria 6418
784 Ga0501035_0104532 3300049822 Bacteria 2483
785 Ga0501035_0120588 3300049822 Bacteria 2293
786 Ga0501044_0013961 3300049823 Bacteria 8676
787 Ga0501044_0148737 3300049823 Bacteria 2325
788 nmdc:mga03n38_33245_c1 3300050490 Bacteria 2192
789 nmdc:mga03n38_348948_c1 3300050490 Bacteria 805
790 nmdc:mga00v17_78683_c1 3300050491 Bacteria 2055
791 nmdc:mga0yw44_324650_c1 3300050492 Bacteria 1034
792 nmdc:mga0yw44_339383_c1 3300050492 Bacteria 1010
793 nmdc:mga0yw44_410945_c1 3300050492 Bacteria 916
794 nmdc:mga0yw44_96825_c1 3300050492 Bacteria 1874
795 nmdc:mga0k408_10501_c1 3300050493 Bacteria 5009
796 nmdc:mga0k408_111545_c1 3300050493 Bacteria 1617
797 nmdc:mga0k408_14119_c2 3300050493 Bacteria 2484
798 nmdc:mga0k408_14745_c1 3300050493 Bacteria 4312
799 nmdc:mga0k408_201630_c1 3300050493 Bacteria 1188
800 nmdc:mga0k408_323732_c1 3300050493 Bacteria 920
801 nmdc:mga0k408_35013_c1 3300050493 Bacteria 2878
802 nmdc:mga0k408_40610_c1 3300050493 Bacteria 2678
803 nmdc:mga0k408_4653_c1 3300050493 Bacteria 7271
804 nmdc:mga06z11_61813_c1 3300050494 Bacteria 1955
805 nmdc:mga07m45_179357_c1 3300050496 Bacteria 1232
806 nmdc:mga07m45_18581_c1 3300050496 Bacteria 3756
807 nmdc:mga07m45_26255_c1 3300050496 Bacteria 3201
808 nmdc:mga07m45_3277_c1 3300050496 Bacteria 7785
809 nmdc:mga07m45_3995_c1 3300050496 Bacteria 7174
810 nmdc:mga07m45_4628_c1 3300050496 Bacteria 6747
811 nmdc:mga07m45_468_c1 3300050496 Bacteria 16990
812 nmdc:mga07m45_49006_c1 3300050496 Bacteria 2377
813 nmdc:mga07m45_494_c1 3300050496 Bacteria 16679
814 nmdc:mga05p37_28163_c1 3300050507 Bacteria 6848
815 nmdc:mga09592_1109_c1 3300050508 Bacteria 21409
816 nmdc:mga0qj67_194221_c1 3300050509 Bacteria 1649
817 nmdc:mga0n895_93044_c1 3300050512 Bacteria 3018
818 nmdc:mga0sz30_115229_c1 3300050516 Bacteria 1179
819 nmdc:mga0sz30_17015_c1 3300050516 Bacteria 2895
820 nmdc:mga0sz30_4255_c1 3300050516 Bacteria 3021
821 Ga0495601_0000453 3300053077 Bacteria 21492
822 Ga0495601_0325694 3300053077 Bacteria 1000
823 Ga0495612_0129886 3300053078 Bacteria 1088
824 Ga0495619_0041407 3300053085 Bacteria 3013
825 Ga0495619_0067162 3300053085 Bacteria 2394
826 Ga0500578_0000057 3300053086 Bacteria 120178
827 Ga0500646_0001133 3300053090 Bacteria 7188
828 Ga0500646_0017240 3300053090 Bacteria 1892
829 Ga0500583_0039612 3300053092 Bacteria 2129
830 Ga0500651_0035425 3300053093 Bacteria 3145
831 Ga0500562_049598 3300053108 Bacteria 1122
832 Ga0500569_061511 3300053109 Bacteria 1160
833 Ga0500593_000186 3300053117 Bacteria 25186
834 Ga0500593_000199 3300053117 Bacteria 24418
835 Ga0500595_010356 3300053119 Bacteria 3709
836 Ga0500652_002632 3300053131 Bacteria 5421
837 Ga0500655_035354 3300053133 Bacteria 970
838 Ga0500658_0001951 3300053134 Bacteria 8075
839 Ga0500658_0062796 3300053134 Bacteria 1549
840 Ga0500604_0028653 3300053151 Bacteria 1618
841 Ga0500616_0000028 3300053153 Bacteria 435722
842 Ga0500622_0000530 3300053156 Bacteria 35364
843 Ga0500627_0144519 3300053158 Bacteria 1074
844 Ga0500645_000978 3300053730 Bacteria 16206
845 Ga0500645_008154 3300053730 Bacteria 3598
846 Ga0500661_010782 3300055283 Bacteria 1661
847 Ga0501082_0469980 3300060353 Bacteria 1099
848 Ga0466962_0012685 3300061719 Bacteria 4053
849 2511245469 2511231002 Bacteria 5042903
850 2511358074 2511231021 Bacteria 7302637
851 2514040420 2513237165 Bacteria 6771773
852 2587726033 2585428057 Bacteria 6737412
853 2587737094 2585428058 Bacteria 6853932
854 2587758103 2585428062 Bacteria 6842168
855 2588290361 2588253510 Bacteria 6901809
856 2643967670 2643221592 Bacteria 6608788
857 2644140492 2643221625 Bacteria 6512927
858 2644273459 2643221648 Bacteria 6521465
859 2738723559 2738541277 Bacteria 7458140
860 2739284290 2738543019 Bacteria 7459457
861 2838127292 2838122688 Bacteria 8803140
862 2841987392 2841983080 Bacteria 8395090
863 2881103107 2881101125 Bacteria 4590519
864 2900643337 2900634093 Bacteria 10263517
865 2901312698 2901300506 Bacteria 8463898
866 2904618506 2904615490 Bacteria 10047340
867 2917701080 2917699015 Bacteria 7043791
868 2939633203 2939631187 Bacteria 6118131
869 Ga0070658_10146194
870 LJNas_1012990
871 JGI25155J39150_1000035
872 JGI25156J39149_1000012
873 JGI25154J39366_1000029
874 JGI25154J39366_1001259
875 JGI25157J39369_1000014
876 JGI25157J39369_1000179
877 JGI25159J45721_1000334
878 JGI25159J45721_1003179
879 JGI25151J46595_10008323
880 JGI25151J46595_10008820
881 JGI25160J50197_1000303
882 JGI25160J50197_1044611
883 JGI25161J50226_1000094
884 Ga0055539_1000509
885 Ga0055539_1001998
886 Ga0055533_1000008
887 Ga0055535_1000346
888 Ga0055535_1000467
889 Ga0055535_1007880
890 Ga0055529_1000156
891 Ga0055526_1000854
892 Ga0055526_1004656
893 Ga0055537_1000092
894 Ga0055524_1000306
895 Ga0055536_1020051
896 Ga0055534_1006822
897 Ga0055528_1000480
898 Ga0055530_10000863
899 Ga0055540_1000449
900 Ga0055540_1006320
901 Ga0055531_10002683
902 Ga0055531_10002832
903 Ga0055543_1000780
904 Ga0065165_1001186
905 Ga0065714_10018971
906 Ga0065707_10176353
907 Ga0070658_10115923
908 Ga0070658_10589056
909 Ga0070676_10006298
910 Ga0070683_100040327
911 Ga0070683_100065230
912 Ga0070690_100062871
913 Ga0070670_100040562
914 Ga0070670_100042619
915 Ga0070670_100409341
916 Ga0070670_100512908
917 Ga0070677_10067027
918 Ga0068869_100108125
919 Ga0070680_100462302
920 Ga0070682_100104091
921 Ga0068868_100011018
922 Ga0068868_100015797
923 Ga0068868_100555220
924 Ga0070660_100025973
925 Ga0070660_100061955
926 Ga0070660_100140920
927 Ga0070689_100128466
928 Ga0070661_100112646
929 Ga0070668_100004185
930 Ga0070669_100025707
931 Ga0070669_100455366
932 Ga0070675_100009133
933 Ga0070675_100080463
934 Ga0070671_100113696
935 Ga0070671_100531978
936 Ga0070674_100019585
937 Ga0070674_100088035
938 Ga0070674_100321063
939 Ga0070659_100067511
940 Ga0070659_100176025
941 Ga0070667_100260497
942 Ga0070701_10160769
943 Ga0070700_100020552
944 Ga0070694_100240688
945 Ga0070708_100246996
946 Ga0070663_100008867
947 Ga0070662_100004805
948 Ga0070662_100094281
949 Ga0070681_10031139
950 Ga0070681_10732200
951 Ga0068867_100058847
952 Ga0068867_100408129
953 Ga0070706_100000367
954 Ga0070698_100139972
955 Ga0070679_100004721
956 Ga0070679_100134851
957 Ga0070679_100230597
958 Ga0070684_100131782
959 Ga0068853_100031519
960 Ga0068853_100063215
961 Ga0068853_100095812
962 Ga0068853_100315396
963 Ga0068853_100490830
964 Ga0070672_100021949
965 Ga0070672_100100367
966 Ga0070686_100334627
967 Ga0070696_100264630
968 Ga0070693_100052404
969 Ga0070693_100101508
970 Ga0070665_100033015
971 Ga0070665_100501096
972 Ga0070665_100625402
973 Ga0068855_100024131
974 Ga0068855_100173573
975 Ga0068855_100189798
976 Ga0068855_100255777
977 Ga0070664_100057283
978 Ga0070664_100263031
979 Ga0070664_100366849
980 Ga0068857_100023783
981 Ga0068857_100087284
982 Ga0068857_100268815
983 Ga0068854_100026160
984 Ga0068854_100206692
985 Ga0068854_100206956
986 Ga0068856_100012272
987 Ga0068856_100021189
988 Ga0068856_100083459
989 Ga0068856_100275801
990 Ga0068856_100392910
991 Ga0068856_100583872
992 Ga0070702_100184225
993 Ga0070702_100241977
994 Ga0070702_100577765
995 Ga0068852_100032795
996 Ga0068852_100324762
997 Ga0068852_100331606
998 Ga0068852_100364378
999 Ga0068859_100019359
1000 Ga0068859_100442113
1001 Ga0068864_100009062
1002 Ga0068864_100011997
1003 Ga0068864_100017095
1004 Ga0068866_10073079
1005 Ga0068861_100001656
1006 Ga0068861_100019378
1007 Ga0068861_100045356
1008 Ga0068851_10032935
1009 Ga0068851_10089997
1010 Ga0068863_100463299
1011 Ga0068858_100002470
1012 Ga0068858_100008215
1013 Ga0068858_100175626
1014 Ga0068858_100259239
1015 Ga0068860_100001365
1016 Ga0068860_100103887
1017 Ga0068862_100538947
1018 Ga0081539_10017388
1019 Ga0075365_10013289
1020 Ga0075365_10016664
1021 Ga0075365_10087742
1022 Ga0075365_10096082
1023 Ga0075368_10040676
1024 Ga0075363_100080638
1025 Ga0075363_100086368
1026 Ga0075364_10022311
1027 Ga0075364_10049231
1028 Ga0075432_10006527
1029 Ga0075432_10016456
1030 Ga0070716_100168069
1031 Ga0075362_10032249
1032 Ga0075362_10080073
1033 Ga0075362_10081004
1034 Ga0075362_10160324
1035 Ga0075367_10015436
1036 Ga0075367_10018865
1037 Ga0075367_10043243
1038 Ga0075367_10094747
1039 Ga0075369_10014645
1040 Ga0075366_10007983
1041 Ga0075366_10015005
1042 Ga0075366_10041892
1043 Ga0075366_10043723
1044 Ga0075366_10091374
1045 Ga0097621_100020754
1046 Ga0097621_100078702
1047 Ga0097621_100085195
1048 Ga0097621_100842200
1049 Ga0075370_10000151
1050 Ga0075370_10002757
1051 Ga0075370_10003232
1052 Ga0075370_10003626
1053 Ga0075370_10346862
1054 Ga0068871_100054136
1055 Ga0068871_100096935
1056 Ga0075428_100406219
1057 Ga0075428_101159703
1058 Ga0075430_100221789
1059 Ga0075431_100155082
1060 Ga0075431_100555548
1061 Ga0075429_100008410
1062 Ga0097620_100019361
1063 Ga0097620_100442089
1064 Ga0099795_10017584
1065 Ga0105240_10009978
1066 Ga0105240_10016101
1067 Ga0105240_10429932
1068 Ga0105240_10682907
1069 Ga0111539_10405288
1070 Ga0105245_10114171
1071 Ga0105245_10189923
1072 Ga0105245_11182731
1073 Ga0105247_10532069
1074 Ga0114129_10058968
1075 Ga0105243_10119990
1076 Ga0105243_10140765
1077 Ga0105241_10066756
1078 Ga0105248_10025188
1079 Ga0105248_10034909
1080 Ga0105248_10071563
1081 Ga0105248_10098068
1082 Ga0105237_10008751
1083 Ga0105237_10010803
1084 Ga0105237_10015804
1085 Ga0105237_10489490
1086 Ga0105237_10723080
1087 Ga0105238_10016417
1088 Ga0105238_10020457
1089 Ga0105238_10086366
1090 Ga0105238_10153244
1091 Ga0105239_10001543
1092 Ga0105239_10050326
1093 Ga0105239_10506477
1094 Ga0105239_10531343
1095 Ga0105239_10640138
1096 Ga0105239_11085710
1097 Ga0157373_10054846
1098 Ga0157371_10271449
1099 Ga0157370_10187911
1100 Ga0157369_10092084
1101 Ga0157369_10177351
1102 Ga0157374_10576139
1103 Ga0157378_10340944
1104 Ga0157378_10653201
1105 Ga0163162_10036736
1106 Ga0163162_10437512
1107 Ga0163162_10468804
1108 Ga0157372_10206397
1109 Ga0157372_10365023
1110 Ga0157375_10157383
1111 Ga0157375_10269437
1112 Ga0157375_10402262
1113 Ga0157375_10578590
1114 Ga0163163_10286818
1115 Ga0163163_10327258
1116 Ga0157380_10075509
1117 Ga0182008_10185237
1118 Ga0157377_10001260
1119 Ga0157379_10012658
1120 Ga0157379_10196358
1121 Ga0157376_10006493
1122 Ga0157376_10035440
1123 Ga0157376_11129019
1124 Ga0182007_10061376
1125 Ga0182007_10118646
1126 Ga0213876_10043510
1127 Ga0213875_10001372
1128 Ga0209435_100002
1129 Ga0209674_100015
1130 Ga0209563_100017
1131 Ga0209563_107053
1132 Ga0207427_100989
1133 Ga0209258_100025
1134 Ga0209258_100557
1135 Ga0207425_1003954
1136 Ga0207425_1017783
1137 Ga0209646_1000001
1138 Ga0209646_1000131
1139 Ga0209026_1000038
1140 Ga0209026_1000040
1141 Ga0209677_100022
1142 Ga0209677_100074
1143 Ga0209677_100832
1144 Ga0209148_1002620
1145 Ga0209759_1000001
1146 Ga0209759_1000031
1147 Ga0209759_1004903
1148 Ga0209759_1007462
1149 Ga0209129_1011540
1150 Ga0209565_1000026
1151 Ga0209565_1001255
1152 Ga0209565_1005280
1153 Ga0209565_1014193
1154 Ga0207666_1001927
1155 Ga0209455_1000089
1156 Ga0209455_1012267
1157 Ga0209673_1000009
1158 Ga0209673_1000012
1159 Ga0209673_1051404
1160 Ga0209130_1000183
1161 Ga0209130_1000644
1162 Ga0209675_1000308
1163 Ga0209675_1006996
1164 Ga0209675_1012555
1165 Ga0209675_1017411
1166 Ga0209676_1000013
1167 Ga0209676_1003161
1168 Ga0209025_1005365
1169 Ga0209025_1006206
1170 Ga0209025_1031654
1171 Ga0209564_1001304
1172 Ga0209564_1004427
1173 Ga0209564_1004860
1174 Ga0209758_1000304
1175 Ga0209758_1007970
1176 Ga0209050_1000008
1177 Ga0209050_1000266
1178 Ga0209050_1001933
1179 Ga0209050_1006110
1180 Ga0209050_1025810
1181 Ga0209256_1000003
1182 Ga0209256_1000049
1183 Ga0209256_1001148
1184 Ga0207426_1000062
1185 Ga0207426_1003042
1186 Ga0209051_1000005
1187 Ga0209051_1000025
1188 Ga0209051_1009298
1189 Ga0209051_1042094
1190 Ga0209257_1000039
1191 Ga0209257_1000048
1192 Ga0209257_1012197
1193 Ga0207697_10098276
1194 Ga0207656_10017653
1195 Ga0207656_10322762
1196 Ga0207682_10024170
1197 Ga0207688_10086801
1198 Ga0207688_10120969
1199 Ga0207680_10097179
1200 Ga0207680_10100226
1201 Ga0207680_10131443
1202 Ga0207699_10000129
1203 Ga0207645_10008065
1204 Ga0207645_10022328
1205 Ga0207645_10023553
1206 Ga0207645_10111785
1207 Ga0207705_10145984
1208 Ga0207684_10005313
1209 Ga0207654_10030295
1210 Ga0207654_10035373
1211 Ga0207654_10128404
1212 Ga0207707_10022477
1213 Ga0207707_10178613
1214 Ga0207707_10683737
1215 Ga0207695_10014227
1216 Ga0207695_10065783
1217 Ga0207695_10197632
1218 Ga0207671_10010930
1219 Ga0207671_10022450
1220 Ga0207671_10064598
1221 Ga0207671_10088141
1222 Ga0207660_10169553
1223 Ga0207662_10021765
1224 Ga0207657_10010934
1225 Ga0207657_10074502
1226 Ga0207657_10112162
1227 Ga0207657_10188518
1228 Ga0207649_10235302
1229 Ga0207652_10022385
1230 Ga0207652_10049913
1231 Ga0207681_10023814
1232 Ga0207681_10191883
1233 Ga0207681_10564861
1234 Ga0207694_10061758
1235 Ga0207694_10135696
1236 Ga0207694_10183779
1237 Ga0207694_10428311
1238 Ga0207694_10732629
1239 Ga0207650_10023362
1240 Ga0207650_10060524
1241 Ga0207650_10101250
1242 Ga0207659_10022700
1243 Ga0207687_10024102
1244 Ga0207687_10033528
1245 Ga0207687_10358276
1246 Ga0207687_10460726
1247 Ga0207644_10032713
1248 Ga0207644_10423898
1249 Ga0207690_10126632
1250 Ga0207690_10288059
1251 Ga0207690_10439131
1252 Ga0207706_10001995
1253 Ga0207706_10119541
1254 Ga0207706_10170119
1255 Ga0207706_10509612
1256 Ga0207709_10050782
1257 Ga0207709_10133921
1258 Ga0207670_10145065
1259 Ga0207669_10099865
1260 Ga0207669_10137672
1261 Ga0207669_10684543
1262 Ga0207704_10111724
1263 Ga0207691_10004985
1264 Ga0207691_10027031
1265 Ga0207711_10009070
1266 Ga0207711_10011255
1267 Ga0207711_10046878
1268 Ga0207711_10060141
1269 Ga0207711_10463249
1270 Ga0207689_10000996
1271 Ga0207689_10011569
1272 Ga0207689_10198912
1273 Ga0207661_10043857
1274 Ga0207661_10180601
1275 Ga0207679_10015982
1276 Ga0207679_10122608
1277 Ga0207667_10021835
1278 Ga0207667_10453804
1279 Ga0207651_10030894
1280 Ga0207651_10134764
1281 Ga0207712_10233178
1282 Ga0207668_10090770
1283 Ga0207640_10221288
1284 Ga0207640_10345284
1285 Ga0207658_10012023
1286 Ga0207658_10073606
1287 Ga0207658_10583726
1288 Ga0207677_10000853
1289 Ga0207677_10057976
1290 Ga0207703_10003620
1291 Ga0207703_10009640
1292 Ga0207703_10044880
1293 Ga0207703_10214019
1294 Ga0207639_10006133
1295 Ga0207639_10272831
1296 Ga0207639_10273608
1297 Ga0207678_10062737
1298 Ga0207678_10103777
1299 Ga0207708_10019046
1300 Ga0207708_10043438
1301 Ga0207708_10185426
1302 Ga0207702_10004240
1303 Ga0207702_10014759
1304 Ga0207702_10087741
1305 Ga0207641_10139494
1306 Ga0207641_10333084
1307 Ga0207648_10129602
1308 Ga0207648_10408558
1309 Ga0207648_10691485
1310 Ga0207648_10949846
1311 Ga0207676_10003408
1312 Ga0207676_10028197
1313 Ga0207676_10029223
1314 Ga0207674_10021307
1315 Ga0207674_10022527
1316 Ga0207674_10031102
1317 Ga0207674_10257168
1318 Ga0207674_10643093
1319 Ga0207675_100002360
1320 Ga0207675_100090758
1321 Ga0207675_100262784
1322 Ga0207683_10009600
1323 Ga0207698_10020822
1324 Ga0207698_10027402
1325 Ga0207698_10065102
1326 Ga0207698_11071726
1327 Ga0207698_11078538
1328 Ga0209995_1000160
1329 Ga0209982_1021798
1330 Ga0209998_10015322
1331 Ga0209813_10063458
1332 Ga0209974_10003807
1333 Ga0207428_10152541
1334 Ga0265354_1002175
1335 Ga0268266_10117960
1336 Ga0268265_10792347
1337 Ga0268265_10891596
1338 Ga0268264_10011726
1339 Ga0268264_10068442
1340 Ga0265336_10000029
1341 Ga0307517_10297086
1342 Ga0307515_10000123
1343 Ga0307515_10001456
1344 Ga0307515_10002728
1345 Ga0307515_10009581
1346 Ga0307515_10175757
1347 Ga0307515_10424713
1348 Ga0265324_10000326
1349 Ga0307511_10000092
1350 Ga0307511_10059059
1351 Ga0307512_10090121
1352 Ga0307512_10114850
1353 Ga0265763_1001692
1354 Ga0265770_1001763
1355 Ga0265330_10037955
1356 Ga0265325_10004429
1357 Ga0265325_10029087
1358 Ga0265329_10060855
1359 Ga0265327_10000049
1360 Ga0265327_10113012
1361 Ga0265316_10038848
1362 Ga0265316_10054144
1363 Ga0307513_10000057
1364 Ga0307513_10041778
1365 Ga0307513_10240657
1366 Ga0307509_10069245
1367 Ga0307408_100062798
1368 Ga0307408_100148179
1369 Ga0265313_10142367
1370 Ga0307508_10008033
1371 Ga0307508_10298811
1372 Ga0307508_10363596
1373 Ga0307514_10008631
1374 Ga0265314_10002601
1375 Ga0265314_10023252
1376 Ga0265314_10313544
1377 Ga0307516_10000017
1378 Ga0307516_10005729
1379 Ga0307516_10016806
1380 Ga0307516_10021030
1381 Ga0307516_10176861
1382 Ga0307516_10400243
1383 Ga0307406_10537104
1384 Ga0307412_10264747
1385 Ga0307412_10369013
1386 Ga0307507_10040352
1387 Ga0307507_10040381
1388 Ga0373959_0053251
1389 Ga0373926_0030127
1390 Ga0373944_0007686
1391 Ga0373952_0020702
1392 Ga0373923_0016948
1393 Ga0373936_0042331
1394 Ga0373936_0189988
1395 Ga0373945_0000417
1396 Ga0373945_0062883
1397 Ga0373954_0029214
1398 Ga0373954_0089060
1399 Ga0373943_0000245
1400 Ga0373955_0432428
1401 Ga0373931_0011040
1402 Ga0373935_0001774
1403 Ga0373927_0000215
1404 Ga0373927_0278597
1405 Ga0373927_0356018
1406 Ga0373947_0000242
1407 Ga0373937_0196091
1408 Ga0373937_0233384
1409 Ga0373925_0000700
1410 Ga0373925_0177241
1411 Ga0395899_0002984
1412 Ga0395899_0004579
1413 Ga0395900_0000387
1414 Ga0395900_0006516
1415 Ga0395900_0010859
1416 Ga0395900_0020030
1417 Ga0395900_0044597
1418 Ga0395900_0267418
1419 Ga0395898_0000958
1420 Ga0395898_0002933
1421 Ga0395898_0010476
1422 Ga0395898_0012459
1423 Ga0395898_0028246
1424 Ga0395905_0002575
1425 Ga0395905_0004104
1426 Ga0395905_0005907
1427 Ga0395905_0006007
1428 Ga0395905_0007574
1429 Ga0395905_0009071
1430 Ga0395905_0023096
1431 Ga0395905_0104621
1432 Ga0395905_0105356
1433 Ga0395905_0112958
1434 Ga0395905_0113088
1435 Ga0395905_0139673
1436 Ga0395905_0190377
1437 Ga0395905_0198583
1438 Ga0395905_0348044
1439 Ga0436364_0252687
1440 Ga0395901_0003137
1441 Ga0395901_0038125
1442 Ga0395901_0144544
1443 Ga0395901_0250782
1444 Ga0395901_0424467
1445 Ga0395901_0679900
1446 Ga0237819_05419
1447 Ga0436365_1382513
1448 Ga0436361_0010685
1449 Ga0436363_0491254
1450 Ga0436363_1157161
1451 Ga0439447_005815
1452 Ga0439453_0029934
1453 Ga0439465_0126018
1454 Ga0451789_0890581
1455 Ga0451798_0006129
1456 Ga0451800_1231896
1457 Ga0439431_0006681
1458 Ga0439433_0009143
1459 Ga0439449_0012132
1460 Ga0439450_016327
1461 Ga0439451_013034
1462 Ga0439456_020582
1463 Ga0439457_057648
1464 Ga0439462_0009145
1465 Ga0450898_009171
1466 Ga0450902_008026
1467 Ga0450903_001354
1468 Ga0450903_002112
1469 Ga0450905_010419
1470 Ga0439446_0012973
1471 Ga0439446_0019921
1472 Ga0450908_007790
1473 Ga0439434_0047294
1474 Ga0439460_0033721
1475 Ga0451577_0001028
1476 Ga0451577_0027391
1477 Ga0451577_0178976
1478 Ga0466969_0000009
1479 Ga0466969_0013911
1480 Ga0466969_0032818
1481 Ga0466969_0036236
1482 Ga0453683_0012323
1483 Ga0453683_0068463
1484 Ga0466965_0003719
1485 Ga0466966_0000818
1486 Ga0466966_0021372
1487 Ga0466966_0228245
1488 Ga0466961_0038195
1489 Ga0466961_0111823
1490 Ga0466961_0168319
1491 Ga0466961_0217074
1492 Ga0466963_0050472
1493 Ga0466963_0121342
1494 Ga0466963_0410234
1495 Ga0466964_0004255
1496 Ga0453684_0000280
1497 Ga0453684_0030004
1498 Ga0453684_0492545
1499 Ga0453684_0501604
1500 Ga0466971_0009634
1501 Ga0466968_0018776
1502 Ga0466968_0024344
1503 Ga0466970_0166066
1504 Ga0466957_0003611
1505 Ga0466957_0044811
1506 Ga0466957_0076160
1507 Ga0466960_0093818
1508 Ga0466959_0005772
1509 Ga0466959_0009501
1510 Ga0466959_0023548
1511 Ga0466959_0041525
1512 Ga0466959_0064165
1513 Ga0466959_0173392
1514 Ga0451576_0003797
1515 Ga0451576_0004140
1516 Ga0451576_0027493
1517 Ga0451576_0309203
1518 Ga0451576_0343726
1519 Ga0451576_0406597
1520 Ga0451576_0543329
1521 Ga0466958_0032521
1522 Ga0466958_0037418
1523 Ga0466958_0098498
1524 Ga0466967_0016859
1525 Ga0466967_0021050
1526 Ga0466967_0312674
1527 Ga0495592_0001331
1528 Ga0495592_0350457
1529 Ga0495603_0034923
1530 Ga0495590_0000939
1531 Ga0495590_0015656
1532 Ga0495638_0000224
1533 Ga0495638_0002166
1534 Ga0495638_0002585
1535 Ga0495580_0000118
1536 Ga0495580_0003172
1537 Ga0495580_0404365
1538 Ga0495582_0226193
1539 Ga0495664_0187568
1540 Ga0495594_0026445
1541 Ga0495594_0304463
1542 Ga0495583_0000071
1543 Ga0495583_0084614
1544 Ga0495606_0000560
1545 Ga0495608_0156099
1546 Ga0495620_0050297
1547 Ga0495620_0052557
1548 Ga0495628_0005510
1549 Ga0495630_0001053
1550 Ga0495632_0011670
1551 Ga0495632_0035966
1552 Ga0495632_0050326
1553 Ga0495632_0051520
1554 Ga0495663_0014896
1555 Ga0495666_0174275
1556 Ga0495642_0203357
1557 Ga0495652_0227862
1558 Ga0495652_0251536
1559 Ga0495654_0090777
1560 Ga0495665_0007571
1561 Ga0495665_0092298
1562 Ga0495640_0011409
1563 Ga0495640_0094616
1564 Ga0495586_0033151
1565 Ga0495586_0219923
1566 Ga0495597_0012332
1567 Ga0495667_0015443
1568 Ga0495656_0021763
1569 Ga0495656_0022579
1570 Ga0495634_0016833
1571 Ga0495625_0000990
1572 Ga0495625_0013676
1573 Ga0495635_0012723
1574 Ga0495635_0136506
1575 Ga0495635_0146342
1576 Ga0495659_0104335
1577 Ga0495588_0084029
1578 Ga0495658_0030201
1579 Ga0495613_0029473
1580 Ga0495613_0561293
1581 Ga0495624_0003524
1582 Ga0495670_0101905
1583 Ga0495671_0042279
1584 Ga0495649_0000144
1585 Ga0495649_0001813
1586 Ga0495589_0022802
1587 Ga0495600_0103555
1588 Ga0495660_0041610
1589 Ga0495581_0012636
1590 Ga0495604_0002984
1591 Ga0495674_0050007
1592 Ga0495674_0463555
1593 Ga0495676_0053068
1594 Ga0495680_0263007
1595 Ga0495687_000454
1596 Ga0495687_007504
1597 Ga0495685_019184
1598 Ga0495673_0070024
1599 Ga0495673_0091723
1600 Ga0495681_0164801
1601 Ga0495684_0004024
1602 Ga0495684_0037777
1603 Ga0495684_0437164
1604 Ga0495686_0001272
1605 Ga0495593_0024039
1606 Ga0495614_0160986
1607 Ga0495626_0102388
1608 Ga0496101_0099560
1609 Ga0496102_0001271
1610 Ga0496102_0027990
1611 Ga0496102_0041644
1612 Ga0496102_0910253
1613 Ga0496103_0095447
1614 Ga0496104_0037358
1615 Ga0496105_0307559
1616 Ga0496106_0308786
1617 Ga0496106_0411920
1618 Ga0496107_0059744
1619 Ga0496107_0468999
1620 Ga0496108_0154503
1621 Ga0496108_0456468
1622 Ga0496108_0475369
1623 Ga0496109_0122282
1624 Ga0496109_0359833
1625 Ga0496109_0382153
1626 Ga0496110_0030521
1627 Ga0496111_0544345
1628 Ga0496113_0075019
1629 Ga0496114_0019358
1630 Ga0496114_0047036
1631 Ga0496114_0155840
1632 Ga0496115_0050330
1633 Ga0496121_0002728
1634 Ga0496122_0134255
1635 Ga0496123_0235711
1636 Ga0496125_0297340
1637 Ga0496126_0137269
1638 Ga0496126_0229384
1639 Ga0501034_0000106
1640 Ga0501034_0035657
1641 Ga0501038_0115715
1642 Ga0501043_0050928
1643 Ga0501046_0007148
1644 Ga0501046_0374205
1645 Ga0501047_0028441
1646 Ga0501071_0314737
1647 Ga0501076_0278236
1648 Ga0501198_000023
1649 Ga0501222_000031
1650 Ga0501080_0064774
1651 Ga0501035_0018506
1652 Ga0501035_0104532
1653 Ga0501035_0120588
1654 Ga0501044_0013961
1655 Ga0501044_0148737
1656 nmdc:mga03n38_33245_c1
1657 nmdc:mga03n38_348948_c1
1658 nmdc:mga00v17_78683_c1
1659 nmdc:mga0yw44_324650_c1
1660 nmdc:mga0yw44_339383_c1
1661 nmdc:mga0yw44_410945_c1
1662 nmdc:mga0yw44_96825_c1
1663 nmdc:mga0k408_10501_c1
1664 nmdc:mga0k408_111545_c1
1665 nmdc:mga0k408_14119_c2
1666 nmdc:mga0k408_14745_c1
1667 nmdc:mga0k408_201630_c1
1668 nmdc:mga0k408_323732_c1
1669 nmdc:mga0k408_35013_c1
1670 nmdc:mga0k408_40610_c1
1671 nmdc:mga0k408_4653_c1
1672 nmdc:mga06z11_61813_c1
1673 nmdc:mga07m45_179357_c1
1674 nmdc:mga07m45_18581_c1
1675 nmdc:mga07m45_26255_c1
1676 nmdc:mga07m45_3277_c1
1677 nmdc:mga07m45_3995_c1
1678 nmdc:mga07m45_4628_c1
1679 nmdc:mga07m45_468_c1
1680 nmdc:mga07m45_49006_c1
1681 nmdc:mga07m45_494_c1
1682 nmdc:mga05p37_28163_c1
1683 nmdc:mga09592_1109_c1
1684 nmdc:mga0qj67_194221_c1
1685 nmdc:mga0n895_93044_c1
1686 nmdc:mga0sz30_115229_c1
1687 nmdc:mga0sz30_17015_c1
1688 nmdc:mga0sz30_4255_c1
1689 Ga0495601_0000453
1690 Ga0495601_0325694
1691 Ga0495612_0129886
1692 Ga0495619_0041407
1693 Ga0495619_0067162
1694 Ga0500578_0000057
1695 Ga0500646_0001133
1696 Ga0500646_0017240
1697 Ga0500583_0039612
1698 Ga0500651_0035425
1699 Ga0500562_049598
1700 Ga0500569_061511
1701 Ga0500593_000186
1702 Ga0500593_000199
1703 Ga0500595_010356
1704 Ga0500652_002632
1705 Ga0500655_035354
1706 Ga0500658_0001951
1707 Ga0500658_0062796
1708 Ga0500604_0028653
1709 Ga0500616_0000028
1710 Ga0500622_0000530
1711 Ga0500627_0144519
1712 Ga0500645_000978
1713 Ga0500645_008154
1714 Ga0500661_010782
1715 Ga0501082_0469980
1716 Ga0466962_0012685
1717 2511245469
1718 2511358074
1719 2514040420
1720 2587726033
1721 2587737094
1722 2587758103
1723 2588290361
1724 2643967670
1725 2644140492
1726 2644273459
1727 2738723559
1728 2739284290
1729 2838127292
1730 2841987392
1731 2881103107
1732 2900643337
1733 2901312698
1734 2904618506
1735 2917701080
1736 2939633203

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

48

190

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.8983 1 235
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.8946 1 235
3rlf-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.8916 6 222
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.8901 4 225
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.8885 4 225
ID Description Score Start End Superfamily
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9134 1 235 3.40.50.300
af_O86311_2_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9133 3 224 3.40.50.300
af_O53149_2_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9128 1 227 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9096 1 235 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9008 5 234 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A127JQP1-F1-model_v4 Histidinol dehydrogenase 0.9951 2 235 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A4Y7B3T8-F1-model_v4 deleted 0.994 5 235
AF-A0A7H0GJX1-F1-model_v4 ABC transporter ATP-binding protein 0.9932 1 235 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-M1SDV6-F1-model_v4 ABC transporter related protein 0.9926 5 235 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A0Q6TCL7-F1-model_v4 ABC transporter ATP-binding protein 0.9925 3 235 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887

Map