F484094
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 868 | 292 | 866 | 175 |
Family's Representative Sequence
| Representative Sequence | 3300048089|Ga0495614_0059104|Ga0495614_0059104_170_688 |
| Length | 172 |
| Sequence | MSLQGRKILVLAADYFEESELLYPVIRLREENADVVVAGVTRDAVKGKSGYGPYPVDVAVDEVDAAEFDAVVVPGGFAPDLLRRSSRVLDLVRHFDEAGKPLAIVCHGGWVPVSAGILRDRTVTSVAAIRDDLVNAGADWIDEPVVVDRNLISAQLPRDLGPWMKALITALA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 3 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 4 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 7 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 179 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 180 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 181 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 182 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 183 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 184 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 185 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 188 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 189 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 190 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 194 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 198 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 201 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 202 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 203 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 204 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 205 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 206 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 207 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 208 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 209 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 210 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 211 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 212 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 213 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 214 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 215 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 216 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 217 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 218 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 219 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 220 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 221 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 222 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 223 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 224 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 225 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 226 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 227 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 228 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 229 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 236 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 237 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 238 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 239 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 242 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 243 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 244 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 245 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 277 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 278 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 279 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 289 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 292 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.81 |
| Metatranscriptomes | 1.96 |
| Isolates | 0.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.58 |
| Nodule | 0 |
| Rhizoplane | 1.96 |
| Rhizosphere | 96.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10009013 | 3300003203 | Bacteria | 4485 |
| 2 | JGI26129J50193_1002094 | 3300003349 | Bacteria | 1394 |
| 3 | Ga0058859_11388371 | 3300004798 | Bacteria | 954 |
| 4 | Ga0058863_10794585 | 3300004799 | Bacteria | 629 |
| 5 | Ga0058863_11506664 | 3300004799 | Bacteria | 1133 |
| 6 | Ga0058861_11729795 | 3300004800 | Bacteria | 1134 |
| 7 | Ga0058860_11455887 | 3300004801 | Bacteria | 1091 |
| 8 | Ga0058862_12569376 | 3300004803 | Bacteria | 1163 |
| 9 | Ga0065715_10707811 | 3300005293 | Bacteria | 650 |
| 10 | Ga0070658_10029920 | 3300005327 | Bacteria | 4375 |
| 11 | Ga0070676_10023181 | 3300005328 | Bacteria | 3487 |
| 12 | Ga0070683_100096602 | 3300005329 | Bacteria | 2779 |
| 13 | Ga0070690_100017062 | 3300005330 | Bacteria | 4358 |
| 14 | Ga0070670_100008486 | 3300005331 | Bacteria | 8762 |
| 15 | Ga0070677_10292517 | 3300005333 | Bacteria | 824 |
| 16 | Ga0068869_100006217 | 3300005334 | Bacteria | 7561 |
| 17 | Ga0068869_100078090 | 3300005334 | Bacteria | 2465 |
| 18 | Ga0070666_10202859 | 3300005335 | Bacteria | 1395 |
| 19 | Ga0070680_100009694 | 3300005336 | Bacteria | 7409 |
| 20 | Ga0070680_100027659 | 3300005336 | Bacteria | 4542 |
| 21 | Ga0070680_100068815 | 3300005336 | Bacteria | 2906 |
| 22 | Ga0070680_100184356 | 3300005336 | Bacteria | 1758 |
| 23 | Ga0070680_101134924 | 3300005336 | Bacteria | 676 |
| 24 | Ga0070682_100000788 | 3300005337 | Bacteria | 18618 |
| 25 | Ga0070682_100858959 | 3300005337 | Bacteria | 742 |
| 26 | Ga0070660_100007707 | 3300005339 | Bacteria | 7504 |
| 27 | Ga0070689_100063051 | 3300005340 | Bacteria | 2885 |
| 28 | Ga0070691_10001039 | 3300005341 | Bacteria | 11421 |
| 29 | Ga0070691_10017615 | 3300005341 | Bacteria | 3287 |
| 30 | Ga0070691_10289622 | 3300005341 | Bacteria | 891 |
| 31 | Ga0070687_100006584 | 3300005343 | Bacteria | 4772 |
| 32 | Ga0070661_100003068 | 3300005344 | Bacteria | 11489 |
| 33 | Ga0070661_100101059 | 3300005344 | Bacteria | 2145 |
| 34 | Ga0070692_10001528 | 3300005345 | Bacteria | 8486 |
| 35 | Ga0070668_101228316 | 3300005347 | Bacteria | 680 |
| 36 | Ga0070669_100096497 | 3300005353 | Bacteria | 2224 |
| 37 | Ga0070675_100265808 | 3300005354 | Bacteria | 1504 |
| 38 | Ga0070671_100127402 | 3300005355 | Bacteria | 2144 |
| 39 | Ga0070659_100000529 | 3300005366 | Bacteria | 27921 |
| 40 | Ga0070703_10237601 | 3300005406 | Bacteria | 733 |
| 41 | Ga0070713_100197615 | 3300005436 | Bacteria | 1815 |
| 42 | Ga0070705_100000374 | 3300005440 | Bacteria | 26102 |
| 43 | Ga0070700_100370814 | 3300005441 | Bacteria | 1067 |
| 44 | Ga0070700_100940759 | 3300005441 | Bacteria | 706 |
| 45 | Ga0070694_100008918 | 3300005444 | Bacteria | 6143 |
| 46 | Ga0070694_100043921 | 3300005444 | Bacteria | 2990 |
| 47 | Ga0070694_100334081 | 3300005444 | Bacteria | 1170 |
| 48 | Ga0070694_100338205 | 3300005444 | Bacteria | 1163 |
| 49 | Ga0070694_100729423 | 3300005444 | Bacteria | 808 |
| 50 | Ga0070708_100034359 | 3300005445 | Bacteria | 4411 |
| 51 | Ga0070708_100037504 | 3300005445 | Unclassified | 4229 |
| 52 | Ga0070708_100056223 | 3300005445 | Bacteria | 3500 |
| 53 | Ga0070708_100056710 | 3300005445 | Bacteria | 3486 |
| 54 | Ga0070708_100057821 | 3300005445 | Unclassified | 3454 |
| 55 | Ga0070708_100065060 | 3300005445 | Unclassified | 3269 |
| 56 | Ga0070708_100171584 | 3300005445 | Bacteria | 2025 |
| 57 | Ga0070708_100221620 | 3300005445 | Bacteria | 1774 |
| 58 | Ga0070708_100246242 | 3300005445 | Bacteria | 1679 |
| 59 | Ga0070708_100299728 | 3300005445 | Bacteria | 1513 |
| 60 | Ga0070708_100432291 | 3300005445 | Bacteria | 1242 |
| 61 | Ga0070708_100523416 | 3300005445 | Unclassified | 1118 |
| 62 | Ga0070708_100615895 | 3300005445 | Bacteria | 1023 |
| 63 | Ga0070708_100624828 | 3300005445 | Bacteria | 1015 |
| 64 | Ga0070663_100003952 | 3300005455 | Bacteria | 8639 |
| 65 | Ga0070662_100086653 | 3300005457 | Bacteria | 2343 |
| 66 | Ga0070662_100118286 | 3300005457 | Bacteria | 2028 |
| 67 | Ga0070681_10020175 | 3300005458 | Bacteria | 6681 |
| 68 | Ga0070681_10083185 | 3300005458 | Bacteria | 3154 |
| 69 | Ga0070681_10738336 | 3300005458 | Bacteria | 901 |
| 70 | Ga0068867_100018215 | 3300005459 | Bacteria | 4990 |
| 71 | Ga0068867_100394557 | 3300005459 | Bacteria | 1166 |
| 72 | Ga0070706_100002980 | 3300005467 | Bacteria | 16786 |
| 73 | Ga0070706_100004544 | 3300005467 | Bacteria | 13349 |
| 74 | Ga0070706_100038369 | 3300005467 | Unclassified | 4420 |
| 75 | Ga0070706_100103755 | 3300005467 | Bacteria | 2643 |
| 76 | Ga0070706_100106203 | 3300005467 | Bacteria | 2612 |
| 77 | Ga0070706_100177055 | 3300005467 | Bacteria | 1991 |
| 78 | Ga0070706_100180596 | 3300005467 | Bacteria | 1970 |
| 79 | Ga0070706_100203157 | 3300005467 | Bacteria | 1851 |
| 80 | Ga0070706_100312635 | 3300005467 | Bacteria | 1465 |
| 81 | Ga0070706_100354290 | 3300005467 | Bacteria | 1368 |
| 82 | Ga0070706_100758989 | 3300005467 | Bacteria | 899 |
| 83 | Ga0070706_101220946 | 3300005467 | Bacteria | 690 |
| 84 | Ga0070707_100003625 | 3300005468 | Bacteria | 14564 |
| 85 | Ga0070707_100021132 | 3300005468 | Bacteria | 6149 |
| 86 | Ga0070707_100042747 | 3300005468 | Bacteria | 4339 |
| 87 | Ga0070707_100057551 | 3300005468 | Bacteria | 3729 |
| 88 | Ga0070707_100094333 | 3300005468 | Bacteria | 2897 |
| 89 | Ga0070707_100205701 | 3300005468 | Bacteria | 1918 |
| 90 | Ga0070707_100256515 | 3300005468 | Bacteria | 1701 |
| 91 | Ga0070707_100459199 | 3300005468 | Bacteria | 1234 |
| 92 | Ga0070707_100608259 | 3300005468 | Bacteria | 1055 |
| 93 | Ga0070707_101098104 | 3300005468 | Bacteria | 761 |
| 94 | Ga0070698_100040059 | 3300005471 | Bacteria | 4817 |
| 95 | Ga0070698_100158242 | 3300005471 | Unclassified | 2210 |
| 96 | Ga0070698_100201977 | 3300005471 | Bacteria | 1923 |
| 97 | Ga0070698_100823813 | 3300005471 | Bacteria | 872 |
| 98 | Ga0070699_100007997 | 3300005518 | Bacteria | 9179 |
| 99 | Ga0070699_100050238 | 3300005518 | Bacteria | 3610 |
| 100 | Ga0070699_100099647 | 3300005518 | Bacteria | 2546 |
| 101 | Ga0070699_100134169 | 3300005518 | Unclassified | 2183 |
| 102 | Ga0070699_100285241 | 3300005518 | Bacteria | 1479 |
| 103 | Ga0070699_100292920 | 3300005518 | Bacteria | 1459 |
| 104 | Ga0070699_100294096 | 3300005518 | Bacteria | 1456 |
| 105 | Ga0070699_100298197 | 3300005518 | Bacteria | 1446 |
| 106 | Ga0070679_100007439 | 3300005530 | Bacteria | 10235 |
| 107 | Ga0070679_100031833 | 3300005530 | Bacteria | 5215 |
| 108 | Ga0070679_100195514 | 3300005530 | Bacteria | 1990 |
| 109 | Ga0070684_100005222 | 3300005535 | Bacteria | 9929 |
| 110 | Ga0070684_100201093 | 3300005535 | Bacteria | 1815 |
| 111 | Ga0070684_100407527 | 3300005535 | Bacteria | 1254 |
| 112 | Ga0070697_100016756 | 3300005536 | Bacteria | 5764 |
| 113 | Ga0070697_100023193 | 3300005536 | Bacteria | 4935 |
| 114 | Ga0070697_100023802 | 3300005536 | Bacteria | 4874 |
| 115 | Ga0070697_100026935 | 3300005536 | Bacteria | 4597 |
| 116 | Ga0070697_100181023 | 3300005536 | Bacteria | 1786 |
| 117 | Ga0068853_100001594 | 3300005539 | Bacteria | 16518 |
| 118 | Ga0070686_100205439 | 3300005544 | Bacteria | 1415 |
| 119 | Ga0070695_100003170 | 3300005545 | Bacteria | 9593 |
| 120 | Ga0070695_100004272 | 3300005545 | Bacteria | 8358 |
| 121 | Ga0070695_100058543 | 3300005545 | Bacteria | 2491 |
| 122 | Ga0070695_100117303 | 3300005545 | Bacteria | 1816 |
| 123 | Ga0070695_100215950 | 3300005545 | Unclassified | 1379 |
| 124 | Ga0070696_100008387 | 3300005546 | Bacteria | 6913 |
| 125 | Ga0070696_100012972 | 3300005546 | Bacteria | 5593 |
| 126 | Ga0070696_100022945 | 3300005546 | Bacteria | 4243 |
| 127 | Ga0070696_100235372 | 3300005546 | Bacteria | 1379 |
| 128 | Ga0070696_100551085 | 3300005546 | Unclassified | 924 |
| 129 | Ga0070696_100960078 | 3300005546 | Bacteria | 712 |
| 130 | Ga0070693_100011771 | 3300005547 | Bacteria | 4411 |
| 131 | Ga0070693_100030328 | 3300005547 | Bacteria | 2956 |
| 132 | Ga0070704_100047443 | 3300005549 | Bacteria | 3002 |
| 133 | Ga0070704_100070171 | 3300005549 | Bacteria | 2541 |
| 134 | Ga0070704_100129774 | 3300005549 | Bacteria | 1951 |
| 135 | Ga0070704_100759334 | 3300005549 | Bacteria | 864 |
| 136 | Ga0068855_100010887 | 3300005563 | Bacteria | 10979 |
| 137 | Ga0068855_100358407 | 3300005563 | Bacteria | 1605 |
| 138 | Ga0070664_100013742 | 3300005564 | Bacteria | 6598 |
| 139 | Ga0070664_100524141 | 3300005564 | Bacteria | 1094 |
| 140 | Ga0068857_100020642 | 3300005577 | Bacteria | 5797 |
| 141 | Ga0068857_100088568 | 3300005577 | Bacteria | 2769 |
| 142 | Ga0068857_100162040 | 3300005577 | Bacteria | 2030 |
| 143 | Ga0068857_100299896 | 3300005577 | Bacteria | 1481 |
| 144 | Ga0068854_100011479 | 3300005578 | Bacteria | 5770 |
| 145 | Ga0068856_100005201 | 3300005614 | Bacteria | 12846 |
| 146 | Ga0068856_101243279 | 3300005614 | Bacteria | 761 |
| 147 | Ga0070702_100011369 | 3300005615 | Bacteria | 4426 |
| 148 | Ga0070702_100070371 | 3300005615 | Bacteria | 2065 |
| 149 | Ga0068852_100136394 | 3300005616 | Bacteria | 2266 |
| 150 | Ga0068859_100006840 | 3300005617 | Bacteria | 11584 |
| 151 | Ga0068859_100230992 | 3300005617 | Bacteria | 1938 |
| 152 | Ga0068864_100014894 | 3300005618 | Bacteria | 6460 |
| 153 | Ga0068864_100015376 | 3300005618 | Bacteria | 6362 |
| 154 | Ga0068861_100114196 | 3300005719 | Bacteria | 2168 |
| 155 | Ga0068861_100553382 | 3300005719 | Bacteria | 1049 |
| 156 | Ga0068870_10000125 | 3300005840 | Bacteria | 26430 |
| 157 | Ga0068863_100027042 | 3300005841 | Bacteria | 5471 |
| 158 | Ga0068863_100056394 | 3300005841 | Bacteria | 3719 |
| 159 | Ga0068858_100024297 | 3300005842 | Bacteria | 5648 |
| 160 | Ga0068860_100047615 | 3300005843 | Bacteria | 4086 |
| 161 | Ga0068860_100410120 | 3300005843 | Bacteria | 1342 |
| 162 | Ga0068862_100007501 | 3300005844 | Bacteria | 9039 |
| 163 | Ga0068862_100145626 | 3300005844 | Bacteria | 2105 |
| 164 | Ga0081455_10000189 | 3300005937 | Bacteria | 78564 |
| 165 | Ga0081538_10086579 | 3300005981 | Bacteria | 1639 |
| 166 | Ga0081540_1005614 | 3300005983 | Bacteria | 9339 |
| 167 | Ga0081539_10000166 | 3300005985 | Bacteria | 153758 |
| 168 | Ga0070717_10022010 | 3300006028 | Bacteria | 5031 |
| 169 | Ga0075432_10027943 | 3300006058 | Bacteria | 1945 |
| 170 | Ga0070716_100397688 | 3300006173 | Bacteria | 990 |
| 171 | Ga0075366_10346991 | 3300006195 | Bacteria | 911 |
| 172 | Ga0097621_100426815 | 3300006237 | Bacteria | 1191 |
| 173 | Ga0068871_100131529 | 3300006358 | Bacteria | 2122 |
| 174 | Ga0068871_100960789 | 3300006358 | Bacteria | 794 |
| 175 | Ga0075428_100000368 | 3300006844 | Bacteria | 44722 |
| 176 | Ga0075428_100000410 | 3300006844 | Bacteria | 42619 |
| 177 | Ga0075428_100004668 | 3300006844 | Bacteria | 15168 |
| 178 | Ga0075428_100086890 | 3300006844 | Bacteria | 3411 |
| 179 | Ga0075428_100136817 | 3300006844 | Unclassified | 2664 |
| 180 | Ga0075428_100176959 | 3300006844 | Bacteria | 2310 |
| 181 | Ga0075428_100185079 | 3300006844 | Bacteria | 2254 |
| 182 | Ga0075428_100242629 | 3300006844 | Unclassified | 1944 |
| 183 | Ga0075428_100660351 | 3300006844 | Bacteria | 1115 |
| 184 | Ga0075428_100672215 | 3300006844 | Bacteria | 1104 |
| 185 | Ga0075428_100698680 | 3300006844 | Bacteria | 1080 |
| 186 | Ga0075430_100002647 | 3300006846 | Bacteria | 14931 |
| 187 | Ga0075430_100003046 | 3300006846 | Bacteria | 14015 |
| 188 | Ga0075430_100011404 | 3300006846 | Bacteria | 7546 |
| 189 | Ga0075430_100148490 | 3300006846 | Bacteria | 1952 |
| 190 | Ga0075430_100347290 | 3300006846 | Bacteria | 1225 |
| 191 | Ga0075430_100415131 | 3300006846 | Bacteria | 1111 |
| 192 | Ga0075431_100000843 | 3300006847 | Bacteria | 26867 |
| 193 | Ga0075431_100002781 | 3300006847 | Bacteria | 16939 |
| 194 | Ga0075431_100010752 | 3300006847 | Bacteria | 9201 |
| 195 | Ga0075431_100011301 | 3300006847 | Bacteria | 8993 |
| 196 | Ga0075431_100012211 | 3300006847 | Bacteria | 8670 |
| 197 | Ga0075431_100029113 | 3300006847 | Bacteria | 5682 |
| 198 | Ga0075431_100136317 | 3300006847 | Bacteria | 2531 |
| 199 | Ga0075431_100143565 | 3300006847 | Bacteria | 2460 |
| 200 | Ga0075431_100258162 | 3300006847 | Unclassified | 1769 |
| 201 | Ga0075431_100452884 | 3300006847 | Bacteria | 1279 |
| 202 | Ga0075431_100481376 | 3300006847 | Unclassified | 1234 |
| 203 | Ga0075431_100912241 | 3300006847 | Bacteria | 848 |
| 204 | Ga0075433_10000489 | 3300006852 | Bacteria | 25808 |
| 205 | Ga0075433_10007833 | 3300006852 | Bacteria | 8494 |
| 206 | Ga0075433_10008458 | 3300006852 | Bacteria | 8212 |
| 207 | Ga0075433_10014343 | 3300006852 | Bacteria | 6472 |
| 208 | Ga0075433_10128763 | 3300006852 | Bacteria | 2249 |
| 209 | Ga0075433_10268062 | 3300006852 | Bacteria | 1513 |
| 210 | Ga0075433_10561270 | 3300006852 | Bacteria | 1003 |
| 211 | Ga0075434_100007947 | 3300006871 | Bacteria | 9831 |
| 212 | Ga0075434_100139858 | 3300006871 | Bacteria | 2440 |
| 213 | Ga0075434_100178127 | 3300006871 | Bacteria | 2146 |
| 214 | Ga0075434_100323890 | 3300006871 | Bacteria | 1561 |
| 215 | Ga0075434_100367859 | 3300006871 | Bacteria | 1459 |
| 216 | Ga0075434_100428526 | 3300006871 | Unclassified | 1344 |
| 217 | Ga0075434_100560246 | 3300006871 | Unclassified | 1162 |
| 218 | Ga0075434_101008432 | 3300006871 | Unclassified | 846 |
| 219 | Ga0075429_100003897 | 3300006880 | Bacteria | 12747 |
| 220 | Ga0075429_100014858 | 3300006880 | Bacteria | 6751 |
| 221 | Ga0075429_100018255 | 3300006880 | Bacteria | 6073 |
| 222 | Ga0075429_100018795 | 3300006880 | Bacteria | 5985 |
| 223 | Ga0075429_100097772 | 3300006880 | Bacteria | 2561 |
| 224 | Ga0075429_100169307 | 3300006880 | Bacteria | 1914 |
| 225 | Ga0068865_100933823 | 3300006881 | Bacteria | 756 |
| 226 | Ga0075436_100002956 | 3300006914 | Bacteria | 11640 |
| 227 | Ga0075436_100003545 | 3300006914 | Bacteria | 10707 |
| 228 | Ga0075436_100063393 | 3300006914 | Unclassified | 2555 |
| 229 | Ga0075436_100100109 | 3300006914 | Bacteria | 2018 |
| 230 | Ga0075436_100133092 | 3300006914 | Bacteria | 1744 |
| 231 | Ga0075436_100195911 | 3300006914 | Bacteria | 1430 |
| 232 | Ga0075436_100649964 | 3300006914 | Bacteria | 779 |
| 233 | Ga0097620_100006840 | 3300006931 | Bacteria | 11584 |
| 234 | Ga0097620_100230980 | 3300006931 | Bacteria | 1938 |
| 235 | Ga0075435_100066728 | 3300007076 | Bacteria | 2928 |
| 236 | Ga0075435_100081935 | 3300007076 | Bacteria | 2651 |
| 237 | Ga0075435_100121001 | 3300007076 | Bacteria | 2184 |
| 238 | Ga0075435_100131752 | 3300007076 | Bacteria | 2092 |
| 239 | Ga0075435_101243231 | 3300007076 | Bacteria | 652 |
| 240 | Ga0075435_101250420 | 3300007076 | Bacteria | 650 |
| 241 | Ga0099794_10008590 | 3300007265 | Bacteria | 4252 |
| 242 | Ga0099794_10025323 | 3300007265 | Unclassified | 2731 |
| 243 | Ga0099794_10234168 | 3300007265 | Bacteria | 945 |
| 244 | Ga0099794_10530423 | 3300007265 | Bacteria | 621 |
| 245 | Ga0105240_10869923 | 3300009093 | Bacteria | 972 |
| 246 | Ga0111539_10153212 | 3300009094 | Unclassified | 2698 |
| 247 | Ga0111539_11072427 | 3300009094 | Bacteria | 936 |
| 248 | Ga0105245_10215285 | 3300009098 | Bacteria | 1851 |
| 249 | Ga0114129_10000074 | 3300009147 | Bacteria | 92340 |
| 250 | Ga0114129_10000893 | 3300009147 | Bacteria | 38856 |
| 251 | Ga0114129_10001132 | 3300009147 | Bacteria | 35229 |
| 252 | Ga0114129_10002386 | 3300009147 | Bacteria | 26094 |
| 253 | Ga0114129_10014235 | 3300009147 | Bacteria | 11335 |
| 254 | Ga0114129_10025545 | 3300009147 | Bacteria | 8368 |
| 255 | Ga0114129_10041361 | 3300009147 | Bacteria | 6495 |
| 256 | Ga0114129_10044920 | 3300009147 | Bacteria | 6213 |
| 257 | Ga0114129_10050132 | 3300009147 | Bacteria | 5865 |
| 258 | Ga0114129_10098924 | 3300009147 | Bacteria | 4037 |
| 259 | Ga0114129_10111142 | 3300009147 | Bacteria | 3782 |
| 260 | Ga0114129_10149320 | 3300009147 | Bacteria | 3199 |
| 261 | Ga0114129_10165930 | 3300009147 | Bacteria | 3014 |
| 262 | Ga0114129_10192171 | 3300009147 | Bacteria | 2771 |
| 263 | Ga0114129_10219538 | 3300009147 | Bacteria | 2565 |
| 264 | Ga0114129_10229368 | 3300009147 | Bacteria | 2502 |
| 265 | Ga0114129_10253697 | 3300009147 | Bacteria | 2360 |
| 266 | Ga0114129_10260573 | 3300009147 | Bacteria | 2324 |
| 267 | Ga0114129_10308035 | 3300009147 | Unclassified | 2109 |
| 268 | Ga0105243_10035661 | 3300009148 | Bacteria | 3857 |
| 269 | Ga0105243_10242607 | 3300009148 | Bacteria | 1604 |
| 270 | Ga0105243_10814419 | 3300009148 | Unclassified | 922 |
| 271 | Ga0105241_10000650 | 3300009174 | Bacteria | 26087 |
| 272 | Ga0105248_10022443 | 3300009177 | Bacteria | 7000 |
| 273 | Ga0105237_10036293 | 3300009545 | Bacteria | 4986 |
| 274 | Ga0105249_10097197 | 3300009553 | Bacteria | 2764 |
| 275 | Ga0157373_10005161 | 3300013100 | Bacteria | 9812 |
| 276 | Ga0157371_10156661 | 3300013102 | Bacteria | 1626 |
| 277 | Ga0157371_10165860 | 3300013102 | Bacteria | 1577 |
| 278 | Ga0157370_10236465 | 3300013104 | Bacteria | 1691 |
| 279 | Ga0157369_10023823 | 3300013105 | Bacteria | 6816 |
| 280 | Ga0157369_10119686 | 3300013105 | Bacteria | 2794 |
| 281 | Ga0157374_10393546 | 3300013296 | Bacteria | 1381 |
| 282 | Ga0157378_10464030 | 3300013297 | Bacteria | 1259 |
| 283 | Ga0157378_11336969 | 3300013297 | Bacteria | 758 |
| 284 | Ga0157372_10000746 | 3300013307 | Bacteria | 35404 |
| 285 | Ga0157372_10085982 | 3300013307 | Bacteria | 3568 |
| 286 | Ga0157372_10495332 | 3300013307 | Bacteria | 1425 |
| 287 | Ga0157375_11804818 | 3300013308 | Bacteria | 725 |
| 288 | Ga0163163_10030503 | 3300014325 | Bacteria | 5196 |
| 289 | Ga0163163_10196633 | 3300014325 | Bacteria | 2064 |
| 290 | Ga0157380_10418667 | 3300014326 | Bacteria | 1277 |
| 291 | Ga0157380_10653418 | 3300014326 | Bacteria | 1049 |
| 292 | Ga0157379_10230549 | 3300014968 | Bacteria | 1678 |
| 293 | Ga0157379_10244236 | 3300014968 | Bacteria | 1629 |
| 294 | Ga0157376_11034033 | 3300014969 | Unclassified | 845 |
| 295 | Ga0157376_11562853 | 3300014969 | Bacteria | 693 |
| 296 | Ga0197907_10121884 | 3300020069 | Bacteria | 681 |
| 297 | Ga0206356_11013378 | 3300020070 | Bacteria | 1011 |
| 298 | Ga0206356_11834943 | 3300020070 | Bacteria | 2169 |
| 299 | Ga0206353_10128875 | 3300020082 | Bacteria | 2127 |
| 300 | Ga0206353_11558259 | 3300020082 | Bacteria | 1255 |
| 301 | Ga0224712_10026200 | 3300022467 | Bacteria | 2059 |
| 302 | Ga0224712_10152723 | 3300022467 | Bacteria | 1024 |
| 303 | Ga0207680_10189322 | 3300025903 | Bacteria | 1396 |
| 304 | Ga0207685_10009271 | 3300025905 | Unclassified | 2851 |
| 305 | Ga0207699_10123723 | 3300025906 | Bacteria | 1676 |
| 306 | Ga0207645_10007485 | 3300025907 | Bacteria | 7706 |
| 307 | Ga0207645_10021617 | 3300025907 | Bacteria | 4194 |
| 308 | Ga0207643_10000210 | 3300025908 | Bacteria | 40925 |
| 309 | Ga0207705_10032819 | 3300025909 | Bacteria | 3710 |
| 310 | Ga0207684_10000501 | 3300025910 | Bacteria | 49523 |
| 311 | Ga0207684_10002039 | 3300025910 | Bacteria | 20805 |
| 312 | Ga0207684_10007653 | 3300025910 | Bacteria | 9689 |
| 313 | Ga0207684_10008119 | 3300025910 | Bacteria | 9358 |
| 314 | Ga0207684_10028818 | 3300025910 | Bacteria | 4729 |
| 315 | Ga0207684_10034707 | 3300025910 | Unclassified | 4285 |
| 316 | Ga0207684_10056223 | 3300025910 | Bacteria | 3338 |
| 317 | Ga0207684_10085803 | 3300025910 | Bacteria | 2681 |
| 318 | Ga0207684_10180500 | 3300025910 | Bacteria | 1820 |
| 319 | Ga0207684_10316733 | 3300025910 | Bacteria | 1345 |
| 320 | Ga0207684_10502421 | 3300025910 | Bacteria | 1039 |
| 321 | Ga0207684_10503206 | 3300025910 | Unclassified | 1038 |
| 322 | Ga0207654_10011378 | 3300025911 | Bacteria | 4539 |
| 323 | Ga0207707_10016649 | 3300025912 | Bacteria | 6408 |
| 324 | Ga0207707_10032880 | 3300025912 | Bacteria | 4540 |
| 325 | Ga0207707_10033934 | 3300025912 | Bacteria | 4466 |
| 326 | Ga0207707_10879771 | 3300025912 | Unclassified | 742 |
| 327 | Ga0207695_10799377 | 3300025913 | Bacteria | 823 |
| 328 | Ga0207671_10202283 | 3300025914 | Bacteria | 1551 |
| 329 | Ga0207693_10218796 | 3300025915 | Bacteria | 1496 |
| 330 | Ga0207660_10010898 | 3300025917 | Bacteria | 5910 |
| 331 | Ga0207660_10114294 | 3300025917 | Bacteria | 2036 |
| 332 | Ga0207660_10172389 | 3300025917 | Bacteria | 1676 |
| 333 | Ga0207660_10991288 | 3300025917 | Bacteria | 685 |
| 334 | Ga0207662_10016639 | 3300025918 | Bacteria | 4152 |
| 335 | Ga0207657_10001132 | 3300025919 | Bacteria | 28327 |
| 336 | Ga0207649_10001277 | 3300025920 | Bacteria | 15028 |
| 337 | Ga0207649_10022014 | 3300025920 | Bacteria | 3679 |
| 338 | Ga0207652_10002841 | 3300025921 | Bacteria | 14517 |
| 339 | Ga0207652_10108289 | 3300025921 | Bacteria | 2462 |
| 340 | Ga0207646_10003794 | 3300025922 | Bacteria | 16820 |
| 341 | Ga0207646_10004103 | 3300025922 | Bacteria | 16045 |
| 342 | Ga0207646_10007888 | 3300025922 | Bacteria | 10745 |
| 343 | Ga0207646_10008540 | 3300025922 | Bacteria | 10250 |
| 344 | Ga0207646_10015545 | 3300025922 | Bacteria | 7184 |
| 345 | Ga0207646_10020443 | 3300025922 | Bacteria | 6133 |
| 346 | Ga0207646_10046814 | 3300025922 | Bacteria | 3880 |
| 347 | Ga0207646_10088629 | 3300025922 | Bacteria | 2769 |
| 348 | Ga0207646_10223246 | 3300025922 | Bacteria | 1702 |
| 349 | Ga0207646_10292016 | 3300025922 | Unclassified | 1473 |
| 350 | Ga0207646_10384808 | 3300025922 | Bacteria | 1267 |
| 351 | Ga0207646_10512661 | 3300025922 | Bacteria | 1080 |
| 352 | Ga0207646_10689867 | 3300025922 | Unclassified | 913 |
| 353 | Ga0207681_10152750 | 3300025923 | Bacteria | 1732 |
| 354 | Ga0207681_10543912 | 3300025923 | Unclassified | 955 |
| 355 | Ga0207650_10041437 | 3300025925 | Bacteria | 3374 |
| 356 | Ga0207687_10142795 | 3300025927 | Bacteria | 1818 |
| 357 | Ga0207700_10240372 | 3300025928 | Bacteria | 1543 |
| 358 | Ga0207664_10036203 | 3300025929 | Bacteria | 3814 |
| 359 | Ga0207664_10059535 | 3300025929 | Bacteria | 3042 |
| 360 | Ga0207690_10003389 | 3300025932 | Bacteria | 9519 |
| 361 | Ga0207706_10051460 | 3300025933 | Bacteria | 3637 |
| 362 | Ga0207706_10579999 | 3300025933 | Unclassified | 964 |
| 363 | Ga0207709_10048879 | 3300025935 | Bacteria | 2579 |
| 364 | Ga0207709_10774398 | 3300025935 | Bacteria | 773 |
| 365 | Ga0207670_10033490 | 3300025936 | Bacteria | 3312 |
| 366 | Ga0207670_10259098 | 3300025936 | Unclassified | 1347 |
| 367 | Ga0207704_11306458 | 3300025938 | Bacteria | 620 |
| 368 | Ga0207665_10189926 | 3300025939 | Bacteria | 1492 |
| 369 | Ga0207711_10045468 | 3300025941 | Bacteria | 3752 |
| 370 | Ga0207689_10001491 | 3300025942 | Bacteria | 22363 |
| 371 | Ga0207689_10042483 | 3300025942 | Bacteria | 3760 |
| 372 | Ga0207661_10042351 | 3300025944 | Bacteria | 3589 |
| 373 | Ga0207679_10001453 | 3300025945 | Bacteria | 14876 |
| 374 | Ga0207679_11455797 | 3300025945 | Bacteria | 628 |
| 375 | Ga0207667_10003068 | 3300025949 | Bacteria | 20705 |
| 376 | Ga0207667_10236810 | 3300025949 | Bacteria | 1868 |
| 377 | Ga0207712_10041976 | 3300025961 | Bacteria | 3147 |
| 378 | Ga0207668_10672375 | 3300025972 | Bacteria | 908 |
| 379 | Ga0207640_10005366 | 3300025981 | Bacteria | 6992 |
| 380 | Ga0207640_10161292 | 3300025981 | Bacteria | 1659 |
| 381 | Ga0207639_10004549 | 3300026041 | Bacteria | 9340 |
| 382 | Ga0207678_10025484 | 3300026067 | Bacteria | 5162 |
| 383 | Ga0207708_10574774 | 3300026075 | Bacteria | 952 |
| 384 | Ga0207708_11182765 | 3300026075 | Bacteria | 668 |
| 385 | Ga0207702_10002765 | 3300026078 | Bacteria | 16425 |
| 386 | Ga0207702_10418962 | 3300026078 | Bacteria | 1295 |
| 387 | Ga0207702_11469896 | 3300026078 | Unclassified | 675 |
| 388 | Ga0207641_10092610 | 3300026088 | Bacteria | 2647 |
| 389 | Ga0207648_10000854 | 3300026089 | Bacteria | 34339 |
| 390 | Ga0207648_10323495 | 3300026089 | Bacteria | 1386 |
| 391 | Ga0207674_10001007 | 3300026116 | Bacteria | 36810 |
| 392 | Ga0207674_10054189 | 3300026116 | Bacteria | 4084 |
| 393 | Ga0207674_10112218 | 3300026116 | Bacteria | 2700 |
| 394 | Ga0207675_100129549 | 3300026118 | Bacteria | 2392 |
| 395 | Ga0207675_100832085 | 3300026118 | Bacteria | 937 |
| 396 | Ga0207698_10149757 | 3300026142 | Bacteria | 2023 |
| 397 | Ga0209969_1016635 | 3300027360 | Bacteria | 1080 |
| 398 | Ga0209981_1051225 | 3300027378 | Eukaryota | 625 |
| 399 | Ga0209996_1004068 | 3300027395 | Bacteria | 1854 |
| 400 | Ga0210000_1006342 | 3300027462 | Bacteria | 1722 |
| 401 | Ga0209995_1001777 | 3300027471 | Bacteria | 3355 |
| 402 | Ga0209968_1002224 | 3300027526 | Bacteria | 2936 |
| 403 | Ga0209999_1008541 | 3300027543 | Bacteria | 1849 |
| 404 | Ga0209999_1027556 | 3300027543 | Bacteria | 1052 |
| 405 | Ga0209970_1000996 | 3300027614 | Bacteria | 5034 |
| 406 | Ga0210002_1005220 | 3300027617 | Bacteria | 1949 |
| 407 | Ga0209983_1004209 | 3300027665 | Bacteria | 3034 |
| 408 | Ga0209588_1006881 | 3300027671 | Bacteria | 3326 |
| 409 | Ga0209971_1000015 | 3300027682 | Bacteria | 65578 |
| 410 | Ga0209966_1000025 | 3300027695 | Bacteria | 66143 |
| 411 | Ga0209998_10002824 | 3300027717 | Bacteria | 3906 |
| 412 | Ga0209998_10021687 | 3300027717 | Unclassified | 1380 |
| 413 | Ga0209974_10006662 | 3300027876 | Bacteria | 4017 |
| 414 | Ga0207428_10005120 | 3300027907 | Bacteria | 12294 |
| 415 | Ga0268265_10012051 | 3300028380 | Bacteria | 5854 |
| 416 | Ga0268265_10093772 | 3300028380 | Bacteria | 2406 |
| 417 | Ga0268265_11382477 | 3300028380 | Bacteria | 706 |
| 418 | Ga0268264_10031816 | 3300028381 | Bacteria | 4327 |
| 419 | Ga0268264_10900229 | 3300028381 | Bacteria | 888 |
| 420 | Ga0307408_100241287 | 3300031548 | Unclassified | 1485 |
| 421 | Ga0307408_100365387 | 3300031548 | Bacteria | 1229 |
| 422 | Ga0316575_10000724 | 3300031665 | Bacteria | 9915 |
| 423 | Ga0316575_10084478 | 3300031665 | Bacteria | 1282 |
| 424 | Ga0316575_10196680 | 3300031665 | Bacteria | 839 |
| 425 | Ga0316575_10235249 | 3300031665 | Bacteria | 766 |
| 426 | Ga0316579_10062978 | 3300031691 | Bacteria | 1747 |
| 427 | Ga0316579_10133018 | 3300031691 | Bacteria | 1198 |
| 428 | Ga0316579_10183418 | 3300031691 | Unclassified | 1012 |
| 429 | Ga0316579_10266604 | 3300031691 | Unclassified | 828 |
| 430 | Ga0316579_10285564 | 3300031691 | Bacteria | 798 |
| 431 | Ga0316576_10028193 | 3300031727 | Unclassified | 3955 |
| 432 | Ga0316576_10085369 | 3300031727 | Bacteria | 2346 |
| 433 | Ga0316576_10216222 | 3300031727 | Bacteria | 1442 |
| 434 | Ga0316576_10270657 | 3300031727 | Bacteria | 1273 |
| 435 | Ga0316576_10290079 | 3300031727 | Bacteria | 1224 |
| 436 | Ga0316576_10467545 | 3300031727 | Bacteria | 930 |
| 437 | Ga0316578_10005511 | 3300031728 | Bacteria | 6147 |
| 438 | Ga0316578_10011441 | 3300031728 | Bacteria | 4644 |
| 439 | Ga0316578_10069480 | 3300031728 | Bacteria | 2084 |
| 440 | Ga0316578_10369739 | 3300031728 | Bacteria | 852 |
| 441 | Ga0316577_10000364 | 3300031733 | Bacteria | 17032 |
| 442 | Ga0316577_10025713 | 3300031733 | Bacteria | 3274 |
| 443 | Ga0316577_10083992 | 3300031733 | Bacteria | 1781 |
| 444 | Ga0316577_10101974 | 3300031733 | Bacteria | 1609 |
| 445 | Ga0316577_10241950 | 3300031733 | Bacteria | 1020 |
| 446 | Ga0307413_11078027 | 3300031824 | Bacteria | 693 |
| 447 | Ga0307406_10293912 | 3300031901 | Bacteria | 1245 |
| 448 | Ga0307406_10690640 | 3300031901 | Bacteria | 851 |
| 449 | Ga0307416_101168467 | 3300032002 | Bacteria | 875 |
| 450 | Ga0307411_10483894 | 3300032005 | Bacteria | 1043 |
| 451 | Ga0307411_11556843 | 3300032005 | Bacteria | 609 |
| 452 | Ga0316583_10001181 | 3300032133 | Bacteria | 8558 |
| 453 | Ga0316583_10040210 | 3300032133 | Bacteria | 1655 |
| 454 | Ga0316583_10047352 | 3300032133 | Bacteria | 1516 |
| 455 | Ga0316585_10000005 | 3300032137 | Bacteria | 32299 |
| 456 | Ga0316593_10008379 | 3300032168 | Bacteria | 2880 |
| 457 | Ga0316593_10064020 | 3300032168 | Bacteria | 1262 |
| 458 | Ga0316593_10070365 | 3300032168 | Bacteria | 1209 |
| 459 | Ga0316593_10090249 | 3300032168 | Unclassified | 1079 |
| 460 | Ga0373948_0136983 | 3300034817 | Bacteria | 603 |
| 461 | Ga0373951_0015985 | 3300035091 | Bacteria | 1692 |
| 462 | Ga0373952_0025089 | 3300035092 | Bacteria | 1285 |
| 463 | Ga0373932_0311443 | 3300035112 | Bacteria | 590 |
| 464 | Ga0373941_0022104 | 3300035115 | Bacteria | 1802 |
| 465 | Ga0373960_0015883 | 3300035121 | Bacteria | 1929 |
| 466 | Ga0316574_0000011 | 3300035398 | Bacteria | 45512 |
| 467 | Ga0316574_0028169 | 3300035398 | Bacteria | 3386 |
| 468 | Ga0316574_0031606 | 3300035398 | Bacteria | 3211 |
| 469 | Ga0316574_0043584 | 3300035398 | Bacteria | 2772 |
| 470 | Ga0373927_0002036 | 3300035695 | Bacteria | 14892 |
| 471 | Ga0373937_0841189 | 3300036401 | Bacteria | 866 |
| 472 | Ga0316582_0007758 | 3300036647 | Bacteria | 5732 |
| 473 | Ga0316582_0009425 | 3300036647 | Bacteria | 5300 |
| 474 | Ga0316582_0076840 | 3300036647 | Bacteria | 2172 |
| 475 | Ga0316582_0091738 | 3300036647 | Bacteria | 2001 |
| 476 | Ga0316582_0100139 | 3300036647 | Unclassified | 1918 |
| 477 | Ga0316582_0243059 | 3300036647 | Unclassified | 1233 |
| 478 | Ga0316582_0276498 | 3300036647 | Bacteria | 1152 |
| 479 | Ga0316582_0410119 | 3300036647 | Unclassified | 933 |
| 480 | Ga0316582_0555687 | 3300036647 | Unclassified | 791 |
| 481 | Ga0316582_0629696 | 3300036647 | Unclassified | 738 |
| 482 | Ga0316584_0007998 | 3300036712 | Bacteria | 7259 |
| 483 | Ga0316584_0014805 | 3300036712 | Bacteria | 5570 |
| 484 | Ga0316584_0018842 | 3300036712 | Bacteria | 4983 |
| 485 | Ga0316584_0061293 | 3300036712 | Bacteria | 2817 |
| 486 | Ga0316584_0154835 | 3300036712 | Bacteria | 1705 |
| 487 | Ga0316584_0184968 | 3300036712 | Bacteria | 1542 |
| 488 | Ga0316584_0196017 | 3300036712 | Bacteria | 1492 |
| 489 | Ga0316584_0284559 | 3300036712 | Unclassified | 1201 |
| 490 | Ga0316584_0431949 | 3300036712 | Bacteria | 934 |
| 491 | Ga0395899_0321354 | 3300037312 | Bacteria | 1042 |
| 492 | Ga0395900_0039595 | 3300037418 | Bacteria | 4856 |
| 493 | Ga0395900_0557859 | 3300037418 | Bacteria | 1089 |
| 494 | Ga0395898_0702193 | 3300037466 | Bacteria | 953 |
| 495 | Ga0395905_0012207 | 3300037471 | Bacteria | 8275 |
| 496 | Ga0316581_0007940 | 3300037588 | Bacteria | 2870 |
| 497 | Ga0316581_0095150 | 3300037588 | Bacteria | 917 |
| 498 | Ga0316581_0180898 | 3300037588 | Unclassified | 650 |
| 499 | Ga0395901_0100457 | 3300038443 | Unclassified | 3035 |
| 500 | Ga0400490_07043 | 3300038726 | Bacteria | 1024 |
| 501 | Ga0400485_12648 | 3300038735 | Bacteria | 70172 |
| 502 | Ga0400486_19650 | 3300038742 | Bacteria | 31391 |
| 503 | Ga0242420_008752 | 3300038996 | Unclassified | 1649 |
| 504 | Ga0242420_009466 | 3300038996 | Bacteria | 1599 |
| 505 | Ga0242420_011643 | 3300038996 | Bacteria | 1479 |
| 506 | Ga0242420_027015 | 3300038996 | Bacteria | 1050 |
| 507 | Ga0400489_55776 | 3300039093 | Bacteria | 15112 |
| 508 | Ga0400487_35590 | 3300039110 | Bacteria | 25492 |
| 509 | Ga0439441_078405 | 3300042001 | Bacteria | 716 |
| 510 | Ga0439448_0071818 | 3300042005 | Bacteria | 1153 |
| 511 | Ga0439455_0008138 | 3300042012 | Bacteria | 2241 |
| 512 | Ga0439455_0072089 | 3300042012 | Bacteria | 929 |
| 513 | Ga0450889_004308 | 3300042144 | Bacteria | 1407 |
| 514 | Ga0439458_0006689 | 3300042157 | Bacteria | 2569 |
| 515 | Ga0439459_0004125 | 3300042438 | Bacteria | 2326 |
| 516 | Ga0439464_0018432 | 3300042439 | Bacteria | 1899 |
| 517 | Ga0439464_0038737 | 3300042439 | Bacteria | 1354 |
| 518 | Ga0439460_0001601 | 3300042461 | Bacteria | 5361 |
| 519 | Ga0450893_0061635 | 3300042532 | Bacteria | 717 |
| 520 | Ga0451577_0078028 | 3300042876 | Bacteria | 2953 |
| 521 | Ga0451577_0198191 | 3300042876 | Bacteria | 1812 |
| 522 | Ga0451577_0242690 | 3300042876 | Bacteria | 1630 |
| 523 | Ga0439440_0055770 | 3300042993 | Bacteria | 998 |
| 524 | Ga0453683_0036968 | 3300044673 | Unclassified | 3072 |
| 525 | Ga0453683_0105587 | 3300044673 | Bacteria | 1770 |
| 526 | Ga0453683_0156588 | 3300044673 | Bacteria | 1440 |
| 527 | Ga0453683_0608074 | 3300044673 | Bacteria | 713 |
| 528 | Ga0453684_0044975 | 3300044712 | Bacteria | 5896 |
| 529 | Ga0453684_1461051 | 3300044712 | Bacteria | 707 |
| 530 | Ga0466959_0612198 | 3300045049 | Unclassified | 732 |
| 531 | Ga0451576_0012483 | 3300045051 | Bacteria | 9539 |
| 532 | Ga0451576_0022854 | 3300045051 | Bacteria | 6775 |
| 533 | Ga0451576_0073514 | 3300045051 | Bacteria | 3557 |
| 534 | Ga0451576_0119751 | 3300045051 | Bacteria | 2740 |
| 535 | Ga0451576_0376510 | 3300045051 | Unclassified | 1488 |
| 536 | Ga0451576_0837922 | 3300045051 | Unclassified | 965 |
| 537 | Ga0495629_0145917 | 3300046459 | Bacteria | 1646 |
| 538 | Ga0495630_0113280 | 3300046517 | Bacteria | 2055 |
| 539 | Ga0495665_0241085 | 3300046531 | Bacteria | 932 |
| 540 | Ga0495657_0776326 | 3300046675 | Bacteria | 548 |
| 541 | Ga0495581_0134020 | 3300047315 | Bacteria | 1444 |
| 542 | Ga0495614_0059104 | 3300048089 | Bacteria | 1647 |
| 543 | Ga0496102_0051265 | 3300048905 | Bacteria | 3760 |
| 544 | Ga0496102_0080800 | 3300048905 | Bacteria | 2996 |
| 545 | Ga0496102_0841493 | 3300048905 | Bacteria | 840 |
| 546 | Ga0496104_0012746 | 3300048907 | Bacteria | 7573 |
| 547 | Ga0496104_0738211 | 3300048907 | Bacteria | 892 |
| 548 | Ga0496105_0068439 | 3300048908 | Bacteria | 2933 |
| 549 | Ga0496106_0054853 | 3300048909 | Bacteria | 3012 |
| 550 | Ga0496106_1067290 | 3300048909 | Bacteria | 634 |
| 551 | Ga0496108_0011753 | 3300048911 | Bacteria | 7120 |
| 552 | Ga0496109_0203779 | 3300048912 | Bacteria | 1860 |
| 553 | Ga0496109_0678498 | 3300048912 | Unclassified | 968 |
| 554 | Ga0496110_0024875 | 3300048913 | Bacteria | 5109 |
| 555 | Ga0496111_0012377 | 3300048914 | Bacteria | 5774 |
| 556 | Ga0496112_0066335 | 3300048915 | Bacteria | 3561 |
| 557 | Ga0496112_0066764 | 3300048915 | Bacteria | 3549 |
| 558 | Ga0496113_0006938 | 3300048916 | Bacteria | 7236 |
| 559 | Ga0496113_1182081 | 3300048916 | Bacteria | 598 |
| 560 | Ga0501031_0031403 | 3300049568 | Bacteria | 3465 |
| 561 | Ga0501032_0430586 | 3300049569 | Bacteria | 846 |
| 562 | Ga0501033_0279268 | 3300049570 | Bacteria | 1179 |
| 563 | Ga0501033_0283430 | 3300049570 | Bacteria | 1169 |
| 564 | Ga0501036_0001561 | 3300049572 | Bacteria | 17690 |
| 565 | Ga0501036_0031720 | 3300049572 | Bacteria | 4465 |
| 566 | Ga0501036_0059724 | 3300049572 | Bacteria | 3231 |
| 567 | Ga0501036_0105276 | 3300049572 | Bacteria | 2386 |
| 568 | Ga0501036_0239478 | 3300049572 | Bacteria | 1522 |
| 569 | Ga0501036_0272545 | 3300049572 | Unclassified | 1417 |
| 570 | Ga0501036_0483946 | 3300049572 | Bacteria | 1030 |
| 571 | Ga0501036_0645479 | 3300049572 | Bacteria | 876 |
| 572 | Ga0501036_0762708 | 3300049572 | Bacteria | 798 |
| 573 | Ga0501037_0076391 | 3300049573 | Bacteria | 2432 |
| 574 | Ga0501037_0355717 | 3300049573 | Bacteria | 1009 |
| 575 | Ga0501037_0391551 | 3300049573 | Bacteria | 954 |
| 576 | Ga0501038_0002016 | 3300049574 | Bacteria | 18755 |
| 577 | Ga0501038_0119864 | 3300049574 | Bacteria | 2171 |
| 578 | Ga0501038_0353056 | 3300049574 | Bacteria | 1145 |
| 579 | Ga0501038_0447805 | 3300049574 | Bacteria | 993 |
| 580 | Ga0501039_0017830 | 3300049575 | Bacteria | 5446 |
| 581 | Ga0501039_0294315 | 3300049575 | Bacteria | 1276 |
| 582 | Ga0501039_0425139 | 3300049575 | Bacteria | 1043 |
| 583 | Ga0501039_0660556 | 3300049575 | Bacteria | 818 |
| 584 | Ga0501040_0021002 | 3300049576 | Bacteria | 4354 |
| 585 | Ga0501040_0022215 | 3300049576 | Bacteria | 4244 |
| 586 | Ga0501040_0122858 | 3300049576 | Bacteria | 1822 |
| 587 | Ga0501040_0135686 | 3300049576 | Bacteria | 1732 |
| 588 | Ga0501040_0139836 | 3300049576 | Bacteria | 1705 |
| 589 | Ga0501040_0145412 | 3300049576 | Bacteria | 1671 |
| 590 | Ga0501040_0431252 | 3300049576 | Bacteria | 948 |
| 591 | Ga0501040_0445544 | 3300049576 | Bacteria | 932 |
| 592 | Ga0501040_0762199 | 3300049576 | Bacteria | 700 |
| 593 | Ga0501041_0003824 | 3300049577 | Bacteria | 8665 |
| 594 | Ga0501041_0014897 | 3300049577 | Bacteria | 4617 |
| 595 | Ga0501041_0051508 | 3300049577 | Bacteria | 2509 |
| 596 | Ga0501041_0086635 | 3300049577 | Bacteria | 1932 |
| 597 | Ga0501041_0103756 | 3300049577 | Bacteria | 1761 |
| 598 | Ga0501041_0391180 | 3300049577 | Bacteria | 880 |
| 599 | Ga0501041_0471638 | 3300049577 | Bacteria | 797 |
| 600 | Ga0501041_0484214 | 3300049577 | Bacteria | 786 |
| 601 | Ga0501042_0002923 | 3300049578 | Bacteria | 10608 |
| 602 | Ga0501042_0033753 | 3300049578 | Bacteria | 3628 |
| 603 | Ga0501042_0048990 | 3300049578 | Bacteria | 3013 |
| 604 | Ga0501042_0053577 | 3300049578 | Bacteria | 2878 |
| 605 | Ga0501042_0071800 | 3300049578 | Bacteria | 2477 |
| 606 | Ga0501042_0108182 | 3300049578 | Bacteria | 2002 |
| 607 | Ga0501042_0598797 | 3300049578 | Bacteria | 801 |
| 608 | Ga0501043_0143931 | 3300049579 | Bacteria | 1866 |
| 609 | Ga0501043_0531830 | 3300049579 | Bacteria | 875 |
| 610 | Ga0501043_0822853 | 3300049579 | Bacteria | 670 |
| 611 | Ga0501046_0000476 | 3300049580 | Bacteria | 40171 |
| 612 | Ga0501046_0023214 | 3300049580 | Bacteria | 5104 |
| 613 | Ga0501046_0036233 | 3300049580 | Bacteria | 3972 |
| 614 | Ga0501046_0116441 | 3300049580 | Bacteria | 2037 |
| 615 | Ga0501046_0116530 | 3300049580 | Bacteria | 2036 |
| 616 | Ga0501046_0155913 | 3300049580 | Bacteria | 1720 |
| 617 | Ga0501046_0236450 | 3300049580 | Bacteria | 1348 |
| 618 | Ga0501046_0874773 | 3300049580 | Bacteria | 628 |
| 619 | Ga0501047_0062026 | 3300049581 | Bacteria | 3607 |
| 620 | Ga0501048_0006058 | 3300049582 | Bacteria | 9207 |
| 621 | Ga0501048_0007656 | 3300049582 | Bacteria | 8189 |
| 622 | Ga0501048_0027939 | 3300049582 | Bacteria | 4098 |
| 623 | Ga0501048_0141175 | 3300049582 | Bacteria | 1703 |
| 624 | Ga0501048_0269442 | 3300049582 | Bacteria | 1210 |
| 625 | Ga0501048_0301898 | 3300049582 | Unclassified | 1139 |
| 626 | Ga0501048_0671629 | 3300049582 | Bacteria | 744 |
| 627 | Ga0501048_0693543 | 3300049582 | Bacteria | 731 |
| 628 | Ga0501068_0054941 | 3300049584 | Bacteria | 2413 |
| 629 | Ga0501068_0064140 | 3300049584 | Bacteria | 2235 |
| 630 | Ga0501068_0066202 | 3300049584 | Bacteria | 2200 |
| 631 | Ga0501068_0157188 | 3300049584 | Bacteria | 1432 |
| 632 | Ga0501068_0344449 | 3300049584 | Unclassified | 957 |
| 633 | Ga0501068_0421403 | 3300049584 | Bacteria | 862 |
| 634 | Ga0501068_0454190 | 3300049584 | Bacteria | 829 |
| 635 | Ga0501069_0032278 | 3300049585 | Bacteria | 2882 |
| 636 | Ga0501069_0146851 | 3300049585 | Bacteria | 1354 |
| 637 | Ga0501070_0079961 | 3300049586 | Bacteria | 2705 |
| 638 | Ga0501070_0727127 | 3300049586 | Bacteria | 784 |
| 639 | Ga0501071_0000146 | 3300049587 | Bacteria | 29418 |
| 640 | Ga0501071_0017630 | 3300049587 | Bacteria | 4929 |
| 641 | Ga0501071_0028787 | 3300049587 | Bacteria | 3917 |
| 642 | Ga0501071_0142655 | 3300049587 | Bacteria | 1784 |
| 643 | Ga0501071_0150657 | 3300049587 | Bacteria | 1735 |
| 644 | Ga0501071_0266387 | 3300049587 | Bacteria | 1295 |
| 645 | Ga0501071_0420821 | 3300049587 | Bacteria | 1021 |
| 646 | Ga0501071_0611609 | 3300049587 | Bacteria | 838 |
| 647 | Ga0501071_0632587 | 3300049587 | Unclassified | 823 |
| 648 | Ga0501072_0001090 | 3300049588 | Bacteria | 20179 |
| 649 | Ga0501072_0024330 | 3300049588 | Bacteria | 4710 |
| 650 | Ga0501072_0049544 | 3300049588 | Bacteria | 3306 |
| 651 | Ga0501072_0092290 | 3300049588 | Bacteria | 2405 |
| 652 | Ga0501072_0104792 | 3300049588 | Bacteria | 2248 |
| 653 | Ga0501072_0125191 | 3300049588 | Bacteria | 2047 |
| 654 | Ga0501072_0140833 | 3300049588 | Bacteria | 1923 |
| 655 | Ga0501072_0452674 | 3300049588 | Bacteria | 1016 |
| 656 | Ga0501072_1015092 | 3300049588 | Bacteria | 646 |
| 657 | Ga0501073_0112475 | 3300049589 | Bacteria | 1889 |
| 658 | Ga0501073_0283161 | 3300049589 | Bacteria | 1144 |
| 659 | Ga0501073_0373660 | 3300049589 | Bacteria | 985 |
| 660 | Ga0501073_0589683 | 3300049589 | Bacteria | 768 |
| 661 | Ga0501073_0631443 | 3300049589 | Bacteria | 739 |
| 662 | Ga0501074_0020451 | 3300049590 | Bacteria | 4810 |
| 663 | Ga0501074_0143337 | 3300049590 | Unclassified | 1709 |
| 664 | Ga0501074_0175619 | 3300049590 | Bacteria | 1529 |
| 665 | Ga0501074_0348253 | 3300049590 | Bacteria | 1051 |
| 666 | Ga0501074_0485847 | 3300049590 | Bacteria | 875 |
| 667 | Ga0501074_0555007 | 3300049590 | Bacteria | 813 |
| 668 | Ga0501074_0560808 | 3300049590 | Bacteria | 808 |
| 669 | Ga0501074_0589570 | 3300049590 | Bacteria | 786 |
| 670 | Ga0501075_0000205 | 3300049591 | Bacteria | 31452 |
| 671 | Ga0501075_0006572 | 3300049591 | Bacteria | 8008 |
| 672 | Ga0501075_0008457 | 3300049591 | Bacteria | 7180 |
| 673 | Ga0501075_0029261 | 3300049591 | Bacteria | 4072 |
| 674 | Ga0501075_0083369 | 3300049591 | Bacteria | 2421 |
| 675 | Ga0501075_0121126 | 3300049591 | Bacteria | 1991 |
| 676 | Ga0501075_0145036 | 3300049591 | Bacteria | 1809 |
| 677 | Ga0501075_0177679 | 3300049591 | Bacteria | 1624 |
| 678 | Ga0501075_0196867 | 3300049591 | Bacteria | 1537 |
| 679 | Ga0501075_0237524 | 3300049591 | Bacteria | 1389 |
| 680 | Ga0501075_0263584 | 3300049591 | Unclassified | 1313 |
| 681 | Ga0501075_0370602 | 3300049591 | Unclassified | 1091 |
| 682 | Ga0501076_0000137 | 3300049592 | Bacteria | 41327 |
| 683 | Ga0501076_0000395 | 3300049592 | Bacteria | 27358 |
| 684 | Ga0501076_0003994 | 3300049592 | Bacteria | 10422 |
| 685 | Ga0501076_0007226 | 3300049592 | Bacteria | 8081 |
| 686 | Ga0501076_0058543 | 3300049592 | Bacteria | 3063 |
| 687 | Ga0501076_0115470 | 3300049592 | Bacteria | 2172 |
| 688 | Ga0501076_0154646 | 3300049592 | Bacteria | 1866 |
| 689 | Ga0501076_0246814 | 3300049592 | Bacteria | 1461 |
| 690 | Ga0501076_0445008 | 3300049592 | Bacteria | 1066 |
| 691 | Ga0501076_0926682 | 3300049592 | Bacteria | 718 |
| 692 | Ga0501076_1018049 | 3300049592 | Bacteria | 682 |
| 693 | Ga0501077_0006006 | 3300049593 | Bacteria | 7415 |
| 694 | Ga0501077_0011430 | 3300049593 | Bacteria | 5544 |
| 695 | Ga0501077_0014533 | 3300049593 | Bacteria | 4948 |
| 696 | Ga0501077_0019267 | 3300049593 | Bacteria | 4315 |
| 697 | Ga0501077_0057319 | 3300049593 | Bacteria | 2473 |
| 698 | Ga0501077_0062680 | 3300049593 | Bacteria | 2359 |
| 699 | Ga0501077_0083247 | 3300049593 | Bacteria | 2027 |
| 700 | Ga0501077_0185891 | 3300049593 | Bacteria | 1320 |
| 701 | Ga0501077_0477996 | 3300049593 | Bacteria | 798 |
| 702 | Ga0501079_0003718 | 3300049741 | Bacteria | 11255 |
| 703 | Ga0501079_0016521 | 3300049741 | Bacteria | 5638 |
| 704 | Ga0501079_0022665 | 3300049741 | Bacteria | 4818 |
| 705 | Ga0501079_0031727 | 3300049741 | Bacteria | 4060 |
| 706 | Ga0501079_0076365 | 3300049741 | Bacteria | 2591 |
| 707 | Ga0501079_0824170 | 3300049741 | Bacteria | 731 |
| 708 | Ga0501080_0004005 | 3300049742 | Bacteria | 13042 |
| 709 | Ga0501080_0026494 | 3300049742 | Bacteria | 5387 |
| 710 | Ga0501080_0110225 | 3300049742 | Bacteria | 2551 |
| 711 | Ga0501080_0138619 | 3300049742 | Bacteria | 2250 |
| 712 | Ga0501080_0141524 | 3300049742 | Bacteria | 2224 |
| 713 | Ga0501080_0190991 | 3300049742 | Bacteria | 1882 |
| 714 | Ga0501080_0192249 | 3300049742 | Bacteria | 1875 |
| 715 | Ga0501080_0279095 | 3300049742 | Bacteria | 1519 |
| 716 | Ga0501080_0360483 | 3300049742 | Bacteria | 1312 |
| 717 | Ga0501081_0000816 | 3300049743 | Bacteria | 18394 |
| 718 | Ga0501081_0003078 | 3300049743 | Bacteria | 10589 |
| 719 | Ga0501081_0008477 | 3300049743 | Bacteria | 6681 |
| 720 | Ga0501081_0012639 | 3300049743 | Bacteria | 5550 |
| 721 | Ga0501081_0017401 | 3300049743 | Bacteria | 4757 |
| 722 | Ga0501081_0034761 | 3300049743 | Bacteria | 3430 |
| 723 | Ga0501081_0091688 | 3300049743 | Bacteria | 2137 |
| 724 | Ga0501081_0104979 | 3300049743 | Bacteria | 2001 |
| 725 | Ga0501081_0128041 | 3300049743 | Bacteria | 1812 |
| 726 | Ga0501081_0216605 | 3300049743 | Bacteria | 1392 |
| 727 | Ga0501081_0311467 | 3300049743 | Bacteria | 1156 |
| 728 | Ga0501081_0426614 | 3300049743 | Unclassified | 983 |
| 729 | Ga0501081_0460685 | 3300049743 | Bacteria | 945 |
| 730 | Ga0501083_0059827 | 3300049744 | Bacteria | 2547 |
| 731 | Ga0501083_0175673 | 3300049744 | Bacteria | 1399 |
| 732 | Ga0501083_0245353 | 3300049744 | Bacteria | 1166 |
| 733 | Ga0501083_0696632 | 3300049744 | Bacteria | 661 |
| 734 | Ga0501035_0060869 | 3300049822 | Bacteria | 3361 |
| 735 | Ga0501035_0182015 | 3300049822 | Bacteria | 1810 |
| 736 | Ga0501035_0317326 | 3300049822 | Bacteria | 1310 |
| 737 | Ga0501044_0732140 | 3300049823 | Bacteria | 872 |
| 738 | Ga0501045_0003262 | 3300049824 | Bacteria | 11083 |
| 739 | Ga0501045_0045545 | 3300049824 | Bacteria | 3193 |
| 740 | Ga0501045_0047319 | 3300049824 | Bacteria | 3133 |
| 741 | Ga0501045_0125013 | 3300049824 | Bacteria | 1910 |
| 742 | Ga0501045_0170260 | 3300049824 | Bacteria | 1622 |
| 743 | Ga0501045_0179722 | 3300049824 | Bacteria | 1576 |
| 744 | Ga0501045_0188676 | 3300049824 | Bacteria | 1536 |
| 745 | Ga0501045_0565338 | 3300049824 | Bacteria | 843 |
| 746 | Ga0501045_0675451 | 3300049824 | Bacteria | 763 |
| 747 | Ga0501045_0701805 | 3300049824 | Bacteria | 747 |
| 748 | Ga0501045_0711311 | 3300049824 | Bacteria | 741 |
| 749 | nmdc:mga03683_135440_c1 | 3300050489 | Bacteria | 1104 |
| 750 | nmdc:mga03n38_685743_c1 | 3300050490 | Bacteria | 589 |
| 751 | nmdc:mga0k408_240248_c1 | 3300050493 | Bacteria | 1081 |
| 752 | nmdc:mga05p37_1381_c1 | 3300050507 | Bacteria | 28239 |
| 753 | nmdc:mga05p37_138226_c1 | 3300050507 | Bacteria | 2986 |
| 754 | nmdc:mga05p37_173483_c1 | 3300050507 | Bacteria | 2628 |
| 755 | nmdc:mga05p37_20723_c1 | 3300050507 | Bacteria | 7955 |
| 756 | nmdc:mga05p37_214272_c1 | 3300050507 | Bacteria | 2327 |
| 757 | nmdc:mga05p37_2162_c1 | 3300050507 | Bacteria | 22903 |
| 758 | nmdc:mga05p37_237487_c1 | 3300050507 | Bacteria | 2193 |
| 759 | nmdc:mga05p37_245624_c1 | 3300050507 | Bacteria | 2149 |
| 760 | nmdc:mga05p37_27267_c1 | 3300050507 | Bacteria | 6955 |
| 761 | nmdc:mga05p37_27703_c1 | 3300050507 | Bacteria | 6903 |
| 762 | nmdc:mga05p37_320066_c1 | 3300050507 | Bacteria | 1836 |
| 763 | nmdc:mga05p37_366_c1 | 3300050507 | Bacteria | 48604 |
| 764 | nmdc:mga05p37_38713_c1 | 3300050507 | Bacteria | 5850 |
| 765 | nmdc:mga05p37_40993_c1 | 3300050507 | Bacteria | 5685 |
| 766 | nmdc:mga05p37_420_c1 | 3300050507 | Bacteria | 45931 |
| 767 | nmdc:mga05p37_455555_c1 | 3300050507 | Bacteria | 1479 |
| 768 | nmdc:mga05p37_456088_c1 | 3300050507 | Bacteria | 1478 |
| 769 | nmdc:mga05p37_55220_c1 | 3300050507 | Bacteria | 4887 |
| 770 | nmdc:mga05p37_763161_c1 | 3300050507 | Unclassified | 1064 |
| 771 | nmdc:mga09592_142152_c1 | 3300050508 | Bacteria | 2069 |
| 772 | nmdc:mga09592_1725_c1 | 3300050508 | Bacteria | 17600 |
| 773 | nmdc:mga09592_27933_c1 | 3300050508 | Bacteria | 4684 |
| 774 | nmdc:mga09592_31228_c1 | 3300050508 | Bacteria | 4437 |
| 775 | nmdc:mga09592_43727_c1 | 3300050508 | Bacteria | 3768 |
| 776 | nmdc:mga09592_56205_c1 | 3300050508 | Bacteria | 3326 |
| 777 | nmdc:mga09592_659_c2 | 3300050508 | Bacteria | 17711 |
| 778 | nmdc:mga0qj67_226099_c1 | 3300050509 | Bacteria | 1519 |
| 779 | nmdc:mga0qj67_240783_c1 | 3300050509 | Bacteria | 1468 |
| 780 | nmdc:mga0qj67_29487_c1 | 3300050509 | Bacteria | 4262 |
| 781 | nmdc:mga0qj67_62907_c1 | 3300050509 | Bacteria | 2950 |
| 782 | nmdc:mga0qj67_79_c2 | 3300050509 | Bacteria | 27322 |
| 783 | nmdc:mga06r32_224794_c1 | 3300050510 | Unclassified | 1865 |
| 784 | nmdc:mga06r32_29097_c1 | 3300050510 | Bacteria | 5175 |
| 785 | nmdc:mga06r32_393204_c1 | 3300050510 | Bacteria | 1369 |
| 786 | nmdc:mga06r32_4242_c1 | 3300050510 | Bacteria | 12845 |
| 787 | nmdc:mga06r32_4674_c1 | 3300050510 | Bacteria | 12292 |
| 788 | nmdc:mga06r32_839_c1 | 3300050510 | Bacteria | 27208 |
| 789 | nmdc:mga06r32_922928_c1 | 3300050510 | Bacteria | 829 |
| 790 | nmdc:mga08y16_243974_c1 | 3300050511 | Unclassified | 1857 |
| 791 | nmdc:mga08y16_655178_c1 | 3300050511 | Unclassified | 1054 |
| 792 | nmdc:mga0n895_1198385_c1 | 3300050512 | Bacteria | 733 |
| 793 | nmdc:mga0n895_1205366_c1 | 3300050512 | Unclassified | 731 |
| 794 | nmdc:mga0n895_1328180_c1 | 3300050512 | Bacteria | 689 |
| 795 | nmdc:mga0n895_21842_c1 | 3300050512 | Bacteria | 5992 |
| 796 | nmdc:mga0n895_228569_c1 | 3300050512 | Bacteria | 1889 |
| 797 | nmdc:mga0n895_237723_c1 | 3300050512 | Bacteria | 1849 |
| 798 | nmdc:mga0n895_351083_c1 | 3300050512 | Bacteria | 1494 |
| 799 | nmdc:mga0n895_515330_c1 | 3300050512 | Bacteria | 1204 |
| 800 | nmdc:mga0n895_522286_c1 | 3300050512 | Unclassified | 1195 |
| 801 | nmdc:mga0n895_573841_c1 | 3300050512 | Bacteria | 1132 |
| 802 | nmdc:mga0n895_72892_c1 | 3300050512 | Bacteria | 3408 |
| 803 | nmdc:mga0rr50_1063_c1 | 3300050513 | Bacteria | 14934 |
| 804 | nmdc:mga0rr50_1253156_c1 | 3300050513 | Bacteria | 629 |
| 805 | nmdc:mga0rr50_197052_c1 | 3300050513 | Bacteria | 1654 |
| 806 | nmdc:mga0rr50_52581_c1 | 3300050513 | Bacteria | 3028 |
| 807 | nmdc:mga0rr50_5896_c1 | 3300050513 | Bacteria | 7372 |
| 808 | nmdc:mga0rr50_777368_c1 | 3300050513 | Unclassified | 817 |
| 809 | nmdc:mga0rr50_857269_c1 | 3300050513 | Bacteria | 775 |
| 810 | nmdc:mga08x19_120485_c1 | 3300050514 | Bacteria | 1759 |
| 811 | nmdc:mga08x19_1458_c1 | 3300050514 | Bacteria | 14629 |
| 812 | nmdc:mga08x19_19467_c1 | 3300050514 | Bacteria | 4165 |
| 813 | nmdc:mga08x19_374743_c1 | 3300050514 | Bacteria | 996 |
| 814 | nmdc:mga08x19_601986_c1 | 3300050514 | Bacteria | 779 |
| 815 | nmdc:mga08x19_90818_c1 | 3300050514 | Bacteria | 2016 |
| 816 | nmdc:mga08x19_94959_c1 | 3300050514 | Bacteria | 1972 |
| 817 | nmdc:mga0a205_10314_c2 | 3300050515 | Bacteria | 6985 |
| 818 | nmdc:mga0a205_12191_c1 | 3300050515 | Bacteria | 7949 |
| 819 | nmdc:mga0a205_141732_c1 | 3300050515 | Unclassified | 2304 |
| 820 | nmdc:mga0a205_420492_c1 | 3300050515 | Bacteria | 1198 |
| 821 | nmdc:mga0a205_589033_c1 | 3300050515 | Unclassified | 966 |
| 822 | nmdc:mga0a205_6576_c1 | 3300050515 | Bacteria | 10516 |
| 823 | nmdc:mga0a205_701672_c1 | 3300050515 | Bacteria | 862 |
| 824 | nmdc:mga0a205_73782_c1 | 3300050515 | Bacteria | 3296 |
| 825 | nmdc:mga0a205_77799_c1 | 3300050515 | Bacteria | 3205 |
| 826 | nmdc:mga0a205_83577_c1 | 3300050515 | Bacteria | 3084 |
| 827 | nmdc:mga0a205_84896_c1 | 3300050515 | Bacteria | 3058 |
| 828 | nmdc:mga0a205_86273_c1 | 3300050515 | Unclassified | 3032 |
| 829 | nmdc:mga0sz30_215025_c1 | 3300050516 | Bacteria | 854 |
| 830 | Ga0501084_0002983 | 3300054114 | Bacteria | 13701 |
| 831 | Ga0501084_0004662 | 3300054114 | Bacteria | 11193 |
| 832 | Ga0501084_0006404 | 3300054114 | Bacteria | 9676 |
| 833 | Ga0501084_0009660 | 3300054114 | Bacteria | 7980 |
| 834 | Ga0501084_0012861 | 3300054114 | Bacteria | 6933 |
| 835 | Ga0501084_0046677 | 3300054114 | Bacteria | 3628 |
| 836 | Ga0501084_0049668 | 3300054114 | Bacteria | 3511 |
| 837 | Ga0501084_0122614 | 3300054114 | Bacteria | 2186 |
| 838 | Ga0501084_0214330 | 3300054114 | Bacteria | 1624 |
| 839 | Ga0501084_0254007 | 3300054114 | Bacteria | 1484 |
| 840 | Ga0501084_0293122 | 3300054114 | Bacteria | 1374 |
| 841 | Ga0501084_0304971 | 3300054114 | Bacteria | 1345 |
| 842 | Ga0501084_0310334 | 3300054114 | Bacteria | 1332 |
| 843 | Ga0501084_0769949 | 3300054114 | Bacteria | 811 |
| 844 | Ga0501082_0000775 | 3300060353 | Bacteria | 28022 |
| 845 | Ga0501082_0004399 | 3300060353 | Bacteria | 12302 |
| 846 | Ga0501082_0059506 | 3300060353 | Bacteria | 3292 |
| 847 | Ga0501082_0087471 | 3300060353 | Bacteria | 2688 |
| 848 | Ga0501082_0094782 | 3300060353 | Bacteria | 2579 |
| 849 | Ga0501082_0100158 | 3300060353 | Bacteria | 2506 |
| 850 | Ga0501082_0177594 | 3300060353 | Bacteria | 1851 |
| 851 | Ga0501082_0376127 | 3300060353 | Bacteria | 1239 |
| 852 | Ga0501082_0589609 | 3300060353 | Unclassified | 972 |
| 853 | Ga0501082_0690329 | 3300060353 | Bacteria | 893 |
| 854 | Ga0501082_1148752 | 3300060353 | Bacteria | 679 |
| 855 | Ga0530510_0000017 | 3300061734 | Bacteria | 84530 |
| 856 | Ga0530510_0000168 | 3300061734 | Bacteria | 39753 |
| 857 | Ga0530510_0008103 | 3300061734 | Bacteria | 7324 |
| 858 | Ga0530510_0017607 | 3300061734 | Bacteria | 5063 |
| 859 | Ga0530510_0032920 | 3300061734 | Bacteria | 3731 |
| 860 | Ga0530510_0039287 | 3300061734 | Bacteria | 3416 |
| 861 | Ga0530510_0066647 | 3300061734 | Bacteria | 2611 |
| 862 | Ga0530510_0069200 | 3300061734 | Bacteria | 2561 |
| 863 | Ga0530510_0269289 | 3300061734 | Bacteria | 1271 |
| 864 | Ga0530510_0287721 | 3300061734 | Bacteria | 1228 |
| 865 | Ga0530510_0510475 | 3300061734 | Bacteria | 911 |
| 866 | Ga0530510_0676018 | 3300061734 | Unclassified | 786 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046675 | Ga0495657_0776326 | Ga0495657_0776326_11_478 | 147 |
| 2 | 3300048909 | Ga0496106_1067290 | Ga0496106_1067290_12_479 | 147 |
| 3 | 3300044712 | Ga0453684_1461051 | Ga0453684_1461051_36_542 | 168 |
| 4 | iso_pu_bacteria | 8001781756 | 8001787832 | 168 |
| 5 | iso_pu_bacteria | 8001781756 | 8001788359 | 168 |
| 6 | 3300025938 | Ga0207704_11306458 | Ga0207704_113064581 | 169 |
| 7 | 3300025929 | Ga0207664_10036203 | Ga0207664_100362034 | 171 |
| 8 | 3300048089 | Ga0495614_0059104 | Ga0495614_0059104_170_688 | 171 |
| 9 | 3300006871 | Ga0075434_100560246 | Ga0075434_1005602463 | 172 |
| 10 | 3300031665 | Ga0316575_10000724 | Ga0316575_100007249 | 172 |
| 11 | 3300031665 | Ga0316575_10084478 | Ga0316575_100844782 | 172 |
| 12 | 3300031665 | Ga0316575_10235249 | Ga0316575_102352492 | 172 |
| 13 | 3300031691 | Ga0316579_10133018 | Ga0316579_101330181 | 172 |
| 14 | 3300031691 | Ga0316579_10183418 | Ga0316579_101834181 | 172 |
| 15 | 3300031691 | Ga0316579_10266604 | Ga0316579_102666042 | 172 |
| 16 | 3300031691 | Ga0316579_10285564 | Ga0316579_102855641 | 172 |
| 17 | 3300031727 | Ga0316576_10028193 | Ga0316576_100281931 | 172 |
| 18 | 3300031727 | Ga0316576_10216222 | Ga0316576_102162222 | 172 |
| 19 | 3300031727 | Ga0316576_10290079 | Ga0316576_102900792 | 172 |
| 20 | 3300031727 | Ga0316576_10467545 | Ga0316576_104675452 | 172 |
| 21 | 3300031728 | Ga0316578_10005511 | Ga0316578_100055115 | 172 |
| 22 | 3300031728 | Ga0316578_10011441 | Ga0316578_100114413 | 172 |
| 23 | 3300031728 | Ga0316578_10069480 | Ga0316578_100694802 | 172 |
| 24 | 3300031728 | Ga0316578_10369739 | Ga0316578_103697392 | 172 |
| 25 | 3300031733 | Ga0316577_10000364 | Ga0316577_100003644 | 172 |
| 26 | 3300031733 | Ga0316577_10025713 | Ga0316577_100257131 | 172 |
| 27 | 3300031733 | Ga0316577_10083992 | Ga0316577_100839922 | 172 |
| 28 | 3300032133 | Ga0316583_10001181 | Ga0316583_100011819 | 172 |
| 29 | 3300032133 | Ga0316583_10040210 | Ga0316583_100402102 | 172 |
| 30 | 3300032133 | Ga0316583_10047352 | Ga0316583_100473522 | 172 |
| 31 | 3300032137 | Ga0316585_10000005 | Ga0316585_1000000523 | 172 |
| 32 | 3300032168 | Ga0316593_10008379 | Ga0316593_100083793 | 172 |
| 33 | 3300032168 | Ga0316593_10070365 | Ga0316593_100703652 | 172 |
| 34 | 3300032168 | Ga0316593_10090249 | Ga0316593_100902492 | 172 |
| 35 | 3300035398 | Ga0316574_0000011 | Ga0316574_0000011_332_850 | 172 |
| 36 | 3300035398 | Ga0316574_0028169 | Ga0316574_0028169_801_1319 | 172 |
| 37 | 3300035398 | Ga0316574_0031606 | Ga0316574_0031606_249_767 | 172 |
| 38 | 3300035398 | Ga0316574_0043584 | Ga0316574_0043584_564_1082 | 172 |
| 39 | 3300036647 | Ga0316582_0007758 | Ga0316582_0007758_4982_5500 | 172 |
| 40 | 3300036647 | Ga0316582_0009425 | Ga0316582_0009425_35_553 | 172 |
| 41 | 3300036647 | Ga0316582_0076840 | Ga0316582_0076840_1508_2026 | 172 |
| 42 | 3300036647 | Ga0316582_0091738 | Ga0316582_0091738_330_848 | 172 |
| 43 | 3300036647 | Ga0316582_0100139 | Ga0316582_0100139_47_577 | 172 |
| 44 | 3300036647 | Ga0316582_0243059 | Ga0316582_0243059_577_1095 | 172 |
| 45 | 3300036647 | Ga0316582_0276498 | Ga0316582_0276498_558_1076 | 172 |
| 46 | 3300036647 | Ga0316582_0410119 | Ga0316582_0410119_284_817 | 172 |
| 47 | 3300036647 | Ga0316582_0555687 | Ga0316582_0555687_75_593 | 172 |
| 48 | 3300036712 | Ga0316584_0007998 | Ga0316584_0007998_329_847 | 172 |
| 49 | 3300036712 | Ga0316584_0014805 | Ga0316584_0014805_448_966 | 172 |
| 50 | 3300036712 | Ga0316584_0018842 | Ga0316584_0018842_1011_1529 | 172 |
| 51 | 3300036712 | Ga0316584_0196017 | Ga0316584_0196017_177_695 | 172 |
| 52 | 3300036712 | Ga0316584_0284559 | Ga0316584_0284559_641_1159 | 172 |
| 53 | 3300037588 | Ga0316581_0007940 | Ga0316581_0007940_329_847 | 172 |
| 54 | 3300037588 | Ga0316581_0180898 | Ga0316581_0180898_102_635 | 172 |
| 55 | 3300038726 | Ga0400490_07043 | Ga0400490_07043_28_546 | 172 |
| 56 | 3300038735 | Ga0400485_12648 | Ga0400485_12648_4847_5365 | 172 |
| 57 | 3300038742 | Ga0400486_19650 | Ga0400486_19650_26055_26573 | 172 |
| 58 | 3300039093 | Ga0400489_55776 | Ga0400489_55776_12949_13467 | 172 |
| 59 | 3300039110 | Ga0400487_35590 | Ga0400487_35590_18591_19109 | 172 |
| 60 | 3300005354 | Ga0070675_100265808 | Ga0070675_1002658081 | 173 |
| 61 | 3300005535 | Ga0070684_100201093 | Ga0070684_1002010932 | 173 |
| 62 | 3300005545 | Ga0070695_100215950 | Ga0070695_1002159502 | 173 |
| 63 | 3300005577 | Ga0068857_100299896 | Ga0068857_1002998962 | 173 |
| 64 | 3300006846 | Ga0075430_100415131 | Ga0075430_1004151312 | 173 |
| 65 | 3300006847 | Ga0075431_100143565 | Ga0075431_1001435654 | 173 |
| 66 | 3300006914 | Ga0075436_100002956 | Ga0075436_10000295611 | 173 |
| 67 | 3300006914 | Ga0075436_100649964 | Ga0075436_1006499642 | 173 |
| 68 | 3300007076 | Ga0075435_101250420 | Ga0075435_1012504201 | 173 |
| 69 | 3300013296 | Ga0157374_10393546 | Ga0157374_103935462 | 173 |
| 70 | 3300014969 | Ga0157376_11034033 | Ga0157376_110340332 | 173 |
| 71 | 3300025912 | Ga0207707_10016649 | Ga0207707_100166493 | 173 |
| 72 | 3300026116 | Ga0207674_10112218 | Ga0207674_101122183 | 173 |
| 73 | 3300027543 | Ga0209999_1027556 | Ga0209999_10275563 | 173 |
| 74 | 3300031665 | Ga0316575_10196680 | Ga0316575_101966801 | 173 |
| 75 | 3300031691 | Ga0316579_10062978 | Ga0316579_100629781 | 173 |
| 76 | 3300031727 | Ga0316576_10085369 | Ga0316576_100853691 | 173 |
| 77 | 3300031727 | Ga0316576_10270657 | Ga0316576_102706572 | 173 |
| 78 | 3300031733 | Ga0316577_10101974 | Ga0316577_101019742 | 173 |
| 79 | 3300031733 | Ga0316577_10241950 | Ga0316577_102419501 | 173 |
| 80 | 3300032168 | Ga0316593_10064020 | Ga0316593_100640202 | 173 |
| 81 | 3300035695 | Ga0373927_0002036 | Ga0373927_0002036_2024_2563 | 173 |
| 82 | 3300036712 | Ga0316584_0061293 | Ga0316584_0061293_515_1036 | 173 |
| 83 | 3300036712 | Ga0316584_0154835 | Ga0316584_0154835_947_1468 | 173 |
| 84 | 3300036712 | Ga0316584_0431949 | Ga0316584_0431949_108_629 | 173 |
| 85 | 3300037588 | Ga0316581_0095150 | Ga0316581_0095150_371_892 | 173 |
| 86 | 3300050512 | nmdc:mga0n895_573841_c1 | nmdc:mga0n895_573841_c1_274_801 | 173 |
| 87 | 3300050513 | nmdc:mga0rr50_1253156_c1 | nmdc:mga0rr50_1253156_c1_28_567 | 173 |
| 88 | 3300050514 | nmdc:mga08x19_1458_c1 | nmdc:mga08x19_1458_c1_5169_5708 | 173 |
| 89 | 3300050514 | nmdc:mga08x19_601986_c1 | nmdc:mga08x19_601986_c1_215_754 | 173 |
| 90 | 3300003203 | JGI25406J46586_10009013 | JGI25406J46586_100090135 | 174 |
| 91 | 3300003349 | JGI26129J50193_1002094 | JGI26129J50193_10020942 | 174 |
| 92 | 3300004798 | Ga0058859_11388371 | Ga0058859_113883712 | 174 |
| 93 | 3300004799 | Ga0058863_10794585 | Ga0058863_107945851 | 174 |
| 94 | 3300004799 | Ga0058863_11506664 | Ga0058863_115066642 | 174 |
| 95 | 3300004800 | Ga0058861_11729795 | Ga0058861_117297952 | 174 |
| 96 | 3300004801 | Ga0058860_11455887 | Ga0058860_114558872 | 174 |
| 97 | 3300004803 | Ga0058862_12569376 | Ga0058862_125693762 | 174 |
| 98 | 3300005293 | Ga0065715_10707811 | Ga0065715_107078111 | 174 |
| 99 | 3300005327 | Ga0070658_10029920 | Ga0070658_100299203 | 174 |
| 100 | 3300005328 | Ga0070676_10023181 | Ga0070676_100231815 | 174 |
| 101 | 3300005329 | Ga0070683_100096602 | Ga0070683_1000966023 | 174 |
| 102 | 3300005330 | Ga0070690_100017062 | Ga0070690_1000170623 | 174 |
| 103 | 3300005331 | Ga0070670_100008486 | Ga0070670_1000084869 | 174 |
| 104 | 3300005333 | Ga0070677_10292517 | Ga0070677_102925171 | 174 |
| 105 | 3300005334 | Ga0068869_100006217 | Ga0068869_1000062172 | 174 |
| 106 | 3300005334 | Ga0068869_100078090 | Ga0068869_1000780902 | 174 |
| 107 | 3300005335 | Ga0070666_10202859 | Ga0070666_102028592 | 174 |
| 108 | 3300005336 | Ga0070680_100009694 | Ga0070680_1000096945 | 174 |
| 109 | 3300005336 | Ga0070680_100027659 | Ga0070680_1000276593 | 174 |
| 110 | 3300005336 | Ga0070680_100068815 | Ga0070680_1000688153 | 174 |
| 111 | 3300005336 | Ga0070680_100184356 | Ga0070680_1001843562 | 174 |
| 112 | 3300005336 | Ga0070680_101134924 | Ga0070680_1011349241 | 174 |
| 113 | 3300005337 | Ga0070682_100000788 | Ga0070682_10000078816 | 174 |
| 114 | 3300005337 | Ga0070682_100858959 | Ga0070682_1008589591 | 174 |
| 115 | 3300005339 | Ga0070660_100007707 | Ga0070660_1000077076 | 174 |
| 116 | 3300005340 | Ga0070689_100063051 | Ga0070689_1000630512 | 174 |
| 117 | 3300005341 | Ga0070691_10001039 | Ga0070691_100010396 | 174 |
| 118 | 3300005341 | Ga0070691_10017615 | Ga0070691_100176153 | 174 |
| 119 | 3300005341 | Ga0070691_10289622 | Ga0070691_102896222 | 174 |
| 120 | 3300005343 | Ga0070687_100006584 | Ga0070687_1000065846 | 174 |
| 121 | 3300005344 | Ga0070661_100003068 | Ga0070661_1000030686 | 174 |
| 122 | 3300005344 | Ga0070661_100101059 | Ga0070661_1001010593 | 174 |
| 123 | 3300005345 | Ga0070692_10001528 | Ga0070692_100015282 | 174 |
| 124 | 3300005347 | Ga0070668_101228316 | Ga0070668_1012283161 | 174 |
| 125 | 3300005353 | Ga0070669_100096497 | Ga0070669_1000964972 | 174 |
| 126 | 3300005355 | Ga0070671_100127402 | Ga0070671_1001274022 | 174 |
| 127 | 3300005366 | Ga0070659_100000529 | Ga0070659_10000052924 | 174 |
| 128 | 3300005406 | Ga0070703_10237601 | Ga0070703_102376011 | 174 |
| 129 | 3300005436 | Ga0070713_100197615 | Ga0070713_1001976152 | 174 |
| 130 | 3300005440 | Ga0070705_100000374 | Ga0070705_10000037419 | 174 |
| 131 | 3300005441 | Ga0070700_100370814 | Ga0070700_1003708141 | 174 |
| 132 | 3300005441 | Ga0070700_100940759 | Ga0070700_1009407591 | 174 |
| 133 | 3300005444 | Ga0070694_100008918 | Ga0070694_1000089182 | 174 |
| 134 | 3300005444 | Ga0070694_100043921 | Ga0070694_1000439215 | 174 |
| 135 | 3300005444 | Ga0070694_100334081 | Ga0070694_1003340812 | 174 |
| 136 | 3300005444 | Ga0070694_100338205 | Ga0070694_1003382052 | 174 |
| 137 | 3300005444 | Ga0070694_100729423 | Ga0070694_1007294231 | 174 |
| 138 | 3300005445 | Ga0070708_100034359 | Ga0070708_1000343593 | 174 |
| 139 | 3300005445 | Ga0070708_100037504 | Ga0070708_1000375044 | 174 |
| 140 | 3300005445 | Ga0070708_100056223 | Ga0070708_1000562235 | 174 |
| 141 | 3300005445 | Ga0070708_100056710 | Ga0070708_1000567101 | 174 |
| 142 | 3300005445 | Ga0070708_100057821 | Ga0070708_1000578213 | 174 |
| 143 | 3300005445 | Ga0070708_100065060 | Ga0070708_1000650603 | 174 |
| 144 | 3300005445 | Ga0070708_100171584 | Ga0070708_1001715842 | 174 |
| 145 | 3300005445 | Ga0070708_100221620 | Ga0070708_1002216202 | 174 |
| 146 | 3300005445 | Ga0070708_100246242 | Ga0070708_1002462422 | 174 |
| 147 | 3300005445 | Ga0070708_100299728 | Ga0070708_1002997282 | 174 |
| 148 | 3300005445 | Ga0070708_100432291 | Ga0070708_1004322912 | 174 |
| 149 | 3300005445 | Ga0070708_100523416 | Ga0070708_1005234163 | 174 |
| 150 | 3300005445 | Ga0070708_100615895 | Ga0070708_1006158952 | 174 |
| 151 | 3300005445 | Ga0070708_100624828 | Ga0070708_1006248282 | 174 |
| 152 | 3300005455 | Ga0070663_100003952 | Ga0070663_10000395211 | 174 |
| 153 | 3300005457 | Ga0070662_100086653 | Ga0070662_1000866532 | 174 |
| 154 | 3300005457 | Ga0070662_100118286 | Ga0070662_1001182863 | 174 |
| 155 | 3300005458 | Ga0070681_10020175 | Ga0070681_100201751 | 174 |
| 156 | 3300005458 | Ga0070681_10083185 | Ga0070681_100831852 | 174 |
| 157 | 3300005458 | Ga0070681_10738336 | Ga0070681_107383362 | 174 |
| 158 | 3300005459 | Ga0068867_100018215 | Ga0068867_1000182156 | 174 |
| 159 | 3300005459 | Ga0068867_100394557 | Ga0068867_1003945572 | 174 |
| 160 | 3300005467 | Ga0070706_100002980 | Ga0070706_10000298010 | 174 |
| 161 | 3300005467 | Ga0070706_100004544 | Ga0070706_1000045449 | 174 |
| 162 | 3300005467 | Ga0070706_100038369 | Ga0070706_1000383694 | 174 |
| 163 | 3300005467 | Ga0070706_100103755 | Ga0070706_1001037553 | 174 |
| 164 | 3300005467 | Ga0070706_100106203 | Ga0070706_1001062032 | 174 |
| 165 | 3300005467 | Ga0070706_100177055 | Ga0070706_1001770553 | 174 |
| 166 | 3300005467 | Ga0070706_100180596 | Ga0070706_1001805962 | 174 |
| 167 | 3300005467 | Ga0070706_100203157 | Ga0070706_1002031572 | 174 |
| 168 | 3300005467 | Ga0070706_100312635 | Ga0070706_1003126352 | 174 |
| 169 | 3300005467 | Ga0070706_100354290 | Ga0070706_1003542901 | 174 |
| 170 | 3300005467 | Ga0070706_100758989 | Ga0070706_1007589891 | 174 |
| 171 | 3300005467 | Ga0070706_101220946 | Ga0070706_1012209461 | 174 |
| 172 | 3300005468 | Ga0070707_100003625 | Ga0070707_1000036258 | 174 |
| 173 | 3300005468 | Ga0070707_100021132 | Ga0070707_1000211321 | 174 |
| 174 | 3300005468 | Ga0070707_100042747 | Ga0070707_1000427475 | 174 |
| 175 | 3300005468 | Ga0070707_100057551 | Ga0070707_1000575513 | 174 |
| 176 | 3300005468 | Ga0070707_100094333 | Ga0070707_1000943333 | 174 |
| 177 | 3300005468 | Ga0070707_100205701 | Ga0070707_1002057014 | 174 |
| 178 | 3300005468 | Ga0070707_100256515 | Ga0070707_1002565152 | 174 |
| 179 | 3300005468 | Ga0070707_100459199 | Ga0070707_1004591992 | 174 |
| 180 | 3300005468 | Ga0070707_100608259 | Ga0070707_1006082592 | 174 |
| 181 | 3300005468 | Ga0070707_101098104 | Ga0070707_1010981042 | 174 |
| 182 | 3300005471 | Ga0070698_100040059 | Ga0070698_1000400595 | 174 |
| 183 | 3300005471 | Ga0070698_100158242 | Ga0070698_1001582423 | 174 |
| 184 | 3300005471 | Ga0070698_100201977 | Ga0070698_1002019772 | 174 |
| 185 | 3300005471 | Ga0070698_100823813 | Ga0070698_1008238131 | 174 |
| 186 | 3300005518 | Ga0070699_100007997 | Ga0070699_1000079977 | 174 |
| 187 | 3300005518 | Ga0070699_100050238 | Ga0070699_1000502384 | 174 |
| 188 | 3300005518 | Ga0070699_100099647 | Ga0070699_1000996472 | 174 |
| 189 | 3300005518 | Ga0070699_100134169 | Ga0070699_1001341692 | 174 |
| 190 | 3300005518 | Ga0070699_100285241 | Ga0070699_1002852412 | 174 |
| 191 | 3300005518 | Ga0070699_100292920 | Ga0070699_1002929202 | 174 |
| 192 | 3300005518 | Ga0070699_100294096 | Ga0070699_1002940963 | 174 |
| 193 | 3300005518 | Ga0070699_100298197 | Ga0070699_1002981972 | 174 |
| 194 | 3300005530 | Ga0070679_100007439 | Ga0070679_1000074397 | 174 |
| 195 | 3300005530 | Ga0070679_100031833 | Ga0070679_1000318334 | 174 |
| 196 | 3300005530 | Ga0070679_100195514 | Ga0070679_1001955141 | 174 |
| 197 | 3300005535 | Ga0070684_100005222 | Ga0070684_1000052223 | 174 |
| 198 | 3300005535 | Ga0070684_100407527 | Ga0070684_1004075272 | 174 |
| 199 | 3300005536 | Ga0070697_100016756 | Ga0070697_1000167562 | 174 |
| 200 | 3300005536 | Ga0070697_100023193 | Ga0070697_1000231935 | 174 |
| 201 | 3300005536 | Ga0070697_100023802 | Ga0070697_1000238023 | 174 |
| 202 | 3300005536 | Ga0070697_100026935 | Ga0070697_1000269351 | 174 |
| 203 | 3300005536 | Ga0070697_100181023 | Ga0070697_1001810231 | 174 |
| 204 | 3300005539 | Ga0068853_100001594 | Ga0068853_10000159411 | 174 |
| 205 | 3300005544 | Ga0070686_100205439 | Ga0070686_1002054392 | 174 |
| 206 | 3300005545 | Ga0070695_100003170 | Ga0070695_1000031703 | 174 |
| 207 | 3300005545 | Ga0070695_100004272 | Ga0070695_1000042722 | 174 |
| 208 | 3300005545 | Ga0070695_100058543 | Ga0070695_1000585433 | 174 |
| 209 | 3300005545 | Ga0070695_100117303 | Ga0070695_1001173033 | 174 |
| 210 | 3300005546 | Ga0070696_100008387 | Ga0070696_1000083873 | 174 |
| 211 | 3300005546 | Ga0070696_100012972 | Ga0070696_1000129724 | 174 |
| 212 | 3300005546 | Ga0070696_100022945 | Ga0070696_1000229457 | 174 |
| 213 | 3300005546 | Ga0070696_100235372 | Ga0070696_1002353722 | 174 |
| 214 | 3300005546 | Ga0070696_100551085 | Ga0070696_1005510852 | 174 |
| 215 | 3300005546 | Ga0070696_100960078 | Ga0070696_1009600781 | 174 |
| 216 | 3300005547 | Ga0070693_100011771 | Ga0070693_1000117716 | 174 |
| 217 | 3300005547 | Ga0070693_100030328 | Ga0070693_1000303282 | 174 |
| 218 | 3300005549 | Ga0070704_100047443 | Ga0070704_1000474432 | 174 |
| 219 | 3300005549 | Ga0070704_100070171 | Ga0070704_1000701715 | 174 |
| 220 | 3300005549 | Ga0070704_100129774 | Ga0070704_1001297741 | 174 |
| 221 | 3300005549 | Ga0070704_100759334 | Ga0070704_1007593342 | 174 |
| 222 | 3300005563 | Ga0068855_100010887 | Ga0068855_1000108879 | 174 |
| 223 | 3300005563 | Ga0068855_100358407 | Ga0068855_1003584072 | 174 |
| 224 | 3300005564 | Ga0070664_100013742 | Ga0070664_1000137422 | 174 |
| 225 | 3300005564 | Ga0070664_100524141 | Ga0070664_1005241412 | 174 |
| 226 | 3300005577 | Ga0068857_100020642 | Ga0068857_1000206426 | 174 |
| 227 | 3300005577 | Ga0068857_100088568 | Ga0068857_1000885682 | 174 |
| 228 | 3300005577 | Ga0068857_100162040 | Ga0068857_1001620403 | 174 |
| 229 | 3300005578 | Ga0068854_100011479 | Ga0068854_1000114796 | 174 |
| 230 | 3300005614 | Ga0068856_100005201 | Ga0068856_1000052018 | 174 |
| 231 | 3300005614 | Ga0068856_101243279 | Ga0068856_1012432791 | 174 |
| 232 | 3300005615 | Ga0070702_100011369 | Ga0070702_1000113696 | 174 |
| 233 | 3300005615 | Ga0070702_100070371 | Ga0070702_1000703713 | 174 |
| 234 | 3300005616 | Ga0068852_100136394 | Ga0068852_1001363943 | 174 |
| 235 | 3300005617 | Ga0068859_100006840 | Ga0068859_1000068406 | 174 |
| 236 | 3300005617 | Ga0068859_100230992 | Ga0068859_1002309923 | 174 |
| 237 | 3300005618 | Ga0068864_100014894 | Ga0068864_1000148942 | 174 |
| 238 | 3300005618 | Ga0068864_100015376 | Ga0068864_1000153762 | 174 |
| 239 | 3300005719 | Ga0068861_100114196 | Ga0068861_1001141961 | 174 |
| 240 | 3300005719 | Ga0068861_100553382 | Ga0068861_1005533822 | 174 |
| 241 | 3300005840 | Ga0068870_10000125 | Ga0068870_100001253 | 174 |
| 242 | 3300005841 | Ga0068863_100027042 | Ga0068863_1000270425 | 174 |
| 243 | 3300005841 | Ga0068863_100056394 | Ga0068863_1000563942 | 174 |
| 244 | 3300005842 | Ga0068858_100024297 | Ga0068858_1000242976 | 174 |
| 245 | 3300005843 | Ga0068860_100047615 | Ga0068860_1000476153 | 174 |
| 246 | 3300005843 | Ga0068860_100410120 | Ga0068860_1004101202 | 174 |
| 247 | 3300005844 | Ga0068862_100007501 | Ga0068862_10000750110 | 174 |
| 248 | 3300005844 | Ga0068862_100145626 | Ga0068862_1001456264 | 174 |
| 249 | 3300005937 | Ga0081455_10000189 | Ga0081455_100001892 | 174 |
| 250 | 3300005981 | Ga0081538_10086579 | Ga0081538_100865791 | 174 |
| 251 | 3300005983 | Ga0081540_1005614 | Ga0081540_10056146 | 174 |
| 252 | 3300005985 | Ga0081539_10000166 | Ga0081539_1000016649 | 174 |
| 253 | 3300006028 | Ga0070717_10022010 | Ga0070717_100220103 | 174 |
| 254 | 3300006058 | Ga0075432_10027943 | Ga0075432_100279433 | 174 |
| 255 | 3300006173 | Ga0070716_100397688 | Ga0070716_1003976882 | 174 |
| 256 | 3300006195 | Ga0075366_10346991 | Ga0075366_103469911 | 174 |
| 257 | 3300006237 | Ga0097621_100426815 | Ga0097621_1004268152 | 174 |
| 258 | 3300006358 | Ga0068871_100131529 | Ga0068871_1001315293 | 174 |
| 259 | 3300006358 | Ga0068871_100960789 | Ga0068871_1009607891 | 174 |
| 260 | 3300006844 | Ga0075428_100000368 | Ga0075428_1000003689 | 174 |
| 261 | 3300006844 | Ga0075428_100000410 | Ga0075428_10000041040 | 174 |
| 262 | 3300006844 | Ga0075428_100004668 | Ga0075428_1000046684 | 174 |
| 263 | 3300006844 | Ga0075428_100086890 | Ga0075428_1000868901 | 174 |
| 264 | 3300006844 | Ga0075428_100136817 | Ga0075428_1001368174 | 174 |
| 265 | 3300006844 | Ga0075428_100176959 | Ga0075428_1001769593 | 174 |
| 266 | 3300006844 | Ga0075428_100185079 | Ga0075428_1001850793 | 174 |
| 267 | 3300006844 | Ga0075428_100242629 | Ga0075428_1002426293 | 174 |
| 268 | 3300006844 | Ga0075428_100660351 | Ga0075428_1006603513 | 174 |
| 269 | 3300006844 | Ga0075428_100672215 | Ga0075428_1006722151 | 174 |
| 270 | 3300006844 | Ga0075428_100698680 | Ga0075428_1006986803 | 174 |
| 271 | 3300006846 | Ga0075430_100002647 | Ga0075430_10000264716 | 174 |
| 272 | 3300006846 | Ga0075430_100003046 | Ga0075430_1000030468 | 174 |
| 273 | 3300006846 | Ga0075430_100011404 | Ga0075430_1000114041 | 174 |
| 274 | 3300006846 | Ga0075430_100148490 | Ga0075430_1001484902 | 174 |
| 275 | 3300006846 | Ga0075430_100347290 | Ga0075430_1003472901 | 174 |
| 276 | 3300006847 | Ga0075431_100000843 | Ga0075431_10000084319 | 174 |
| 277 | 3300006847 | Ga0075431_100002781 | Ga0075431_10000278115 | 174 |
| 278 | 3300006847 | Ga0075431_100010752 | Ga0075431_1000107525 | 174 |
| 279 | 3300006847 | Ga0075431_100011301 | Ga0075431_1000113014 | 174 |
| 280 | 3300006847 | Ga0075431_100012211 | Ga0075431_1000122115 | 174 |
| 281 | 3300006847 | Ga0075431_100029113 | Ga0075431_1000291133 | 174 |
| 282 | 3300006847 | Ga0075431_100136317 | Ga0075431_1001363173 | 174 |
| 283 | 3300006847 | Ga0075431_100258162 | Ga0075431_1002581622 | 174 |
| 284 | 3300006847 | Ga0075431_100452884 | Ga0075431_1004528842 | 174 |
| 285 | 3300006847 | Ga0075431_100481376 | Ga0075431_1004813763 | 174 |
| 286 | 3300006847 | Ga0075431_100912241 | Ga0075431_1009122412 | 174 |
| 287 | 3300006852 | Ga0075433_10000489 | Ga0075433_1000048916 | 174 |
| 288 | 3300006852 | Ga0075433_10007833 | Ga0075433_100078337 | 174 |
| 289 | 3300006852 | Ga0075433_10008458 | Ga0075433_1000845810 | 174 |
| 290 | 3300006852 | Ga0075433_10014343 | Ga0075433_100143438 | 174 |
| 291 | 3300006852 | Ga0075433_10128763 | Ga0075433_101287634 | 174 |
| 292 | 3300006852 | Ga0075433_10268062 | Ga0075433_102680622 | 174 |
| 293 | 3300006852 | Ga0075433_10561270 | Ga0075433_105612701 | 174 |
| 294 | 3300006871 | Ga0075434_100007947 | Ga0075434_10000794710 | 174 |
| 295 | 3300006871 | Ga0075434_100139858 | Ga0075434_1001398582 | 174 |
| 296 | 3300006871 | Ga0075434_100178127 | Ga0075434_1001781271 | 174 |
| 297 | 3300006871 | Ga0075434_100323890 | Ga0075434_1003238903 | 174 |
| 298 | 3300006871 | Ga0075434_100367859 | Ga0075434_1003678593 | 174 |
| 299 | 3300006871 | Ga0075434_100428526 | Ga0075434_1004285262 | 174 |
| 300 | 3300006871 | Ga0075434_101008432 | Ga0075434_1010084321 | 174 |
| 301 | 3300006880 | Ga0075429_100003897 | Ga0075429_1000038977 | 174 |
| 302 | 3300006880 | Ga0075429_100014858 | Ga0075429_1000148584 | 174 |
| 303 | 3300006880 | Ga0075429_100018255 | Ga0075429_1000182551 | 174 |
| 304 | 3300006880 | Ga0075429_100018795 | Ga0075429_1000187955 | 174 |
| 305 | 3300006880 | Ga0075429_100097772 | Ga0075429_1000977723 | 174 |
| 306 | 3300006880 | Ga0075429_100169307 | Ga0075429_1001693073 | 174 |
| 307 | 3300006881 | Ga0068865_100933823 | Ga0068865_1009338232 | 174 |
| 308 | 3300006914 | Ga0075436_100003545 | Ga0075436_1000035459 | 174 |
| 309 | 3300006914 | Ga0075436_100063393 | Ga0075436_1000633931 | 174 |
| 310 | 3300006914 | Ga0075436_100100109 | Ga0075436_1001001091 | 174 |
| 311 | 3300006914 | Ga0075436_100133092 | Ga0075436_1001330923 | 174 |
| 312 | 3300006914 | Ga0075436_100195911 | Ga0075436_1001959112 | 174 |
| 313 | 3300006931 | Ga0097620_100006840 | Ga0097620_1000068406 | 174 |
| 314 | 3300006931 | Ga0097620_100230980 | Ga0097620_1002309803 | 174 |
| 315 | 3300007076 | Ga0075435_100066728 | Ga0075435_1000667282 | 174 |
| 316 | 3300007076 | Ga0075435_100081935 | Ga0075435_1000819353 | 174 |
| 317 | 3300007076 | Ga0075435_100121001 | Ga0075435_1001210012 | 174 |
| 318 | 3300007076 | Ga0075435_100131752 | Ga0075435_1001317522 | 174 |
| 319 | 3300007076 | Ga0075435_101243231 | Ga0075435_1012432311 | 174 |
| 320 | 3300007265 | Ga0099794_10008590 | Ga0099794_100085906 | 174 |
| 321 | 3300007265 | Ga0099794_10025323 | Ga0099794_100253231 | 174 |
| 322 | 3300007265 | Ga0099794_10234168 | Ga0099794_102341681 | 174 |
| 323 | 3300007265 | Ga0099794_10530423 | Ga0099794_105304231 | 174 |
| 324 | 3300009093 | Ga0105240_10869923 | Ga0105240_108699231 | 174 |
| 325 | 3300009094 | Ga0111539_10153212 | Ga0111539_101532122 | 174 |
| 326 | 3300009094 | Ga0111539_11072427 | Ga0111539_110724272 | 174 |
| 327 | 3300009098 | Ga0105245_10215285 | Ga0105245_102152852 | 174 |
| 328 | 3300009147 | Ga0114129_10000074 | Ga0114129_1000007413 | 174 |
| 329 | 3300009147 | Ga0114129_10000893 | Ga0114129_1000089335 | 174 |
| 330 | 3300009147 | Ga0114129_10001132 | Ga0114129_1000113215 | 174 |
| 331 | 3300009147 | Ga0114129_10002386 | Ga0114129_1000238617 | 174 |
| 332 | 3300009147 | Ga0114129_10014235 | Ga0114129_100142358 | 174 |
| 333 | 3300009147 | Ga0114129_10025545 | Ga0114129_100255453 | 174 |
| 334 | 3300009147 | Ga0114129_10041361 | Ga0114129_100413614 | 174 |
| 335 | 3300009147 | Ga0114129_10044920 | Ga0114129_100449205 | 174 |
| 336 | 3300009147 | Ga0114129_10050132 | Ga0114129_100501322 | 174 |
| 337 | 3300009147 | Ga0114129_10098924 | Ga0114129_100989244 | 174 |
| 338 | 3300009147 | Ga0114129_10111142 | Ga0114129_101111423 | 174 |
| 339 | 3300009147 | Ga0114129_10149320 | Ga0114129_101493202 | 174 |
| 340 | 3300009147 | Ga0114129_10165930 | Ga0114129_101659302 | 174 |
| 341 | 3300009147 | Ga0114129_10192171 | Ga0114129_101921713 | 174 |
| 342 | 3300009147 | Ga0114129_10219538 | Ga0114129_102195383 | 174 |
| 343 | 3300009147 | Ga0114129_10229368 | Ga0114129_102293682 | 174 |
| 344 | 3300009147 | Ga0114129_10253697 | Ga0114129_102536972 | 174 |
| 345 | 3300009147 | Ga0114129_10260573 | Ga0114129_102605735 | 174 |
| 346 | 3300009147 | Ga0114129_10308035 | Ga0114129_103080351 | 174 |
| 347 | 3300009148 | Ga0105243_10035661 | Ga0105243_100356612 | 174 |
| 348 | 3300009148 | Ga0105243_10242607 | Ga0105243_102426072 | 174 |
| 349 | 3300009148 | Ga0105243_10814419 | Ga0105243_108144191 | 174 |
| 350 | 3300009174 | Ga0105241_10000650 | Ga0105241_1000065018 | 174 |
| 351 | 3300009177 | Ga0105248_10022443 | Ga0105248_100224435 | 174 |
| 352 | 3300009545 | Ga0105237_10036293 | Ga0105237_100362936 | 174 |
| 353 | 3300009553 | Ga0105249_10097197 | Ga0105249_100971972 | 174 |
| 354 | 3300013100 | Ga0157373_10005161 | Ga0157373_100051618 | 174 |
| 355 | 3300013102 | Ga0157371_10156661 | Ga0157371_101566612 | 174 |
| 356 | 3300013102 | Ga0157371_10165860 | Ga0157371_101658602 | 174 |
| 357 | 3300013104 | Ga0157370_10236465 | Ga0157370_102364652 | 174 |
| 358 | 3300013105 | Ga0157369_10023823 | Ga0157369_100238234 | 174 |
| 359 | 3300013105 | Ga0157369_10119686 | Ga0157369_101196862 | 174 |
| 360 | 3300013297 | Ga0157378_10464030 | Ga0157378_104640302 | 174 |
| 361 | 3300013297 | Ga0157378_11336969 | Ga0157378_113369691 | 174 |
| 362 | 3300013307 | Ga0157372_10000746 | Ga0157372_1000074611 | 174 |
| 363 | 3300013307 | Ga0157372_10085982 | Ga0157372_100859825 | 174 |
| 364 | 3300013307 | Ga0157372_10495332 | Ga0157372_104953322 | 174 |
| 365 | 3300013308 | Ga0157375_11804818 | Ga0157375_118048181 | 174 |
| 366 | 3300014325 | Ga0163163_10030503 | Ga0163163_100305034 | 174 |
| 367 | 3300014325 | Ga0163163_10196633 | Ga0163163_101966332 | 174 |
| 368 | 3300014326 | Ga0157380_10418667 | Ga0157380_104186672 | 174 |
| 369 | 3300014326 | Ga0157380_10653418 | Ga0157380_106534181 | 174 |
| 370 | 3300014968 | Ga0157379_10230549 | Ga0157379_102305492 | 174 |
| 371 | 3300014968 | Ga0157379_10244236 | Ga0157379_102442362 | 174 |
| 372 | 3300014969 | Ga0157376_11562853 | Ga0157376_115628531 | 174 |
| 373 | 3300020069 | Ga0197907_10121884 | Ga0197907_101218841 | 174 |
| 374 | 3300020070 | Ga0206356_11013378 | Ga0206356_110133781 | 174 |
| 375 | 3300020070 | Ga0206356_11834943 | Ga0206356_118349432 | 174 |
| 376 | 3300020082 | Ga0206353_10128875 | Ga0206353_101288753 | 174 |
| 377 | 3300020082 | Ga0206353_11558259 | Ga0206353_115582592 | 174 |
| 378 | 3300022467 | Ga0224712_10026200 | Ga0224712_100262002 | 174 |
| 379 | 3300022467 | Ga0224712_10152723 | Ga0224712_101527232 | 174 |
| 380 | 3300025903 | Ga0207680_10189322 | Ga0207680_101893222 | 174 |
| 381 | 3300025905 | Ga0207685_10009271 | Ga0207685_100092712 | 174 |
| 382 | 3300025906 | Ga0207699_10123723 | Ga0207699_101237233 | 174 |
| 383 | 3300025907 | Ga0207645_10007485 | Ga0207645_100074856 | 174 |
| 384 | 3300025907 | Ga0207645_10021617 | Ga0207645_100216172 | 174 |
| 385 | 3300025908 | Ga0207643_10000210 | Ga0207643_100002104 | 174 |
| 386 | 3300025909 | Ga0207705_10032819 | Ga0207705_100328193 | 174 |
| 387 | 3300025910 | Ga0207684_10000501 | Ga0207684_1000050152 | 174 |
| 388 | 3300025910 | Ga0207684_10002039 | Ga0207684_1000203910 | 174 |
| 389 | 3300025910 | Ga0207684_10007653 | Ga0207684_100076535 | 174 |
| 390 | 3300025910 | Ga0207684_10008119 | Ga0207684_100081192 | 174 |
| 391 | 3300025910 | Ga0207684_10028818 | Ga0207684_100288182 | 174 |
| 392 | 3300025910 | Ga0207684_10034707 | Ga0207684_100347075 | 174 |
| 393 | 3300025910 | Ga0207684_10056223 | Ga0207684_100562234 | 174 |
| 394 | 3300025910 | Ga0207684_10085803 | Ga0207684_100858033 | 174 |
| 395 | 3300025910 | Ga0207684_10180500 | Ga0207684_101805004 | 174 |
| 396 | 3300025910 | Ga0207684_10316733 | Ga0207684_103167333 | 174 |
| 397 | 3300025910 | Ga0207684_10502421 | Ga0207684_105024212 | 174 |
| 398 | 3300025910 | Ga0207684_10503206 | Ga0207684_105032061 | 174 |
| 399 | 3300025911 | Ga0207654_10011378 | Ga0207654_100113782 | 174 |
| 400 | 3300025912 | Ga0207707_10032880 | Ga0207707_100328803 | 174 |
| 401 | 3300025912 | Ga0207707_10033934 | Ga0207707_100339341 | 174 |
| 402 | 3300025912 | Ga0207707_10879771 | Ga0207707_108797712 | 174 |
| 403 | 3300025913 | Ga0207695_10799377 | Ga0207695_107993771 | 174 |
| 404 | 3300025914 | Ga0207671_10202283 | Ga0207671_102022832 | 174 |
| 405 | 3300025915 | Ga0207693_10218796 | Ga0207693_102187963 | 174 |
| 406 | 3300025917 | Ga0207660_10010898 | Ga0207660_100108983 | 174 |
| 407 | 3300025917 | Ga0207660_10114294 | Ga0207660_101142941 | 174 |
| 408 | 3300025917 | Ga0207660_10172389 | Ga0207660_101723892 | 174 |
| 409 | 3300025917 | Ga0207660_10991288 | Ga0207660_109912881 | 174 |
| 410 | 3300025918 | Ga0207662_10016639 | Ga0207662_100166392 | 174 |
| 411 | 3300025919 | Ga0207657_10001132 | Ga0207657_1000113225 | 174 |
| 412 | 3300025920 | Ga0207649_10001277 | Ga0207649_1000127713 | 174 |
| 413 | 3300025920 | Ga0207649_10022014 | Ga0207649_100220143 | 174 |
| 414 | 3300025921 | Ga0207652_10002841 | Ga0207652_100028414 | 174 |
| 415 | 3300025921 | Ga0207652_10108289 | Ga0207652_101082892 | 174 |
| 416 | 3300025922 | Ga0207646_10003794 | Ga0207646_1000379410 | 174 |
| 417 | 3300025922 | Ga0207646_10004103 | Ga0207646_1000410316 | 174 |
| 418 | 3300025922 | Ga0207646_10007888 | Ga0207646_100078889 | 174 |
| 419 | 3300025922 | Ga0207646_10008540 | Ga0207646_100085409 | 174 |
| 420 | 3300025922 | Ga0207646_10015545 | Ga0207646_100155451 | 174 |
| 421 | 3300025922 | Ga0207646_10020443 | Ga0207646_100204431 | 174 |
| 422 | 3300025922 | Ga0207646_10046814 | Ga0207646_100468143 | 174 |
| 423 | 3300025922 | Ga0207646_10088629 | Ga0207646_100886292 | 174 |
| 424 | 3300025922 | Ga0207646_10223246 | Ga0207646_102232462 | 174 |
| 425 | 3300025922 | Ga0207646_10292016 | Ga0207646_102920162 | 174 |
| 426 | 3300025922 | Ga0207646_10384808 | Ga0207646_103848082 | 174 |
| 427 | 3300025922 | Ga0207646_10512661 | Ga0207646_105126611 | 174 |
| 428 | 3300025922 | Ga0207646_10689867 | Ga0207646_106898672 | 174 |
| 429 | 3300025923 | Ga0207681_10152750 | Ga0207681_101527502 | 174 |
| 430 | 3300025923 | Ga0207681_10543912 | Ga0207681_105439121 | 174 |
| 431 | 3300025925 | Ga0207650_10041437 | Ga0207650_100414372 | 174 |
| 432 | 3300025927 | Ga0207687_10142795 | Ga0207687_101427952 | 174 |
| 433 | 3300025928 | Ga0207700_10240372 | Ga0207700_102403722 | 174 |
| 434 | 3300025929 | Ga0207664_10059535 | Ga0207664_100595354 | 174 |
| 435 | 3300025932 | Ga0207690_10003389 | Ga0207690_100033895 | 174 |
| 436 | 3300025933 | Ga0207706_10051460 | Ga0207706_100514601 | 174 |
| 437 | 3300025933 | Ga0207706_10579999 | Ga0207706_105799992 | 174 |
| 438 | 3300025935 | Ga0207709_10048879 | Ga0207709_100488792 | 174 |
| 439 | 3300025935 | Ga0207709_10774398 | Ga0207709_107743981 | 174 |
| 440 | 3300025936 | Ga0207670_10033490 | Ga0207670_100334903 | 174 |
| 441 | 3300025936 | Ga0207670_10259098 | Ga0207670_102590982 | 174 |
| 442 | 3300025939 | Ga0207665_10189926 | Ga0207665_101899262 | 174 |
| 443 | 3300025941 | Ga0207711_10045468 | Ga0207711_100454682 | 174 |
| 444 | 3300025942 | Ga0207689_10001491 | Ga0207689_1000149121 | 174 |
| 445 | 3300025942 | Ga0207689_10042483 | Ga0207689_100424835 | 174 |
| 446 | 3300025944 | Ga0207661_10042351 | Ga0207661_100423513 | 174 |
| 447 | 3300025945 | Ga0207679_10001453 | Ga0207679_100014536 | 174 |
| 448 | 3300025945 | Ga0207679_11455797 | Ga0207679_114557971 | 174 |
| 449 | 3300025949 | Ga0207667_10003068 | Ga0207667_1000306818 | 174 |
| 450 | 3300025949 | Ga0207667_10236810 | Ga0207667_102368103 | 174 |
| 451 | 3300025961 | Ga0207712_10041976 | Ga0207712_100419765 | 174 |
| 452 | 3300025972 | Ga0207668_10672375 | Ga0207668_106723751 | 174 |
| 453 | 3300025981 | Ga0207640_10005366 | Ga0207640_100053666 | 174 |
| 454 | 3300025981 | Ga0207640_10161292 | Ga0207640_101612922 | 174 |
| 455 | 3300026041 | Ga0207639_10004549 | Ga0207639_1000454911 | 174 |
| 456 | 3300026067 | Ga0207678_10025484 | Ga0207678_100254846 | 174 |
| 457 | 3300026075 | Ga0207708_10574774 | Ga0207708_105747742 | 174 |
| 458 | 3300026075 | Ga0207708_11182765 | Ga0207708_111827651 | 174 |
| 459 | 3300026078 | Ga0207702_10002765 | Ga0207702_100027653 | 174 |
| 460 | 3300026078 | Ga0207702_10418962 | Ga0207702_104189622 | 174 |
| 461 | 3300026078 | Ga0207702_11469896 | Ga0207702_114698961 | 174 |
| 462 | 3300026088 | Ga0207641_10092610 | Ga0207641_100926102 | 174 |
| 463 | 3300026089 | Ga0207648_10000854 | Ga0207648_1000085422 | 174 |
| 464 | 3300026089 | Ga0207648_10323495 | Ga0207648_103234952 | 174 |
| 465 | 3300026116 | Ga0207674_10001007 | Ga0207674_1000100713 | 174 |
| 466 | 3300026116 | Ga0207674_10054189 | Ga0207674_100541891 | 174 |
| 467 | 3300026118 | Ga0207675_100129549 | Ga0207675_1001295492 | 174 |
| 468 | 3300026118 | Ga0207675_100832085 | Ga0207675_1008320852 | 174 |
| 469 | 3300026142 | Ga0207698_10149757 | Ga0207698_101497572 | 174 |
| 470 | 3300027360 | Ga0209969_1016635 | Ga0209969_10166352 | 174 |
| 471 | 3300027378 | Ga0209981_1051225 | Ga0209981_10512251 | 174 |
| 472 | 3300027395 | Ga0209996_1004068 | Ga0209996_10040684 | 174 |
| 473 | 3300027462 | Ga0210000_1006342 | Ga0210000_10063423 | 174 |
| 474 | 3300027471 | Ga0209995_1001777 | Ga0209995_10017772 | 174 |
| 475 | 3300027526 | Ga0209968_1002224 | Ga0209968_10022242 | 174 |
| 476 | 3300027543 | Ga0209999_1008541 | Ga0209999_10085414 | 174 |
| 477 | 3300027614 | Ga0209970_1000996 | Ga0209970_10009967 | 174 |
| 478 | 3300027617 | Ga0210002_1005220 | Ga0210002_10052201 | 174 |
| 479 | 3300027665 | Ga0209983_1004209 | Ga0209983_10042091 | 174 |
| 480 | 3300027671 | Ga0209588_1006881 | Ga0209588_10068814 | 174 |
| 481 | 3300027682 | Ga0209971_1000015 | Ga0209971_10000153 | 174 |
| 482 | 3300027695 | Ga0209966_1000025 | Ga0209966_100002563 | 174 |
| 483 | 3300027717 | Ga0209998_10002824 | Ga0209998_100028244 | 174 |
| 484 | 3300027717 | Ga0209998_10021687 | Ga0209998_100216871 | 174 |
| 485 | 3300027876 | Ga0209974_10006662 | Ga0209974_100066621 | 174 |
| 486 | 3300027907 | Ga0207428_10005120 | Ga0207428_100051206 | 174 |
| 487 | 3300028380 | Ga0268265_10012051 | Ga0268265_100120513 | 174 |
| 488 | 3300028380 | Ga0268265_10093772 | Ga0268265_100937724 | 174 |
| 489 | 3300028380 | Ga0268265_11382477 | Ga0268265_113824771 | 174 |
| 490 | 3300028381 | Ga0268264_10031816 | Ga0268264_100318164 | 174 |
| 491 | 3300028381 | Ga0268264_10900229 | Ga0268264_109002292 | 174 |
| 492 | 3300031548 | Ga0307408_100241287 | Ga0307408_1002412872 | 174 |
| 493 | 3300031548 | Ga0307408_100365387 | Ga0307408_1003653873 | 174 |
| 494 | 3300031824 | Ga0307413_11078027 | Ga0307413_110780271 | 174 |
| 495 | 3300031901 | Ga0307406_10293912 | Ga0307406_102939123 | 174 |
| 496 | 3300031901 | Ga0307406_10690640 | Ga0307406_106906402 | 174 |
| 497 | 3300032002 | Ga0307416_101168467 | Ga0307416_1011684671 | 174 |
| 498 | 3300032005 | Ga0307411_10483894 | Ga0307411_104838943 | 174 |
| 499 | 3300032005 | Ga0307411_11556843 | Ga0307411_115568431 | 174 |
| 500 | 3300034817 | Ga0373948_0136983 | Ga0373948_0136983_61_588 | 174 |
| 501 | 3300035091 | Ga0373951_0015985 | Ga0373951_0015985_717_1244 | 174 |
| 502 | 3300035092 | Ga0373952_0025089 | Ga0373952_0025089_168_695 | 174 |
| 503 | 3300035112 | Ga0373932_0311443 | Ga0373932_0311443_48_575 | 174 |
| 504 | 3300035115 | Ga0373941_0022104 | Ga0373941_0022104_1202_1729 | 174 |
| 505 | 3300035121 | Ga0373960_0015883 | Ga0373960_0015883_116_643 | 174 |
| 506 | 3300036401 | Ga0373937_0841189 | Ga0373937_0841189_29_610 | 174 |
| 507 | 3300036647 | Ga0316582_0629696 | Ga0316582_0629696_107_631 | 174 |
| 508 | 3300036712 | Ga0316584_0184968 | Ga0316584_0184968_738_1262 | 174 |
| 509 | 3300037312 | Ga0395899_0321354 | Ga0395899_0321354_326_850 | 174 |
| 510 | 3300037418 | Ga0395900_0039595 | Ga0395900_0039595_2240_2764 | 174 |
| 511 | 3300037418 | Ga0395900_0557859 | Ga0395900_0557859_94_618 | 174 |
| 512 | 3300037466 | Ga0395898_0702193 | Ga0395898_0702193_27_551 | 174 |
| 513 | 3300037471 | Ga0395905_0012207 | Ga0395905_0012207_6937_7461 | 174 |
| 514 | 3300038443 | Ga0395901_0100457 | Ga0395901_0100457_849_1373 | 174 |
| 515 | 3300038996 | Ga0242420_008752 | Ga0242420_008752_866_1390 | 174 |
| 516 | 3300038996 | Ga0242420_009466 | Ga0242420_009466_359_886 | 174 |
| 517 | 3300038996 | Ga0242420_011643 | Ga0242420_011643_12_536 | 174 |
| 518 | 3300038996 | Ga0242420_027015 | Ga0242420_027015_82_609 | 174 |
| 519 | 3300042001 | Ga0439441_078405 | Ga0439441_078405_116_643 | 174 |
| 520 | 3300042005 | Ga0439448_0071818 | Ga0439448_0071818_357_884 | 174 |
| 521 | 3300042012 | Ga0439455_0008138 | Ga0439455_0008138_1308_1835 | 174 |
| 522 | 3300042012 | Ga0439455_0072089 | Ga0439455_0072089_88_615 | 174 |
| 523 | 3300042144 | Ga0450889_004308 | Ga0450889_004308_556_1083 | 174 |
| 524 | 3300042157 | Ga0439458_0006689 | Ga0439458_0006689_1632_2159 | 174 |
| 525 | 3300042438 | Ga0439459_0004125 | Ga0439459_0004125_376_903 | 174 |
| 526 | 3300042439 | Ga0439464_0018432 | Ga0439464_0018432_1321_1848 | 174 |
| 527 | 3300042439 | Ga0439464_0038737 | Ga0439464_0038737_111_638 | 174 |
| 528 | 3300042461 | Ga0439460_0001601 | Ga0439460_0001601_1668_2195 | 174 |
| 529 | 3300042532 | Ga0450893_0061635 | Ga0450893_0061635_11_538 | 174 |
| 530 | 3300042876 | Ga0451577_0078028 | Ga0451577_0078028_616_1143 | 174 |
| 531 | 3300042876 | Ga0451577_0198191 | Ga0451577_0198191_177_704 | 174 |
| 532 | 3300042876 | Ga0451577_0242690 | Ga0451577_0242690_441_968 | 174 |
| 533 | 3300042993 | Ga0439440_0055770 | Ga0439440_0055770_168_695 | 174 |
| 534 | 3300044673 | Ga0453683_0036968 | Ga0453683_0036968_1857_2384 | 174 |
| 535 | 3300044673 | Ga0453683_0105587 | Ga0453683_0105587_458_982 | 174 |
| 536 | 3300044673 | Ga0453683_0156588 | Ga0453683_0156588_400_927 | 174 |
| 537 | 3300044673 | Ga0453683_0608074 | Ga0453683_0608074_152_679 | 174 |
| 538 | 3300044712 | Ga0453684_0044975 | Ga0453684_0044975_898_1425 | 174 |
| 539 | 3300045049 | Ga0466959_0612198 | Ga0466959_0612198_133_711 | 174 |
| 540 | 3300045051 | Ga0451576_0012483 | Ga0451576_0012483_4117_4644 | 174 |
| 541 | 3300045051 | Ga0451576_0022854 | Ga0451576_0022854_151_678 | 174 |
| 542 | 3300045051 | Ga0451576_0073514 | Ga0451576_0073514_2649_3176 | 174 |
| 543 | 3300045051 | Ga0451576_0119751 | Ga0451576_0119751_171_698 | 174 |
| 544 | 3300045051 | Ga0451576_0376510 | Ga0451576_0376510_675_1199 | 174 |
| 545 | 3300045051 | Ga0451576_0837922 | Ga0451576_0837922_172_699 | 174 |
| 546 | 3300046459 | Ga0495629_0145917 | Ga0495629_0145917_826_1407 | 174 |
| 547 | 3300046517 | Ga0495630_0113280 | Ga0495630_0113280_83_634 | 174 |
| 548 | 3300046531 | Ga0495665_0241085 | Ga0495665_0241085_228_779 | 174 |
| 549 | 3300047315 | Ga0495581_0134020 | Ga0495581_0134020_858_1409 | 174 |
| 550 | 3300048905 | Ga0496102_0051265 | Ga0496102_0051265_1902_2429 | 174 |
| 551 | 3300048905 | Ga0496102_0080800 | Ga0496102_0080800_1663_2190 | 174 |
| 552 | 3300048905 | Ga0496102_0841493 | Ga0496102_0841493_134_685 | 174 |
| 553 | 3300048907 | Ga0496104_0012746 | Ga0496104_0012746_2497_3048 | 174 |
| 554 | 3300048907 | Ga0496104_0738211 | Ga0496104_0738211_167_694 | 174 |
| 555 | 3300048908 | Ga0496105_0068439 | Ga0496105_0068439_2243_2794 | 174 |
| 556 | 3300048909 | Ga0496106_0054853 | Ga0496106_0054853_1272_1799 | 174 |
| 557 | 3300048911 | Ga0496108_0011753 | Ga0496108_0011753_1157_1708 | 174 |
| 558 | 3300048912 | Ga0496109_0203779 | Ga0496109_0203779_1157_1708 | 174 |
| 559 | 3300048912 | Ga0496109_0678498 | Ga0496109_0678498_121_645 | 174 |
| 560 | 3300048913 | Ga0496110_0024875 | Ga0496110_0024875_3088_3639 | 174 |
| 561 | 3300048914 | Ga0496111_0012377 | Ga0496111_0012377_399_950 | 174 |
| 562 | 3300048915 | Ga0496112_0066335 | Ga0496112_0066335_2961_3488 | 174 |
| 563 | 3300048915 | Ga0496112_0066764 | Ga0496112_0066764_1969_2520 | 174 |
| 564 | 3300048916 | Ga0496113_0006938 | Ga0496113_0006938_4168_4719 | 174 |
| 565 | 3300048916 | Ga0496113_1182081 | Ga0496113_1182081_24_554 | 174 |
| 566 | 3300049568 | Ga0501031_0031403 | Ga0501031_0031403_1830_2354 | 174 |
| 567 | 3300049569 | Ga0501032_0430586 | Ga0501032_0430586_227_751 | 174 |
| 568 | 3300049570 | Ga0501033_0279268 | Ga0501033_0279268_278_802 | 174 |
| 569 | 3300049570 | Ga0501033_0283430 | Ga0501033_0283430_633_1157 | 174 |
| 570 | 3300049572 | Ga0501036_0001561 | Ga0501036_0001561_15200_15724 | 174 |
| 571 | 3300049572 | Ga0501036_0031720 | Ga0501036_0031720_2078_2602 | 174 |
| 572 | 3300049572 | Ga0501036_0059724 | Ga0501036_0059724_635_1159 | 174 |
| 573 | 3300049572 | Ga0501036_0105276 | Ga0501036_0105276_900_1424 | 174 |
| 574 | 3300049572 | Ga0501036_0239478 | Ga0501036_0239478_454_978 | 174 |
| 575 | 3300049572 | Ga0501036_0272545 | Ga0501036_0272545_798_1322 | 174 |
| 576 | 3300049572 | Ga0501036_0483946 | Ga0501036_0483946_232_759 | 174 |
| 577 | 3300049572 | Ga0501036_0645479 | Ga0501036_0645479_342_866 | 174 |
| 578 | 3300049572 | Ga0501036_0762708 | Ga0501036_0762708_188_712 | 174 |
| 579 | 3300049573 | Ga0501037_0076391 | Ga0501037_0076391_1891_2415 | 174 |
| 580 | 3300049573 | Ga0501037_0355717 | Ga0501037_0355717_278_802 | 174 |
| 581 | 3300049573 | Ga0501037_0391551 | Ga0501037_0391551_252_776 | 174 |
| 582 | 3300049574 | Ga0501038_0002016 | Ga0501038_0002016_17864_18388 | 174 |
| 583 | 3300049574 | Ga0501038_0119864 | Ga0501038_0119864_556_1080 | 174 |
| 584 | 3300049574 | Ga0501038_0353056 | Ga0501038_0353056_151_675 | 174 |
| 585 | 3300049574 | Ga0501038_0447805 | Ga0501038_0447805_168_692 | 174 |
| 586 | 3300049575 | Ga0501039_0017830 | Ga0501039_0017830_776_1300 | 174 |
| 587 | 3300049575 | Ga0501039_0294315 | Ga0501039_0294315_58_582 | 174 |
| 588 | 3300049575 | Ga0501039_0425139 | Ga0501039_0425139_179_703 | 174 |
| 589 | 3300049575 | Ga0501039_0660556 | Ga0501039_0660556_227_751 | 174 |
| 590 | 3300049576 | Ga0501040_0021002 | Ga0501040_0021002_1719_2246 | 174 |
| 591 | 3300049576 | Ga0501040_0022215 | Ga0501040_0022215_1145_1669 | 174 |
| 592 | 3300049576 | Ga0501040_0122858 | Ga0501040_0122858_70_594 | 174 |
| 593 | 3300049576 | Ga0501040_0135686 | Ga0501040_0135686_106_633 | 174 |
| 594 | 3300049576 | Ga0501040_0139836 | Ga0501040_0139836_853_1377 | 174 |
| 595 | 3300049576 | Ga0501040_0145412 | Ga0501040_0145412_699_1223 | 174 |
| 596 | 3300049576 | Ga0501040_0431252 | Ga0501040_0431252_331_855 | 174 |
| 597 | 3300049576 | Ga0501040_0445544 | Ga0501040_0445544_200_724 | 174 |
| 598 | 3300049576 | Ga0501040_0762199 | Ga0501040_0762199_101_625 | 174 |
| 599 | 3300049577 | Ga0501041_0003824 | Ga0501041_0003824_1223_1747 | 174 |
| 600 | 3300049577 | Ga0501041_0014897 | Ga0501041_0014897_3650_4174 | 174 |
| 601 | 3300049577 | Ga0501041_0051508 | Ga0501041_0051508_1598_2122 | 174 |
| 602 | 3300049577 | Ga0501041_0086635 | Ga0501041_0086635_383_907 | 174 |
| 603 | 3300049577 | Ga0501041_0103756 | Ga0501041_0103756_326_850 | 174 |
| 604 | 3300049577 | Ga0501041_0391180 | Ga0501041_0391180_161_685 | 174 |
| 605 | 3300049577 | Ga0501041_0471638 | Ga0501041_0471638_135_662 | 174 |
| 606 | 3300049577 | Ga0501041_0484214 | Ga0501041_0484214_100_624 | 174 |
| 607 | 3300049578 | Ga0501042_0002923 | Ga0501042_0002923_9247_9771 | 174 |
| 608 | 3300049578 | Ga0501042_0033753 | Ga0501042_0033753_2059_2583 | 174 |
| 609 | 3300049578 | Ga0501042_0048990 | Ga0501042_0048990_1328_1852 | 174 |
| 610 | 3300049578 | Ga0501042_0053577 | Ga0501042_0053577_631_1158 | 174 |
| 611 | 3300049578 | Ga0501042_0071800 | Ga0501042_0071800_491_1015 | 174 |
| 612 | 3300049578 | Ga0501042_0108182 | Ga0501042_0108182_198_725 | 174 |
| 613 | 3300049578 | Ga0501042_0598797 | Ga0501042_0598797_83_607 | 174 |
| 614 | 3300049579 | Ga0501043_0143931 | Ga0501043_0143931_196_720 | 174 |
| 615 | 3300049579 | Ga0501043_0531830 | Ga0501043_0531830_143_667 | 174 |
| 616 | 3300049579 | Ga0501043_0822853 | Ga0501043_0822853_114_638 | 174 |
| 617 | 3300049580 | Ga0501046_0000476 | Ga0501046_0000476_1956_2483 | 174 |
| 618 | 3300049580 | Ga0501046_0023214 | Ga0501046_0023214_3289_3813 | 174 |
| 619 | 3300049580 | Ga0501046_0036233 | Ga0501046_0036233_1614_2138 | 174 |
| 620 | 3300049580 | Ga0501046_0116441 | Ga0501046_0116441_1141_1665 | 174 |
| 621 | 3300049580 | Ga0501046_0116530 | Ga0501046_0116530_371_898 | 174 |
| 622 | 3300049580 | Ga0501046_0155913 | Ga0501046_0155913_440_964 | 174 |
| 623 | 3300049580 | Ga0501046_0236450 | Ga0501046_0236450_340_864 | 174 |
| 624 | 3300049580 | Ga0501046_0874773 | Ga0501046_0874773_20_544 | 174 |
| 625 | 3300049581 | Ga0501047_0062026 | Ga0501047_0062026_1739_2266 | 174 |
| 626 | 3300049582 | Ga0501048_0006058 | Ga0501048_0006058_8012_8536 | 174 |
| 627 | 3300049582 | Ga0501048_0007656 | Ga0501048_0007656_2797_3321 | 174 |
| 628 | 3300049582 | Ga0501048_0027939 | Ga0501048_0027939_251_775 | 174 |
| 629 | 3300049582 | Ga0501048_0141175 | Ga0501048_0141175_292_816 | 174 |
| 630 | 3300049582 | Ga0501048_0269442 | Ga0501048_0269442_670_1194 | 174 |
| 631 | 3300049582 | Ga0501048_0301898 | Ga0501048_0301898_292_819 | 174 |
| 632 | 3300049582 | Ga0501048_0671629 | Ga0501048_0671629_135_659 | 174 |
| 633 | 3300049582 | Ga0501048_0693543 | Ga0501048_0693543_54_578 | 174 |
| 634 | 3300049584 | Ga0501068_0054941 | Ga0501068_0054941_943_1467 | 174 |
| 635 | 3300049584 | Ga0501068_0064140 | Ga0501068_0064140_1434_1958 | 174 |
| 636 | 3300049584 | Ga0501068_0066202 | Ga0501068_0066202_984_1508 | 174 |
| 637 | 3300049584 | Ga0501068_0157188 | Ga0501068_0157188_779_1306 | 174 |
| 638 | 3300049584 | Ga0501068_0344449 | Ga0501068_0344449_404_931 | 174 |
| 639 | 3300049584 | Ga0501068_0421403 | Ga0501068_0421403_58_582 | 174 |
| 640 | 3300049584 | Ga0501068_0454190 | Ga0501068_0454190_287_811 | 174 |
| 641 | 3300049585 | Ga0501069_0032278 | Ga0501069_0032278_1829_2353 | 174 |
| 642 | 3300049585 | Ga0501069_0146851 | Ga0501069_0146851_562_1086 | 174 |
| 643 | 3300049586 | Ga0501070_0079961 | Ga0501070_0079961_1291_1815 | 174 |
| 644 | 3300049586 | Ga0501070_0727127 | Ga0501070_0727127_42_566 | 174 |
| 645 | 3300049587 | Ga0501071_0000146 | Ga0501071_0000146_28744_29268 | 174 |
| 646 | 3300049587 | Ga0501071_0017630 | Ga0501071_0017630_93_617 | 174 |
| 647 | 3300049587 | Ga0501071_0028787 | Ga0501071_0028787_2651_3175 | 174 |
| 648 | 3300049587 | Ga0501071_0142655 | Ga0501071_0142655_46_570 | 174 |
| 649 | 3300049587 | Ga0501071_0150657 | Ga0501071_0150657_536_1060 | 174 |
| 650 | 3300049587 | Ga0501071_0266387 | Ga0501071_0266387_181_705 | 174 |
| 651 | 3300049587 | Ga0501071_0420821 | Ga0501071_0420821_425_952 | 174 |
| 652 | 3300049587 | Ga0501071_0611609 | Ga0501071_0611609_122_646 | 174 |
| 653 | 3300049587 | Ga0501071_0632587 | Ga0501071_0632587_203_730 | 174 |
| 654 | 3300049588 | Ga0501072_0001090 | Ga0501072_0001090_4331_4855 | 174 |
| 655 | 3300049588 | Ga0501072_0024330 | Ga0501072_0024330_395_919 | 174 |
| 656 | 3300049588 | Ga0501072_0049544 | Ga0501072_0049544_1693_2217 | 174 |
| 657 | 3300049588 | Ga0501072_0092290 | Ga0501072_0092290_451_975 | 174 |
| 658 | 3300049588 | Ga0501072_0104792 | Ga0501072_0104792_391_915 | 174 |
| 659 | 3300049588 | Ga0501072_0125191 | Ga0501072_0125191_1482_2006 | 174 |
| 660 | 3300049588 | Ga0501072_0140833 | Ga0501072_0140833_950_1474 | 174 |
| 661 | 3300049588 | Ga0501072_0452674 | Ga0501072_0452674_199_723 | 174 |
| 662 | 3300049588 | Ga0501072_1015092 | Ga0501072_1015092_101_625 | 174 |
| 663 | 3300049589 | Ga0501073_0112475 | Ga0501073_0112475_326_850 | 174 |
| 664 | 3300049589 | Ga0501073_0283161 | Ga0501073_0283161_411_938 | 174 |
| 665 | 3300049589 | Ga0501073_0373660 | Ga0501073_0373660_64_588 | 174 |
| 666 | 3300049589 | Ga0501073_0589683 | Ga0501073_0589683_127_651 | 174 |
| 667 | 3300049589 | Ga0501073_0631443 | Ga0501073_0631443_92_616 | 174 |
| 668 | 3300049590 | Ga0501074_0020451 | Ga0501074_0020451_4008_4532 | 174 |
| 669 | 3300049590 | Ga0501074_0143337 | Ga0501074_0143337_428_1021 | 174 |
| 670 | 3300049590 | Ga0501074_0175619 | Ga0501074_0175619_873_1397 | 174 |
| 671 | 3300049590 | Ga0501074_0348253 | Ga0501074_0348253_263_787 | 174 |
| 672 | 3300049590 | Ga0501074_0485847 | Ga0501074_0485847_270_794 | 174 |
| 673 | 3300049590 | Ga0501074_0555007 | Ga0501074_0555007_77_601 | 174 |
| 674 | 3300049590 | Ga0501074_0560808 | Ga0501074_0560808_209_733 | 174 |
| 675 | 3300049590 | Ga0501074_0589570 | Ga0501074_0589570_170_697 | 174 |
| 676 | 3300049591 | Ga0501075_0000205 | Ga0501075_0000205_11396_11920 | 174 |
| 677 | 3300049591 | Ga0501075_0006572 | Ga0501075_0006572_5293_5817 | 174 |
| 678 | 3300049591 | Ga0501075_0008457 | Ga0501075_0008457_2812_3339 | 174 |
| 679 | 3300049591 | Ga0501075_0029261 | Ga0501075_0029261_1434_1961 | 174 |
| 680 | 3300049591 | Ga0501075_0083369 | Ga0501075_0083369_786_1310 | 174 |
| 681 | 3300049591 | Ga0501075_0121126 | Ga0501075_0121126_541_1065 | 174 |
| 682 | 3300049591 | Ga0501075_0145036 | Ga0501075_0145036_125_649 | 174 |
| 683 | 3300049591 | Ga0501075_0177679 | Ga0501075_0177679_189_713 | 174 |
| 684 | 3300049591 | Ga0501075_0196867 | Ga0501075_0196867_959_1510 | 174 |
| 685 | 3300049591 | Ga0501075_0237524 | Ga0501075_0237524_817_1341 | 174 |
| 686 | 3300049591 | Ga0501075_0263584 | Ga0501075_0263584_514_1101 | 174 |
| 687 | 3300049591 | Ga0501075_0370602 | Ga0501075_0370602_204_731 | 174 |
| 688 | 3300049592 | Ga0501076_0000137 | Ga0501076_0000137_31176_31700 | 174 |
| 689 | 3300049592 | Ga0501076_0000395 | Ga0501076_0000395_26331_26855 | 174 |
| 690 | 3300049592 | Ga0501076_0003994 | Ga0501076_0003994_4005_4529 | 174 |
| 691 | 3300049592 | Ga0501076_0007226 | Ga0501076_0007226_2448_2972 | 174 |
| 692 | 3300049592 | Ga0501076_0058543 | Ga0501076_0058543_1691_2218 | 174 |
| 693 | 3300049592 | Ga0501076_0115470 | Ga0501076_0115470_794_1318 | 174 |
| 694 | 3300049592 | Ga0501076_0154646 | Ga0501076_0154646_173_697 | 174 |
| 695 | 3300049592 | Ga0501076_0246814 | Ga0501076_0246814_553_1077 | 174 |
| 696 | 3300049592 | Ga0501076_0445008 | Ga0501076_0445008_493_1020 | 174 |
| 697 | 3300049592 | Ga0501076_0926682 | Ga0501076_0926682_57_581 | 174 |
| 698 | 3300049592 | Ga0501076_1018049 | Ga0501076_1018049_53_577 | 174 |
| 699 | 3300049593 | Ga0501077_0006006 | Ga0501077_0006006_3920_4444 | 174 |
| 700 | 3300049593 | Ga0501077_0011430 | Ga0501077_0011430_4963_5487 | 174 |
| 701 | 3300049593 | Ga0501077_0014533 | Ga0501077_0014533_1253_1780 | 174 |
| 702 | 3300049593 | Ga0501077_0019267 | Ga0501077_0019267_1834_2358 | 174 |
| 703 | 3300049593 | Ga0501077_0057319 | Ga0501077_0057319_710_1234 | 174 |
| 704 | 3300049593 | Ga0501077_0062680 | Ga0501077_0062680_1824_2348 | 174 |
| 705 | 3300049593 | Ga0501077_0083247 | Ga0501077_0083247_820_1344 | 174 |
| 706 | 3300049593 | Ga0501077_0185891 | Ga0501077_0185891_187_711 | 174 |
| 707 | 3300049593 | Ga0501077_0477996 | Ga0501077_0477996_219_743 | 174 |
| 708 | 3300049741 | Ga0501079_0003718 | Ga0501079_0003718_7266_7793 | 174 |
| 709 | 3300049741 | Ga0501079_0016521 | Ga0501079_0016521_2922_3446 | 174 |
| 710 | 3300049741 | Ga0501079_0022665 | Ga0501079_0022665_148_672 | 174 |
| 711 | 3300049741 | Ga0501079_0031727 | Ga0501079_0031727_169_693 | 174 |
| 712 | 3300049741 | Ga0501079_0076365 | Ga0501079_0076365_1336_1860 | 174 |
| 713 | 3300049741 | Ga0501079_0824170 | Ga0501079_0824170_29_553 | 174 |
| 714 | 3300049742 | Ga0501080_0004005 | Ga0501080_0004005_10302_10826 | 174 |
| 715 | 3300049742 | Ga0501080_0026494 | Ga0501080_0026494_4051_4575 | 174 |
| 716 | 3300049742 | Ga0501080_0110225 | Ga0501080_0110225_180_707 | 174 |
| 717 | 3300049742 | Ga0501080_0138619 | Ga0501080_0138619_180_704 | 174 |
| 718 | 3300049742 | Ga0501080_0141524 | Ga0501080_0141524_925_1452 | 174 |
| 719 | 3300049742 | Ga0501080_0190991 | Ga0501080_0190991_557_1081 | 174 |
| 720 | 3300049742 | Ga0501080_0192249 | Ga0501080_0192249_678_1202 | 174 |
| 721 | 3300049742 | Ga0501080_0279095 | Ga0501080_0279095_14_541 | 174 |
| 722 | 3300049742 | Ga0501080_0360483 | Ga0501080_0360483_273_797 | 174 |
| 723 | 3300049743 | Ga0501081_0000816 | Ga0501081_0000816_3258_3785 | 174 |
| 724 | 3300049743 | Ga0501081_0003078 | Ga0501081_0003078_890_1414 | 174 |
| 725 | 3300049743 | Ga0501081_0008477 | Ga0501081_0008477_2766_3290 | 174 |
| 726 | 3300049743 | Ga0501081_0012639 | Ga0501081_0012639_78_602 | 174 |
| 727 | 3300049743 | Ga0501081_0017401 | Ga0501081_0017401_306_830 | 174 |
| 728 | 3300049743 | Ga0501081_0034761 | Ga0501081_0034761_1439_1966 | 174 |
| 729 | 3300049743 | Ga0501081_0091688 | Ga0501081_0091688_493_1017 | 174 |
| 730 | 3300049743 | Ga0501081_0104979 | Ga0501081_0104979_889_1413 | 174 |
| 731 | 3300049743 | Ga0501081_0128041 | Ga0501081_0128041_558_1082 | 174 |
| 732 | 3300049743 | Ga0501081_0216605 | Ga0501081_0216605_384_908 | 174 |
| 733 | 3300049743 | Ga0501081_0311467 | Ga0501081_0311467_609_1133 | 174 |
| 734 | 3300049743 | Ga0501081_0426614 | Ga0501081_0426614_306_899 | 174 |
| 735 | 3300049743 | Ga0501081_0460685 | Ga0501081_0460685_19_543 | 174 |
| 736 | 3300049744 | Ga0501083_0059827 | Ga0501083_0059827_1608_2132 | 174 |
| 737 | 3300049744 | Ga0501083_0175673 | Ga0501083_0175673_565_1089 | 174 |
| 738 | 3300049744 | Ga0501083_0245353 | Ga0501083_0245353_21_545 | 174 |
| 739 | 3300049744 | Ga0501083_0696632 | Ga0501083_0696632_28_552 | 174 |
| 740 | 3300049822 | Ga0501035_0060869 | Ga0501035_0060869_1042_1566 | 174 |
| 741 | 3300049822 | Ga0501035_0182015 | Ga0501035_0182015_783_1307 | 174 |
| 742 | 3300049822 | Ga0501035_0317326 | Ga0501035_0317326_54_578 | 174 |
| 743 | 3300049823 | Ga0501044_0732140 | Ga0501044_0732140_243_767 | 174 |
| 744 | 3300049824 | Ga0501045_0003262 | Ga0501045_0003262_8355_8879 | 174 |
| 745 | 3300049824 | Ga0501045_0045545 | Ga0501045_0045545_1622_2149 | 174 |
| 746 | 3300049824 | Ga0501045_0047319 | Ga0501045_0047319_1403_1927 | 174 |
| 747 | 3300049824 | Ga0501045_0125013 | Ga0501045_0125013_589_1113 | 174 |
| 748 | 3300049824 | Ga0501045_0170260 | Ga0501045_0170260_680_1204 | 174 |
| 749 | 3300049824 | Ga0501045_0179722 | Ga0501045_0179722_57_581 | 174 |
| 750 | 3300049824 | Ga0501045_0188676 | Ga0501045_0188676_16_540 | 174 |
| 751 | 3300049824 | Ga0501045_0565338 | Ga0501045_0565338_55_579 | 174 |
| 752 | 3300049824 | Ga0501045_0675451 | Ga0501045_0675451_216_740 | 174 |
| 753 | 3300049824 | Ga0501045_0701805 | Ga0501045_0701805_191_715 | 174 |
| 754 | 3300049824 | Ga0501045_0711311 | Ga0501045_0711311_17_541 | 174 |
| 755 | 3300050489 | nmdc:mga03683_135440_c1 | nmdc:mga03683_135440_c1_75_653 | 174 |
| 756 | 3300050490 | nmdc:mga03n38_685743_c1 | nmdc:mga03n38_685743_c1_31_576 | 174 |
| 757 | 3300050493 | nmdc:mga0k408_240248_c1 | nmdc:mga0k408_240248_c1_289_867 | 174 |
| 758 | 3300050507 | nmdc:mga05p37_1381_c1 | nmdc:mga05p37_1381_c1_14729_15253 | 174 |
| 759 | 3300050507 | nmdc:mga05p37_138226_c1 | nmdc:mga05p37_138226_c1_826_1350 | 174 |
| 760 | 3300050507 | nmdc:mga05p37_173483_c1 | nmdc:mga05p37_173483_c1_631_1155 | 174 |
| 761 | 3300050507 | nmdc:mga05p37_20723_c1 | nmdc:mga05p37_20723_c1_6037_6564 | 174 |
| 762 | 3300050507 | nmdc:mga05p37_214272_c1 | nmdc:mga05p37_214272_c1_472_996 | 174 |
| 763 | 3300050507 | nmdc:mga05p37_2162_c1 | nmdc:mga05p37_2162_c1_9164_9688 | 174 |
| 764 | 3300050507 | nmdc:mga05p37_237487_c1 | nmdc:mga05p37_237487_c1_252_779 | 174 |
| 765 | 3300050507 | nmdc:mga05p37_245624_c1 | nmdc:mga05p37_245624_c1_275_799 | 174 |
| 766 | 3300050507 | nmdc:mga05p37_27267_c1 | nmdc:mga05p37_27267_c1_4150_4674 | 174 |
| 767 | 3300050507 | nmdc:mga05p37_27703_c1 | nmdc:mga05p37_27703_c1_5970_6494 | 174 |
| 768 | 3300050507 | nmdc:mga05p37_320066_c1 | nmdc:mga05p37_320066_c1_1088_1612 | 174 |
| 769 | 3300050507 | nmdc:mga05p37_366_c1 | nmdc:mga05p37_366_c1_5436_5960 | 174 |
| 770 | 3300050507 | nmdc:mga05p37_38713_c1 | nmdc:mga05p37_38713_c1_219_743 | 174 |
| 771 | 3300050507 | nmdc:mga05p37_40993_c1 | nmdc:mga05p37_40993_c1_1559_2086 | 174 |
| 772 | 3300050507 | nmdc:mga05p37_420_c1 | nmdc:mga05p37_420_c1_9468_10019 | 174 |
| 773 | 3300050507 | nmdc:mga05p37_455555_c1 | nmdc:mga05p37_455555_c1_728_1279 | 174 |
| 774 | 3300050507 | nmdc:mga05p37_456088_c1 | nmdc:mga05p37_456088_c1_232_756 | 174 |
| 775 | 3300050507 | nmdc:mga05p37_55220_c1 | nmdc:mga05p37_55220_c1_2531_3055 | 174 |
| 776 | 3300050507 | nmdc:mga05p37_763161_c1 | nmdc:mga05p37_763161_c1_139_666 | 174 |
| 777 | 3300050508 | nmdc:mga09592_142152_c1 | nmdc:mga09592_142152_c1_189_713 | 174 |
| 778 | 3300050508 | nmdc:mga09592_1725_c1 | nmdc:mga09592_1725_c1_11968_12492 | 174 |
| 779 | 3300050508 | nmdc:mga09592_27933_c1 | nmdc:mga09592_27933_c1_1629_2153 | 174 |
| 780 | 3300050508 | nmdc:mga09592_31228_c1 | nmdc:mga09592_31228_c1_2814_3338 | 174 |
| 781 | 3300050508 | nmdc:mga09592_43727_c1 | nmdc:mga09592_43727_c1_539_1063 | 174 |
| 782 | 3300050508 | nmdc:mga09592_56205_c1 | nmdc:mga09592_56205_c1_337_861 | 174 |
| 783 | 3300050508 | nmdc:mga09592_659_c2 | nmdc:mga09592_659_c2_9603_10154 | 174 |
| 784 | 3300050509 | nmdc:mga0qj67_226099_c1 | nmdc:mga0qj67_226099_c1_983_1507 | 174 |
| 785 | 3300050509 | nmdc:mga0qj67_240783_c1 | nmdc:mga0qj67_240783_c1_519_1043 | 174 |
| 786 | 3300050509 | nmdc:mga0qj67_29487_c1 | nmdc:mga0qj67_29487_c1_2865_3389 | 174 |
| 787 | 3300050509 | nmdc:mga0qj67_62907_c1 | nmdc:mga0qj67_62907_c1_2001_2525 | 174 |
| 788 | 3300050509 | nmdc:mga0qj67_79_c2 | nmdc:mga0qj67_79_c2_9603_10154 | 174 |
| 789 | 3300050510 | nmdc:mga06r32_224794_c1 | nmdc:mga06r32_224794_c1_636_1160 | 174 |
| 790 | 3300050510 | nmdc:mga06r32_29097_c1 | nmdc:mga06r32_29097_c1_806_1330 | 174 |
| 791 | 3300050510 | nmdc:mga06r32_393204_c1 | nmdc:mga06r32_393204_c1_809_1333 | 174 |
| 792 | 3300050510 | nmdc:mga06r32_4242_c1 | nmdc:mga06r32_4242_c1_5415_5939 | 174 |
| 793 | 3300050510 | nmdc:mga06r32_4674_c1 | nmdc:mga06r32_4674_c1_5892_6416 | 174 |
| 794 | 3300050510 | nmdc:mga06r32_839_c1 | nmdc:mga06r32_839_c1_9489_10040 | 174 |
| 795 | 3300050510 | nmdc:mga06r32_922928_c1 | nmdc:mga06r32_922928_c1_96_620 | 174 |
| 796 | 3300050511 | nmdc:mga08y16_243974_c1 | nmdc:mga08y16_243974_c1_817_1344 | 174 |
| 797 | 3300050511 | nmdc:mga08y16_655178_c1 | nmdc:mga08y16_655178_c1_163_690 | 174 |
| 798 | 3300050512 | nmdc:mga0n895_1198385_c1 | nmdc:mga0n895_1198385_c1_67_594 | 174 |
| 799 | 3300050512 | nmdc:mga0n895_1205366_c1 | nmdc:mga0n895_1205366_c1_13_537 | 174 |
| 800 | 3300050512 | nmdc:mga0n895_1328180_c1 | nmdc:mga0n895_1328180_c1_136_660 | 174 |
| 801 | 3300050512 | nmdc:mga0n895_21842_c1 | nmdc:mga0n895_21842_c1_2766_3290 | 174 |
| 802 | 3300050512 | nmdc:mga0n895_228569_c1 | nmdc:mga0n895_228569_c1_1266_1793 | 174 |
| 803 | 3300050512 | nmdc:mga0n895_237723_c1 | nmdc:mga0n895_237723_c1_885_1412 | 174 |
| 804 | 3300050512 | nmdc:mga0n895_351083_c1 | nmdc:mga0n895_351083_c1_525_1049 | 174 |
| 805 | 3300050512 | nmdc:mga0n895_515330_c1 | nmdc:mga0n895_515330_c1_30_557 | 174 |
| 806 | 3300050512 | nmdc:mga0n895_522286_c1 | nmdc:mga0n895_522286_c1_55_582 | 174 |
| 807 | 3300050512 | nmdc:mga0n895_72892_c1 | nmdc:mga0n895_72892_c1_2367_2894 | 174 |
| 808 | 3300050513 | nmdc:mga0rr50_1063_c1 | nmdc:mga0rr50_1063_c1_1800_2324 | 174 |
| 809 | 3300050513 | nmdc:mga0rr50_197052_c1 | nmdc:mga0rr50_197052_c1_58_585 | 174 |
| 810 | 3300050513 | nmdc:mga0rr50_52581_c1 | nmdc:mga0rr50_52581_c1_1684_2211 | 174 |
| 811 | 3300050513 | nmdc:mga0rr50_5896_c1 | nmdc:mga0rr50_5896_c1_1927_2454 | 174 |
| 812 | 3300050513 | nmdc:mga0rr50_777368_c1 | nmdc:mga0rr50_777368_c1_170_697 | 174 |
| 813 | 3300050513 | nmdc:mga0rr50_857269_c1 | nmdc:mga0rr50_857269_c1_226_750 | 174 |
| 814 | 3300050514 | nmdc:mga08x19_120485_c1 | nmdc:mga08x19_120485_c1_462_986 | 174 |
| 815 | 3300050514 | nmdc:mga08x19_19467_c1 | nmdc:mga08x19_19467_c1_2718_3257 | 174 |
| 816 | 3300050514 | nmdc:mga08x19_374743_c1 | nmdc:mga08x19_374743_c1_430_954 | 174 |
| 817 | 3300050514 | nmdc:mga08x19_90818_c1 | nmdc:mga08x19_90818_c1_1265_1792 | 174 |
| 818 | 3300050514 | nmdc:mga08x19_94959_c1 | nmdc:mga08x19_94959_c1_471_995 | 174 |
| 819 | 3300050515 | nmdc:mga0a205_10314_c2 | nmdc:mga0a205_10314_c2_3282_3809 | 174 |
| 820 | 3300050515 | nmdc:mga0a205_12191_c1 | nmdc:mga0a205_12191_c1_5807_6331 | 174 |
| 821 | 3300050515 | nmdc:mga0a205_141732_c1 | nmdc:mga0a205_141732_c1_916_1443 | 174 |
| 822 | 3300050515 | nmdc:mga0a205_420492_c1 | nmdc:mga0a205_420492_c1_308_835 | 174 |
| 823 | 3300050515 | nmdc:mga0a205_589033_c1 | nmdc:mga0a205_589033_c1_122_646 | 174 |
| 824 | 3300050515 | nmdc:mga0a205_6576_c1 | nmdc:mga0a205_6576_c1_4801_5328 | 174 |
| 825 | 3300050515 | nmdc:mga0a205_701672_c1 | nmdc:mga0a205_701672_c1_175_699 | 174 |
| 826 | 3300050515 | nmdc:mga0a205_73782_c1 | nmdc:mga0a205_73782_c1_406_930 | 174 |
| 827 | 3300050515 | nmdc:mga0a205_77799_c1 | nmdc:mga0a205_77799_c1_2197_2721 | 174 |
| 828 | 3300050515 | nmdc:mga0a205_83577_c1 | nmdc:mga0a205_83577_c1_225_752 | 174 |
| 829 | 3300050515 | nmdc:mga0a205_84896_c1 | nmdc:mga0a205_84896_c1_2234_2758 | 174 |
| 830 | 3300050515 | nmdc:mga0a205_86273_c1 | nmdc:mga0a205_86273_c1_2070_2597 | 174 |
| 831 | 3300050516 | nmdc:mga0sz30_215025_c1 | nmdc:mga0sz30_215025_c1_155_733 | 174 |
| 832 | 3300054114 | Ga0501084_0002983 | Ga0501084_0002983_3257_3784 | 174 |
| 833 | 3300054114 | Ga0501084_0004662 | Ga0501084_0004662_10113_10637 | 174 |
| 834 | 3300054114 | Ga0501084_0006404 | Ga0501084_0006404_5588_6112 | 174 |
| 835 | 3300054114 | Ga0501084_0009660 | Ga0501084_0009660_5571_6095 | 174 |
| 836 | 3300054114 | Ga0501084_0012861 | Ga0501084_0012861_3037_3561 | 174 |
| 837 | 3300054114 | Ga0501084_0046677 | Ga0501084_0046677_1226_1753 | 174 |
| 838 | 3300054114 | Ga0501084_0049668 | Ga0501084_0049668_1552_2076 | 174 |
| 839 | 3300054114 | Ga0501084_0122614 | Ga0501084_0122614_53_577 | 174 |
| 840 | 3300054114 | Ga0501084_0214330 | Ga0501084_0214330_561_1085 | 174 |
| 841 | 3300054114 | Ga0501084_0254007 | Ga0501084_0254007_914_1438 | 174 |
| 842 | 3300054114 | Ga0501084_0293122 | Ga0501084_0293122_646_1170 | 174 |
| 843 | 3300054114 | Ga0501084_0304971 | Ga0501084_0304971_423_947 | 174 |
| 844 | 3300054114 | Ga0501084_0310334 | Ga0501084_0310334_613_1137 | 174 |
| 845 | 3300054114 | Ga0501084_0769949 | Ga0501084_0769949_67_636 | 174 |
| 846 | 3300060353 | Ga0501082_0000775 | Ga0501082_0000775_27348_27872 | 174 |
| 847 | 3300060353 | Ga0501082_0004399 | Ga0501082_0004399_3225_3749 | 174 |
| 848 | 3300060353 | Ga0501082_0059506 | Ga0501082_0059506_1832_2359 | 174 |
| 849 | 3300060353 | Ga0501082_0087471 | Ga0501082_0087471_65_589 | 174 |
| 850 | 3300060353 | Ga0501082_0094782 | Ga0501082_0094782_1845_2369 | 174 |
| 851 | 3300060353 | Ga0501082_0100158 | Ga0501082_0100158_1185_1709 | 174 |
| 852 | 3300060353 | Ga0501082_0177594 | Ga0501082_0177594_568_1095 | 174 |
| 853 | 3300060353 | Ga0501082_0376127 | Ga0501082_0376127_266_790 | 174 |
| 854 | 3300060353 | Ga0501082_0589609 | Ga0501082_0589609_194_721 | 174 |
| 855 | 3300060353 | Ga0501082_0690329 | Ga0501082_0690329_321_845 | 174 |
| 856 | 3300060353 | Ga0501082_1148752 | Ga0501082_1148752_84_608 | 174 |
| 857 | 3300061734 | Ga0530510_0000017 | Ga0530510_0000017_58014_58538 | 174 |
| 858 | 3300061734 | Ga0530510_0000168 | Ga0530510_0000168_23279_23803 | 174 |
| 859 | 3300061734 | Ga0530510_0008103 | Ga0530510_0008103_5725_6249 | 174 |
| 860 | 3300061734 | Ga0530510_0017607 | Ga0530510_0017607_4038_4562 | 174 |
| 861 | 3300061734 | Ga0530510_0032920 | Ga0530510_0032920_109_660 | 174 |
| 862 | 3300061734 | Ga0530510_0039287 | Ga0530510_0039287_837_1361 | 174 |
| 863 | 3300061734 | Ga0530510_0066647 | Ga0530510_0066647_1456_1980 | 174 |
| 864 | 3300061734 | Ga0530510_0069200 | Ga0530510_0069200_1552_2076 | 174 |
| 865 | 3300061734 | Ga0530510_0269289 | Ga0530510_0269289_218_742 | 174 |
| 866 | 3300061734 | Ga0530510_0287721 | Ga0530510_0287721_24_551 | 174 |
| 867 | 3300061734 | Ga0530510_0510475 | Ga0530510_0510475_281_805 | 174 |
| 868 | 3300061734 | Ga0530510_0676018 | Ga0530510_0676018_193_717 | 174 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fse-assembly1.cif.gz_A | crystal structure of a two-domain protein containing dj-1/thij/pfpi-like and ferritin-like domains (ava_4496) from anabaena variabilis atcc 29413 at 1.90 a resolution | 0.9849 | 6 | 171 |
| 3fse-assembly1.cif.gz_B | crystal structure of a two-domain protein containing dj-1/thij/pfpi-like and ferritin-like domains (ava_4496) from anabaena variabilis atcc 29413 at 1.90 a resolution | 0.9846 | 6 | 171 |
| 3l18-assembly1.cif.gz_B | ton1285, an intracellular protease from thermococcus onnurineus na1 | 0.9783 | 5 | 171 |
| 6q3t-assembly1.cif.gz_A | structure of protease1 from pyrococcus horikoshii at room temperature in chipx microfluidic device | 0.9768 | 7 | 171 |
| 7r66-assembly1.cif.gz_A | structure of pfp1 protease from thermococcus thioreducens: large unit cell at 1.44 a resolution | 0.9763 | 7 | 171 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3fseB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9764 | 6 | 171 | 3.40.50.880 |
| 1oi4B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9731 | 6 | 171 | 3.40.50.880 |
| 4y1eA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9696 | 6 | 171 | 3.40.50.880 |
| 6f2fA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.969 | 7 | 171 | 3.40.50.880 |
| 6f2fA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9518 | 7 | 171 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6W9J2-F1-model_v4 | DJ-1/PfpI domain-containing protein | 0.9991 | 1 | 143 |
|
| AF-A0A7V0Z3A3-F1-model_v4 | Type 1 glutamine amidotransferase | 0.9976 | 1 | 172 |
GO:0016740
|
| AF-A0A7C5EMH0-F1-model_v4 | Type 1 glutamine amidotransferase | 0.9966 | 1 | 171 |
GO:0016740
|
| AF-X1IU28-F1-model_v4 | DJ-1/PfpI domain-containing protein | 0.9965 | 70 | 173 |
|
| AF-A0A2G4I534-F1-model_v4 | DJ-1/PfpI domain-containing protein | 0.9962 | 68 | 173 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar