F484094

General Info

Members Datasets Scaffolds Average Seq Length
868 292 866 175

Family's Representative Sequence

Representative Sequence 3300048089|Ga0495614_0059104|Ga0495614_0059104_170_688
Length 172
Sequence MSLQGRKILVLAADYFEESELLYPVIRLREENADVVVAGVTRDAVKGKSGYGPYPVDVAVDEVDAAEFDAVVVPGGFAPDLLRRSSRVLDLVRHFDEAGKPLAIVCHGGWVPVSAGILRDRTVTSVAAIRDDLVNAGADWIDEPVVVDRNLISAQLPRDLGPWMKALITALA

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
180 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
181 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
182 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
183 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
189 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
190 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
192 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
193 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
194 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
195 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
196 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
197 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
201 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
202 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
209 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
210 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
211 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
212 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
213 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
214 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
215 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
216 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
217 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
218 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
219 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
220 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
221 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
222 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
223 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
224 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
225 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
226 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
227 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
228 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
232 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
260 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
261 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
262 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
263 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
264 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
265 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
266 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
267 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
268 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
269 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
272 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
277 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
278 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
281 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
282 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
286 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
287 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
288 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
289 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
291 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
292 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 1.96
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 1.96
Rhizosphere 96.66
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10009013 3300003203 Bacteria 4485
2 JGI26129J50193_1002094 3300003349 Bacteria 1394
3 Ga0058859_11388371 3300004798 Bacteria 954
4 Ga0058863_10794585 3300004799 Bacteria 629
5 Ga0058863_11506664 3300004799 Bacteria 1133
6 Ga0058861_11729795 3300004800 Bacteria 1134
7 Ga0058860_11455887 3300004801 Bacteria 1091
8 Ga0058862_12569376 3300004803 Bacteria 1163
9 Ga0065715_10707811 3300005293 Bacteria 650
10 Ga0070658_10029920 3300005327 Bacteria 4375
11 Ga0070676_10023181 3300005328 Bacteria 3487
12 Ga0070683_100096602 3300005329 Bacteria 2779
13 Ga0070690_100017062 3300005330 Bacteria 4358
14 Ga0070670_100008486 3300005331 Bacteria 8762
15 Ga0070677_10292517 3300005333 Bacteria 824
16 Ga0068869_100006217 3300005334 Bacteria 7561
17 Ga0068869_100078090 3300005334 Bacteria 2465
18 Ga0070666_10202859 3300005335 Bacteria 1395
19 Ga0070680_100009694 3300005336 Bacteria 7409
20 Ga0070680_100027659 3300005336 Bacteria 4542
21 Ga0070680_100068815 3300005336 Bacteria 2906
22 Ga0070680_100184356 3300005336 Bacteria 1758
23 Ga0070680_101134924 3300005336 Bacteria 676
24 Ga0070682_100000788 3300005337 Bacteria 18618
25 Ga0070682_100858959 3300005337 Bacteria 742
26 Ga0070660_100007707 3300005339 Bacteria 7504
27 Ga0070689_100063051 3300005340 Bacteria 2885
28 Ga0070691_10001039 3300005341 Bacteria 11421
29 Ga0070691_10017615 3300005341 Bacteria 3287
30 Ga0070691_10289622 3300005341 Bacteria 891
31 Ga0070687_100006584 3300005343 Bacteria 4772
32 Ga0070661_100003068 3300005344 Bacteria 11489
33 Ga0070661_100101059 3300005344 Bacteria 2145
34 Ga0070692_10001528 3300005345 Bacteria 8486
35 Ga0070668_101228316 3300005347 Bacteria 680
36 Ga0070669_100096497 3300005353 Bacteria 2224
37 Ga0070675_100265808 3300005354 Bacteria 1504
38 Ga0070671_100127402 3300005355 Bacteria 2144
39 Ga0070659_100000529 3300005366 Bacteria 27921
40 Ga0070703_10237601 3300005406 Bacteria 733
41 Ga0070713_100197615 3300005436 Bacteria 1815
42 Ga0070705_100000374 3300005440 Bacteria 26102
43 Ga0070700_100370814 3300005441 Bacteria 1067
44 Ga0070700_100940759 3300005441 Bacteria 706
45 Ga0070694_100008918 3300005444 Bacteria 6143
46 Ga0070694_100043921 3300005444 Bacteria 2990
47 Ga0070694_100334081 3300005444 Bacteria 1170
48 Ga0070694_100338205 3300005444 Bacteria 1163
49 Ga0070694_100729423 3300005444 Bacteria 808
50 Ga0070708_100034359 3300005445 Bacteria 4411
51 Ga0070708_100037504 3300005445 Unclassified 4229
52 Ga0070708_100056223 3300005445 Bacteria 3500
53 Ga0070708_100056710 3300005445 Bacteria 3486
54 Ga0070708_100057821 3300005445 Unclassified 3454
55 Ga0070708_100065060 3300005445 Unclassified 3269
56 Ga0070708_100171584 3300005445 Bacteria 2025
57 Ga0070708_100221620 3300005445 Bacteria 1774
58 Ga0070708_100246242 3300005445 Bacteria 1679
59 Ga0070708_100299728 3300005445 Bacteria 1513
60 Ga0070708_100432291 3300005445 Bacteria 1242
61 Ga0070708_100523416 3300005445 Unclassified 1118
62 Ga0070708_100615895 3300005445 Bacteria 1023
63 Ga0070708_100624828 3300005445 Bacteria 1015
64 Ga0070663_100003952 3300005455 Bacteria 8639
65 Ga0070662_100086653 3300005457 Bacteria 2343
66 Ga0070662_100118286 3300005457 Bacteria 2028
67 Ga0070681_10020175 3300005458 Bacteria 6681
68 Ga0070681_10083185 3300005458 Bacteria 3154
69 Ga0070681_10738336 3300005458 Bacteria 901
70 Ga0068867_100018215 3300005459 Bacteria 4990
71 Ga0068867_100394557 3300005459 Bacteria 1166
72 Ga0070706_100002980 3300005467 Bacteria 16786
73 Ga0070706_100004544 3300005467 Bacteria 13349
74 Ga0070706_100038369 3300005467 Unclassified 4420
75 Ga0070706_100103755 3300005467 Bacteria 2643
76 Ga0070706_100106203 3300005467 Bacteria 2612
77 Ga0070706_100177055 3300005467 Bacteria 1991
78 Ga0070706_100180596 3300005467 Bacteria 1970
79 Ga0070706_100203157 3300005467 Bacteria 1851
80 Ga0070706_100312635 3300005467 Bacteria 1465
81 Ga0070706_100354290 3300005467 Bacteria 1368
82 Ga0070706_100758989 3300005467 Bacteria 899
83 Ga0070706_101220946 3300005467 Bacteria 690
84 Ga0070707_100003625 3300005468 Bacteria 14564
85 Ga0070707_100021132 3300005468 Bacteria 6149
86 Ga0070707_100042747 3300005468 Bacteria 4339
87 Ga0070707_100057551 3300005468 Bacteria 3729
88 Ga0070707_100094333 3300005468 Bacteria 2897
89 Ga0070707_100205701 3300005468 Bacteria 1918
90 Ga0070707_100256515 3300005468 Bacteria 1701
91 Ga0070707_100459199 3300005468 Bacteria 1234
92 Ga0070707_100608259 3300005468 Bacteria 1055
93 Ga0070707_101098104 3300005468 Bacteria 761
94 Ga0070698_100040059 3300005471 Bacteria 4817
95 Ga0070698_100158242 3300005471 Unclassified 2210
96 Ga0070698_100201977 3300005471 Bacteria 1923
97 Ga0070698_100823813 3300005471 Bacteria 872
98 Ga0070699_100007997 3300005518 Bacteria 9179
99 Ga0070699_100050238 3300005518 Bacteria 3610
100 Ga0070699_100099647 3300005518 Bacteria 2546
101 Ga0070699_100134169 3300005518 Unclassified 2183
102 Ga0070699_100285241 3300005518 Bacteria 1479
103 Ga0070699_100292920 3300005518 Bacteria 1459
104 Ga0070699_100294096 3300005518 Bacteria 1456
105 Ga0070699_100298197 3300005518 Bacteria 1446
106 Ga0070679_100007439 3300005530 Bacteria 10235
107 Ga0070679_100031833 3300005530 Bacteria 5215
108 Ga0070679_100195514 3300005530 Bacteria 1990
109 Ga0070684_100005222 3300005535 Bacteria 9929
110 Ga0070684_100201093 3300005535 Bacteria 1815
111 Ga0070684_100407527 3300005535 Bacteria 1254
112 Ga0070697_100016756 3300005536 Bacteria 5764
113 Ga0070697_100023193 3300005536 Bacteria 4935
114 Ga0070697_100023802 3300005536 Bacteria 4874
115 Ga0070697_100026935 3300005536 Bacteria 4597
116 Ga0070697_100181023 3300005536 Bacteria 1786
117 Ga0068853_100001594 3300005539 Bacteria 16518
118 Ga0070686_100205439 3300005544 Bacteria 1415
119 Ga0070695_100003170 3300005545 Bacteria 9593
120 Ga0070695_100004272 3300005545 Bacteria 8358
121 Ga0070695_100058543 3300005545 Bacteria 2491
122 Ga0070695_100117303 3300005545 Bacteria 1816
123 Ga0070695_100215950 3300005545 Unclassified 1379
124 Ga0070696_100008387 3300005546 Bacteria 6913
125 Ga0070696_100012972 3300005546 Bacteria 5593
126 Ga0070696_100022945 3300005546 Bacteria 4243
127 Ga0070696_100235372 3300005546 Bacteria 1379
128 Ga0070696_100551085 3300005546 Unclassified 924
129 Ga0070696_100960078 3300005546 Bacteria 712
130 Ga0070693_100011771 3300005547 Bacteria 4411
131 Ga0070693_100030328 3300005547 Bacteria 2956
132 Ga0070704_100047443 3300005549 Bacteria 3002
133 Ga0070704_100070171 3300005549 Bacteria 2541
134 Ga0070704_100129774 3300005549 Bacteria 1951
135 Ga0070704_100759334 3300005549 Bacteria 864
136 Ga0068855_100010887 3300005563 Bacteria 10979
137 Ga0068855_100358407 3300005563 Bacteria 1605
138 Ga0070664_100013742 3300005564 Bacteria 6598
139 Ga0070664_100524141 3300005564 Bacteria 1094
140 Ga0068857_100020642 3300005577 Bacteria 5797
141 Ga0068857_100088568 3300005577 Bacteria 2769
142 Ga0068857_100162040 3300005577 Bacteria 2030
143 Ga0068857_100299896 3300005577 Bacteria 1481
144 Ga0068854_100011479 3300005578 Bacteria 5770
145 Ga0068856_100005201 3300005614 Bacteria 12846
146 Ga0068856_101243279 3300005614 Bacteria 761
147 Ga0070702_100011369 3300005615 Bacteria 4426
148 Ga0070702_100070371 3300005615 Bacteria 2065
149 Ga0068852_100136394 3300005616 Bacteria 2266
150 Ga0068859_100006840 3300005617 Bacteria 11584
151 Ga0068859_100230992 3300005617 Bacteria 1938
152 Ga0068864_100014894 3300005618 Bacteria 6460
153 Ga0068864_100015376 3300005618 Bacteria 6362
154 Ga0068861_100114196 3300005719 Bacteria 2168
155 Ga0068861_100553382 3300005719 Bacteria 1049
156 Ga0068870_10000125 3300005840 Bacteria 26430
157 Ga0068863_100027042 3300005841 Bacteria 5471
158 Ga0068863_100056394 3300005841 Bacteria 3719
159 Ga0068858_100024297 3300005842 Bacteria 5648
160 Ga0068860_100047615 3300005843 Bacteria 4086
161 Ga0068860_100410120 3300005843 Bacteria 1342
162 Ga0068862_100007501 3300005844 Bacteria 9039
163 Ga0068862_100145626 3300005844 Bacteria 2105
164 Ga0081455_10000189 3300005937 Bacteria 78564
165 Ga0081538_10086579 3300005981 Bacteria 1639
166 Ga0081540_1005614 3300005983 Bacteria 9339
167 Ga0081539_10000166 3300005985 Bacteria 153758
168 Ga0070717_10022010 3300006028 Bacteria 5031
169 Ga0075432_10027943 3300006058 Bacteria 1945
170 Ga0070716_100397688 3300006173 Bacteria 990
171 Ga0075366_10346991 3300006195 Bacteria 911
172 Ga0097621_100426815 3300006237 Bacteria 1191
173 Ga0068871_100131529 3300006358 Bacteria 2122
174 Ga0068871_100960789 3300006358 Bacteria 794
175 Ga0075428_100000368 3300006844 Bacteria 44722
176 Ga0075428_100000410 3300006844 Bacteria 42619
177 Ga0075428_100004668 3300006844 Bacteria 15168
178 Ga0075428_100086890 3300006844 Bacteria 3411
179 Ga0075428_100136817 3300006844 Unclassified 2664
180 Ga0075428_100176959 3300006844 Bacteria 2310
181 Ga0075428_100185079 3300006844 Bacteria 2254
182 Ga0075428_100242629 3300006844 Unclassified 1944
183 Ga0075428_100660351 3300006844 Bacteria 1115
184 Ga0075428_100672215 3300006844 Bacteria 1104
185 Ga0075428_100698680 3300006844 Bacteria 1080
186 Ga0075430_100002647 3300006846 Bacteria 14931
187 Ga0075430_100003046 3300006846 Bacteria 14015
188 Ga0075430_100011404 3300006846 Bacteria 7546
189 Ga0075430_100148490 3300006846 Bacteria 1952
190 Ga0075430_100347290 3300006846 Bacteria 1225
191 Ga0075430_100415131 3300006846 Bacteria 1111
192 Ga0075431_100000843 3300006847 Bacteria 26867
193 Ga0075431_100002781 3300006847 Bacteria 16939
194 Ga0075431_100010752 3300006847 Bacteria 9201
195 Ga0075431_100011301 3300006847 Bacteria 8993
196 Ga0075431_100012211 3300006847 Bacteria 8670
197 Ga0075431_100029113 3300006847 Bacteria 5682
198 Ga0075431_100136317 3300006847 Bacteria 2531
199 Ga0075431_100143565 3300006847 Bacteria 2460
200 Ga0075431_100258162 3300006847 Unclassified 1769
201 Ga0075431_100452884 3300006847 Bacteria 1279
202 Ga0075431_100481376 3300006847 Unclassified 1234
203 Ga0075431_100912241 3300006847 Bacteria 848
204 Ga0075433_10000489 3300006852 Bacteria 25808
205 Ga0075433_10007833 3300006852 Bacteria 8494
206 Ga0075433_10008458 3300006852 Bacteria 8212
207 Ga0075433_10014343 3300006852 Bacteria 6472
208 Ga0075433_10128763 3300006852 Bacteria 2249
209 Ga0075433_10268062 3300006852 Bacteria 1513
210 Ga0075433_10561270 3300006852 Bacteria 1003
211 Ga0075434_100007947 3300006871 Bacteria 9831
212 Ga0075434_100139858 3300006871 Bacteria 2440
213 Ga0075434_100178127 3300006871 Bacteria 2146
214 Ga0075434_100323890 3300006871 Bacteria 1561
215 Ga0075434_100367859 3300006871 Bacteria 1459
216 Ga0075434_100428526 3300006871 Unclassified 1344
217 Ga0075434_100560246 3300006871 Unclassified 1162
218 Ga0075434_101008432 3300006871 Unclassified 846
219 Ga0075429_100003897 3300006880 Bacteria 12747
220 Ga0075429_100014858 3300006880 Bacteria 6751
221 Ga0075429_100018255 3300006880 Bacteria 6073
222 Ga0075429_100018795 3300006880 Bacteria 5985
223 Ga0075429_100097772 3300006880 Bacteria 2561
224 Ga0075429_100169307 3300006880 Bacteria 1914
225 Ga0068865_100933823 3300006881 Bacteria 756
226 Ga0075436_100002956 3300006914 Bacteria 11640
227 Ga0075436_100003545 3300006914 Bacteria 10707
228 Ga0075436_100063393 3300006914 Unclassified 2555
229 Ga0075436_100100109 3300006914 Bacteria 2018
230 Ga0075436_100133092 3300006914 Bacteria 1744
231 Ga0075436_100195911 3300006914 Bacteria 1430
232 Ga0075436_100649964 3300006914 Bacteria 779
233 Ga0097620_100006840 3300006931 Bacteria 11584
234 Ga0097620_100230980 3300006931 Bacteria 1938
235 Ga0075435_100066728 3300007076 Bacteria 2928
236 Ga0075435_100081935 3300007076 Bacteria 2651
237 Ga0075435_100121001 3300007076 Bacteria 2184
238 Ga0075435_100131752 3300007076 Bacteria 2092
239 Ga0075435_101243231 3300007076 Bacteria 652
240 Ga0075435_101250420 3300007076 Bacteria 650
241 Ga0099794_10008590 3300007265 Bacteria 4252
242 Ga0099794_10025323 3300007265 Unclassified 2731
243 Ga0099794_10234168 3300007265 Bacteria 945
244 Ga0099794_10530423 3300007265 Bacteria 621
245 Ga0105240_10869923 3300009093 Bacteria 972
246 Ga0111539_10153212 3300009094 Unclassified 2698
247 Ga0111539_11072427 3300009094 Bacteria 936
248 Ga0105245_10215285 3300009098 Bacteria 1851
249 Ga0114129_10000074 3300009147 Bacteria 92340
250 Ga0114129_10000893 3300009147 Bacteria 38856
251 Ga0114129_10001132 3300009147 Bacteria 35229
252 Ga0114129_10002386 3300009147 Bacteria 26094
253 Ga0114129_10014235 3300009147 Bacteria 11335
254 Ga0114129_10025545 3300009147 Bacteria 8368
255 Ga0114129_10041361 3300009147 Bacteria 6495
256 Ga0114129_10044920 3300009147 Bacteria 6213
257 Ga0114129_10050132 3300009147 Bacteria 5865
258 Ga0114129_10098924 3300009147 Bacteria 4037
259 Ga0114129_10111142 3300009147 Bacteria 3782
260 Ga0114129_10149320 3300009147 Bacteria 3199
261 Ga0114129_10165930 3300009147 Bacteria 3014
262 Ga0114129_10192171 3300009147 Bacteria 2771
263 Ga0114129_10219538 3300009147 Bacteria 2565
264 Ga0114129_10229368 3300009147 Bacteria 2502
265 Ga0114129_10253697 3300009147 Bacteria 2360
266 Ga0114129_10260573 3300009147 Bacteria 2324
267 Ga0114129_10308035 3300009147 Unclassified 2109
268 Ga0105243_10035661 3300009148 Bacteria 3857
269 Ga0105243_10242607 3300009148 Bacteria 1604
270 Ga0105243_10814419 3300009148 Unclassified 922
271 Ga0105241_10000650 3300009174 Bacteria 26087
272 Ga0105248_10022443 3300009177 Bacteria 7000
273 Ga0105237_10036293 3300009545 Bacteria 4986
274 Ga0105249_10097197 3300009553 Bacteria 2764
275 Ga0157373_10005161 3300013100 Bacteria 9812
276 Ga0157371_10156661 3300013102 Bacteria 1626
277 Ga0157371_10165860 3300013102 Bacteria 1577
278 Ga0157370_10236465 3300013104 Bacteria 1691
279 Ga0157369_10023823 3300013105 Bacteria 6816
280 Ga0157369_10119686 3300013105 Bacteria 2794
281 Ga0157374_10393546 3300013296 Bacteria 1381
282 Ga0157378_10464030 3300013297 Bacteria 1259
283 Ga0157378_11336969 3300013297 Bacteria 758
284 Ga0157372_10000746 3300013307 Bacteria 35404
285 Ga0157372_10085982 3300013307 Bacteria 3568
286 Ga0157372_10495332 3300013307 Bacteria 1425
287 Ga0157375_11804818 3300013308 Bacteria 725
288 Ga0163163_10030503 3300014325 Bacteria 5196
289 Ga0163163_10196633 3300014325 Bacteria 2064
290 Ga0157380_10418667 3300014326 Bacteria 1277
291 Ga0157380_10653418 3300014326 Bacteria 1049
292 Ga0157379_10230549 3300014968 Bacteria 1678
293 Ga0157379_10244236 3300014968 Bacteria 1629
294 Ga0157376_11034033 3300014969 Unclassified 845
295 Ga0157376_11562853 3300014969 Bacteria 693
296 Ga0197907_10121884 3300020069 Bacteria 681
297 Ga0206356_11013378 3300020070 Bacteria 1011
298 Ga0206356_11834943 3300020070 Bacteria 2169
299 Ga0206353_10128875 3300020082 Bacteria 2127
300 Ga0206353_11558259 3300020082 Bacteria 1255
301 Ga0224712_10026200 3300022467 Bacteria 2059
302 Ga0224712_10152723 3300022467 Bacteria 1024
303 Ga0207680_10189322 3300025903 Bacteria 1396
304 Ga0207685_10009271 3300025905 Unclassified 2851
305 Ga0207699_10123723 3300025906 Bacteria 1676
306 Ga0207645_10007485 3300025907 Bacteria 7706
307 Ga0207645_10021617 3300025907 Bacteria 4194
308 Ga0207643_10000210 3300025908 Bacteria 40925
309 Ga0207705_10032819 3300025909 Bacteria 3710
310 Ga0207684_10000501 3300025910 Bacteria 49523
311 Ga0207684_10002039 3300025910 Bacteria 20805
312 Ga0207684_10007653 3300025910 Bacteria 9689
313 Ga0207684_10008119 3300025910 Bacteria 9358
314 Ga0207684_10028818 3300025910 Bacteria 4729
315 Ga0207684_10034707 3300025910 Unclassified 4285
316 Ga0207684_10056223 3300025910 Bacteria 3338
317 Ga0207684_10085803 3300025910 Bacteria 2681
318 Ga0207684_10180500 3300025910 Bacteria 1820
319 Ga0207684_10316733 3300025910 Bacteria 1345
320 Ga0207684_10502421 3300025910 Bacteria 1039
321 Ga0207684_10503206 3300025910 Unclassified 1038
322 Ga0207654_10011378 3300025911 Bacteria 4539
323 Ga0207707_10016649 3300025912 Bacteria 6408
324 Ga0207707_10032880 3300025912 Bacteria 4540
325 Ga0207707_10033934 3300025912 Bacteria 4466
326 Ga0207707_10879771 3300025912 Unclassified 742
327 Ga0207695_10799377 3300025913 Bacteria 823
328 Ga0207671_10202283 3300025914 Bacteria 1551
329 Ga0207693_10218796 3300025915 Bacteria 1496
330 Ga0207660_10010898 3300025917 Bacteria 5910
331 Ga0207660_10114294 3300025917 Bacteria 2036
332 Ga0207660_10172389 3300025917 Bacteria 1676
333 Ga0207660_10991288 3300025917 Bacteria 685
334 Ga0207662_10016639 3300025918 Bacteria 4152
335 Ga0207657_10001132 3300025919 Bacteria 28327
336 Ga0207649_10001277 3300025920 Bacteria 15028
337 Ga0207649_10022014 3300025920 Bacteria 3679
338 Ga0207652_10002841 3300025921 Bacteria 14517
339 Ga0207652_10108289 3300025921 Bacteria 2462
340 Ga0207646_10003794 3300025922 Bacteria 16820
341 Ga0207646_10004103 3300025922 Bacteria 16045
342 Ga0207646_10007888 3300025922 Bacteria 10745
343 Ga0207646_10008540 3300025922 Bacteria 10250
344 Ga0207646_10015545 3300025922 Bacteria 7184
345 Ga0207646_10020443 3300025922 Bacteria 6133
346 Ga0207646_10046814 3300025922 Bacteria 3880
347 Ga0207646_10088629 3300025922 Bacteria 2769
348 Ga0207646_10223246 3300025922 Bacteria 1702
349 Ga0207646_10292016 3300025922 Unclassified 1473
350 Ga0207646_10384808 3300025922 Bacteria 1267
351 Ga0207646_10512661 3300025922 Bacteria 1080
352 Ga0207646_10689867 3300025922 Unclassified 913
353 Ga0207681_10152750 3300025923 Bacteria 1732
354 Ga0207681_10543912 3300025923 Unclassified 955
355 Ga0207650_10041437 3300025925 Bacteria 3374
356 Ga0207687_10142795 3300025927 Bacteria 1818
357 Ga0207700_10240372 3300025928 Bacteria 1543
358 Ga0207664_10036203 3300025929 Bacteria 3814
359 Ga0207664_10059535 3300025929 Bacteria 3042
360 Ga0207690_10003389 3300025932 Bacteria 9519
361 Ga0207706_10051460 3300025933 Bacteria 3637
362 Ga0207706_10579999 3300025933 Unclassified 964
363 Ga0207709_10048879 3300025935 Bacteria 2579
364 Ga0207709_10774398 3300025935 Bacteria 773
365 Ga0207670_10033490 3300025936 Bacteria 3312
366 Ga0207670_10259098 3300025936 Unclassified 1347
367 Ga0207704_11306458 3300025938 Bacteria 620
368 Ga0207665_10189926 3300025939 Bacteria 1492
369 Ga0207711_10045468 3300025941 Bacteria 3752
370 Ga0207689_10001491 3300025942 Bacteria 22363
371 Ga0207689_10042483 3300025942 Bacteria 3760
372 Ga0207661_10042351 3300025944 Bacteria 3589
373 Ga0207679_10001453 3300025945 Bacteria 14876
374 Ga0207679_11455797 3300025945 Bacteria 628
375 Ga0207667_10003068 3300025949 Bacteria 20705
376 Ga0207667_10236810 3300025949 Bacteria 1868
377 Ga0207712_10041976 3300025961 Bacteria 3147
378 Ga0207668_10672375 3300025972 Bacteria 908
379 Ga0207640_10005366 3300025981 Bacteria 6992
380 Ga0207640_10161292 3300025981 Bacteria 1659
381 Ga0207639_10004549 3300026041 Bacteria 9340
382 Ga0207678_10025484 3300026067 Bacteria 5162
383 Ga0207708_10574774 3300026075 Bacteria 952
384 Ga0207708_11182765 3300026075 Bacteria 668
385 Ga0207702_10002765 3300026078 Bacteria 16425
386 Ga0207702_10418962 3300026078 Bacteria 1295
387 Ga0207702_11469896 3300026078 Unclassified 675
388 Ga0207641_10092610 3300026088 Bacteria 2647
389 Ga0207648_10000854 3300026089 Bacteria 34339
390 Ga0207648_10323495 3300026089 Bacteria 1386
391 Ga0207674_10001007 3300026116 Bacteria 36810
392 Ga0207674_10054189 3300026116 Bacteria 4084
393 Ga0207674_10112218 3300026116 Bacteria 2700
394 Ga0207675_100129549 3300026118 Bacteria 2392
395 Ga0207675_100832085 3300026118 Bacteria 937
396 Ga0207698_10149757 3300026142 Bacteria 2023
397 Ga0209969_1016635 3300027360 Bacteria 1080
398 Ga0209981_1051225 3300027378 Eukaryota 625
399 Ga0209996_1004068 3300027395 Bacteria 1854
400 Ga0210000_1006342 3300027462 Bacteria 1722
401 Ga0209995_1001777 3300027471 Bacteria 3355
402 Ga0209968_1002224 3300027526 Bacteria 2936
403 Ga0209999_1008541 3300027543 Bacteria 1849
404 Ga0209999_1027556 3300027543 Bacteria 1052
405 Ga0209970_1000996 3300027614 Bacteria 5034
406 Ga0210002_1005220 3300027617 Bacteria 1949
407 Ga0209983_1004209 3300027665 Bacteria 3034
408 Ga0209588_1006881 3300027671 Bacteria 3326
409 Ga0209971_1000015 3300027682 Bacteria 65578
410 Ga0209966_1000025 3300027695 Bacteria 66143
411 Ga0209998_10002824 3300027717 Bacteria 3906
412 Ga0209998_10021687 3300027717 Unclassified 1380
413 Ga0209974_10006662 3300027876 Bacteria 4017
414 Ga0207428_10005120 3300027907 Bacteria 12294
415 Ga0268265_10012051 3300028380 Bacteria 5854
416 Ga0268265_10093772 3300028380 Bacteria 2406
417 Ga0268265_11382477 3300028380 Bacteria 706
418 Ga0268264_10031816 3300028381 Bacteria 4327
419 Ga0268264_10900229 3300028381 Bacteria 888
420 Ga0307408_100241287 3300031548 Unclassified 1485
421 Ga0307408_100365387 3300031548 Bacteria 1229
422 Ga0316575_10000724 3300031665 Bacteria 9915
423 Ga0316575_10084478 3300031665 Bacteria 1282
424 Ga0316575_10196680 3300031665 Bacteria 839
425 Ga0316575_10235249 3300031665 Bacteria 766
426 Ga0316579_10062978 3300031691 Bacteria 1747
427 Ga0316579_10133018 3300031691 Bacteria 1198
428 Ga0316579_10183418 3300031691 Unclassified 1012
429 Ga0316579_10266604 3300031691 Unclassified 828
430 Ga0316579_10285564 3300031691 Bacteria 798
431 Ga0316576_10028193 3300031727 Unclassified 3955
432 Ga0316576_10085369 3300031727 Bacteria 2346
433 Ga0316576_10216222 3300031727 Bacteria 1442
434 Ga0316576_10270657 3300031727 Bacteria 1273
435 Ga0316576_10290079 3300031727 Bacteria 1224
436 Ga0316576_10467545 3300031727 Bacteria 930
437 Ga0316578_10005511 3300031728 Bacteria 6147
438 Ga0316578_10011441 3300031728 Bacteria 4644
439 Ga0316578_10069480 3300031728 Bacteria 2084
440 Ga0316578_10369739 3300031728 Bacteria 852
441 Ga0316577_10000364 3300031733 Bacteria 17032
442 Ga0316577_10025713 3300031733 Bacteria 3274
443 Ga0316577_10083992 3300031733 Bacteria 1781
444 Ga0316577_10101974 3300031733 Bacteria 1609
445 Ga0316577_10241950 3300031733 Bacteria 1020
446 Ga0307413_11078027 3300031824 Bacteria 693
447 Ga0307406_10293912 3300031901 Bacteria 1245
448 Ga0307406_10690640 3300031901 Bacteria 851
449 Ga0307416_101168467 3300032002 Bacteria 875
450 Ga0307411_10483894 3300032005 Bacteria 1043
451 Ga0307411_11556843 3300032005 Bacteria 609
452 Ga0316583_10001181 3300032133 Bacteria 8558
453 Ga0316583_10040210 3300032133 Bacteria 1655
454 Ga0316583_10047352 3300032133 Bacteria 1516
455 Ga0316585_10000005 3300032137 Bacteria 32299
456 Ga0316593_10008379 3300032168 Bacteria 2880
457 Ga0316593_10064020 3300032168 Bacteria 1262
458 Ga0316593_10070365 3300032168 Bacteria 1209
459 Ga0316593_10090249 3300032168 Unclassified 1079
460 Ga0373948_0136983 3300034817 Bacteria 603
461 Ga0373951_0015985 3300035091 Bacteria 1692
462 Ga0373952_0025089 3300035092 Bacteria 1285
463 Ga0373932_0311443 3300035112 Bacteria 590
464 Ga0373941_0022104 3300035115 Bacteria 1802
465 Ga0373960_0015883 3300035121 Bacteria 1929
466 Ga0316574_0000011 3300035398 Bacteria 45512
467 Ga0316574_0028169 3300035398 Bacteria 3386
468 Ga0316574_0031606 3300035398 Bacteria 3211
469 Ga0316574_0043584 3300035398 Bacteria 2772
470 Ga0373927_0002036 3300035695 Bacteria 14892
471 Ga0373937_0841189 3300036401 Bacteria 866
472 Ga0316582_0007758 3300036647 Bacteria 5732
473 Ga0316582_0009425 3300036647 Bacteria 5300
474 Ga0316582_0076840 3300036647 Bacteria 2172
475 Ga0316582_0091738 3300036647 Bacteria 2001
476 Ga0316582_0100139 3300036647 Unclassified 1918
477 Ga0316582_0243059 3300036647 Unclassified 1233
478 Ga0316582_0276498 3300036647 Bacteria 1152
479 Ga0316582_0410119 3300036647 Unclassified 933
480 Ga0316582_0555687 3300036647 Unclassified 791
481 Ga0316582_0629696 3300036647 Unclassified 738
482 Ga0316584_0007998 3300036712 Bacteria 7259
483 Ga0316584_0014805 3300036712 Bacteria 5570
484 Ga0316584_0018842 3300036712 Bacteria 4983
485 Ga0316584_0061293 3300036712 Bacteria 2817
486 Ga0316584_0154835 3300036712 Bacteria 1705
487 Ga0316584_0184968 3300036712 Bacteria 1542
488 Ga0316584_0196017 3300036712 Bacteria 1492
489 Ga0316584_0284559 3300036712 Unclassified 1201
490 Ga0316584_0431949 3300036712 Bacteria 934
491 Ga0395899_0321354 3300037312 Bacteria 1042
492 Ga0395900_0039595 3300037418 Bacteria 4856
493 Ga0395900_0557859 3300037418 Bacteria 1089
494 Ga0395898_0702193 3300037466 Bacteria 953
495 Ga0395905_0012207 3300037471 Bacteria 8275
496 Ga0316581_0007940 3300037588 Bacteria 2870
497 Ga0316581_0095150 3300037588 Bacteria 917
498 Ga0316581_0180898 3300037588 Unclassified 650
499 Ga0395901_0100457 3300038443 Unclassified 3035
500 Ga0400490_07043 3300038726 Bacteria 1024
501 Ga0400485_12648 3300038735 Bacteria 70172
502 Ga0400486_19650 3300038742 Bacteria 31391
503 Ga0242420_008752 3300038996 Unclassified 1649
504 Ga0242420_009466 3300038996 Bacteria 1599
505 Ga0242420_011643 3300038996 Bacteria 1479
506 Ga0242420_027015 3300038996 Bacteria 1050
507 Ga0400489_55776 3300039093 Bacteria 15112
508 Ga0400487_35590 3300039110 Bacteria 25492
509 Ga0439441_078405 3300042001 Bacteria 716
510 Ga0439448_0071818 3300042005 Bacteria 1153
511 Ga0439455_0008138 3300042012 Bacteria 2241
512 Ga0439455_0072089 3300042012 Bacteria 929
513 Ga0450889_004308 3300042144 Bacteria 1407
514 Ga0439458_0006689 3300042157 Bacteria 2569
515 Ga0439459_0004125 3300042438 Bacteria 2326
516 Ga0439464_0018432 3300042439 Bacteria 1899
517 Ga0439464_0038737 3300042439 Bacteria 1354
518 Ga0439460_0001601 3300042461 Bacteria 5361
519 Ga0450893_0061635 3300042532 Bacteria 717
520 Ga0451577_0078028 3300042876 Bacteria 2953
521 Ga0451577_0198191 3300042876 Bacteria 1812
522 Ga0451577_0242690 3300042876 Bacteria 1630
523 Ga0439440_0055770 3300042993 Bacteria 998
524 Ga0453683_0036968 3300044673 Unclassified 3072
525 Ga0453683_0105587 3300044673 Bacteria 1770
526 Ga0453683_0156588 3300044673 Bacteria 1440
527 Ga0453683_0608074 3300044673 Bacteria 713
528 Ga0453684_0044975 3300044712 Bacteria 5896
529 Ga0453684_1461051 3300044712 Bacteria 707
530 Ga0466959_0612198 3300045049 Unclassified 732
531 Ga0451576_0012483 3300045051 Bacteria 9539
532 Ga0451576_0022854 3300045051 Bacteria 6775
533 Ga0451576_0073514 3300045051 Bacteria 3557
534 Ga0451576_0119751 3300045051 Bacteria 2740
535 Ga0451576_0376510 3300045051 Unclassified 1488
536 Ga0451576_0837922 3300045051 Unclassified 965
537 Ga0495629_0145917 3300046459 Bacteria 1646
538 Ga0495630_0113280 3300046517 Bacteria 2055
539 Ga0495665_0241085 3300046531 Bacteria 932
540 Ga0495657_0776326 3300046675 Bacteria 548
541 Ga0495581_0134020 3300047315 Bacteria 1444
542 Ga0495614_0059104 3300048089 Bacteria 1647
543 Ga0496102_0051265 3300048905 Bacteria 3760
544 Ga0496102_0080800 3300048905 Bacteria 2996
545 Ga0496102_0841493 3300048905 Bacteria 840
546 Ga0496104_0012746 3300048907 Bacteria 7573
547 Ga0496104_0738211 3300048907 Bacteria 892
548 Ga0496105_0068439 3300048908 Bacteria 2933
549 Ga0496106_0054853 3300048909 Bacteria 3012
550 Ga0496106_1067290 3300048909 Bacteria 634
551 Ga0496108_0011753 3300048911 Bacteria 7120
552 Ga0496109_0203779 3300048912 Bacteria 1860
553 Ga0496109_0678498 3300048912 Unclassified 968
554 Ga0496110_0024875 3300048913 Bacteria 5109
555 Ga0496111_0012377 3300048914 Bacteria 5774
556 Ga0496112_0066335 3300048915 Bacteria 3561
557 Ga0496112_0066764 3300048915 Bacteria 3549
558 Ga0496113_0006938 3300048916 Bacteria 7236
559 Ga0496113_1182081 3300048916 Bacteria 598
560 Ga0501031_0031403 3300049568 Bacteria 3465
561 Ga0501032_0430586 3300049569 Bacteria 846
562 Ga0501033_0279268 3300049570 Bacteria 1179
563 Ga0501033_0283430 3300049570 Bacteria 1169
564 Ga0501036_0001561 3300049572 Bacteria 17690
565 Ga0501036_0031720 3300049572 Bacteria 4465
566 Ga0501036_0059724 3300049572 Bacteria 3231
567 Ga0501036_0105276 3300049572 Bacteria 2386
568 Ga0501036_0239478 3300049572 Bacteria 1522
569 Ga0501036_0272545 3300049572 Unclassified 1417
570 Ga0501036_0483946 3300049572 Bacteria 1030
571 Ga0501036_0645479 3300049572 Bacteria 876
572 Ga0501036_0762708 3300049572 Bacteria 798
573 Ga0501037_0076391 3300049573 Bacteria 2432
574 Ga0501037_0355717 3300049573 Bacteria 1009
575 Ga0501037_0391551 3300049573 Bacteria 954
576 Ga0501038_0002016 3300049574 Bacteria 18755
577 Ga0501038_0119864 3300049574 Bacteria 2171
578 Ga0501038_0353056 3300049574 Bacteria 1145
579 Ga0501038_0447805 3300049574 Bacteria 993
580 Ga0501039_0017830 3300049575 Bacteria 5446
581 Ga0501039_0294315 3300049575 Bacteria 1276
582 Ga0501039_0425139 3300049575 Bacteria 1043
583 Ga0501039_0660556 3300049575 Bacteria 818
584 Ga0501040_0021002 3300049576 Bacteria 4354
585 Ga0501040_0022215 3300049576 Bacteria 4244
586 Ga0501040_0122858 3300049576 Bacteria 1822
587 Ga0501040_0135686 3300049576 Bacteria 1732
588 Ga0501040_0139836 3300049576 Bacteria 1705
589 Ga0501040_0145412 3300049576 Bacteria 1671
590 Ga0501040_0431252 3300049576 Bacteria 948
591 Ga0501040_0445544 3300049576 Bacteria 932
592 Ga0501040_0762199 3300049576 Bacteria 700
593 Ga0501041_0003824 3300049577 Bacteria 8665
594 Ga0501041_0014897 3300049577 Bacteria 4617
595 Ga0501041_0051508 3300049577 Bacteria 2509
596 Ga0501041_0086635 3300049577 Bacteria 1932
597 Ga0501041_0103756 3300049577 Bacteria 1761
598 Ga0501041_0391180 3300049577 Bacteria 880
599 Ga0501041_0471638 3300049577 Bacteria 797
600 Ga0501041_0484214 3300049577 Bacteria 786
601 Ga0501042_0002923 3300049578 Bacteria 10608
602 Ga0501042_0033753 3300049578 Bacteria 3628
603 Ga0501042_0048990 3300049578 Bacteria 3013
604 Ga0501042_0053577 3300049578 Bacteria 2878
605 Ga0501042_0071800 3300049578 Bacteria 2477
606 Ga0501042_0108182 3300049578 Bacteria 2002
607 Ga0501042_0598797 3300049578 Bacteria 801
608 Ga0501043_0143931 3300049579 Bacteria 1866
609 Ga0501043_0531830 3300049579 Bacteria 875
610 Ga0501043_0822853 3300049579 Bacteria 670
611 Ga0501046_0000476 3300049580 Bacteria 40171
612 Ga0501046_0023214 3300049580 Bacteria 5104
613 Ga0501046_0036233 3300049580 Bacteria 3972
614 Ga0501046_0116441 3300049580 Bacteria 2037
615 Ga0501046_0116530 3300049580 Bacteria 2036
616 Ga0501046_0155913 3300049580 Bacteria 1720
617 Ga0501046_0236450 3300049580 Bacteria 1348
618 Ga0501046_0874773 3300049580 Bacteria 628
619 Ga0501047_0062026 3300049581 Bacteria 3607
620 Ga0501048_0006058 3300049582 Bacteria 9207
621 Ga0501048_0007656 3300049582 Bacteria 8189
622 Ga0501048_0027939 3300049582 Bacteria 4098
623 Ga0501048_0141175 3300049582 Bacteria 1703
624 Ga0501048_0269442 3300049582 Bacteria 1210
625 Ga0501048_0301898 3300049582 Unclassified 1139
626 Ga0501048_0671629 3300049582 Bacteria 744
627 Ga0501048_0693543 3300049582 Bacteria 731
628 Ga0501068_0054941 3300049584 Bacteria 2413
629 Ga0501068_0064140 3300049584 Bacteria 2235
630 Ga0501068_0066202 3300049584 Bacteria 2200
631 Ga0501068_0157188 3300049584 Bacteria 1432
632 Ga0501068_0344449 3300049584 Unclassified 957
633 Ga0501068_0421403 3300049584 Bacteria 862
634 Ga0501068_0454190 3300049584 Bacteria 829
635 Ga0501069_0032278 3300049585 Bacteria 2882
636 Ga0501069_0146851 3300049585 Bacteria 1354
637 Ga0501070_0079961 3300049586 Bacteria 2705
638 Ga0501070_0727127 3300049586 Bacteria 784
639 Ga0501071_0000146 3300049587 Bacteria 29418
640 Ga0501071_0017630 3300049587 Bacteria 4929
641 Ga0501071_0028787 3300049587 Bacteria 3917
642 Ga0501071_0142655 3300049587 Bacteria 1784
643 Ga0501071_0150657 3300049587 Bacteria 1735
644 Ga0501071_0266387 3300049587 Bacteria 1295
645 Ga0501071_0420821 3300049587 Bacteria 1021
646 Ga0501071_0611609 3300049587 Bacteria 838
647 Ga0501071_0632587 3300049587 Unclassified 823
648 Ga0501072_0001090 3300049588 Bacteria 20179
649 Ga0501072_0024330 3300049588 Bacteria 4710
650 Ga0501072_0049544 3300049588 Bacteria 3306
651 Ga0501072_0092290 3300049588 Bacteria 2405
652 Ga0501072_0104792 3300049588 Bacteria 2248
653 Ga0501072_0125191 3300049588 Bacteria 2047
654 Ga0501072_0140833 3300049588 Bacteria 1923
655 Ga0501072_0452674 3300049588 Bacteria 1016
656 Ga0501072_1015092 3300049588 Bacteria 646
657 Ga0501073_0112475 3300049589 Bacteria 1889
658 Ga0501073_0283161 3300049589 Bacteria 1144
659 Ga0501073_0373660 3300049589 Bacteria 985
660 Ga0501073_0589683 3300049589 Bacteria 768
661 Ga0501073_0631443 3300049589 Bacteria 739
662 Ga0501074_0020451 3300049590 Bacteria 4810
663 Ga0501074_0143337 3300049590 Unclassified 1709
664 Ga0501074_0175619 3300049590 Bacteria 1529
665 Ga0501074_0348253 3300049590 Bacteria 1051
666 Ga0501074_0485847 3300049590 Bacteria 875
667 Ga0501074_0555007 3300049590 Bacteria 813
668 Ga0501074_0560808 3300049590 Bacteria 808
669 Ga0501074_0589570 3300049590 Bacteria 786
670 Ga0501075_0000205 3300049591 Bacteria 31452
671 Ga0501075_0006572 3300049591 Bacteria 8008
672 Ga0501075_0008457 3300049591 Bacteria 7180
673 Ga0501075_0029261 3300049591 Bacteria 4072
674 Ga0501075_0083369 3300049591 Bacteria 2421
675 Ga0501075_0121126 3300049591 Bacteria 1991
676 Ga0501075_0145036 3300049591 Bacteria 1809
677 Ga0501075_0177679 3300049591 Bacteria 1624
678 Ga0501075_0196867 3300049591 Bacteria 1537
679 Ga0501075_0237524 3300049591 Bacteria 1389
680 Ga0501075_0263584 3300049591 Unclassified 1313
681 Ga0501075_0370602 3300049591 Unclassified 1091
682 Ga0501076_0000137 3300049592 Bacteria 41327
683 Ga0501076_0000395 3300049592 Bacteria 27358
684 Ga0501076_0003994 3300049592 Bacteria 10422
685 Ga0501076_0007226 3300049592 Bacteria 8081
686 Ga0501076_0058543 3300049592 Bacteria 3063
687 Ga0501076_0115470 3300049592 Bacteria 2172
688 Ga0501076_0154646 3300049592 Bacteria 1866
689 Ga0501076_0246814 3300049592 Bacteria 1461
690 Ga0501076_0445008 3300049592 Bacteria 1066
691 Ga0501076_0926682 3300049592 Bacteria 718
692 Ga0501076_1018049 3300049592 Bacteria 682
693 Ga0501077_0006006 3300049593 Bacteria 7415
694 Ga0501077_0011430 3300049593 Bacteria 5544
695 Ga0501077_0014533 3300049593 Bacteria 4948
696 Ga0501077_0019267 3300049593 Bacteria 4315
697 Ga0501077_0057319 3300049593 Bacteria 2473
698 Ga0501077_0062680 3300049593 Bacteria 2359
699 Ga0501077_0083247 3300049593 Bacteria 2027
700 Ga0501077_0185891 3300049593 Bacteria 1320
701 Ga0501077_0477996 3300049593 Bacteria 798
702 Ga0501079_0003718 3300049741 Bacteria 11255
703 Ga0501079_0016521 3300049741 Bacteria 5638
704 Ga0501079_0022665 3300049741 Bacteria 4818
705 Ga0501079_0031727 3300049741 Bacteria 4060
706 Ga0501079_0076365 3300049741 Bacteria 2591
707 Ga0501079_0824170 3300049741 Bacteria 731
708 Ga0501080_0004005 3300049742 Bacteria 13042
709 Ga0501080_0026494 3300049742 Bacteria 5387
710 Ga0501080_0110225 3300049742 Bacteria 2551
711 Ga0501080_0138619 3300049742 Bacteria 2250
712 Ga0501080_0141524 3300049742 Bacteria 2224
713 Ga0501080_0190991 3300049742 Bacteria 1882
714 Ga0501080_0192249 3300049742 Bacteria 1875
715 Ga0501080_0279095 3300049742 Bacteria 1519
716 Ga0501080_0360483 3300049742 Bacteria 1312
717 Ga0501081_0000816 3300049743 Bacteria 18394
718 Ga0501081_0003078 3300049743 Bacteria 10589
719 Ga0501081_0008477 3300049743 Bacteria 6681
720 Ga0501081_0012639 3300049743 Bacteria 5550
721 Ga0501081_0017401 3300049743 Bacteria 4757
722 Ga0501081_0034761 3300049743 Bacteria 3430
723 Ga0501081_0091688 3300049743 Bacteria 2137
724 Ga0501081_0104979 3300049743 Bacteria 2001
725 Ga0501081_0128041 3300049743 Bacteria 1812
726 Ga0501081_0216605 3300049743 Bacteria 1392
727 Ga0501081_0311467 3300049743 Bacteria 1156
728 Ga0501081_0426614 3300049743 Unclassified 983
729 Ga0501081_0460685 3300049743 Bacteria 945
730 Ga0501083_0059827 3300049744 Bacteria 2547
731 Ga0501083_0175673 3300049744 Bacteria 1399
732 Ga0501083_0245353 3300049744 Bacteria 1166
733 Ga0501083_0696632 3300049744 Bacteria 661
734 Ga0501035_0060869 3300049822 Bacteria 3361
735 Ga0501035_0182015 3300049822 Bacteria 1810
736 Ga0501035_0317326 3300049822 Bacteria 1310
737 Ga0501044_0732140 3300049823 Bacteria 872
738 Ga0501045_0003262 3300049824 Bacteria 11083
739 Ga0501045_0045545 3300049824 Bacteria 3193
740 Ga0501045_0047319 3300049824 Bacteria 3133
741 Ga0501045_0125013 3300049824 Bacteria 1910
742 Ga0501045_0170260 3300049824 Bacteria 1622
743 Ga0501045_0179722 3300049824 Bacteria 1576
744 Ga0501045_0188676 3300049824 Bacteria 1536
745 Ga0501045_0565338 3300049824 Bacteria 843
746 Ga0501045_0675451 3300049824 Bacteria 763
747 Ga0501045_0701805 3300049824 Bacteria 747
748 Ga0501045_0711311 3300049824 Bacteria 741
749 nmdc:mga03683_135440_c1 3300050489 Bacteria 1104
750 nmdc:mga03n38_685743_c1 3300050490 Bacteria 589
751 nmdc:mga0k408_240248_c1 3300050493 Bacteria 1081
752 nmdc:mga05p37_1381_c1 3300050507 Bacteria 28239
753 nmdc:mga05p37_138226_c1 3300050507 Bacteria 2986
754 nmdc:mga05p37_173483_c1 3300050507 Bacteria 2628
755 nmdc:mga05p37_20723_c1 3300050507 Bacteria 7955
756 nmdc:mga05p37_214272_c1 3300050507 Bacteria 2327
757 nmdc:mga05p37_2162_c1 3300050507 Bacteria 22903
758 nmdc:mga05p37_237487_c1 3300050507 Bacteria 2193
759 nmdc:mga05p37_245624_c1 3300050507 Bacteria 2149
760 nmdc:mga05p37_27267_c1 3300050507 Bacteria 6955
761 nmdc:mga05p37_27703_c1 3300050507 Bacteria 6903
762 nmdc:mga05p37_320066_c1 3300050507 Bacteria 1836
763 nmdc:mga05p37_366_c1 3300050507 Bacteria 48604
764 nmdc:mga05p37_38713_c1 3300050507 Bacteria 5850
765 nmdc:mga05p37_40993_c1 3300050507 Bacteria 5685
766 nmdc:mga05p37_420_c1 3300050507 Bacteria 45931
767 nmdc:mga05p37_455555_c1 3300050507 Bacteria 1479
768 nmdc:mga05p37_456088_c1 3300050507 Bacteria 1478
769 nmdc:mga05p37_55220_c1 3300050507 Bacteria 4887
770 nmdc:mga05p37_763161_c1 3300050507 Unclassified 1064
771 nmdc:mga09592_142152_c1 3300050508 Bacteria 2069
772 nmdc:mga09592_1725_c1 3300050508 Bacteria 17600
773 nmdc:mga09592_27933_c1 3300050508 Bacteria 4684
774 nmdc:mga09592_31228_c1 3300050508 Bacteria 4437
775 nmdc:mga09592_43727_c1 3300050508 Bacteria 3768
776 nmdc:mga09592_56205_c1 3300050508 Bacteria 3326
777 nmdc:mga09592_659_c2 3300050508 Bacteria 17711
778 nmdc:mga0qj67_226099_c1 3300050509 Bacteria 1519
779 nmdc:mga0qj67_240783_c1 3300050509 Bacteria 1468
780 nmdc:mga0qj67_29487_c1 3300050509 Bacteria 4262
781 nmdc:mga0qj67_62907_c1 3300050509 Bacteria 2950
782 nmdc:mga0qj67_79_c2 3300050509 Bacteria 27322
783 nmdc:mga06r32_224794_c1 3300050510 Unclassified 1865
784 nmdc:mga06r32_29097_c1 3300050510 Bacteria 5175
785 nmdc:mga06r32_393204_c1 3300050510 Bacteria 1369
786 nmdc:mga06r32_4242_c1 3300050510 Bacteria 12845
787 nmdc:mga06r32_4674_c1 3300050510 Bacteria 12292
788 nmdc:mga06r32_839_c1 3300050510 Bacteria 27208
789 nmdc:mga06r32_922928_c1 3300050510 Bacteria 829
790 nmdc:mga08y16_243974_c1 3300050511 Unclassified 1857
791 nmdc:mga08y16_655178_c1 3300050511 Unclassified 1054
792 nmdc:mga0n895_1198385_c1 3300050512 Bacteria 733
793 nmdc:mga0n895_1205366_c1 3300050512 Unclassified 731
794 nmdc:mga0n895_1328180_c1 3300050512 Bacteria 689
795 nmdc:mga0n895_21842_c1 3300050512 Bacteria 5992
796 nmdc:mga0n895_228569_c1 3300050512 Bacteria 1889
797 nmdc:mga0n895_237723_c1 3300050512 Bacteria 1849
798 nmdc:mga0n895_351083_c1 3300050512 Bacteria 1494
799 nmdc:mga0n895_515330_c1 3300050512 Bacteria 1204
800 nmdc:mga0n895_522286_c1 3300050512 Unclassified 1195
801 nmdc:mga0n895_573841_c1 3300050512 Bacteria 1132
802 nmdc:mga0n895_72892_c1 3300050512 Bacteria 3408
803 nmdc:mga0rr50_1063_c1 3300050513 Bacteria 14934
804 nmdc:mga0rr50_1253156_c1 3300050513 Bacteria 629
805 nmdc:mga0rr50_197052_c1 3300050513 Bacteria 1654
806 nmdc:mga0rr50_52581_c1 3300050513 Bacteria 3028
807 nmdc:mga0rr50_5896_c1 3300050513 Bacteria 7372
808 nmdc:mga0rr50_777368_c1 3300050513 Unclassified 817
809 nmdc:mga0rr50_857269_c1 3300050513 Bacteria 775
810 nmdc:mga08x19_120485_c1 3300050514 Bacteria 1759
811 nmdc:mga08x19_1458_c1 3300050514 Bacteria 14629
812 nmdc:mga08x19_19467_c1 3300050514 Bacteria 4165
813 nmdc:mga08x19_374743_c1 3300050514 Bacteria 996
814 nmdc:mga08x19_601986_c1 3300050514 Bacteria 779
815 nmdc:mga08x19_90818_c1 3300050514 Bacteria 2016
816 nmdc:mga08x19_94959_c1 3300050514 Bacteria 1972
817 nmdc:mga0a205_10314_c2 3300050515 Bacteria 6985
818 nmdc:mga0a205_12191_c1 3300050515 Bacteria 7949
819 nmdc:mga0a205_141732_c1 3300050515 Unclassified 2304
820 nmdc:mga0a205_420492_c1 3300050515 Bacteria 1198
821 nmdc:mga0a205_589033_c1 3300050515 Unclassified 966
822 nmdc:mga0a205_6576_c1 3300050515 Bacteria 10516
823 nmdc:mga0a205_701672_c1 3300050515 Bacteria 862
824 nmdc:mga0a205_73782_c1 3300050515 Bacteria 3296
825 nmdc:mga0a205_77799_c1 3300050515 Bacteria 3205
826 nmdc:mga0a205_83577_c1 3300050515 Bacteria 3084
827 nmdc:mga0a205_84896_c1 3300050515 Bacteria 3058
828 nmdc:mga0a205_86273_c1 3300050515 Unclassified 3032
829 nmdc:mga0sz30_215025_c1 3300050516 Bacteria 854
830 Ga0501084_0002983 3300054114 Bacteria 13701
831 Ga0501084_0004662 3300054114 Bacteria 11193
832 Ga0501084_0006404 3300054114 Bacteria 9676
833 Ga0501084_0009660 3300054114 Bacteria 7980
834 Ga0501084_0012861 3300054114 Bacteria 6933
835 Ga0501084_0046677 3300054114 Bacteria 3628
836 Ga0501084_0049668 3300054114 Bacteria 3511
837 Ga0501084_0122614 3300054114 Bacteria 2186
838 Ga0501084_0214330 3300054114 Bacteria 1624
839 Ga0501084_0254007 3300054114 Bacteria 1484
840 Ga0501084_0293122 3300054114 Bacteria 1374
841 Ga0501084_0304971 3300054114 Bacteria 1345
842 Ga0501084_0310334 3300054114 Bacteria 1332
843 Ga0501084_0769949 3300054114 Bacteria 811
844 Ga0501082_0000775 3300060353 Bacteria 28022
845 Ga0501082_0004399 3300060353 Bacteria 12302
846 Ga0501082_0059506 3300060353 Bacteria 3292
847 Ga0501082_0087471 3300060353 Bacteria 2688
848 Ga0501082_0094782 3300060353 Bacteria 2579
849 Ga0501082_0100158 3300060353 Bacteria 2506
850 Ga0501082_0177594 3300060353 Bacteria 1851
851 Ga0501082_0376127 3300060353 Bacteria 1239
852 Ga0501082_0589609 3300060353 Unclassified 972
853 Ga0501082_0690329 3300060353 Bacteria 893
854 Ga0501082_1148752 3300060353 Bacteria 679
855 Ga0530510_0000017 3300061734 Bacteria 84530
856 Ga0530510_0000168 3300061734 Bacteria 39753
857 Ga0530510_0008103 3300061734 Bacteria 7324
858 Ga0530510_0017607 3300061734 Bacteria 5063
859 Ga0530510_0032920 3300061734 Bacteria 3731
860 Ga0530510_0039287 3300061734 Bacteria 3416
861 Ga0530510_0066647 3300061734 Bacteria 2611
862 Ga0530510_0069200 3300061734 Bacteria 2561
863 Ga0530510_0269289 3300061734 Bacteria 1271
864 Ga0530510_0287721 3300061734 Bacteria 1228
865 Ga0530510_0510475 3300061734 Bacteria 911
866 Ga0530510_0676018 3300061734 Unclassified 786

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046675 Ga0495657_0776326 Ga0495657_0776326_11_478 147
2 3300048909 Ga0496106_1067290 Ga0496106_1067290_12_479 147
3 3300044712 Ga0453684_1461051 Ga0453684_1461051_36_542 168
4 iso_pu_bacteria 8001781756 8001787832 168
5 iso_pu_bacteria 8001781756 8001788359 168
6 3300025938 Ga0207704_11306458 Ga0207704_113064581 169
7 3300025929 Ga0207664_10036203 Ga0207664_100362034 171
8 3300048089 Ga0495614_0059104 Ga0495614_0059104_170_688 171
9 3300006871 Ga0075434_100560246 Ga0075434_1005602463 172
10 3300031665 Ga0316575_10000724 Ga0316575_100007249 172
11 3300031665 Ga0316575_10084478 Ga0316575_100844782 172
12 3300031665 Ga0316575_10235249 Ga0316575_102352492 172
13 3300031691 Ga0316579_10133018 Ga0316579_101330181 172
14 3300031691 Ga0316579_10183418 Ga0316579_101834181 172
15 3300031691 Ga0316579_10266604 Ga0316579_102666042 172
16 3300031691 Ga0316579_10285564 Ga0316579_102855641 172
17 3300031727 Ga0316576_10028193 Ga0316576_100281931 172
18 3300031727 Ga0316576_10216222 Ga0316576_102162222 172
19 3300031727 Ga0316576_10290079 Ga0316576_102900792 172
20 3300031727 Ga0316576_10467545 Ga0316576_104675452 172
21 3300031728 Ga0316578_10005511 Ga0316578_100055115 172
22 3300031728 Ga0316578_10011441 Ga0316578_100114413 172
23 3300031728 Ga0316578_10069480 Ga0316578_100694802 172
24 3300031728 Ga0316578_10369739 Ga0316578_103697392 172
25 3300031733 Ga0316577_10000364 Ga0316577_100003644 172
26 3300031733 Ga0316577_10025713 Ga0316577_100257131 172
27 3300031733 Ga0316577_10083992 Ga0316577_100839922 172
28 3300032133 Ga0316583_10001181 Ga0316583_100011819 172
29 3300032133 Ga0316583_10040210 Ga0316583_100402102 172
30 3300032133 Ga0316583_10047352 Ga0316583_100473522 172
31 3300032137 Ga0316585_10000005 Ga0316585_1000000523 172
32 3300032168 Ga0316593_10008379 Ga0316593_100083793 172
33 3300032168 Ga0316593_10070365 Ga0316593_100703652 172
34 3300032168 Ga0316593_10090249 Ga0316593_100902492 172
35 3300035398 Ga0316574_0000011 Ga0316574_0000011_332_850 172
36 3300035398 Ga0316574_0028169 Ga0316574_0028169_801_1319 172
37 3300035398 Ga0316574_0031606 Ga0316574_0031606_249_767 172
38 3300035398 Ga0316574_0043584 Ga0316574_0043584_564_1082 172
39 3300036647 Ga0316582_0007758 Ga0316582_0007758_4982_5500 172
40 3300036647 Ga0316582_0009425 Ga0316582_0009425_35_553 172
41 3300036647 Ga0316582_0076840 Ga0316582_0076840_1508_2026 172
42 3300036647 Ga0316582_0091738 Ga0316582_0091738_330_848 172
43 3300036647 Ga0316582_0100139 Ga0316582_0100139_47_577 172
44 3300036647 Ga0316582_0243059 Ga0316582_0243059_577_1095 172
45 3300036647 Ga0316582_0276498 Ga0316582_0276498_558_1076 172
46 3300036647 Ga0316582_0410119 Ga0316582_0410119_284_817 172
47 3300036647 Ga0316582_0555687 Ga0316582_0555687_75_593 172
48 3300036712 Ga0316584_0007998 Ga0316584_0007998_329_847 172
49 3300036712 Ga0316584_0014805 Ga0316584_0014805_448_966 172
50 3300036712 Ga0316584_0018842 Ga0316584_0018842_1011_1529 172
51 3300036712 Ga0316584_0196017 Ga0316584_0196017_177_695 172
52 3300036712 Ga0316584_0284559 Ga0316584_0284559_641_1159 172
53 3300037588 Ga0316581_0007940 Ga0316581_0007940_329_847 172
54 3300037588 Ga0316581_0180898 Ga0316581_0180898_102_635 172
55 3300038726 Ga0400490_07043 Ga0400490_07043_28_546 172
56 3300038735 Ga0400485_12648 Ga0400485_12648_4847_5365 172
57 3300038742 Ga0400486_19650 Ga0400486_19650_26055_26573 172
58 3300039093 Ga0400489_55776 Ga0400489_55776_12949_13467 172
59 3300039110 Ga0400487_35590 Ga0400487_35590_18591_19109 172
60 3300005354 Ga0070675_100265808 Ga0070675_1002658081 173
61 3300005535 Ga0070684_100201093 Ga0070684_1002010932 173
62 3300005545 Ga0070695_100215950 Ga0070695_1002159502 173
63 3300005577 Ga0068857_100299896 Ga0068857_1002998962 173
64 3300006846 Ga0075430_100415131 Ga0075430_1004151312 173
65 3300006847 Ga0075431_100143565 Ga0075431_1001435654 173
66 3300006914 Ga0075436_100002956 Ga0075436_10000295611 173
67 3300006914 Ga0075436_100649964 Ga0075436_1006499642 173
68 3300007076 Ga0075435_101250420 Ga0075435_1012504201 173
69 3300013296 Ga0157374_10393546 Ga0157374_103935462 173
70 3300014969 Ga0157376_11034033 Ga0157376_110340332 173
71 3300025912 Ga0207707_10016649 Ga0207707_100166493 173
72 3300026116 Ga0207674_10112218 Ga0207674_101122183 173
73 3300027543 Ga0209999_1027556 Ga0209999_10275563 173
74 3300031665 Ga0316575_10196680 Ga0316575_101966801 173
75 3300031691 Ga0316579_10062978 Ga0316579_100629781 173
76 3300031727 Ga0316576_10085369 Ga0316576_100853691 173
77 3300031727 Ga0316576_10270657 Ga0316576_102706572 173
78 3300031733 Ga0316577_10101974 Ga0316577_101019742 173
79 3300031733 Ga0316577_10241950 Ga0316577_102419501 173
80 3300032168 Ga0316593_10064020 Ga0316593_100640202 173
81 3300035695 Ga0373927_0002036 Ga0373927_0002036_2024_2563 173
82 3300036712 Ga0316584_0061293 Ga0316584_0061293_515_1036 173
83 3300036712 Ga0316584_0154835 Ga0316584_0154835_947_1468 173
84 3300036712 Ga0316584_0431949 Ga0316584_0431949_108_629 173
85 3300037588 Ga0316581_0095150 Ga0316581_0095150_371_892 173
86 3300050512 nmdc:mga0n895_573841_c1 nmdc:mga0n895_573841_c1_274_801 173
87 3300050513 nmdc:mga0rr50_1253156_c1 nmdc:mga0rr50_1253156_c1_28_567 173
88 3300050514 nmdc:mga08x19_1458_c1 nmdc:mga08x19_1458_c1_5169_5708 173
89 3300050514 nmdc:mga08x19_601986_c1 nmdc:mga08x19_601986_c1_215_754 173
90 3300003203 JGI25406J46586_10009013 JGI25406J46586_100090135 174
91 3300003349 JGI26129J50193_1002094 JGI26129J50193_10020942 174
92 3300004798 Ga0058859_11388371 Ga0058859_113883712 174
93 3300004799 Ga0058863_10794585 Ga0058863_107945851 174
94 3300004799 Ga0058863_11506664 Ga0058863_115066642 174
95 3300004800 Ga0058861_11729795 Ga0058861_117297952 174
96 3300004801 Ga0058860_11455887 Ga0058860_114558872 174
97 3300004803 Ga0058862_12569376 Ga0058862_125693762 174
98 3300005293 Ga0065715_10707811 Ga0065715_107078111 174
99 3300005327 Ga0070658_10029920 Ga0070658_100299203 174
100 3300005328 Ga0070676_10023181 Ga0070676_100231815 174
101 3300005329 Ga0070683_100096602 Ga0070683_1000966023 174
102 3300005330 Ga0070690_100017062 Ga0070690_1000170623 174
103 3300005331 Ga0070670_100008486 Ga0070670_1000084869 174
104 3300005333 Ga0070677_10292517 Ga0070677_102925171 174
105 3300005334 Ga0068869_100006217 Ga0068869_1000062172 174
106 3300005334 Ga0068869_100078090 Ga0068869_1000780902 174
107 3300005335 Ga0070666_10202859 Ga0070666_102028592 174
108 3300005336 Ga0070680_100009694 Ga0070680_1000096945 174
109 3300005336 Ga0070680_100027659 Ga0070680_1000276593 174
110 3300005336 Ga0070680_100068815 Ga0070680_1000688153 174
111 3300005336 Ga0070680_100184356 Ga0070680_1001843562 174
112 3300005336 Ga0070680_101134924 Ga0070680_1011349241 174
113 3300005337 Ga0070682_100000788 Ga0070682_10000078816 174
114 3300005337 Ga0070682_100858959 Ga0070682_1008589591 174
115 3300005339 Ga0070660_100007707 Ga0070660_1000077076 174
116 3300005340 Ga0070689_100063051 Ga0070689_1000630512 174
117 3300005341 Ga0070691_10001039 Ga0070691_100010396 174
118 3300005341 Ga0070691_10017615 Ga0070691_100176153 174
119 3300005341 Ga0070691_10289622 Ga0070691_102896222 174
120 3300005343 Ga0070687_100006584 Ga0070687_1000065846 174
121 3300005344 Ga0070661_100003068 Ga0070661_1000030686 174
122 3300005344 Ga0070661_100101059 Ga0070661_1001010593 174
123 3300005345 Ga0070692_10001528 Ga0070692_100015282 174
124 3300005347 Ga0070668_101228316 Ga0070668_1012283161 174
125 3300005353 Ga0070669_100096497 Ga0070669_1000964972 174
126 3300005355 Ga0070671_100127402 Ga0070671_1001274022 174
127 3300005366 Ga0070659_100000529 Ga0070659_10000052924 174
128 3300005406 Ga0070703_10237601 Ga0070703_102376011 174
129 3300005436 Ga0070713_100197615 Ga0070713_1001976152 174
130 3300005440 Ga0070705_100000374 Ga0070705_10000037419 174
131 3300005441 Ga0070700_100370814 Ga0070700_1003708141 174
132 3300005441 Ga0070700_100940759 Ga0070700_1009407591 174
133 3300005444 Ga0070694_100008918 Ga0070694_1000089182 174
134 3300005444 Ga0070694_100043921 Ga0070694_1000439215 174
135 3300005444 Ga0070694_100334081 Ga0070694_1003340812 174
136 3300005444 Ga0070694_100338205 Ga0070694_1003382052 174
137 3300005444 Ga0070694_100729423 Ga0070694_1007294231 174
138 3300005445 Ga0070708_100034359 Ga0070708_1000343593 174
139 3300005445 Ga0070708_100037504 Ga0070708_1000375044 174
140 3300005445 Ga0070708_100056223 Ga0070708_1000562235 174
141 3300005445 Ga0070708_100056710 Ga0070708_1000567101 174
142 3300005445 Ga0070708_100057821 Ga0070708_1000578213 174
143 3300005445 Ga0070708_100065060 Ga0070708_1000650603 174
144 3300005445 Ga0070708_100171584 Ga0070708_1001715842 174
145 3300005445 Ga0070708_100221620 Ga0070708_1002216202 174
146 3300005445 Ga0070708_100246242 Ga0070708_1002462422 174
147 3300005445 Ga0070708_100299728 Ga0070708_1002997282 174
148 3300005445 Ga0070708_100432291 Ga0070708_1004322912 174
149 3300005445 Ga0070708_100523416 Ga0070708_1005234163 174
150 3300005445 Ga0070708_100615895 Ga0070708_1006158952 174
151 3300005445 Ga0070708_100624828 Ga0070708_1006248282 174
152 3300005455 Ga0070663_100003952 Ga0070663_10000395211 174
153 3300005457 Ga0070662_100086653 Ga0070662_1000866532 174
154 3300005457 Ga0070662_100118286 Ga0070662_1001182863 174
155 3300005458 Ga0070681_10020175 Ga0070681_100201751 174
156 3300005458 Ga0070681_10083185 Ga0070681_100831852 174
157 3300005458 Ga0070681_10738336 Ga0070681_107383362 174
158 3300005459 Ga0068867_100018215 Ga0068867_1000182156 174
159 3300005459 Ga0068867_100394557 Ga0068867_1003945572 174
160 3300005467 Ga0070706_100002980 Ga0070706_10000298010 174
161 3300005467 Ga0070706_100004544 Ga0070706_1000045449 174
162 3300005467 Ga0070706_100038369 Ga0070706_1000383694 174
163 3300005467 Ga0070706_100103755 Ga0070706_1001037553 174
164 3300005467 Ga0070706_100106203 Ga0070706_1001062032 174
165 3300005467 Ga0070706_100177055 Ga0070706_1001770553 174
166 3300005467 Ga0070706_100180596 Ga0070706_1001805962 174
167 3300005467 Ga0070706_100203157 Ga0070706_1002031572 174
168 3300005467 Ga0070706_100312635 Ga0070706_1003126352 174
169 3300005467 Ga0070706_100354290 Ga0070706_1003542901 174
170 3300005467 Ga0070706_100758989 Ga0070706_1007589891 174
171 3300005467 Ga0070706_101220946 Ga0070706_1012209461 174
172 3300005468 Ga0070707_100003625 Ga0070707_1000036258 174
173 3300005468 Ga0070707_100021132 Ga0070707_1000211321 174
174 3300005468 Ga0070707_100042747 Ga0070707_1000427475 174
175 3300005468 Ga0070707_100057551 Ga0070707_1000575513 174
176 3300005468 Ga0070707_100094333 Ga0070707_1000943333 174
177 3300005468 Ga0070707_100205701 Ga0070707_1002057014 174
178 3300005468 Ga0070707_100256515 Ga0070707_1002565152 174
179 3300005468 Ga0070707_100459199 Ga0070707_1004591992 174
180 3300005468 Ga0070707_100608259 Ga0070707_1006082592 174
181 3300005468 Ga0070707_101098104 Ga0070707_1010981042 174
182 3300005471 Ga0070698_100040059 Ga0070698_1000400595 174
183 3300005471 Ga0070698_100158242 Ga0070698_1001582423 174
184 3300005471 Ga0070698_100201977 Ga0070698_1002019772 174
185 3300005471 Ga0070698_100823813 Ga0070698_1008238131 174
186 3300005518 Ga0070699_100007997 Ga0070699_1000079977 174
187 3300005518 Ga0070699_100050238 Ga0070699_1000502384 174
188 3300005518 Ga0070699_100099647 Ga0070699_1000996472 174
189 3300005518 Ga0070699_100134169 Ga0070699_1001341692 174
190 3300005518 Ga0070699_100285241 Ga0070699_1002852412 174
191 3300005518 Ga0070699_100292920 Ga0070699_1002929202 174
192 3300005518 Ga0070699_100294096 Ga0070699_1002940963 174
193 3300005518 Ga0070699_100298197 Ga0070699_1002981972 174
194 3300005530 Ga0070679_100007439 Ga0070679_1000074397 174
195 3300005530 Ga0070679_100031833 Ga0070679_1000318334 174
196 3300005530 Ga0070679_100195514 Ga0070679_1001955141 174
197 3300005535 Ga0070684_100005222 Ga0070684_1000052223 174
198 3300005535 Ga0070684_100407527 Ga0070684_1004075272 174
199 3300005536 Ga0070697_100016756 Ga0070697_1000167562 174
200 3300005536 Ga0070697_100023193 Ga0070697_1000231935 174
201 3300005536 Ga0070697_100023802 Ga0070697_1000238023 174
202 3300005536 Ga0070697_100026935 Ga0070697_1000269351 174
203 3300005536 Ga0070697_100181023 Ga0070697_1001810231 174
204 3300005539 Ga0068853_100001594 Ga0068853_10000159411 174
205 3300005544 Ga0070686_100205439 Ga0070686_1002054392 174
206 3300005545 Ga0070695_100003170 Ga0070695_1000031703 174
207 3300005545 Ga0070695_100004272 Ga0070695_1000042722 174
208 3300005545 Ga0070695_100058543 Ga0070695_1000585433 174
209 3300005545 Ga0070695_100117303 Ga0070695_1001173033 174
210 3300005546 Ga0070696_100008387 Ga0070696_1000083873 174
211 3300005546 Ga0070696_100012972 Ga0070696_1000129724 174
212 3300005546 Ga0070696_100022945 Ga0070696_1000229457 174
213 3300005546 Ga0070696_100235372 Ga0070696_1002353722 174
214 3300005546 Ga0070696_100551085 Ga0070696_1005510852 174
215 3300005546 Ga0070696_100960078 Ga0070696_1009600781 174
216 3300005547 Ga0070693_100011771 Ga0070693_1000117716 174
217 3300005547 Ga0070693_100030328 Ga0070693_1000303282 174
218 3300005549 Ga0070704_100047443 Ga0070704_1000474432 174
219 3300005549 Ga0070704_100070171 Ga0070704_1000701715 174
220 3300005549 Ga0070704_100129774 Ga0070704_1001297741 174
221 3300005549 Ga0070704_100759334 Ga0070704_1007593342 174
222 3300005563 Ga0068855_100010887 Ga0068855_1000108879 174
223 3300005563 Ga0068855_100358407 Ga0068855_1003584072 174
224 3300005564 Ga0070664_100013742 Ga0070664_1000137422 174
225 3300005564 Ga0070664_100524141 Ga0070664_1005241412 174
226 3300005577 Ga0068857_100020642 Ga0068857_1000206426 174
227 3300005577 Ga0068857_100088568 Ga0068857_1000885682 174
228 3300005577 Ga0068857_100162040 Ga0068857_1001620403 174
229 3300005578 Ga0068854_100011479 Ga0068854_1000114796 174
230 3300005614 Ga0068856_100005201 Ga0068856_1000052018 174
231 3300005614 Ga0068856_101243279 Ga0068856_1012432791 174
232 3300005615 Ga0070702_100011369 Ga0070702_1000113696 174
233 3300005615 Ga0070702_100070371 Ga0070702_1000703713 174
234 3300005616 Ga0068852_100136394 Ga0068852_1001363943 174
235 3300005617 Ga0068859_100006840 Ga0068859_1000068406 174
236 3300005617 Ga0068859_100230992 Ga0068859_1002309923 174
237 3300005618 Ga0068864_100014894 Ga0068864_1000148942 174
238 3300005618 Ga0068864_100015376 Ga0068864_1000153762 174
239 3300005719 Ga0068861_100114196 Ga0068861_1001141961 174
240 3300005719 Ga0068861_100553382 Ga0068861_1005533822 174
241 3300005840 Ga0068870_10000125 Ga0068870_100001253 174
242 3300005841 Ga0068863_100027042 Ga0068863_1000270425 174
243 3300005841 Ga0068863_100056394 Ga0068863_1000563942 174
244 3300005842 Ga0068858_100024297 Ga0068858_1000242976 174
245 3300005843 Ga0068860_100047615 Ga0068860_1000476153 174
246 3300005843 Ga0068860_100410120 Ga0068860_1004101202 174
247 3300005844 Ga0068862_100007501 Ga0068862_10000750110 174
248 3300005844 Ga0068862_100145626 Ga0068862_1001456264 174
249 3300005937 Ga0081455_10000189 Ga0081455_100001892 174
250 3300005981 Ga0081538_10086579 Ga0081538_100865791 174
251 3300005983 Ga0081540_1005614 Ga0081540_10056146 174
252 3300005985 Ga0081539_10000166 Ga0081539_1000016649 174
253 3300006028 Ga0070717_10022010 Ga0070717_100220103 174
254 3300006058 Ga0075432_10027943 Ga0075432_100279433 174
255 3300006173 Ga0070716_100397688 Ga0070716_1003976882 174
256 3300006195 Ga0075366_10346991 Ga0075366_103469911 174
257 3300006237 Ga0097621_100426815 Ga0097621_1004268152 174
258 3300006358 Ga0068871_100131529 Ga0068871_1001315293 174
259 3300006358 Ga0068871_100960789 Ga0068871_1009607891 174
260 3300006844 Ga0075428_100000368 Ga0075428_1000003689 174
261 3300006844 Ga0075428_100000410 Ga0075428_10000041040 174
262 3300006844 Ga0075428_100004668 Ga0075428_1000046684 174
263 3300006844 Ga0075428_100086890 Ga0075428_1000868901 174
264 3300006844 Ga0075428_100136817 Ga0075428_1001368174 174
265 3300006844 Ga0075428_100176959 Ga0075428_1001769593 174
266 3300006844 Ga0075428_100185079 Ga0075428_1001850793 174
267 3300006844 Ga0075428_100242629 Ga0075428_1002426293 174
268 3300006844 Ga0075428_100660351 Ga0075428_1006603513 174
269 3300006844 Ga0075428_100672215 Ga0075428_1006722151 174
270 3300006844 Ga0075428_100698680 Ga0075428_1006986803 174
271 3300006846 Ga0075430_100002647 Ga0075430_10000264716 174
272 3300006846 Ga0075430_100003046 Ga0075430_1000030468 174
273 3300006846 Ga0075430_100011404 Ga0075430_1000114041 174
274 3300006846 Ga0075430_100148490 Ga0075430_1001484902 174
275 3300006846 Ga0075430_100347290 Ga0075430_1003472901 174
276 3300006847 Ga0075431_100000843 Ga0075431_10000084319 174
277 3300006847 Ga0075431_100002781 Ga0075431_10000278115 174
278 3300006847 Ga0075431_100010752 Ga0075431_1000107525 174
279 3300006847 Ga0075431_100011301 Ga0075431_1000113014 174
280 3300006847 Ga0075431_100012211 Ga0075431_1000122115 174
281 3300006847 Ga0075431_100029113 Ga0075431_1000291133 174
282 3300006847 Ga0075431_100136317 Ga0075431_1001363173 174
283 3300006847 Ga0075431_100258162 Ga0075431_1002581622 174
284 3300006847 Ga0075431_100452884 Ga0075431_1004528842 174
285 3300006847 Ga0075431_100481376 Ga0075431_1004813763 174
286 3300006847 Ga0075431_100912241 Ga0075431_1009122412 174
287 3300006852 Ga0075433_10000489 Ga0075433_1000048916 174
288 3300006852 Ga0075433_10007833 Ga0075433_100078337 174
289 3300006852 Ga0075433_10008458 Ga0075433_1000845810 174
290 3300006852 Ga0075433_10014343 Ga0075433_100143438 174
291 3300006852 Ga0075433_10128763 Ga0075433_101287634 174
292 3300006852 Ga0075433_10268062 Ga0075433_102680622 174
293 3300006852 Ga0075433_10561270 Ga0075433_105612701 174
294 3300006871 Ga0075434_100007947 Ga0075434_10000794710 174
295 3300006871 Ga0075434_100139858 Ga0075434_1001398582 174
296 3300006871 Ga0075434_100178127 Ga0075434_1001781271 174
297 3300006871 Ga0075434_100323890 Ga0075434_1003238903 174
298 3300006871 Ga0075434_100367859 Ga0075434_1003678593 174
299 3300006871 Ga0075434_100428526 Ga0075434_1004285262 174
300 3300006871 Ga0075434_101008432 Ga0075434_1010084321 174
301 3300006880 Ga0075429_100003897 Ga0075429_1000038977 174
302 3300006880 Ga0075429_100014858 Ga0075429_1000148584 174
303 3300006880 Ga0075429_100018255 Ga0075429_1000182551 174
304 3300006880 Ga0075429_100018795 Ga0075429_1000187955 174
305 3300006880 Ga0075429_100097772 Ga0075429_1000977723 174
306 3300006880 Ga0075429_100169307 Ga0075429_1001693073 174
307 3300006881 Ga0068865_100933823 Ga0068865_1009338232 174
308 3300006914 Ga0075436_100003545 Ga0075436_1000035459 174
309 3300006914 Ga0075436_100063393 Ga0075436_1000633931 174
310 3300006914 Ga0075436_100100109 Ga0075436_1001001091 174
311 3300006914 Ga0075436_100133092 Ga0075436_1001330923 174
312 3300006914 Ga0075436_100195911 Ga0075436_1001959112 174
313 3300006931 Ga0097620_100006840 Ga0097620_1000068406 174
314 3300006931 Ga0097620_100230980 Ga0097620_1002309803 174
315 3300007076 Ga0075435_100066728 Ga0075435_1000667282 174
316 3300007076 Ga0075435_100081935 Ga0075435_1000819353 174
317 3300007076 Ga0075435_100121001 Ga0075435_1001210012 174
318 3300007076 Ga0075435_100131752 Ga0075435_1001317522 174
319 3300007076 Ga0075435_101243231 Ga0075435_1012432311 174
320 3300007265 Ga0099794_10008590 Ga0099794_100085906 174
321 3300007265 Ga0099794_10025323 Ga0099794_100253231 174
322 3300007265 Ga0099794_10234168 Ga0099794_102341681 174
323 3300007265 Ga0099794_10530423 Ga0099794_105304231 174
324 3300009093 Ga0105240_10869923 Ga0105240_108699231 174
325 3300009094 Ga0111539_10153212 Ga0111539_101532122 174
326 3300009094 Ga0111539_11072427 Ga0111539_110724272 174
327 3300009098 Ga0105245_10215285 Ga0105245_102152852 174
328 3300009147 Ga0114129_10000074 Ga0114129_1000007413 174
329 3300009147 Ga0114129_10000893 Ga0114129_1000089335 174
330 3300009147 Ga0114129_10001132 Ga0114129_1000113215 174
331 3300009147 Ga0114129_10002386 Ga0114129_1000238617 174
332 3300009147 Ga0114129_10014235 Ga0114129_100142358 174
333 3300009147 Ga0114129_10025545 Ga0114129_100255453 174
334 3300009147 Ga0114129_10041361 Ga0114129_100413614 174
335 3300009147 Ga0114129_10044920 Ga0114129_100449205 174
336 3300009147 Ga0114129_10050132 Ga0114129_100501322 174
337 3300009147 Ga0114129_10098924 Ga0114129_100989244 174
338 3300009147 Ga0114129_10111142 Ga0114129_101111423 174
339 3300009147 Ga0114129_10149320 Ga0114129_101493202 174
340 3300009147 Ga0114129_10165930 Ga0114129_101659302 174
341 3300009147 Ga0114129_10192171 Ga0114129_101921713 174
342 3300009147 Ga0114129_10219538 Ga0114129_102195383 174
343 3300009147 Ga0114129_10229368 Ga0114129_102293682 174
344 3300009147 Ga0114129_10253697 Ga0114129_102536972 174
345 3300009147 Ga0114129_10260573 Ga0114129_102605735 174
346 3300009147 Ga0114129_10308035 Ga0114129_103080351 174
347 3300009148 Ga0105243_10035661 Ga0105243_100356612 174
348 3300009148 Ga0105243_10242607 Ga0105243_102426072 174
349 3300009148 Ga0105243_10814419 Ga0105243_108144191 174
350 3300009174 Ga0105241_10000650 Ga0105241_1000065018 174
351 3300009177 Ga0105248_10022443 Ga0105248_100224435 174
352 3300009545 Ga0105237_10036293 Ga0105237_100362936 174
353 3300009553 Ga0105249_10097197 Ga0105249_100971972 174
354 3300013100 Ga0157373_10005161 Ga0157373_100051618 174
355 3300013102 Ga0157371_10156661 Ga0157371_101566612 174
356 3300013102 Ga0157371_10165860 Ga0157371_101658602 174
357 3300013104 Ga0157370_10236465 Ga0157370_102364652 174
358 3300013105 Ga0157369_10023823 Ga0157369_100238234 174
359 3300013105 Ga0157369_10119686 Ga0157369_101196862 174
360 3300013297 Ga0157378_10464030 Ga0157378_104640302 174
361 3300013297 Ga0157378_11336969 Ga0157378_113369691 174
362 3300013307 Ga0157372_10000746 Ga0157372_1000074611 174
363 3300013307 Ga0157372_10085982 Ga0157372_100859825 174
364 3300013307 Ga0157372_10495332 Ga0157372_104953322 174
365 3300013308 Ga0157375_11804818 Ga0157375_118048181 174
366 3300014325 Ga0163163_10030503 Ga0163163_100305034 174
367 3300014325 Ga0163163_10196633 Ga0163163_101966332 174
368 3300014326 Ga0157380_10418667 Ga0157380_104186672 174
369 3300014326 Ga0157380_10653418 Ga0157380_106534181 174
370 3300014968 Ga0157379_10230549 Ga0157379_102305492 174
371 3300014968 Ga0157379_10244236 Ga0157379_102442362 174
372 3300014969 Ga0157376_11562853 Ga0157376_115628531 174
373 3300020069 Ga0197907_10121884 Ga0197907_101218841 174
374 3300020070 Ga0206356_11013378 Ga0206356_110133781 174
375 3300020070 Ga0206356_11834943 Ga0206356_118349432 174
376 3300020082 Ga0206353_10128875 Ga0206353_101288753 174
377 3300020082 Ga0206353_11558259 Ga0206353_115582592 174
378 3300022467 Ga0224712_10026200 Ga0224712_100262002 174
379 3300022467 Ga0224712_10152723 Ga0224712_101527232 174
380 3300025903 Ga0207680_10189322 Ga0207680_101893222 174
381 3300025905 Ga0207685_10009271 Ga0207685_100092712 174
382 3300025906 Ga0207699_10123723 Ga0207699_101237233 174
383 3300025907 Ga0207645_10007485 Ga0207645_100074856 174
384 3300025907 Ga0207645_10021617 Ga0207645_100216172 174
385 3300025908 Ga0207643_10000210 Ga0207643_100002104 174
386 3300025909 Ga0207705_10032819 Ga0207705_100328193 174
387 3300025910 Ga0207684_10000501 Ga0207684_1000050152 174
388 3300025910 Ga0207684_10002039 Ga0207684_1000203910 174
389 3300025910 Ga0207684_10007653 Ga0207684_100076535 174
390 3300025910 Ga0207684_10008119 Ga0207684_100081192 174
391 3300025910 Ga0207684_10028818 Ga0207684_100288182 174
392 3300025910 Ga0207684_10034707 Ga0207684_100347075 174
393 3300025910 Ga0207684_10056223 Ga0207684_100562234 174
394 3300025910 Ga0207684_10085803 Ga0207684_100858033 174
395 3300025910 Ga0207684_10180500 Ga0207684_101805004 174
396 3300025910 Ga0207684_10316733 Ga0207684_103167333 174
397 3300025910 Ga0207684_10502421 Ga0207684_105024212 174
398 3300025910 Ga0207684_10503206 Ga0207684_105032061 174
399 3300025911 Ga0207654_10011378 Ga0207654_100113782 174
400 3300025912 Ga0207707_10032880 Ga0207707_100328803 174
401 3300025912 Ga0207707_10033934 Ga0207707_100339341 174
402 3300025912 Ga0207707_10879771 Ga0207707_108797712 174
403 3300025913 Ga0207695_10799377 Ga0207695_107993771 174
404 3300025914 Ga0207671_10202283 Ga0207671_102022832 174
405 3300025915 Ga0207693_10218796 Ga0207693_102187963 174
406 3300025917 Ga0207660_10010898 Ga0207660_100108983 174
407 3300025917 Ga0207660_10114294 Ga0207660_101142941 174
408 3300025917 Ga0207660_10172389 Ga0207660_101723892 174
409 3300025917 Ga0207660_10991288 Ga0207660_109912881 174
410 3300025918 Ga0207662_10016639 Ga0207662_100166392 174
411 3300025919 Ga0207657_10001132 Ga0207657_1000113225 174
412 3300025920 Ga0207649_10001277 Ga0207649_1000127713 174
413 3300025920 Ga0207649_10022014 Ga0207649_100220143 174
414 3300025921 Ga0207652_10002841 Ga0207652_100028414 174
415 3300025921 Ga0207652_10108289 Ga0207652_101082892 174
416 3300025922 Ga0207646_10003794 Ga0207646_1000379410 174
417 3300025922 Ga0207646_10004103 Ga0207646_1000410316 174
418 3300025922 Ga0207646_10007888 Ga0207646_100078889 174
419 3300025922 Ga0207646_10008540 Ga0207646_100085409 174
420 3300025922 Ga0207646_10015545 Ga0207646_100155451 174
421 3300025922 Ga0207646_10020443 Ga0207646_100204431 174
422 3300025922 Ga0207646_10046814 Ga0207646_100468143 174
423 3300025922 Ga0207646_10088629 Ga0207646_100886292 174
424 3300025922 Ga0207646_10223246 Ga0207646_102232462 174
425 3300025922 Ga0207646_10292016 Ga0207646_102920162 174
426 3300025922 Ga0207646_10384808 Ga0207646_103848082 174
427 3300025922 Ga0207646_10512661 Ga0207646_105126611 174
428 3300025922 Ga0207646_10689867 Ga0207646_106898672 174
429 3300025923 Ga0207681_10152750 Ga0207681_101527502 174
430 3300025923 Ga0207681_10543912 Ga0207681_105439121 174
431 3300025925 Ga0207650_10041437 Ga0207650_100414372 174
432 3300025927 Ga0207687_10142795 Ga0207687_101427952 174
433 3300025928 Ga0207700_10240372 Ga0207700_102403722 174
434 3300025929 Ga0207664_10059535 Ga0207664_100595354 174
435 3300025932 Ga0207690_10003389 Ga0207690_100033895 174
436 3300025933 Ga0207706_10051460 Ga0207706_100514601 174
437 3300025933 Ga0207706_10579999 Ga0207706_105799992 174
438 3300025935 Ga0207709_10048879 Ga0207709_100488792 174
439 3300025935 Ga0207709_10774398 Ga0207709_107743981 174
440 3300025936 Ga0207670_10033490 Ga0207670_100334903 174
441 3300025936 Ga0207670_10259098 Ga0207670_102590982 174
442 3300025939 Ga0207665_10189926 Ga0207665_101899262 174
443 3300025941 Ga0207711_10045468 Ga0207711_100454682 174
444 3300025942 Ga0207689_10001491 Ga0207689_1000149121 174
445 3300025942 Ga0207689_10042483 Ga0207689_100424835 174
446 3300025944 Ga0207661_10042351 Ga0207661_100423513 174
447 3300025945 Ga0207679_10001453 Ga0207679_100014536 174
448 3300025945 Ga0207679_11455797 Ga0207679_114557971 174
449 3300025949 Ga0207667_10003068 Ga0207667_1000306818 174
450 3300025949 Ga0207667_10236810 Ga0207667_102368103 174
451 3300025961 Ga0207712_10041976 Ga0207712_100419765 174
452 3300025972 Ga0207668_10672375 Ga0207668_106723751 174
453 3300025981 Ga0207640_10005366 Ga0207640_100053666 174
454 3300025981 Ga0207640_10161292 Ga0207640_101612922 174
455 3300026041 Ga0207639_10004549 Ga0207639_1000454911 174
456 3300026067 Ga0207678_10025484 Ga0207678_100254846 174
457 3300026075 Ga0207708_10574774 Ga0207708_105747742 174
458 3300026075 Ga0207708_11182765 Ga0207708_111827651 174
459 3300026078 Ga0207702_10002765 Ga0207702_100027653 174
460 3300026078 Ga0207702_10418962 Ga0207702_104189622 174
461 3300026078 Ga0207702_11469896 Ga0207702_114698961 174
462 3300026088 Ga0207641_10092610 Ga0207641_100926102 174
463 3300026089 Ga0207648_10000854 Ga0207648_1000085422 174
464 3300026089 Ga0207648_10323495 Ga0207648_103234952 174
465 3300026116 Ga0207674_10001007 Ga0207674_1000100713 174
466 3300026116 Ga0207674_10054189 Ga0207674_100541891 174
467 3300026118 Ga0207675_100129549 Ga0207675_1001295492 174
468 3300026118 Ga0207675_100832085 Ga0207675_1008320852 174
469 3300026142 Ga0207698_10149757 Ga0207698_101497572 174
470 3300027360 Ga0209969_1016635 Ga0209969_10166352 174
471 3300027378 Ga0209981_1051225 Ga0209981_10512251 174
472 3300027395 Ga0209996_1004068 Ga0209996_10040684 174
473 3300027462 Ga0210000_1006342 Ga0210000_10063423 174
474 3300027471 Ga0209995_1001777 Ga0209995_10017772 174
475 3300027526 Ga0209968_1002224 Ga0209968_10022242 174
476 3300027543 Ga0209999_1008541 Ga0209999_10085414 174
477 3300027614 Ga0209970_1000996 Ga0209970_10009967 174
478 3300027617 Ga0210002_1005220 Ga0210002_10052201 174
479 3300027665 Ga0209983_1004209 Ga0209983_10042091 174
480 3300027671 Ga0209588_1006881 Ga0209588_10068814 174
481 3300027682 Ga0209971_1000015 Ga0209971_10000153 174
482 3300027695 Ga0209966_1000025 Ga0209966_100002563 174
483 3300027717 Ga0209998_10002824 Ga0209998_100028244 174
484 3300027717 Ga0209998_10021687 Ga0209998_100216871 174
485 3300027876 Ga0209974_10006662 Ga0209974_100066621 174
486 3300027907 Ga0207428_10005120 Ga0207428_100051206 174
487 3300028380 Ga0268265_10012051 Ga0268265_100120513 174
488 3300028380 Ga0268265_10093772 Ga0268265_100937724 174
489 3300028380 Ga0268265_11382477 Ga0268265_113824771 174
490 3300028381 Ga0268264_10031816 Ga0268264_100318164 174
491 3300028381 Ga0268264_10900229 Ga0268264_109002292 174
492 3300031548 Ga0307408_100241287 Ga0307408_1002412872 174
493 3300031548 Ga0307408_100365387 Ga0307408_1003653873 174
494 3300031824 Ga0307413_11078027 Ga0307413_110780271 174
495 3300031901 Ga0307406_10293912 Ga0307406_102939123 174
496 3300031901 Ga0307406_10690640 Ga0307406_106906402 174
497 3300032002 Ga0307416_101168467 Ga0307416_1011684671 174
498 3300032005 Ga0307411_10483894 Ga0307411_104838943 174
499 3300032005 Ga0307411_11556843 Ga0307411_115568431 174
500 3300034817 Ga0373948_0136983 Ga0373948_0136983_61_588 174
501 3300035091 Ga0373951_0015985 Ga0373951_0015985_717_1244 174
502 3300035092 Ga0373952_0025089 Ga0373952_0025089_168_695 174
503 3300035112 Ga0373932_0311443 Ga0373932_0311443_48_575 174
504 3300035115 Ga0373941_0022104 Ga0373941_0022104_1202_1729 174
505 3300035121 Ga0373960_0015883 Ga0373960_0015883_116_643 174
506 3300036401 Ga0373937_0841189 Ga0373937_0841189_29_610 174
507 3300036647 Ga0316582_0629696 Ga0316582_0629696_107_631 174
508 3300036712 Ga0316584_0184968 Ga0316584_0184968_738_1262 174
509 3300037312 Ga0395899_0321354 Ga0395899_0321354_326_850 174
510 3300037418 Ga0395900_0039595 Ga0395900_0039595_2240_2764 174
511 3300037418 Ga0395900_0557859 Ga0395900_0557859_94_618 174
512 3300037466 Ga0395898_0702193 Ga0395898_0702193_27_551 174
513 3300037471 Ga0395905_0012207 Ga0395905_0012207_6937_7461 174
514 3300038443 Ga0395901_0100457 Ga0395901_0100457_849_1373 174
515 3300038996 Ga0242420_008752 Ga0242420_008752_866_1390 174
516 3300038996 Ga0242420_009466 Ga0242420_009466_359_886 174
517 3300038996 Ga0242420_011643 Ga0242420_011643_12_536 174
518 3300038996 Ga0242420_027015 Ga0242420_027015_82_609 174
519 3300042001 Ga0439441_078405 Ga0439441_078405_116_643 174
520 3300042005 Ga0439448_0071818 Ga0439448_0071818_357_884 174
521 3300042012 Ga0439455_0008138 Ga0439455_0008138_1308_1835 174
522 3300042012 Ga0439455_0072089 Ga0439455_0072089_88_615 174
523 3300042144 Ga0450889_004308 Ga0450889_004308_556_1083 174
524 3300042157 Ga0439458_0006689 Ga0439458_0006689_1632_2159 174
525 3300042438 Ga0439459_0004125 Ga0439459_0004125_376_903 174
526 3300042439 Ga0439464_0018432 Ga0439464_0018432_1321_1848 174
527 3300042439 Ga0439464_0038737 Ga0439464_0038737_111_638 174
528 3300042461 Ga0439460_0001601 Ga0439460_0001601_1668_2195 174
529 3300042532 Ga0450893_0061635 Ga0450893_0061635_11_538 174
530 3300042876 Ga0451577_0078028 Ga0451577_0078028_616_1143 174
531 3300042876 Ga0451577_0198191 Ga0451577_0198191_177_704 174
532 3300042876 Ga0451577_0242690 Ga0451577_0242690_441_968 174
533 3300042993 Ga0439440_0055770 Ga0439440_0055770_168_695 174
534 3300044673 Ga0453683_0036968 Ga0453683_0036968_1857_2384 174
535 3300044673 Ga0453683_0105587 Ga0453683_0105587_458_982 174
536 3300044673 Ga0453683_0156588 Ga0453683_0156588_400_927 174
537 3300044673 Ga0453683_0608074 Ga0453683_0608074_152_679 174
538 3300044712 Ga0453684_0044975 Ga0453684_0044975_898_1425 174
539 3300045049 Ga0466959_0612198 Ga0466959_0612198_133_711 174
540 3300045051 Ga0451576_0012483 Ga0451576_0012483_4117_4644 174
541 3300045051 Ga0451576_0022854 Ga0451576_0022854_151_678 174
542 3300045051 Ga0451576_0073514 Ga0451576_0073514_2649_3176 174
543 3300045051 Ga0451576_0119751 Ga0451576_0119751_171_698 174
544 3300045051 Ga0451576_0376510 Ga0451576_0376510_675_1199 174
545 3300045051 Ga0451576_0837922 Ga0451576_0837922_172_699 174
546 3300046459 Ga0495629_0145917 Ga0495629_0145917_826_1407 174
547 3300046517 Ga0495630_0113280 Ga0495630_0113280_83_634 174
548 3300046531 Ga0495665_0241085 Ga0495665_0241085_228_779 174
549 3300047315 Ga0495581_0134020 Ga0495581_0134020_858_1409 174
550 3300048905 Ga0496102_0051265 Ga0496102_0051265_1902_2429 174
551 3300048905 Ga0496102_0080800 Ga0496102_0080800_1663_2190 174
552 3300048905 Ga0496102_0841493 Ga0496102_0841493_134_685 174
553 3300048907 Ga0496104_0012746 Ga0496104_0012746_2497_3048 174
554 3300048907 Ga0496104_0738211 Ga0496104_0738211_167_694 174
555 3300048908 Ga0496105_0068439 Ga0496105_0068439_2243_2794 174
556 3300048909 Ga0496106_0054853 Ga0496106_0054853_1272_1799 174
557 3300048911 Ga0496108_0011753 Ga0496108_0011753_1157_1708 174
558 3300048912 Ga0496109_0203779 Ga0496109_0203779_1157_1708 174
559 3300048912 Ga0496109_0678498 Ga0496109_0678498_121_645 174
560 3300048913 Ga0496110_0024875 Ga0496110_0024875_3088_3639 174
561 3300048914 Ga0496111_0012377 Ga0496111_0012377_399_950 174
562 3300048915 Ga0496112_0066335 Ga0496112_0066335_2961_3488 174
563 3300048915 Ga0496112_0066764 Ga0496112_0066764_1969_2520 174
564 3300048916 Ga0496113_0006938 Ga0496113_0006938_4168_4719 174
565 3300048916 Ga0496113_1182081 Ga0496113_1182081_24_554 174
566 3300049568 Ga0501031_0031403 Ga0501031_0031403_1830_2354 174
567 3300049569 Ga0501032_0430586 Ga0501032_0430586_227_751 174
568 3300049570 Ga0501033_0279268 Ga0501033_0279268_278_802 174
569 3300049570 Ga0501033_0283430 Ga0501033_0283430_633_1157 174
570 3300049572 Ga0501036_0001561 Ga0501036_0001561_15200_15724 174
571 3300049572 Ga0501036_0031720 Ga0501036_0031720_2078_2602 174
572 3300049572 Ga0501036_0059724 Ga0501036_0059724_635_1159 174
573 3300049572 Ga0501036_0105276 Ga0501036_0105276_900_1424 174
574 3300049572 Ga0501036_0239478 Ga0501036_0239478_454_978 174
575 3300049572 Ga0501036_0272545 Ga0501036_0272545_798_1322 174
576 3300049572 Ga0501036_0483946 Ga0501036_0483946_232_759 174
577 3300049572 Ga0501036_0645479 Ga0501036_0645479_342_866 174
578 3300049572 Ga0501036_0762708 Ga0501036_0762708_188_712 174
579 3300049573 Ga0501037_0076391 Ga0501037_0076391_1891_2415 174
580 3300049573 Ga0501037_0355717 Ga0501037_0355717_278_802 174
581 3300049573 Ga0501037_0391551 Ga0501037_0391551_252_776 174
582 3300049574 Ga0501038_0002016 Ga0501038_0002016_17864_18388 174
583 3300049574 Ga0501038_0119864 Ga0501038_0119864_556_1080 174
584 3300049574 Ga0501038_0353056 Ga0501038_0353056_151_675 174
585 3300049574 Ga0501038_0447805 Ga0501038_0447805_168_692 174
586 3300049575 Ga0501039_0017830 Ga0501039_0017830_776_1300 174
587 3300049575 Ga0501039_0294315 Ga0501039_0294315_58_582 174
588 3300049575 Ga0501039_0425139 Ga0501039_0425139_179_703 174
589 3300049575 Ga0501039_0660556 Ga0501039_0660556_227_751 174
590 3300049576 Ga0501040_0021002 Ga0501040_0021002_1719_2246 174
591 3300049576 Ga0501040_0022215 Ga0501040_0022215_1145_1669 174
592 3300049576 Ga0501040_0122858 Ga0501040_0122858_70_594 174
593 3300049576 Ga0501040_0135686 Ga0501040_0135686_106_633 174
594 3300049576 Ga0501040_0139836 Ga0501040_0139836_853_1377 174
595 3300049576 Ga0501040_0145412 Ga0501040_0145412_699_1223 174
596 3300049576 Ga0501040_0431252 Ga0501040_0431252_331_855 174
597 3300049576 Ga0501040_0445544 Ga0501040_0445544_200_724 174
598 3300049576 Ga0501040_0762199 Ga0501040_0762199_101_625 174
599 3300049577 Ga0501041_0003824 Ga0501041_0003824_1223_1747 174
600 3300049577 Ga0501041_0014897 Ga0501041_0014897_3650_4174 174
601 3300049577 Ga0501041_0051508 Ga0501041_0051508_1598_2122 174
602 3300049577 Ga0501041_0086635 Ga0501041_0086635_383_907 174
603 3300049577 Ga0501041_0103756 Ga0501041_0103756_326_850 174
604 3300049577 Ga0501041_0391180 Ga0501041_0391180_161_685 174
605 3300049577 Ga0501041_0471638 Ga0501041_0471638_135_662 174
606 3300049577 Ga0501041_0484214 Ga0501041_0484214_100_624 174
607 3300049578 Ga0501042_0002923 Ga0501042_0002923_9247_9771 174
608 3300049578 Ga0501042_0033753 Ga0501042_0033753_2059_2583 174
609 3300049578 Ga0501042_0048990 Ga0501042_0048990_1328_1852 174
610 3300049578 Ga0501042_0053577 Ga0501042_0053577_631_1158 174
611 3300049578 Ga0501042_0071800 Ga0501042_0071800_491_1015 174
612 3300049578 Ga0501042_0108182 Ga0501042_0108182_198_725 174
613 3300049578 Ga0501042_0598797 Ga0501042_0598797_83_607 174
614 3300049579 Ga0501043_0143931 Ga0501043_0143931_196_720 174
615 3300049579 Ga0501043_0531830 Ga0501043_0531830_143_667 174
616 3300049579 Ga0501043_0822853 Ga0501043_0822853_114_638 174
617 3300049580 Ga0501046_0000476 Ga0501046_0000476_1956_2483 174
618 3300049580 Ga0501046_0023214 Ga0501046_0023214_3289_3813 174
619 3300049580 Ga0501046_0036233 Ga0501046_0036233_1614_2138 174
620 3300049580 Ga0501046_0116441 Ga0501046_0116441_1141_1665 174
621 3300049580 Ga0501046_0116530 Ga0501046_0116530_371_898 174
622 3300049580 Ga0501046_0155913 Ga0501046_0155913_440_964 174
623 3300049580 Ga0501046_0236450 Ga0501046_0236450_340_864 174
624 3300049580 Ga0501046_0874773 Ga0501046_0874773_20_544 174
625 3300049581 Ga0501047_0062026 Ga0501047_0062026_1739_2266 174
626 3300049582 Ga0501048_0006058 Ga0501048_0006058_8012_8536 174
627 3300049582 Ga0501048_0007656 Ga0501048_0007656_2797_3321 174
628 3300049582 Ga0501048_0027939 Ga0501048_0027939_251_775 174
629 3300049582 Ga0501048_0141175 Ga0501048_0141175_292_816 174
630 3300049582 Ga0501048_0269442 Ga0501048_0269442_670_1194 174
631 3300049582 Ga0501048_0301898 Ga0501048_0301898_292_819 174
632 3300049582 Ga0501048_0671629 Ga0501048_0671629_135_659 174
633 3300049582 Ga0501048_0693543 Ga0501048_0693543_54_578 174
634 3300049584 Ga0501068_0054941 Ga0501068_0054941_943_1467 174
635 3300049584 Ga0501068_0064140 Ga0501068_0064140_1434_1958 174
636 3300049584 Ga0501068_0066202 Ga0501068_0066202_984_1508 174
637 3300049584 Ga0501068_0157188 Ga0501068_0157188_779_1306 174
638 3300049584 Ga0501068_0344449 Ga0501068_0344449_404_931 174
639 3300049584 Ga0501068_0421403 Ga0501068_0421403_58_582 174
640 3300049584 Ga0501068_0454190 Ga0501068_0454190_287_811 174
641 3300049585 Ga0501069_0032278 Ga0501069_0032278_1829_2353 174
642 3300049585 Ga0501069_0146851 Ga0501069_0146851_562_1086 174
643 3300049586 Ga0501070_0079961 Ga0501070_0079961_1291_1815 174
644 3300049586 Ga0501070_0727127 Ga0501070_0727127_42_566 174
645 3300049587 Ga0501071_0000146 Ga0501071_0000146_28744_29268 174
646 3300049587 Ga0501071_0017630 Ga0501071_0017630_93_617 174
647 3300049587 Ga0501071_0028787 Ga0501071_0028787_2651_3175 174
648 3300049587 Ga0501071_0142655 Ga0501071_0142655_46_570 174
649 3300049587 Ga0501071_0150657 Ga0501071_0150657_536_1060 174
650 3300049587 Ga0501071_0266387 Ga0501071_0266387_181_705 174
651 3300049587 Ga0501071_0420821 Ga0501071_0420821_425_952 174
652 3300049587 Ga0501071_0611609 Ga0501071_0611609_122_646 174
653 3300049587 Ga0501071_0632587 Ga0501071_0632587_203_730 174
654 3300049588 Ga0501072_0001090 Ga0501072_0001090_4331_4855 174
655 3300049588 Ga0501072_0024330 Ga0501072_0024330_395_919 174
656 3300049588 Ga0501072_0049544 Ga0501072_0049544_1693_2217 174
657 3300049588 Ga0501072_0092290 Ga0501072_0092290_451_975 174
658 3300049588 Ga0501072_0104792 Ga0501072_0104792_391_915 174
659 3300049588 Ga0501072_0125191 Ga0501072_0125191_1482_2006 174
660 3300049588 Ga0501072_0140833 Ga0501072_0140833_950_1474 174
661 3300049588 Ga0501072_0452674 Ga0501072_0452674_199_723 174
662 3300049588 Ga0501072_1015092 Ga0501072_1015092_101_625 174
663 3300049589 Ga0501073_0112475 Ga0501073_0112475_326_850 174
664 3300049589 Ga0501073_0283161 Ga0501073_0283161_411_938 174
665 3300049589 Ga0501073_0373660 Ga0501073_0373660_64_588 174
666 3300049589 Ga0501073_0589683 Ga0501073_0589683_127_651 174
667 3300049589 Ga0501073_0631443 Ga0501073_0631443_92_616 174
668 3300049590 Ga0501074_0020451 Ga0501074_0020451_4008_4532 174
669 3300049590 Ga0501074_0143337 Ga0501074_0143337_428_1021 174
670 3300049590 Ga0501074_0175619 Ga0501074_0175619_873_1397 174
671 3300049590 Ga0501074_0348253 Ga0501074_0348253_263_787 174
672 3300049590 Ga0501074_0485847 Ga0501074_0485847_270_794 174
673 3300049590 Ga0501074_0555007 Ga0501074_0555007_77_601 174
674 3300049590 Ga0501074_0560808 Ga0501074_0560808_209_733 174
675 3300049590 Ga0501074_0589570 Ga0501074_0589570_170_697 174
676 3300049591 Ga0501075_0000205 Ga0501075_0000205_11396_11920 174
677 3300049591 Ga0501075_0006572 Ga0501075_0006572_5293_5817 174
678 3300049591 Ga0501075_0008457 Ga0501075_0008457_2812_3339 174
679 3300049591 Ga0501075_0029261 Ga0501075_0029261_1434_1961 174
680 3300049591 Ga0501075_0083369 Ga0501075_0083369_786_1310 174
681 3300049591 Ga0501075_0121126 Ga0501075_0121126_541_1065 174
682 3300049591 Ga0501075_0145036 Ga0501075_0145036_125_649 174
683 3300049591 Ga0501075_0177679 Ga0501075_0177679_189_713 174
684 3300049591 Ga0501075_0196867 Ga0501075_0196867_959_1510 174
685 3300049591 Ga0501075_0237524 Ga0501075_0237524_817_1341 174
686 3300049591 Ga0501075_0263584 Ga0501075_0263584_514_1101 174
687 3300049591 Ga0501075_0370602 Ga0501075_0370602_204_731 174
688 3300049592 Ga0501076_0000137 Ga0501076_0000137_31176_31700 174
689 3300049592 Ga0501076_0000395 Ga0501076_0000395_26331_26855 174
690 3300049592 Ga0501076_0003994 Ga0501076_0003994_4005_4529 174
691 3300049592 Ga0501076_0007226 Ga0501076_0007226_2448_2972 174
692 3300049592 Ga0501076_0058543 Ga0501076_0058543_1691_2218 174
693 3300049592 Ga0501076_0115470 Ga0501076_0115470_794_1318 174
694 3300049592 Ga0501076_0154646 Ga0501076_0154646_173_697 174
695 3300049592 Ga0501076_0246814 Ga0501076_0246814_553_1077 174
696 3300049592 Ga0501076_0445008 Ga0501076_0445008_493_1020 174
697 3300049592 Ga0501076_0926682 Ga0501076_0926682_57_581 174
698 3300049592 Ga0501076_1018049 Ga0501076_1018049_53_577 174
699 3300049593 Ga0501077_0006006 Ga0501077_0006006_3920_4444 174
700 3300049593 Ga0501077_0011430 Ga0501077_0011430_4963_5487 174
701 3300049593 Ga0501077_0014533 Ga0501077_0014533_1253_1780 174
702 3300049593 Ga0501077_0019267 Ga0501077_0019267_1834_2358 174
703 3300049593 Ga0501077_0057319 Ga0501077_0057319_710_1234 174
704 3300049593 Ga0501077_0062680 Ga0501077_0062680_1824_2348 174
705 3300049593 Ga0501077_0083247 Ga0501077_0083247_820_1344 174
706 3300049593 Ga0501077_0185891 Ga0501077_0185891_187_711 174
707 3300049593 Ga0501077_0477996 Ga0501077_0477996_219_743 174
708 3300049741 Ga0501079_0003718 Ga0501079_0003718_7266_7793 174
709 3300049741 Ga0501079_0016521 Ga0501079_0016521_2922_3446 174
710 3300049741 Ga0501079_0022665 Ga0501079_0022665_148_672 174
711 3300049741 Ga0501079_0031727 Ga0501079_0031727_169_693 174
712 3300049741 Ga0501079_0076365 Ga0501079_0076365_1336_1860 174
713 3300049741 Ga0501079_0824170 Ga0501079_0824170_29_553 174
714 3300049742 Ga0501080_0004005 Ga0501080_0004005_10302_10826 174
715 3300049742 Ga0501080_0026494 Ga0501080_0026494_4051_4575 174
716 3300049742 Ga0501080_0110225 Ga0501080_0110225_180_707 174
717 3300049742 Ga0501080_0138619 Ga0501080_0138619_180_704 174
718 3300049742 Ga0501080_0141524 Ga0501080_0141524_925_1452 174
719 3300049742 Ga0501080_0190991 Ga0501080_0190991_557_1081 174
720 3300049742 Ga0501080_0192249 Ga0501080_0192249_678_1202 174
721 3300049742 Ga0501080_0279095 Ga0501080_0279095_14_541 174
722 3300049742 Ga0501080_0360483 Ga0501080_0360483_273_797 174
723 3300049743 Ga0501081_0000816 Ga0501081_0000816_3258_3785 174
724 3300049743 Ga0501081_0003078 Ga0501081_0003078_890_1414 174
725 3300049743 Ga0501081_0008477 Ga0501081_0008477_2766_3290 174
726 3300049743 Ga0501081_0012639 Ga0501081_0012639_78_602 174
727 3300049743 Ga0501081_0017401 Ga0501081_0017401_306_830 174
728 3300049743 Ga0501081_0034761 Ga0501081_0034761_1439_1966 174
729 3300049743 Ga0501081_0091688 Ga0501081_0091688_493_1017 174
730 3300049743 Ga0501081_0104979 Ga0501081_0104979_889_1413 174
731 3300049743 Ga0501081_0128041 Ga0501081_0128041_558_1082 174
732 3300049743 Ga0501081_0216605 Ga0501081_0216605_384_908 174
733 3300049743 Ga0501081_0311467 Ga0501081_0311467_609_1133 174
734 3300049743 Ga0501081_0426614 Ga0501081_0426614_306_899 174
735 3300049743 Ga0501081_0460685 Ga0501081_0460685_19_543 174
736 3300049744 Ga0501083_0059827 Ga0501083_0059827_1608_2132 174
737 3300049744 Ga0501083_0175673 Ga0501083_0175673_565_1089 174
738 3300049744 Ga0501083_0245353 Ga0501083_0245353_21_545 174
739 3300049744 Ga0501083_0696632 Ga0501083_0696632_28_552 174
740 3300049822 Ga0501035_0060869 Ga0501035_0060869_1042_1566 174
741 3300049822 Ga0501035_0182015 Ga0501035_0182015_783_1307 174
742 3300049822 Ga0501035_0317326 Ga0501035_0317326_54_578 174
743 3300049823 Ga0501044_0732140 Ga0501044_0732140_243_767 174
744 3300049824 Ga0501045_0003262 Ga0501045_0003262_8355_8879 174
745 3300049824 Ga0501045_0045545 Ga0501045_0045545_1622_2149 174
746 3300049824 Ga0501045_0047319 Ga0501045_0047319_1403_1927 174
747 3300049824 Ga0501045_0125013 Ga0501045_0125013_589_1113 174
748 3300049824 Ga0501045_0170260 Ga0501045_0170260_680_1204 174
749 3300049824 Ga0501045_0179722 Ga0501045_0179722_57_581 174
750 3300049824 Ga0501045_0188676 Ga0501045_0188676_16_540 174
751 3300049824 Ga0501045_0565338 Ga0501045_0565338_55_579 174
752 3300049824 Ga0501045_0675451 Ga0501045_0675451_216_740 174
753 3300049824 Ga0501045_0701805 Ga0501045_0701805_191_715 174
754 3300049824 Ga0501045_0711311 Ga0501045_0711311_17_541 174
755 3300050489 nmdc:mga03683_135440_c1 nmdc:mga03683_135440_c1_75_653 174
756 3300050490 nmdc:mga03n38_685743_c1 nmdc:mga03n38_685743_c1_31_576 174
757 3300050493 nmdc:mga0k408_240248_c1 nmdc:mga0k408_240248_c1_289_867 174
758 3300050507 nmdc:mga05p37_1381_c1 nmdc:mga05p37_1381_c1_14729_15253 174
759 3300050507 nmdc:mga05p37_138226_c1 nmdc:mga05p37_138226_c1_826_1350 174
760 3300050507 nmdc:mga05p37_173483_c1 nmdc:mga05p37_173483_c1_631_1155 174
761 3300050507 nmdc:mga05p37_20723_c1 nmdc:mga05p37_20723_c1_6037_6564 174
762 3300050507 nmdc:mga05p37_214272_c1 nmdc:mga05p37_214272_c1_472_996 174
763 3300050507 nmdc:mga05p37_2162_c1 nmdc:mga05p37_2162_c1_9164_9688 174
764 3300050507 nmdc:mga05p37_237487_c1 nmdc:mga05p37_237487_c1_252_779 174
765 3300050507 nmdc:mga05p37_245624_c1 nmdc:mga05p37_245624_c1_275_799 174
766 3300050507 nmdc:mga05p37_27267_c1 nmdc:mga05p37_27267_c1_4150_4674 174
767 3300050507 nmdc:mga05p37_27703_c1 nmdc:mga05p37_27703_c1_5970_6494 174
768 3300050507 nmdc:mga05p37_320066_c1 nmdc:mga05p37_320066_c1_1088_1612 174
769 3300050507 nmdc:mga05p37_366_c1 nmdc:mga05p37_366_c1_5436_5960 174
770 3300050507 nmdc:mga05p37_38713_c1 nmdc:mga05p37_38713_c1_219_743 174
771 3300050507 nmdc:mga05p37_40993_c1 nmdc:mga05p37_40993_c1_1559_2086 174
772 3300050507 nmdc:mga05p37_420_c1 nmdc:mga05p37_420_c1_9468_10019 174
773 3300050507 nmdc:mga05p37_455555_c1 nmdc:mga05p37_455555_c1_728_1279 174
774 3300050507 nmdc:mga05p37_456088_c1 nmdc:mga05p37_456088_c1_232_756 174
775 3300050507 nmdc:mga05p37_55220_c1 nmdc:mga05p37_55220_c1_2531_3055 174
776 3300050507 nmdc:mga05p37_763161_c1 nmdc:mga05p37_763161_c1_139_666 174
777 3300050508 nmdc:mga09592_142152_c1 nmdc:mga09592_142152_c1_189_713 174
778 3300050508 nmdc:mga09592_1725_c1 nmdc:mga09592_1725_c1_11968_12492 174
779 3300050508 nmdc:mga09592_27933_c1 nmdc:mga09592_27933_c1_1629_2153 174
780 3300050508 nmdc:mga09592_31228_c1 nmdc:mga09592_31228_c1_2814_3338 174
781 3300050508 nmdc:mga09592_43727_c1 nmdc:mga09592_43727_c1_539_1063 174
782 3300050508 nmdc:mga09592_56205_c1 nmdc:mga09592_56205_c1_337_861 174
783 3300050508 nmdc:mga09592_659_c2 nmdc:mga09592_659_c2_9603_10154 174
784 3300050509 nmdc:mga0qj67_226099_c1 nmdc:mga0qj67_226099_c1_983_1507 174
785 3300050509 nmdc:mga0qj67_240783_c1 nmdc:mga0qj67_240783_c1_519_1043 174
786 3300050509 nmdc:mga0qj67_29487_c1 nmdc:mga0qj67_29487_c1_2865_3389 174
787 3300050509 nmdc:mga0qj67_62907_c1 nmdc:mga0qj67_62907_c1_2001_2525 174
788 3300050509 nmdc:mga0qj67_79_c2 nmdc:mga0qj67_79_c2_9603_10154 174
789 3300050510 nmdc:mga06r32_224794_c1 nmdc:mga06r32_224794_c1_636_1160 174
790 3300050510 nmdc:mga06r32_29097_c1 nmdc:mga06r32_29097_c1_806_1330 174
791 3300050510 nmdc:mga06r32_393204_c1 nmdc:mga06r32_393204_c1_809_1333 174
792 3300050510 nmdc:mga06r32_4242_c1 nmdc:mga06r32_4242_c1_5415_5939 174
793 3300050510 nmdc:mga06r32_4674_c1 nmdc:mga06r32_4674_c1_5892_6416 174
794 3300050510 nmdc:mga06r32_839_c1 nmdc:mga06r32_839_c1_9489_10040 174
795 3300050510 nmdc:mga06r32_922928_c1 nmdc:mga06r32_922928_c1_96_620 174
796 3300050511 nmdc:mga08y16_243974_c1 nmdc:mga08y16_243974_c1_817_1344 174
797 3300050511 nmdc:mga08y16_655178_c1 nmdc:mga08y16_655178_c1_163_690 174
798 3300050512 nmdc:mga0n895_1198385_c1 nmdc:mga0n895_1198385_c1_67_594 174
799 3300050512 nmdc:mga0n895_1205366_c1 nmdc:mga0n895_1205366_c1_13_537 174
800 3300050512 nmdc:mga0n895_1328180_c1 nmdc:mga0n895_1328180_c1_136_660 174
801 3300050512 nmdc:mga0n895_21842_c1 nmdc:mga0n895_21842_c1_2766_3290 174
802 3300050512 nmdc:mga0n895_228569_c1 nmdc:mga0n895_228569_c1_1266_1793 174
803 3300050512 nmdc:mga0n895_237723_c1 nmdc:mga0n895_237723_c1_885_1412 174
804 3300050512 nmdc:mga0n895_351083_c1 nmdc:mga0n895_351083_c1_525_1049 174
805 3300050512 nmdc:mga0n895_515330_c1 nmdc:mga0n895_515330_c1_30_557 174
806 3300050512 nmdc:mga0n895_522286_c1 nmdc:mga0n895_522286_c1_55_582 174
807 3300050512 nmdc:mga0n895_72892_c1 nmdc:mga0n895_72892_c1_2367_2894 174
808 3300050513 nmdc:mga0rr50_1063_c1 nmdc:mga0rr50_1063_c1_1800_2324 174
809 3300050513 nmdc:mga0rr50_197052_c1 nmdc:mga0rr50_197052_c1_58_585 174
810 3300050513 nmdc:mga0rr50_52581_c1 nmdc:mga0rr50_52581_c1_1684_2211 174
811 3300050513 nmdc:mga0rr50_5896_c1 nmdc:mga0rr50_5896_c1_1927_2454 174
812 3300050513 nmdc:mga0rr50_777368_c1 nmdc:mga0rr50_777368_c1_170_697 174
813 3300050513 nmdc:mga0rr50_857269_c1 nmdc:mga0rr50_857269_c1_226_750 174
814 3300050514 nmdc:mga08x19_120485_c1 nmdc:mga08x19_120485_c1_462_986 174
815 3300050514 nmdc:mga08x19_19467_c1 nmdc:mga08x19_19467_c1_2718_3257 174
816 3300050514 nmdc:mga08x19_374743_c1 nmdc:mga08x19_374743_c1_430_954 174
817 3300050514 nmdc:mga08x19_90818_c1 nmdc:mga08x19_90818_c1_1265_1792 174
818 3300050514 nmdc:mga08x19_94959_c1 nmdc:mga08x19_94959_c1_471_995 174
819 3300050515 nmdc:mga0a205_10314_c2 nmdc:mga0a205_10314_c2_3282_3809 174
820 3300050515 nmdc:mga0a205_12191_c1 nmdc:mga0a205_12191_c1_5807_6331 174
821 3300050515 nmdc:mga0a205_141732_c1 nmdc:mga0a205_141732_c1_916_1443 174
822 3300050515 nmdc:mga0a205_420492_c1 nmdc:mga0a205_420492_c1_308_835 174
823 3300050515 nmdc:mga0a205_589033_c1 nmdc:mga0a205_589033_c1_122_646 174
824 3300050515 nmdc:mga0a205_6576_c1 nmdc:mga0a205_6576_c1_4801_5328 174
825 3300050515 nmdc:mga0a205_701672_c1 nmdc:mga0a205_701672_c1_175_699 174
826 3300050515 nmdc:mga0a205_73782_c1 nmdc:mga0a205_73782_c1_406_930 174
827 3300050515 nmdc:mga0a205_77799_c1 nmdc:mga0a205_77799_c1_2197_2721 174
828 3300050515 nmdc:mga0a205_83577_c1 nmdc:mga0a205_83577_c1_225_752 174
829 3300050515 nmdc:mga0a205_84896_c1 nmdc:mga0a205_84896_c1_2234_2758 174
830 3300050515 nmdc:mga0a205_86273_c1 nmdc:mga0a205_86273_c1_2070_2597 174
831 3300050516 nmdc:mga0sz30_215025_c1 nmdc:mga0sz30_215025_c1_155_733 174
832 3300054114 Ga0501084_0002983 Ga0501084_0002983_3257_3784 174
833 3300054114 Ga0501084_0004662 Ga0501084_0004662_10113_10637 174
834 3300054114 Ga0501084_0006404 Ga0501084_0006404_5588_6112 174
835 3300054114 Ga0501084_0009660 Ga0501084_0009660_5571_6095 174
836 3300054114 Ga0501084_0012861 Ga0501084_0012861_3037_3561 174
837 3300054114 Ga0501084_0046677 Ga0501084_0046677_1226_1753 174
838 3300054114 Ga0501084_0049668 Ga0501084_0049668_1552_2076 174
839 3300054114 Ga0501084_0122614 Ga0501084_0122614_53_577 174
840 3300054114 Ga0501084_0214330 Ga0501084_0214330_561_1085 174
841 3300054114 Ga0501084_0254007 Ga0501084_0254007_914_1438 174
842 3300054114 Ga0501084_0293122 Ga0501084_0293122_646_1170 174
843 3300054114 Ga0501084_0304971 Ga0501084_0304971_423_947 174
844 3300054114 Ga0501084_0310334 Ga0501084_0310334_613_1137 174
845 3300054114 Ga0501084_0769949 Ga0501084_0769949_67_636 174
846 3300060353 Ga0501082_0000775 Ga0501082_0000775_27348_27872 174
847 3300060353 Ga0501082_0004399 Ga0501082_0004399_3225_3749 174
848 3300060353 Ga0501082_0059506 Ga0501082_0059506_1832_2359 174
849 3300060353 Ga0501082_0087471 Ga0501082_0087471_65_589 174
850 3300060353 Ga0501082_0094782 Ga0501082_0094782_1845_2369 174
851 3300060353 Ga0501082_0100158 Ga0501082_0100158_1185_1709 174
852 3300060353 Ga0501082_0177594 Ga0501082_0177594_568_1095 174
853 3300060353 Ga0501082_0376127 Ga0501082_0376127_266_790 174
854 3300060353 Ga0501082_0589609 Ga0501082_0589609_194_721 174
855 3300060353 Ga0501082_0690329 Ga0501082_0690329_321_845 174
856 3300060353 Ga0501082_1148752 Ga0501082_1148752_84_608 174
857 3300061734 Ga0530510_0000017 Ga0530510_0000017_58014_58538 174
858 3300061734 Ga0530510_0000168 Ga0530510_0000168_23279_23803 174
859 3300061734 Ga0530510_0008103 Ga0530510_0008103_5725_6249 174
860 3300061734 Ga0530510_0017607 Ga0530510_0017607_4038_4562 174
861 3300061734 Ga0530510_0032920 Ga0530510_0032920_109_660 174
862 3300061734 Ga0530510_0039287 Ga0530510_0039287_837_1361 174
863 3300061734 Ga0530510_0066647 Ga0530510_0066647_1456_1980 174
864 3300061734 Ga0530510_0069200 Ga0530510_0069200_1552_2076 174
865 3300061734 Ga0530510_0269289 Ga0530510_0269289_218_742 174
866 3300061734 Ga0530510_0287721 Ga0530510_0287721_24_551 174
867 3300061734 Ga0530510_0510475 Ga0530510_0510475_281_805 174
868 3300061734 Ga0530510_0676018 Ga0530510_0676018_193_717 174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

6

170

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fse-assembly1.cif.gz_A crystal structure of a two-domain protein containing dj-1/thij/pfpi-like and ferritin-like domains (ava_4496) from anabaena variabilis atcc 29413 at 1.90 a resolution 0.9849 6 171
3fse-assembly1.cif.gz_B crystal structure of a two-domain protein containing dj-1/thij/pfpi-like and ferritin-like domains (ava_4496) from anabaena variabilis atcc 29413 at 1.90 a resolution 0.9846 6 171
3l18-assembly1.cif.gz_B ton1285, an intracellular protease from thermococcus onnurineus na1 0.9783 5 171
6q3t-assembly1.cif.gz_A structure of protease1 from pyrococcus horikoshii at room temperature in chipx microfluidic device 0.9768 7 171
7r66-assembly1.cif.gz_A structure of pfp1 protease from thermococcus thioreducens: large unit cell at 1.44 a resolution 0.9763 7 171
ID Description Score Start End Superfamily
3fseB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9764 6 171 3.40.50.880
1oi4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9731 6 171 3.40.50.880
4y1eA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9696 6 171 3.40.50.880
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.969 7 171 3.40.50.880
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9518 7 171 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2V6W9J2-F1-model_v4 DJ-1/PfpI domain-containing protein 0.9991 1 143
AF-A0A7V0Z3A3-F1-model_v4 Type 1 glutamine amidotransferase 0.9976 1 172 GO:0016740
AF-A0A7C5EMH0-F1-model_v4 Type 1 glutamine amidotransferase 0.9966 1 171 GO:0016740
AF-X1IU28-F1-model_v4 DJ-1/PfpI domain-containing protein 0.9965 70 173
AF-A0A2G4I534-F1-model_v4 DJ-1/PfpI domain-containing protein 0.9962 68 173

Feature Viewer

pLDDT pTM Quality
97.87 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map