F484104
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 868 | 421 | 1736 | 394 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221593|2643975462 |
| Length | 455 |
| Sequence | PTASLGPKPTSYWPLLLAATAMLMITMGIRQSQGLLIKPIGHSTGLGIAEISFALAIGQFVWGAVQPVFGALADQRGPGRVLVFGGVLLIAGMALTPLVSSQWGLIVTLGLLGAAGAGAGSFSILIGATAQRLPAEKRSMAAGVINAGGSMGQFVFAPLVQAVIAAAGWMAAMWTLAAAAVATLPLAWPLRRRAEIATASTTTPAAPPGIGLREQLRIALRDRSYWMLHVGFFTCGFHIAFLVTHLPGEIALCGLSDNVSAMALALIGLFNVAGSLAAGWLGQRYRMKHLLALMYASRAAMIAIYLISPPTPLTFYLFAAGLGVTWLATVPPTAGLVGKLFGPRYLGTLFGLTLLSHQIGGFFGAWLGGLAMAKFGDYTWMWYADIALALIAALANLPIREARPMRVSGLAAAXXXIRDSGFGIRESGIGNRESGIGGDGSMLGAGCRARNEPHP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 3 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 4 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 189 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 190 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 192 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 193 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 194 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 195 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 198 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 199 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 200 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 201 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 202 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 212 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 213 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 216 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 217 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 218 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 219 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 220 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 221 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 222 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 223 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 224 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 225 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 226 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 231 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 232 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 233 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 234 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 235 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 236 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 237 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 238 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 239 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 240 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 241 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 242 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 243 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 244 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 245 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 246 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 311 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 312 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 313 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 314 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 315 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 318 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 319 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 320 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 321 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 322 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 323 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 324 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 325 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 326 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 327 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 328 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 329 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 330 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 331 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 333 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 362 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 374 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 375 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 376 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 377 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 378 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 380 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 382 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 383 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 384 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 385 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 386 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 387 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 388 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 389 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 390 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 391 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 392 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 393 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 394 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 395 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 396 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 397 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 398 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 399 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 400 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 401 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 402 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 403 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 404 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 405 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 406 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 407 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 408 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 409 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 410 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 411 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 412 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 413 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 414 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 415 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 416 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 417 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 418 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 419 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 420 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 421 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.51 |
| Metatranscriptomes | 0 |
| Isolates | 4.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.06 |
| Nodule | 0.12 |
| Rhizoplane | 3.46 |
| Rhizosphere | 80.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1672945 | 2162886007 | Bacteria | 2348 |
| 2 | JGI25152J39213_1000142 | 3300002773 | Bacteria | 49042 |
| 3 | JGI25150J39212_1000204 | 3300002774 | Bacteria | 32292 |
| 4 | JGI25150J39212_1000776 | 3300002774 | Bacteria | 10987 |
| 5 | JGI25151J46595_10000237 | 3300003187 | Bacteria | 64983 |
| 6 | JGI25151J46595_10000530 | 3300003187 | Bacteria | 35539 |
| 7 | JGI25406J46586_10027080 | 3300003203 | Bacteria | 2203 |
| 8 | JGI25153J46596_10000171 | 3300003215 | Bacteria | 64983 |
| 9 | Ga0055525_1000001 | 3300003759 | Bacteria | 1016948 |
| 10 | Ga0055526_1000011 | 3300003771 | Bacteria | 236316 |
| 11 | Ga0055537_1000007 | 3300003773 | Bacteria | 144691 |
| 12 | Ga0055524_1000252 | 3300003775 | Bacteria | 55567 |
| 13 | Ga0055524_1009708 | 3300003775 | Bacteria | 3889 |
| 14 | Ga0055524_1016052 | 3300003775 | Bacteria | 2703 |
| 15 | Ga0055536_1002333 | 3300003781 | Bacteria | 10737 |
| 16 | Ga0055536_1004882 | 3300003781 | Bacteria | 6695 |
| 17 | Ga0055536_1006875 | 3300003781 | Bacteria | 5196 |
| 18 | Ga0055534_1000134 | 3300003784 | Bacteria | 55567 |
| 19 | Ga0055528_1000005 | 3300003790 | Bacteria | 236316 |
| 20 | Ga0055530_10003751 | 3300003791 | Bacteria | 8391 |
| 21 | Ga0055530_10003859 | 3300003791 | Bacteria | 8212 |
| 22 | Ga0055531_10003052 | 3300003794 | Bacteria | 10849 |
| 23 | Ga0055531_10004686 | 3300003794 | Bacteria | 8195 |
| 24 | Ga0055531_10005668 | 3300003794 | Bacteria | 7252 |
| 25 | Ga0055531_10006402 | 3300003794 | Bacteria | 6695 |
| 26 | Ga0055531_10007572 | 3300003794 | Bacteria | 5887 |
| 27 | Ga0055531_10024636 | 3300003794 | Bacteria | 2212 |
| 28 | Ga0058692_1000020 | 3300003856 | Bacteria | 250589 |
| 29 | Ga0065704_10072403 | 3300005289 | Bacteria | 8595 |
| 30 | Ga0065704_10075997 | 3300005289 | Bacteria | 5312 |
| 31 | Ga0065707_10082801 | 3300005295 | Bacteria | 12010 |
| 32 | Ga0070658_10088428 | 3300005327 | Bacteria | 2551 |
| 33 | Ga0070690_100000304 | 3300005330 | Bacteria | 25349 |
| 34 | Ga0070690_100004891 | 3300005330 | Bacteria | 7489 |
| 35 | Ga0070690_100008748 | 3300005330 | Bacteria | 5844 |
| 36 | Ga0070670_100051105 | 3300005331 | Bacteria | 3551 |
| 37 | Ga0070670_100053604 | 3300005331 | Bacteria | 3463 |
| 38 | Ga0068869_100001121 | 3300005334 | Bacteria | 15610 |
| 39 | Ga0068869_100002021 | 3300005334 | Bacteria | 12203 |
| 40 | Ga0068869_100008179 | 3300005334 | Bacteria | 6730 |
| 41 | Ga0068869_100171056 | 3300005334 | Bacteria | 1697 |
| 42 | Ga0068869_100193841 | 3300005334 | Bacteria | 1599 |
| 43 | Ga0070666_10206907 | 3300005335 | Bacteria | 1381 |
| 44 | Ga0070680_100000577 | 3300005336 | Bacteria | 25228 |
| 45 | Ga0070680_100136385 | 3300005336 | Bacteria | 2056 |
| 46 | Ga0070682_100007634 | 3300005337 | Bacteria | 6093 |
| 47 | Ga0068868_100001956 | 3300005338 | Bacteria | 14133 |
| 48 | Ga0068868_100190128 | 3300005338 | Bacteria | 1707 |
| 49 | Ga0070689_100000495 | 3300005340 | Bacteria | 23187 |
| 50 | Ga0070689_100004674 | 3300005340 | Bacteria | 9278 |
| 51 | Ga0070689_100195136 | 3300005340 | Bacteria | 1650 |
| 52 | Ga0070687_100000550 | 3300005343 | Bacteria | 12563 |
| 53 | Ga0070687_100011964 | 3300005343 | Bacteria | 3814 |
| 54 | Ga0070661_100000902 | 3300005344 | Bacteria | 21298 |
| 55 | Ga0070661_100042119 | 3300005344 | Bacteria | 3332 |
| 56 | Ga0070692_10000958 | 3300005345 | Bacteria | 9830 |
| 57 | Ga0070669_100011209 | 3300005353 | Bacteria | 6362 |
| 58 | Ga0070675_100025842 | 3300005354 | Bacteria | 4708 |
| 59 | Ga0070675_100295291 | 3300005354 | Bacteria | 1427 |
| 60 | Ga0070671_100006492 | 3300005355 | Bacteria | 9354 |
| 61 | Ga0070671_100022859 | 3300005355 | Bacteria | 5109 |
| 62 | Ga0070673_100013197 | 3300005364 | Bacteria | 5703 |
| 63 | Ga0070688_100022441 | 3300005365 | Bacteria | 3699 |
| 64 | Ga0070659_100012772 | 3300005366 | Bacteria | 6236 |
| 65 | Ga0070659_100289793 | 3300005366 | Bacteria | 1363 |
| 66 | Ga0070667_100046068 | 3300005367 | Bacteria | 3667 |
| 67 | Ga0070667_100214983 | 3300005367 | Bacteria | 1710 |
| 68 | Ga0070714_100009958 | 3300005435 | Bacteria | 7497 |
| 69 | Ga0070713_100161211 | 3300005436 | Bacteria | 2002 |
| 70 | Ga0070701_10002048 | 3300005438 | Bacteria | 7659 |
| 71 | Ga0070705_100001366 | 3300005440 | Bacteria | 13013 |
| 72 | Ga0070705_100124375 | 3300005440 | Bacteria | 1671 |
| 73 | Ga0070700_100009789 | 3300005441 | Bacteria | 5271 |
| 74 | Ga0070700_100019061 | 3300005441 | Bacteria | 3955 |
| 75 | Ga0070694_100003452 | 3300005444 | Bacteria | 9469 |
| 76 | Ga0070662_100004627 | 3300005457 | Bacteria | 8720 |
| 77 | Ga0070681_10005492 | 3300005458 | Bacteria | 12248 |
| 78 | Ga0068867_100005182 | 3300005459 | Bacteria | 9194 |
| 79 | Ga0068867_100006856 | 3300005459 | Bacteria | 8056 |
| 80 | Ga0068867_100017877 | 3300005459 | Bacteria | 5036 |
| 81 | Ga0068867_100066009 | 3300005459 | Unclassified | 2694 |
| 82 | Ga0070685_10030763 | 3300005466 | Bacteria | 2994 |
| 83 | Ga0070706_100030805 | 3300005467 | Bacteria | 4945 |
| 84 | Ga0070706_100085528 | 3300005467 | Bacteria | 2922 |
| 85 | Ga0070707_100024555 | 3300005468 | Bacteria | 5709 |
| 86 | Ga0068853_100005626 | 3300005539 | Bacteria | 9843 |
| 87 | Ga0068853_100017678 | 3300005539 | Bacteria | 5885 |
| 88 | Ga0068853_100033254 | 3300005539 | Bacteria | 4374 |
| 89 | Ga0068853_100035939 | 3300005539 | Bacteria | 4210 |
| 90 | Ga0068853_100100529 | 3300005539 | Bacteria | 2556 |
| 91 | Ga0070672_100131654 | 3300005543 | Unclassified | 2056 |
| 92 | Ga0070686_100000422 | 3300005544 | Bacteria | 26627 |
| 93 | Ga0070686_100000547 | 3300005544 | Bacteria | 22480 |
| 94 | Ga0070695_100000545 | 3300005545 | Bacteria | 19908 |
| 95 | Ga0070696_100004990 | 3300005546 | Bacteria | 8865 |
| 96 | Ga0070693_100000217 | 3300005547 | Bacteria | 26662 |
| 97 | Ga0070693_100008113 | 3300005547 | Bacteria | 5158 |
| 98 | Ga0070665_100014118 | 3300005548 | Bacteria | 8025 |
| 99 | Ga0070665_100287866 | 3300005548 | Bacteria | 1645 |
| 100 | Ga0070704_100001284 | 3300005549 | Bacteria | 13271 |
| 101 | Ga0068855_100010002 | 3300005563 | Bacteria | 11428 |
| 102 | Ga0068855_100028998 | 3300005563 | Bacteria | 6620 |
| 103 | Ga0068855_100157396 | 3300005563 | Bacteria | 2580 |
| 104 | Ga0068855_100159538 | 3300005563 | Bacteria | 2561 |
| 105 | Ga0068855_100302869 | 3300005563 | Bacteria | 1770 |
| 106 | Ga0070664_100001457 | 3300005564 | Bacteria | 18851 |
| 107 | Ga0070664_100070200 | 3300005564 | Bacteria | 2999 |
| 108 | Ga0070664_100178109 | 3300005564 | Bacteria | 1889 |
| 109 | Ga0068857_100006759 | 3300005577 | Bacteria | 9865 |
| 110 | Ga0068857_100014875 | 3300005577 | Bacteria | 6786 |
| 111 | Ga0068854_100073833 | 3300005578 | Bacteria | 2501 |
| 112 | Ga0068856_100028193 | 3300005614 | Bacteria | 5481 |
| 113 | Ga0068856_100241183 | 3300005614 | Bacteria | 1823 |
| 114 | Ga0070702_100000054 | 3300005615 | Bacteria | 32217 |
| 115 | Ga0068859_100010162 | 3300005617 | Bacteria | 9477 |
| 116 | Ga0068859_100044017 | 3300005617 | Bacteria | 4486 |
| 117 | Ga0068859_100119817 | 3300005617 | Unclassified | 2698 |
| 118 | Ga0068864_100001460 | 3300005618 | Bacteria | 19482 |
| 119 | Ga0068864_100113405 | 3300005618 | Unclassified | 2416 |
| 120 | Ga0068866_10006629 | 3300005718 | Bacteria | 4827 |
| 121 | Ga0068866_10012069 | 3300005718 | Bacteria | 3758 |
| 122 | Ga0068861_100000451 | 3300005719 | Bacteria | 23896 |
| 123 | Ga0068861_100003216 | 3300005719 | Bacteria | 10806 |
| 124 | Ga0068861_100004280 | 3300005719 | Bacteria | 9570 |
| 125 | Ga0068861_100012205 | 3300005719 | Bacteria | 5990 |
| 126 | Ga0068870_10003143 | 3300005840 | Bacteria | 6964 |
| 127 | Ga0068870_10053884 | 3300005840 | Unclassified | 2138 |
| 128 | Ga0068863_100000931 | 3300005841 | Bacteria | 29369 |
| 129 | Ga0068858_100001326 | 3300005842 | Bacteria | 25540 |
| 130 | Ga0068858_100008731 | 3300005842 | Bacteria | 9730 |
| 131 | Ga0068858_100024304 | 3300005842 | Bacteria | 5647 |
| 132 | Ga0068858_100116032 | 3300005842 | Bacteria | 2502 |
| 133 | Ga0068860_100104821 | 3300005843 | Bacteria | 2700 |
| 134 | Ga0068860_100121252 | 3300005843 | Bacteria | 2504 |
| 135 | Ga0068860_100231045 | 3300005843 | Bacteria | 1798 |
| 136 | Ga0068862_100000298 | 3300005844 | Bacteria | 54436 |
| 137 | Ga0068862_100001914 | 3300005844 | Bacteria | 18898 |
| 138 | Ga0068862_100063541 | 3300005844 | Bacteria | 3176 |
| 139 | Ga0081455_10002298 | 3300005937 | Bacteria | 22769 |
| 140 | Ga0081539_10006699 | 3300005985 | Bacteria | 10864 |
| 141 | Ga0070717_10014065 | 3300006028 | Bacteria | 6151 |
| 142 | Ga0075432_10016650 | 3300006058 | Bacteria | 2509 |
| 143 | Ga0070716_100042222 | 3300006173 | Bacteria | 2545 |
| 144 | Ga0070712_100086673 | 3300006175 | Bacteria | 2283 |
| 145 | Ga0075366_10035159 | 3300006195 | Bacteria | 2954 |
| 146 | Ga0097621_100000597 | 3300006237 | Bacteria | 25447 |
| 147 | Ga0097621_100001777 | 3300006237 | Bacteria | 14789 |
| 148 | Ga0097621_100014685 | 3300006237 | Bacteria | 5869 |
| 149 | Ga0068871_100000468 | 3300006358 | Bacteria | 27659 |
| 150 | Ga0068871_100051922 | 3300006358 | Bacteria | 3319 |
| 151 | Ga0068871_100278172 | 3300006358 | Bacteria | 1463 |
| 152 | Ga0075428_100001778 | 3300006844 | Bacteria | 23015 |
| 153 | Ga0075428_100002997 | 3300006844 | Bacteria | 18422 |
| 154 | Ga0075428_100004615 | 3300006844 | Bacteria | 15239 |
| 155 | Ga0075428_100026828 | 3300006844 | Bacteria | 6378 |
| 156 | Ga0075428_100035227 | 3300006844 | Bacteria | 5518 |
| 157 | Ga0075428_100107742 | 3300006844 | Bacteria | 3036 |
| 158 | Ga0075430_100010916 | 3300006846 | Bacteria | 7695 |
| 159 | Ga0075430_100020910 | 3300006846 | Bacteria | 5563 |
| 160 | Ga0075430_100055650 | 3300006846 | Bacteria | 3326 |
| 161 | Ga0075430_100143248 | 3300006846 | Bacteria | 1990 |
| 162 | Ga0075431_100000055 | 3300006847 | Bacteria | 62773 |
| 163 | Ga0075431_100041495 | 3300006847 | Bacteria | 4744 |
| 164 | Ga0075433_10312398 | 3300006852 | Bacteria | 1391 |
| 165 | Ga0075434_100000663 | 3300006871 | Bacteria | 26680 |
| 166 | Ga0075429_100001097 | 3300006880 | Bacteria | 21808 |
| 167 | Ga0075429_100002231 | 3300006880 | Bacteria | 16196 |
| 168 | Ga0075429_100010147 | 3300006880 | Bacteria | 8159 |
| 169 | Ga0075429_100088568 | 3300006880 | Bacteria | 2698 |
| 170 | Ga0068865_100002672 | 3300006881 | Bacteria | 10583 |
| 171 | Ga0068865_100003241 | 3300006881 | Bacteria | 9750 |
| 172 | Ga0075436_100004535 | 3300006914 | Bacteria | 9519 |
| 173 | Ga0075436_100013037 | 3300006914 | Bacteria | 5699 |
| 174 | Ga0097620_100010162 | 3300006931 | Bacteria | 9477 |
| 175 | Ga0097620_100044019 | 3300006931 | Bacteria | 4486 |
| 176 | Ga0097620_100119815 | 3300006931 | Unclassified | 2698 |
| 177 | Ga0075435_100011822 | 3300007076 | Bacteria | 6444 |
| 178 | Ga0105240_10092762 | 3300009093 | Bacteria | 3686 |
| 179 | Ga0111539_10000195 | 3300009094 | Bacteria | 71206 |
| 180 | Ga0111539_10001799 | 3300009094 | Bacteria | 28539 |
| 181 | Ga0111539_10008308 | 3300009094 | Bacteria | 13214 |
| 182 | Ga0111539_10010549 | 3300009094 | Bacteria | 11633 |
| 183 | Ga0111539_10027811 | 3300009094 | Bacteria | 6905 |
| 184 | Ga0111539_10103404 | 3300009094 | Bacteria | 3343 |
| 185 | Ga0105245_10001316 | 3300009098 | Bacteria | 22443 |
| 186 | Ga0105245_10410099 | 3300009098 | Bacteria | 1356 |
| 187 | Ga0114129_10003595 | 3300009147 | Bacteria | 21800 |
| 188 | Ga0114129_10005295 | 3300009147 | Bacteria | 18203 |
| 189 | Ga0114129_10008084 | 3300009147 | Bacteria | 14988 |
| 190 | Ga0114129_10023893 | 3300009147 | Bacteria | 8662 |
| 191 | Ga0114129_10131625 | 3300009147 | Bacteria | 3435 |
| 192 | Ga0114129_10135271 | 3300009147 | Unclassified | 3382 |
| 193 | Ga0105243_10006259 | 3300009148 | Bacteria | 9194 |
| 194 | Ga0105243_10009756 | 3300009148 | Bacteria | 7307 |
| 195 | Ga0105241_10004480 | 3300009174 | Bacteria | 10328 |
| 196 | Ga0105241_10039779 | 3300009174 | Bacteria | 3548 |
| 197 | Ga0105241_10096754 | 3300009174 | Bacteria | 2339 |
| 198 | Ga0105242_10006575 | 3300009176 | Bacteria | 8952 |
| 199 | Ga0105242_10010463 | 3300009176 | Bacteria | 7119 |
| 200 | Ga0105242_10033774 | 3300009176 | Bacteria | 4099 |
| 201 | Ga0105248_10006517 | 3300009177 | Bacteria | 12798 |
| 202 | Ga0105248_10120679 | 3300009177 | Bacteria | 2958 |
| 203 | Ga0105248_10241757 | 3300009177 | Bacteria | 2032 |
| 204 | Ga0105237_10008329 | 3300009545 | Bacteria | 11250 |
| 205 | Ga0105237_10245588 | 3300009545 | Bacteria | 1792 |
| 206 | Ga0105238_10001013 | 3300009551 | Bacteria | 28671 |
| 207 | Ga0105238_10090531 | 3300009551 | Bacteria | 3046 |
| 208 | Ga0105238_10286608 | 3300009551 | Bacteria | 1629 |
| 209 | Ga0105249_10015181 | 3300009553 | Bacteria | 6816 |
| 210 | Ga0105249_10031801 | 3300009553 | Bacteria | 4774 |
| 211 | Ga0105249_10062625 | 3300009553 | Bacteria | 3416 |
| 212 | Ga0105239_10049990 | 3300010375 | Bacteria | 4585 |
| 213 | Ga0105239_10163868 | 3300010375 | Bacteria | 2485 |
| 214 | Ga0105239_10474150 | 3300010375 | Bacteria | 1421 |
| 215 | Ga0157371_10000001 | 3300013102 | Bacteria | 1162285 |
| 216 | Ga0157369_10001365 | 3300013105 | Bacteria | 30097 |
| 217 | Ga0157369_10058667 | 3300013105 | Bacteria | 4151 |
| 218 | Ga0157374_10172211 | 3300013296 | Bacteria | 2112 |
| 219 | Ga0157378_10018590 | 3300013297 | Bacteria | 6110 |
| 220 | Ga0157378_10024328 | 3300013297 | Bacteria | 5326 |
| 221 | Ga0157378_10048035 | 3300013297 | Bacteria | 3795 |
| 222 | Ga0157378_10087372 | 3300013297 | Bacteria | 2828 |
| 223 | Ga0163162_10069963 | 3300013306 | Bacteria | 3561 |
| 224 | Ga0163162_10211135 | 3300013306 | Unclassified | 2071 |
| 225 | Ga0163162_10282648 | 3300013306 | Bacteria | 1791 |
| 226 | Ga0157372_10001111 | 3300013307 | Bacteria | 29223 |
| 227 | Ga0157375_10061558 | 3300013308 | Unclassified | 3727 |
| 228 | Ga0163163_10002436 | 3300014325 | Bacteria | 15739 |
| 229 | Ga0163163_10038360 | 3300014325 | Bacteria | 4669 |
| 230 | Ga0157380_10006169 | 3300014326 | Bacteria | 8408 |
| 231 | Ga0157377_10000910 | 3300014745 | Bacteria | 12344 |
| 232 | Ga0157379_10048974 | 3300014968 | Bacteria | 3772 |
| 233 | Ga0157376_10004528 | 3300014969 | Bacteria | 9685 |
| 234 | Ga0182006_1045299 | 3300015261 | Bacteria | 1712 |
| 235 | Ga0182005_1002026 | 3300015265 | Bacteria | 7603 |
| 236 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 237 | Ga0163161_10005636 | 3300017792 | Bacteria | 8684 |
| 238 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 239 | Ga0207425_1000079 | 3300025245 | Bacteria | 101495 |
| 240 | Ga0209677_102546 | 3300025253 | Bacteria | 6732 |
| 241 | Ga0209129_1000087 | 3300025258 | Bacteria | 179582 |
| 242 | Ga0209565_1000005 | 3300025263 | Bacteria | 947317 |
| 243 | Ga0209565_1003659 | 3300025263 | Bacteria | 4891 |
| 244 | Ga0209673_1000011 | 3300025273 | Bacteria | 586604 |
| 245 | Ga0209675_1000004 | 3300025291 | Bacteria | 947166 |
| 246 | Ga0209676_1000156 | 3300025292 | Bacteria | 163255 |
| 247 | Ga0209676_1000203 | 3300025292 | Bacteria | 132949 |
| 248 | Ga0209676_1000609 | 3300025292 | Bacteria | 52392 |
| 249 | Ga0209676_1003754 | 3300025292 | Bacteria | 9017 |
| 250 | Ga0209676_1004542 | 3300025292 | Bacteria | 7693 |
| 251 | Ga0209676_1005536 | 3300025292 | Bacteria | 6549 |
| 252 | Ga0209676_1006844 | 3300025292 | Bacteria | 5525 |
| 253 | Ga0209676_1006998 | 3300025292 | Bacteria | 5419 |
| 254 | Ga0209025_1000013 | 3300025294 | Bacteria | 871757 |
| 255 | Ga0209025_1000036 | 3300025294 | Bacteria | 404113 |
| 256 | Ga0209025_1002886 | 3300025294 | Bacteria | 17213 |
| 257 | Ga0209025_1017088 | 3300025294 | Bacteria | 4220 |
| 258 | Ga0209025_1030122 | 3300025294 | Bacteria | 2605 |
| 259 | Ga0209564_1000018 | 3300025295 | Bacteria | 586913 |
| 260 | Ga0209564_1010973 | 3300025295 | Bacteria | 4112 |
| 261 | Ga0209564_1014819 | 3300025295 | Bacteria | 3214 |
| 262 | Ga0209758_1000014 | 3300025297 | Bacteria | 871757 |
| 263 | Ga0209050_1000847 | 3300025298 | Bacteria | 41758 |
| 264 | Ga0209256_1000021 | 3300025299 | Bacteria | 537097 |
| 265 | Ga0209256_1001858 | 3300025299 | Bacteria | 19531 |
| 266 | Ga0209256_1002522 | 3300025299 | Bacteria | 14708 |
| 267 | Ga0209256_1012686 | 3300025299 | Bacteria | 3194 |
| 268 | Ga0209257_1000204 | 3300025304 | Bacteria | 143800 |
| 269 | Ga0209257_1000278 | 3300025304 | Bacteria | 114707 |
| 270 | Ga0209257_1000298 | 3300025304 | Bacteria | 109259 |
| 271 | Ga0209257_1000560 | 3300025304 | Bacteria | 63396 |
| 272 | Ga0209257_1001509 | 3300025304 | Bacteria | 27348 |
| 273 | Ga0209257_1002023 | 3300025304 | Bacteria | 21654 |
| 274 | Ga0209257_1009232 | 3300025304 | Bacteria | 5346 |
| 275 | Ga0209257_1013026 | 3300025304 | Bacteria | 3753 |
| 276 | Ga0207699_10097921 | 3300025906 | Bacteria | 1854 |
| 277 | Ga0207645_10053878 | 3300025907 | Bacteria | 2569 |
| 278 | Ga0207643_10007055 | 3300025908 | Bacteria | 6020 |
| 279 | Ga0207643_10008392 | 3300025908 | Bacteria | 5540 |
| 280 | Ga0207643_10040665 | 3300025908 | Bacteria | 2618 |
| 281 | Ga0207705_10064544 | 3300025909 | Bacteria | 2646 |
| 282 | Ga0207654_10020774 | 3300025911 | Bacteria | 3486 |
| 283 | Ga0207654_10023382 | 3300025911 | Bacteria | 3310 |
| 284 | Ga0207707_10122355 | 3300025912 | Bacteria | 2275 |
| 285 | Ga0207695_10086458 | 3300025913 | Bacteria | 3162 |
| 286 | Ga0207660_10111642 | 3300025917 | Bacteria | 2058 |
| 287 | Ga0207662_10000065 | 3300025918 | Bacteria | 46256 |
| 288 | Ga0207662_10017035 | 3300025918 | Bacteria | 4105 |
| 289 | Ga0207657_10022867 | 3300025919 | Bacteria | 5835 |
| 290 | Ga0207657_10059339 | 3300025919 | Bacteria | 3288 |
| 291 | Ga0207652_10007811 | 3300025921 | Bacteria | 8591 |
| 292 | Ga0207652_10310392 | 3300025921 | Bacteria | 1424 |
| 293 | Ga0207646_10176877 | 3300025922 | Bacteria | 1927 |
| 294 | Ga0207681_10020732 | 3300025923 | Bacteria | 4170 |
| 295 | Ga0207681_10122430 | 3300025923 | Bacteria | 1910 |
| 296 | Ga0207694_10056163 | 3300025924 | Bacteria | 3058 |
| 297 | Ga0207650_10055634 | 3300025925 | Bacteria | 2937 |
| 298 | Ga0207687_10006825 | 3300025927 | Bacteria | 7520 |
| 299 | Ga0207687_10012880 | 3300025927 | Bacteria | 5467 |
| 300 | Ga0207700_10068908 | 3300025928 | Bacteria | 2713 |
| 301 | Ga0207700_10233810 | 3300025928 | Bacteria | 1564 |
| 302 | Ga0207664_10008044 | 3300025929 | Bacteria | 7331 |
| 303 | Ga0207664_10087880 | 3300025929 | Bacteria | 2542 |
| 304 | Ga0207644_10012180 | 3300025931 | Bacteria | 5708 |
| 305 | Ga0207644_10242524 | 3300025931 | Bacteria | 1435 |
| 306 | Ga0207690_10023150 | 3300025932 | Bacteria | 3874 |
| 307 | Ga0207706_10009902 | 3300025933 | Bacteria | 8740 |
| 308 | Ga0207686_10004486 | 3300025934 | Bacteria | 7477 |
| 309 | Ga0207686_10014581 | 3300025934 | Bacteria | 4379 |
| 310 | Ga0207686_10015596 | 3300025934 | Bacteria | 4251 |
| 311 | Ga0207686_10020225 | 3300025934 | Bacteria | 3799 |
| 312 | Ga0207709_10014765 | 3300025935 | Bacteria | 4318 |
| 313 | Ga0207709_10024250 | 3300025935 | Bacteria | 3462 |
| 314 | Ga0207670_10003608 | 3300025936 | Bacteria | 8208 |
| 315 | Ga0207670_10022483 | 3300025936 | Bacteria | 3909 |
| 316 | Ga0207670_10159522 | 3300025936 | Bacteria | 1682 |
| 317 | Ga0207669_10104456 | 3300025937 | Bacteria | 1882 |
| 318 | Ga0207704_10004634 | 3300025938 | Bacteria | 6303 |
| 319 | Ga0207704_10017058 | 3300025938 | Bacteria | 3752 |
| 320 | Ga0207691_10031193 | 3300025940 | Unclassified | 4976 |
| 321 | Ga0207711_10047023 | 3300025941 | Bacteria | 3688 |
| 322 | Ga0207689_10000438 | 3300025942 | Bacteria | 39053 |
| 323 | Ga0207689_10001253 | 3300025942 | Bacteria | 24466 |
| 324 | Ga0207689_10008058 | 3300025942 | Bacteria | 9195 |
| 325 | Ga0207689_10012172 | 3300025942 | Bacteria | 7363 |
| 326 | Ga0207661_10121443 | 3300025944 | Bacteria | 2225 |
| 327 | Ga0207679_10000868 | 3300025945 | Bacteria | 19329 |
| 328 | Ga0207679_10175012 | 3300025945 | Bacteria | 1771 |
| 329 | Ga0207667_10030247 | 3300025949 | Bacteria | 5861 |
| 330 | Ga0207667_10031724 | 3300025949 | Bacteria | 5702 |
| 331 | Ga0207667_10043635 | 3300025949 | Bacteria | 4758 |
| 332 | Ga0207667_10075259 | 3300025949 | Bacteria | 3506 |
| 333 | Ga0207667_10201151 | 3300025949 | Bacteria | 2044 |
| 334 | Ga0207667_10215268 | 3300025949 | Bacteria | 1969 |
| 335 | Ga0207651_10105716 | 3300025960 | Bacteria | 2100 |
| 336 | Ga0207712_10015142 | 3300025961 | Bacteria | 4970 |
| 337 | Ga0207712_10019015 | 3300025961 | Bacteria | 4481 |
| 338 | Ga0207712_10036715 | 3300025961 | Bacteria | 3339 |
| 339 | Ga0207668_10039451 | 3300025972 | Bacteria | 3179 |
| 340 | Ga0207640_10075069 | 3300025981 | Bacteria | 2290 |
| 341 | Ga0207658_10060125 | 3300025986 | Bacteria | 2834 |
| 342 | Ga0207658_10115960 | 3300025986 | Bacteria | 2127 |
| 343 | Ga0207677_10031620 | 3300026023 | Bacteria | 3391 |
| 344 | Ga0207677_10164122 | 3300026023 | Bacteria | 1729 |
| 345 | Ga0207703_10009529 | 3300026035 | Bacteria | 7620 |
| 346 | Ga0207703_10014337 | 3300026035 | Bacteria | 6182 |
| 347 | Ga0207703_10031893 | 3300026035 | Bacteria | 4169 |
| 348 | Ga0207639_10082438 | 3300026041 | Bacteria | 2550 |
| 349 | Ga0207639_10103793 | 3300026041 | Bacteria | 2304 |
| 350 | Ga0207639_10129614 | 3300026041 | Bacteria | 2086 |
| 351 | Ga0207639_10144482 | 3300026041 | Bacteria | 1986 |
| 352 | Ga0207708_10001339 | 3300026075 | Bacteria | 18550 |
| 353 | Ga0207708_10002598 | 3300026075 | Bacteria | 13291 |
| 354 | Ga0207708_10007127 | 3300026075 | Bacteria | 8262 |
| 355 | Ga0207708_10029108 | 3300026075 | Bacteria | 4184 |
| 356 | Ga0207708_10066637 | 3300026075 | Unclassified | 2753 |
| 357 | Ga0207702_10022350 | 3300026078 | Bacteria | 5243 |
| 358 | Ga0207702_10072693 | 3300026078 | Bacteria | 2965 |
| 359 | Ga0207641_10007484 | 3300026088 | Bacteria | 9088 |
| 360 | Ga0207648_10000210 | 3300026089 | Bacteria | 62827 |
| 361 | Ga0207648_10010754 | 3300026089 | Bacteria | 8647 |
| 362 | Ga0207648_10020796 | 3300026089 | Bacteria | 5907 |
| 363 | Ga0207648_10022023 | 3300026089 | Bacteria | 5724 |
| 364 | Ga0207676_10009255 | 3300026095 | Bacteria | 7007 |
| 365 | Ga0207676_10191479 | 3300026095 | Bacteria | 1800 |
| 366 | Ga0207674_10006930 | 3300026116 | Bacteria | 13276 |
| 367 | Ga0207674_10049876 | 3300026116 | Bacteria | 4278 |
| 368 | Ga0207675_100000473 | 3300026118 | Bacteria | 39053 |
| 369 | Ga0207675_100001723 | 3300026118 | Bacteria | 21906 |
| 370 | Ga0207675_100006339 | 3300026118 | Bacteria | 11215 |
| 371 | Ga0207675_100007508 | 3300026118 | Bacteria | 10300 |
| 372 | Ga0207675_100033212 | 3300026118 | Bacteria | 4808 |
| 373 | Ga0207675_100104177 | 3300026118 | Bacteria | 2674 |
| 374 | Ga0207683_10021613 | 3300026121 | Bacteria | 5514 |
| 375 | Ga0207698_10251199 | 3300026142 | Bacteria | 1618 |
| 376 | Ga0209371_1000011 | 3300027312 | Bacteria | 848456 |
| 377 | Ga0207428_10002394 | 3300027907 | Bacteria | 18742 |
| 378 | Ga0207428_10002532 | 3300027907 | Bacteria | 18239 |
| 379 | Ga0207428_10006537 | 3300027907 | Bacteria | 10750 |
| 380 | Ga0207428_10011963 | 3300027907 | Bacteria | 7638 |
| 381 | Ga0207428_10031760 | 3300027907 | Bacteria | 4352 |
| 382 | Ga0268266_10204645 | 3300028379 | Bacteria | 1808 |
| 383 | Ga0268266_10233216 | 3300028379 | Bacteria | 1696 |
| 384 | Ga0268265_10000660 | 3300028380 | Bacteria | 34200 |
| 385 | Ga0268265_10002301 | 3300028380 | Bacteria | 14543 |
| 386 | Ga0268265_10145138 | 3300028380 | Bacteria | 1993 |
| 387 | Ga0268264_10001208 | 3300028381 | Bacteria | 24876 |
| 388 | Ga0268264_10044636 | 3300028381 | Bacteria | 3677 |
| 389 | Ga0268264_10079305 | 3300028381 | Bacteria | 2801 |
| 390 | Ga0307517_10055704 | 3300028786 | Bacteria | 3876 |
| 391 | Ga0268256_1000011 | 3300030500 | Bacteria | 848625 |
| 392 | Ga0265332_10000069 | 3300031238 | Bacteria | 88113 |
| 393 | Ga0265332_10000621 | 3300031238 | Bacteria | 23112 |
| 394 | Ga0307513_10023088 | 3300031456 | Bacteria | 7280 |
| 395 | Ga0307509_10000018 | 3300031507 | Bacteria | 258998 |
| 396 | Ga0307408_100025705 | 3300031548 | Bacteria | 4035 |
| 397 | Ga0307408_100032572 | 3300031548 | Bacteria | 3635 |
| 398 | Ga0307408_100235001 | 3300031548 | Bacteria | 1503 |
| 399 | Ga0307516_10000386 | 3300031730 | Bacteria | 57562 |
| 400 | Ga0307405_10113600 | 3300031731 | Bacteria | 1839 |
| 401 | Ga0307406_10006187 | 3300031901 | Bacteria | 6587 |
| 402 | Ga0307406_10091313 | 3300031901 | Bacteria | 2051 |
| 403 | Ga0307412_10160809 | 3300031911 | Bacteria | 1668 |
| 404 | Ga0307416_100087570 | 3300032002 | Bacteria | 2659 |
| 405 | Ga0307416_100162015 | 3300032002 | Bacteria | 2069 |
| 406 | Ga0307414_10001391 | 3300032004 | Bacteria | 12530 |
| 407 | Ga0307414_10006012 | 3300032004 | Bacteria | 6730 |
| 408 | Ga0307414_10084205 | 3300032004 | Bacteria | 2338 |
| 409 | Ga0307414_10114634 | 3300032004 | Bacteria | 2059 |
| 410 | Ga0307415_100100841 | 3300032126 | Bacteria | 2117 |
| 411 | Ga0307415_100303440 | 3300032126 | Bacteria | 1324 |
| 412 | Ga0373930_0009534 | 3300034816 | Bacteria | 1719 |
| 413 | Ga0373944_0006240 | 3300035089 | Bacteria | 3161 |
| 414 | Ga0373944_0008043 | 3300035089 | Bacteria | 2844 |
| 415 | Ga0373951_0004172 | 3300035091 | Bacteria | 3450 |
| 416 | Ga0373936_0012991 | 3300035113 | Bacteria | 3175 |
| 417 | Ga0373936_0017154 | 3300035113 | Bacteria | 2786 |
| 418 | Ga0373941_0011718 | 3300035115 | Bacteria | 2273 |
| 419 | Ga0373954_0119238 | 3300035118 | Bacteria | 1280 |
| 420 | Ga0373943_0035841 | 3300035170 | Bacteria | 2373 |
| 421 | Ga0373946_0010135 | 3300035171 | Bacteria | 3485 |
| 422 | Ga0373924_0025154 | 3300035410 | Bacteria | 2352 |
| 423 | Ga0373931_0002144 | 3300035691 | Bacteria | 8690 |
| 424 | Ga0373931_0019321 | 3300035691 | Bacteria | 3400 |
| 425 | Ga0373931_0028292 | 3300035691 | Bacteria | 2868 |
| 426 | Ga0373931_0078431 | 3300035691 | Bacteria | 1817 |
| 427 | Ga0373927_0025191 | 3300035695 | Bacteria | 3889 |
| 428 | Ga0373927_0111029 | 3300035695 | Bacteria | 1786 |
| 429 | Ga0373947_0024346 | 3300035725 | Bacteria | 3527 |
| 430 | Ga0373947_0082933 | 3300035725 | Bacteria | 1987 |
| 431 | Ga0373937_0049066 | 3300036401 | Bacteria | 3866 |
| 432 | Ga0373937_0063534 | 3300036401 | Bacteria | 3396 |
| 433 | Ga0373937_0246309 | 3300036401 | Bacteria | 1684 |
| 434 | Ga0373925_0014689 | 3300037068 | Bacteria | 5656 |
| 435 | Ga0373925_0046526 | 3300037068 | Bacteria | 3226 |
| 436 | Ga0395899_0010581 | 3300037312 | Bacteria | 7070 |
| 437 | Ga0395899_0030172 | 3300037312 | Bacteria | 4078 |
| 438 | Ga0395900_0119979 | 3300037418 | Bacteria | 2698 |
| 439 | Ga0395900_0147671 | 3300037418 | Bacteria | 2403 |
| 440 | Ga0395900_0271731 | 3300037418 | Bacteria | 1689 |
| 441 | Ga0395898_0248791 | 3300037466 | Bacteria | 1695 |
| 442 | Ga0395905_0000760 | 3300037471 | Bacteria | 42467 |
| 443 | Ga0395905_0033313 | 3300037471 | Bacteria | 4841 |
| 444 | Ga0395905_0037797 | 3300037471 | Bacteria | 4531 |
| 445 | Ga0395905_0080591 | 3300037471 | Bacteria | 3050 |
| 446 | Ga0395905_0140442 | 3300037471 | Bacteria | 2272 |
| 447 | Ga0395905_0244814 | 3300037471 | Bacteria | 1675 |
| 448 | Ga0395901_0002258 | 3300038443 | Bacteria | 19672 |
| 449 | Ga0395901_0011885 | 3300038443 | Bacteria | 8830 |
| 450 | Ga0237819_00457 | 3300038705 | Bacteria | 13925 |
| 451 | Ga0237816_00019 | 3300039145 | Bacteria | 9443 |
| 452 | Ga0436360_0453682 | 3300039438 | Bacteria | 9051 |
| 453 | Ga0439436_0006667 | 3300041404 | Bacteria | 3548 |
| 454 | Ga0439439_0000762 | 3300041406 | Bacteria | 5802 |
| 455 | Ga0439465_0000341 | 3300041413 | Bacteria | 13349 |
| 456 | Ga0439465_0001011 | 3300041413 | Bacteria | 8944 |
| 457 | Ga0439465_0015568 | 3300041413 | Bacteria | 2373 |
| 458 | Ga0451795_0730108 | 3300041456 | Bacteria | 2279 |
| 459 | Ga0451798_0102601 | 3300041458 | Bacteria | 1778 |
| 460 | Ga0451802_1477178 | 3300041460 | Bacteria | 2330 |
| 461 | Ga0451807_0329075 | 3300041486 | Bacteria | 4529 |
| 462 | Ga0451807_0460780 | 3300041486 | Bacteria | 3912 |
| 463 | Ga0451807_1430651 | 3300041486 | Bacteria | 2415 |
| 464 | Ga0439431_0005416 | 3300041997 | Bacteria | 2818 |
| 465 | Ga0439445_0000418 | 3300042004 | Bacteria | 8547 |
| 466 | Ga0439445_0008016 | 3300042004 | Bacteria | 2464 |
| 467 | Ga0439448_0001012 | 3300042005 | Bacteria | 7019 |
| 468 | Ga0439449_0000054 | 3300042007 | Bacteria | 34695 |
| 469 | Ga0450904_000561 | 3300042139 | Bacteria | 7005 |
| 470 | Ga0451577_0002661 | 3300042876 | Bacteria | 20878 |
| 471 | Ga0451577_0005688 | 3300042876 | Bacteria | 12649 |
| 472 | Ga0451577_0047571 | 3300042876 | Bacteria | 3835 |
| 473 | Ga0451577_0152483 | 3300042876 | Bacteria | 2079 |
| 474 | Ga0466972_0001868 | 3300044658 | Bacteria | 10322 |
| 475 | Ga0453683_0160379 | 3300044673 | Unclassified | 1423 |
| 476 | Ga0466965_0001068 | 3300044683 | Bacteria | 10641 |
| 477 | Ga0466966_0002614 | 3300044684 | Bacteria | 11807 |
| 478 | Ga0466966_0059519 | 3300044684 | Bacteria | 2412 |
| 479 | Ga0466966_0061420 | 3300044684 | Bacteria | 2370 |
| 480 | Ga0466961_0069181 | 3300044693 | Bacteria | 2241 |
| 481 | Ga0466964_0000439 | 3300044706 | Bacteria | 12668 |
| 482 | Ga0466968_0001260 | 3300044735 | Bacteria | 9011 |
| 483 | Ga0466959_0017154 | 3300045049 | Bacteria | 5303 |
| 484 | Ga0451576_0000675 | 3300045051 | Bacteria | 69506 |
| 485 | Ga0451576_0002092 | 3300045051 | Bacteria | 31120 |
| 486 | Ga0451576_0006176 | 3300045051 | Bacteria | 14752 |
| 487 | Ga0451576_0090949 | 3300045051 | Bacteria | 3174 |
| 488 | Ga0451576_0105681 | 3300045051 | Bacteria | 2929 |
| 489 | Ga0451576_0238812 | 3300045051 | Bacteria | 1898 |
| 490 | Ga0451576_0312658 | 3300045051 | Bacteria | 1643 |
| 491 | Ga0466967_0339935 | 3300045976 | Bacteria | 1451 |
| 492 | Ga0495617_000940 | 3300046452 | Bacteria | 13541 |
| 493 | Ga0495627_008987 | 3300046453 | Bacteria | 3694 |
| 494 | Ga0495592_0176358 | 3300046454 | Bacteria | 1459 |
| 495 | Ga0495603_0100907 | 3300046455 | Bacteria | 1684 |
| 496 | Ga0495590_0024555 | 3300046457 | Bacteria | 2124 |
| 497 | Ga0495591_027772 | 3300046458 | Bacteria | 1740 |
| 498 | Ga0495629_0041452 | 3300046459 | Bacteria | 3239 |
| 499 | Ga0495638_0001975 | 3300046460 | Bacteria | 17522 |
| 500 | Ga0495638_0066413 | 3300046460 | Bacteria | 2217 |
| 501 | Ga0495650_0000048 | 3300046471 | Bacteria | 334427 |
| 502 | Ga0495650_0000292 | 3300046471 | Bacteria | 92418 |
| 503 | Ga0495650_0011282 | 3300046471 | Bacteria | 4907 |
| 504 | Ga0495605_0000652 | 3300046474 | Bacteria | 26506 |
| 505 | Ga0495605_0010723 | 3300046474 | Bacteria | 5122 |
| 506 | Ga0495605_0048675 | 3300046474 | Bacteria | 2074 |
| 507 | Ga0495584_0000006 | 3300046491 | Bacteria | 301775 |
| 508 | Ga0495584_0000495 | 3300046491 | Bacteria | 27066 |
| 509 | Ga0495584_0002112 | 3300046491 | Bacteria | 11381 |
| 510 | Ga0495584_0024537 | 3300046491 | Bacteria | 3058 |
| 511 | Ga0495584_0045621 | 3300046491 | Bacteria | 2211 |
| 512 | Ga0495585_0000061 | 3300046492 | Bacteria | 110727 |
| 513 | Ga0495585_0000207 | 3300046492 | Bacteria | 61587 |
| 514 | Ga0495585_0000265 | 3300046492 | Bacteria | 52393 |
| 515 | Ga0495585_0000972 | 3300046492 | Bacteria | 24063 |
| 516 | Ga0495585_0036102 | 3300046492 | Bacteria | 2790 |
| 517 | Ga0495594_0002393 | 3300046499 | Bacteria | 9768 |
| 518 | Ga0495594_0051460 | 3300046499 | Bacteria | 2266 |
| 519 | Ga0495594_0119125 | 3300046499 | Bacteria | 1491 |
| 520 | Ga0495596_0001025 | 3300046500 | Bacteria | 16597 |
| 521 | Ga0495596_0001109 | 3300046500 | Bacteria | 15950 |
| 522 | Ga0495596_0004521 | 3300046500 | Bacteria | 6763 |
| 523 | Ga0495607_0002364 | 3300046501 | Bacteria | 15407 |
| 524 | Ga0495607_0004272 | 3300046501 | Bacteria | 10573 |
| 525 | Ga0495607_0005188 | 3300046501 | Bacteria | 9391 |
| 526 | Ga0495607_0005552 | 3300046501 | Bacteria | 8994 |
| 527 | Ga0495607_0032942 | 3300046501 | Bacteria | 3156 |
| 528 | Ga0495583_0000941 | 3300046506 | Bacteria | 33886 |
| 529 | Ga0495583_0001016 | 3300046506 | Bacteria | 32027 |
| 530 | Ga0495583_0009279 | 3300046506 | Bacteria | 5894 |
| 531 | Ga0495583_0011121 | 3300046506 | Bacteria | 5186 |
| 532 | Ga0495583_0015704 | 3300046506 | Bacteria | 4103 |
| 533 | Ga0495606_0004606 | 3300046507 | Bacteria | 13660 |
| 534 | Ga0495606_0009601 | 3300046507 | Bacteria | 8155 |
| 535 | Ga0495606_0023823 | 3300046507 | Bacteria | 4426 |
| 536 | Ga0495606_0104058 | 3300046507 | Bacteria | 1723 |
| 537 | Ga0495606_0130137 | 3300046507 | Bacteria | 1497 |
| 538 | Ga0495610_0008048 | 3300046512 | Bacteria | 6898 |
| 539 | Ga0495616_0000097 | 3300046513 | Bacteria | 74443 |
| 540 | Ga0495616_0000827 | 3300046513 | Bacteria | 22588 |
| 541 | Ga0495616_0004577 | 3300046513 | Bacteria | 8702 |
| 542 | Ga0495616_0015904 | 3300046513 | Bacteria | 4171 |
| 543 | Ga0495616_0023743 | 3300046513 | Bacteria | 3296 |
| 544 | Ga0495616_0061112 | 3300046513 | Bacteria | 1848 |
| 545 | Ga0495631_0003948 | 3300046518 | Bacteria | 8008 |
| 546 | Ga0495631_0010256 | 3300046518 | Bacteria | 4641 |
| 547 | Ga0495631_0011067 | 3300046518 | Bacteria | 4450 |
| 548 | Ga0495631_0018703 | 3300046518 | Bacteria | 3258 |
| 549 | Ga0495631_0024570 | 3300046518 | Bacteria | 2782 |
| 550 | Ga0495632_0000267 | 3300046519 | Bacteria | 52020 |
| 551 | Ga0495632_0000604 | 3300046519 | Bacteria | 33295 |
| 552 | Ga0495632_0003433 | 3300046519 | Bacteria | 11251 |
| 553 | Ga0495632_0037304 | 3300046519 | Bacteria | 2467 |
| 554 | Ga0495632_0040941 | 3300046519 | Bacteria | 2330 |
| 555 | Ga0495637_0039022 | 3300046520 | Bacteria | 2053 |
| 556 | Ga0495643_0000432 | 3300046522 | Bacteria | 54506 |
| 557 | Ga0495643_0001321 | 3300046522 | Bacteria | 23458 |
| 558 | Ga0495643_0006079 | 3300046522 | Bacteria | 8039 |
| 559 | Ga0495643_0007868 | 3300046522 | Bacteria | 6814 |
| 560 | Ga0495643_0008842 | 3300046522 | Bacteria | 6340 |
| 561 | Ga0495643_0019290 | 3300046522 | Bacteria | 3948 |
| 562 | Ga0495644_0017595 | 3300046523 | Bacteria | 2732 |
| 563 | Ga0495648_0000096 | 3300046524 | Bacteria | 110227 |
| 564 | Ga0495648_0035332 | 3300046524 | Bacteria | 3241 |
| 565 | Ga0495648_0098884 | 3300046524 | Bacteria | 1615 |
| 566 | Ga0495663_0001704 | 3300046525 | Bacteria | 6851 |
| 567 | Ga0495663_0004634 | 3300046525 | Bacteria | 3852 |
| 568 | Ga0495663_0005706 | 3300046525 | Bacteria | 3446 |
| 569 | Ga0495663_0015893 | 3300046525 | Bacteria | 2125 |
| 570 | Ga0495642_0000746 | 3300046528 | Bacteria | 16051 |
| 571 | Ga0495642_0009192 | 3300046528 | Bacteria | 3783 |
| 572 | Ga0495642_0016654 | 3300046528 | Bacteria | 2867 |
| 573 | Ga0495642_0019073 | 3300046528 | Bacteria | 2686 |
| 574 | Ga0495642_0027377 | 3300046528 | Bacteria | 2268 |
| 575 | Ga0495665_0003914 | 3300046531 | Bacteria | 8059 |
| 576 | Ga0495586_0022463 | 3300046535 | Bacteria | 3367 |
| 577 | Ga0495586_0038008 | 3300046535 | Bacteria | 2584 |
| 578 | Ga0495587_0165012 | 3300046536 | Bacteria | 1259 |
| 579 | Ga0495609_0000731 | 3300046538 | Bacteria | 24981 |
| 580 | Ga0495609_0000857 | 3300046538 | Bacteria | 22430 |
| 581 | Ga0495609_0002565 | 3300046538 | Bacteria | 11083 |
| 582 | Ga0495609_0036870 | 3300046538 | Bacteria | 2206 |
| 583 | Ga0495609_0063676 | 3300046538 | Bacteria | 1627 |
| 584 | Ga0495597_0002776 | 3300046542 | Bacteria | 10780 |
| 585 | Ga0495597_0005968 | 3300046542 | Bacteria | 6357 |
| 586 | Ga0495597_0021087 | 3300046542 | Bacteria | 3029 |
| 587 | Ga0495645_0038819 | 3300046543 | Bacteria | 3473 |
| 588 | Ga0495622_0001642 | 3300046557 | Bacteria | 11054 |
| 589 | Ga0495622_0018356 | 3300046557 | Bacteria | 3257 |
| 590 | Ga0495622_0101857 | 3300046557 | Bacteria | 1316 |
| 591 | Ga0495622_0110027 | 3300046557 | Bacteria | 1261 |
| 592 | Ga0495633_0004334 | 3300046558 | Bacteria | 9059 |
| 593 | Ga0495633_0006439 | 3300046558 | Bacteria | 6961 |
| 594 | Ga0495633_0008724 | 3300046558 | Bacteria | 5681 |
| 595 | Ga0495667_0077035 | 3300046559 | Bacteria | 2169 |
| 596 | Ga0495668_0001114 | 3300046616 | Bacteria | 27719 |
| 597 | Ga0495668_0002176 | 3300046616 | Bacteria | 16784 |
| 598 | Ga0495668_0007237 | 3300046616 | Bacteria | 7121 |
| 599 | Ga0495668_0015647 | 3300046616 | Bacteria | 4425 |
| 600 | Ga0495668_0125926 | 3300046616 | Bacteria | 1402 |
| 601 | Ga0495668_0133182 | 3300046616 | Bacteria | 1360 |
| 602 | Ga0495611_0006802 | 3300046648 | Bacteria | 4858 |
| 603 | Ga0495611_0012508 | 3300046648 | Bacteria | 3608 |
| 604 | Ga0495625_0182908 | 3300046660 | Bacteria | 1392 |
| 605 | Ga0495661_0000894 | 3300046665 | Bacteria | 27503 |
| 606 | Ga0495661_0002340 | 3300046665 | Bacteria | 14620 |
| 607 | Ga0495661_0004974 | 3300046665 | Bacteria | 9492 |
| 608 | Ga0495661_0005871 | 3300046665 | Bacteria | 8675 |
| 609 | Ga0495661_0008538 | 3300046665 | Bacteria | 7079 |
| 610 | Ga0495661_0010678 | 3300046665 | Bacteria | 6256 |
| 611 | Ga0495661_0038966 | 3300046665 | Bacteria | 2956 |
| 612 | Ga0495661_0056703 | 3300046665 | Bacteria | 2342 |
| 613 | Ga0495661_0121889 | 3300046665 | Bacteria | 1439 |
| 614 | Ga0495588_0000174 | 3300046674 | Bacteria | 81329 |
| 615 | Ga0495588_0052754 | 3300046674 | Bacteria | 2096 |
| 616 | Ga0495669_0007006 | 3300046684 | Bacteria | 4719 |
| 617 | Ga0495624_0010461 | 3300046690 | Bacteria | 6395 |
| 618 | Ga0495670_0005413 | 3300046691 | Bacteria | 6266 |
| 619 | Ga0495671_0001737 | 3300046692 | Bacteria | 14121 |
| 620 | Ga0495671_0003344 | 3300046692 | Bacteria | 9901 |
| 621 | Ga0495671_0017420 | 3300046692 | Bacteria | 3825 |
| 622 | Ga0495649_0039193 | 3300046694 | Bacteria | 2598 |
| 623 | Ga0495589_0000693 | 3300046794 | Bacteria | 21927 |
| 624 | Ga0495589_0000990 | 3300046794 | Bacteria | 17241 |
| 625 | Ga0495589_0020146 | 3300046794 | Bacteria | 3412 |
| 626 | Ga0495589_0029408 | 3300046794 | Bacteria | 2770 |
| 627 | Ga0495660_0000157 | 3300046810 | Bacteria | 73772 |
| 628 | Ga0495660_0038108 | 3300046810 | Bacteria | 2674 |
| 629 | Ga0495660_0087114 | 3300046810 | Bacteria | 1629 |
| 630 | Ga0495581_0016929 | 3300047315 | Bacteria | 4236 |
| 631 | Ga0495636_0000593 | 3300047318 | Bacteria | 13310 |
| 632 | Ga0495674_0005713 | 3300047319 | Bacteria | 11916 |
| 633 | Ga0495672_0000333 | 3300047320 | Bacteria | 61835 |
| 634 | Ga0495672_0003512 | 3300047320 | Bacteria | 13363 |
| 635 | Ga0495672_0009609 | 3300047320 | Bacteria | 6983 |
| 636 | Ga0495672_0018529 | 3300047320 | Bacteria | 4616 |
| 637 | Ga0495672_0027488 | 3300047320 | Bacteria | 3614 |
| 638 | Ga0495680_0060320 | 3300047322 | Bacteria | 2925 |
| 639 | Ga0495683_0000041 | 3300047323 | Bacteria | 137557 |
| 640 | Ga0495683_0020521 | 3300047323 | Bacteria | 3407 |
| 641 | Ga0495683_0022080 | 3300047323 | Bacteria | 3274 |
| 642 | Ga0495687_000215 | 3300047443 | Bacteria | 82752 |
| 643 | Ga0495687_000457 | 3300047443 | Bacteria | 49882 |
| 644 | Ga0495687_001337 | 3300047443 | Bacteria | 22967 |
| 645 | Ga0495687_006930 | 3300047443 | Bacteria | 6817 |
| 646 | Ga0495687_021704 | 3300047443 | Bacteria | 3099 |
| 647 | Ga0495687_036968 | 3300047443 | Bacteria | 2179 |
| 648 | Ga0495675_0115874 | 3300047444 | Bacteria | 1671 |
| 649 | Ga0495677_0000259 | 3300047445 | Bacteria | 23264 |
| 650 | Ga0495677_0000915 | 3300047445 | Bacteria | 11884 |
| 651 | Ga0495677_0001756 | 3300047445 | Bacteria | 8684 |
| 652 | Ga0495677_0005432 | 3300047445 | Bacteria | 4831 |
| 653 | Ga0495677_0024538 | 3300047445 | Bacteria | 2187 |
| 654 | Ga0495673_0008170 | 3300047469 | Bacteria | 5918 |
| 655 | Ga0495681_0000629 | 3300047470 | Bacteria | 26892 |
| 656 | Ga0495681_0018454 | 3300047470 | Bacteria | 3843 |
| 657 | Ga0495681_0020724 | 3300047470 | Bacteria | 3558 |
| 658 | Ga0495681_0021411 | 3300047470 | Bacteria | 3486 |
| 659 | Ga0495681_0061283 | 3300047470 | Bacteria | 1733 |
| 660 | Ga0495686_0000356 | 3300047472 | Bacteria | 74751 |
| 661 | Ga0495686_0011389 | 3300047472 | Bacteria | 6268 |
| 662 | Ga0495593_0028400 | 3300047673 | Bacteria | 3072 |
| 663 | Ga0495614_0068694 | 3300048089 | Bacteria | 1526 |
| 664 | Ga0495626_0000016 | 3300048091 | Bacteria | 232214 |
| 665 | Ga0495626_0000640 | 3300048091 | Bacteria | 33839 |
| 666 | Ga0495626_0001380 | 3300048091 | Bacteria | 19523 |
| 667 | Ga0495626_0002008 | 3300048091 | Bacteria | 14997 |
| 668 | Ga0495626_0002438 | 3300048091 | Bacteria | 12914 |
| 669 | Ga0495626_0002604 | 3300048091 | Bacteria | 12318 |
| 670 | Ga0495626_0006273 | 3300048091 | Bacteria | 6787 |
| 671 | Ga0495626_0011312 | 3300048091 | Bacteria | 4724 |
| 672 | Ga0495626_0019856 | 3300048091 | Bacteria | 3354 |
| 673 | Ga0496100_0105627 | 3300048903 | Bacteria | 1948 |
| 674 | Ga0496100_0167502 | 3300048903 | Bacteria | 1580 |
| 675 | Ga0496102_0023234 | 3300048905 | Bacteria | 5503 |
| 676 | Ga0496102_0044099 | 3300048905 | Bacteria | 4046 |
| 677 | Ga0496102_0482136 | 3300048905 | Bacteria | 1161 |
| 678 | Ga0496103_0010228 | 3300048906 | Bacteria | 5549 |
| 679 | Ga0496104_0051477 | 3300048907 | Bacteria | 3887 |
| 680 | Ga0496106_0084488 | 3300048909 | Bacteria | 2443 |
| 681 | Ga0496106_0099602 | 3300048909 | Bacteria | 2253 |
| 682 | Ga0496107_0058584 | 3300048910 | Bacteria | 2785 |
| 683 | Ga0496108_0255380 | 3300048911 | Bacteria | 1525 |
| 684 | Ga0496109_0080458 | 3300048912 | Bacteria | 3002 |
| 685 | Ga0496109_0112533 | 3300048912 | Bacteria | 2531 |
| 686 | Ga0496109_0253372 | 3300048912 | Bacteria | 1658 |
| 687 | Ga0496110_0017299 | 3300048913 | Bacteria | 6032 |
| 688 | Ga0496111_0014500 | 3300048914 | Bacteria | 5386 |
| 689 | Ga0496111_0048076 | 3300048914 | Bacteria | 3073 |
| 690 | Ga0496113_0001052 | 3300048916 | Bacteria | 14902 |
| 691 | Ga0496113_0031830 | 3300048916 | Bacteria | 3831 |
| 692 | Ga0496113_0034554 | 3300048916 | Bacteria | 3689 |
| 693 | Ga0496113_0043642 | 3300048916 | Bacteria | 3319 |
| 694 | Ga0496114_0002540 | 3300048917 | Bacteria | 13926 |
| 695 | Ga0496115_0001055 | 3300048918 | Bacteria | 19985 |
| 696 | Ga0496115_0150027 | 3300048918 | Bacteria | 1925 |
| 697 | Ga0496116_0018948 | 3300048919 | Bacteria | 5285 |
| 698 | Ga0496117_0010323 | 3300048920 | Bacteria | 8535 |
| 699 | Ga0496117_0015652 | 3300048920 | Bacteria | 6447 |
| 700 | Ga0496117_0017213 | 3300048920 | Bacteria | 6048 |
| 701 | Ga0496117_0018365 | 3300048920 | Bacteria | 5794 |
| 702 | Ga0496117_0052830 | 3300048920 | Bacteria | 2860 |
| 703 | Ga0496118_0013416 | 3300048921 | Bacteria | 7754 |
| 704 | Ga0496118_0016030 | 3300048921 | Bacteria | 6899 |
| 705 | Ga0496118_0016359 | 3300048921 | Bacteria | 6808 |
| 706 | Ga0496118_0018462 | 3300048921 | Bacteria | 6293 |
| 707 | Ga0496118_0037647 | 3300048921 | Bacteria | 3890 |
| 708 | Ga0496118_0051396 | 3300048921 | Bacteria | 3153 |
| 709 | Ga0496118_0092489 | 3300048921 | Bacteria | 2075 |
| 710 | Ga0496121_0033648 | 3300048924 | Bacteria | 4633 |
| 711 | Ga0496121_0190246 | 3300048924 | Bacteria | 1472 |
| 712 | Ga0496122_0003343 | 3300048925 | Bacteria | 21158 |
| 713 | Ga0496122_0013150 | 3300048925 | Bacteria | 8134 |
| 714 | Ga0496122_0014643 | 3300048925 | Bacteria | 7568 |
| 715 | Ga0496122_0025680 | 3300048925 | Bacteria | 5106 |
| 716 | Ga0496122_0108151 | 3300048925 | Bacteria | 1835 |
| 717 | Ga0496123_0001399 | 3300048926 | Bacteria | 33811 |
| 718 | Ga0496123_0002772 | 3300048926 | Bacteria | 20912 |
| 719 | Ga0496123_0006033 | 3300048926 | Bacteria | 11910 |
| 720 | Ga0496123_0020992 | 3300048926 | Bacteria | 5089 |
| 721 | Ga0496124_0000018 | 3300048927 | Bacteria | 442940 |
| 722 | Ga0496124_0002026 | 3300048927 | Bacteria | 27552 |
| 723 | Ga0496124_0005171 | 3300048927 | Bacteria | 14846 |
| 724 | Ga0496124_0006351 | 3300048927 | Bacteria | 12900 |
| 725 | Ga0496124_0017367 | 3300048927 | Bacteria | 6781 |
| 726 | Ga0496124_0022379 | 3300048927 | Bacteria | 5795 |
| 727 | Ga0496124_0023215 | 3300048927 | Bacteria | 5668 |
| 728 | Ga0496124_0026567 | 3300048927 | Bacteria | 5217 |
| 729 | Ga0496124_0091350 | 3300048927 | Bacteria | 2481 |
| 730 | Ga0496124_0115839 | 3300048927 | Bacteria | 2150 |
| 731 | Ga0496124_0125716 | 3300048927 | Bacteria | 2043 |
| 732 | Ga0496125_0000954 | 3300048928 | Bacteria | 45477 |
| 733 | Ga0496125_0001095 | 3300048928 | Bacteria | 41736 |
| 734 | Ga0496125_0011785 | 3300048928 | Bacteria | 8712 |
| 735 | Ga0496125_0065938 | 3300048928 | Bacteria | 2864 |
| 736 | Ga0496126_0004287 | 3300048929 | Bacteria | 17153 |
| 737 | Ga0496126_0018169 | 3300048929 | Bacteria | 6977 |
| 738 | Ga0496126_0069132 | 3300048929 | Bacteria | 3151 |
| 739 | Ga0495678_002888 | 3300049459 | Bacteria | 11064 |
| 740 | Ga0495678_007954 | 3300049459 | Bacteria | 5428 |
| 741 | Ga0501299_002715 | 3300049522 | Bacteria | 2479 |
| 742 | Ga0501033_0030923 | 3300049570 | Bacteria | 4024 |
| 743 | Ga0501034_0000458 | 3300049571 | Bacteria | 67394 |
| 744 | Ga0501034_0035041 | 3300049571 | Bacteria | 5090 |
| 745 | Ga0501036_0022362 | 3300049572 | Bacteria | 5318 |
| 746 | Ga0501036_0148311 | 3300049572 | Bacteria | 1979 |
| 747 | Ga0501037_0031215 | 3300049573 | Bacteria | 3934 |
| 748 | Ga0501038_0010174 | 3300049574 | Bacteria | 8609 |
| 749 | Ga0501039_0008418 | 3300049575 | Bacteria | 7860 |
| 750 | Ga0501040_0000273 | 3300049576 | Bacteria | 30160 |
| 751 | Ga0501041_0000391 | 3300049577 | Bacteria | 22011 |
| 752 | Ga0501041_0022733 | 3300049577 | Bacteria | 3756 |
| 753 | Ga0501042_0001697 | 3300049578 | Bacteria | 13144 |
| 754 | Ga0501043_0001632 | 3300049579 | Bacteria | 19502 |
| 755 | Ga0501046_0008085 | 3300049580 | Bacteria | 9193 |
| 756 | Ga0501048_0003439 | 3300049582 | Bacteria | 12026 |
| 757 | Ga0501067_0059046 | 3300049583 | Bacteria | 2124 |
| 758 | Ga0501068_0007720 | 3300049584 | Bacteria | 5952 |
| 759 | Ga0501068_0015391 | 3300049584 | Bacteria | 4391 |
| 760 | Ga0501068_0018426 | 3300049584 | Bacteria | 4043 |
| 761 | Ga0501069_0107720 | 3300049585 | Bacteria | 1585 |
| 762 | Ga0501070_0007880 | 3300049586 | Bacteria | 9028 |
| 763 | Ga0501070_0019761 | 3300049586 | Bacteria | 5650 |
| 764 | Ga0501070_0057050 | 3300049586 | Bacteria | 3237 |
| 765 | Ga0501071_0006024 | 3300049587 | Bacteria | 7852 |
| 766 | Ga0501071_0018711 | 3300049587 | Bacteria | 4802 |
| 767 | Ga0501072_0002420 | 3300049588 | Bacteria | 13967 |
| 768 | Ga0501072_0003820 | 3300049588 | Bacteria | 11373 |
| 769 | Ga0501072_0080930 | 3300049588 | Bacteria | 2574 |
| 770 | Ga0501073_0001960 | 3300049589 | Bacteria | 15345 |
| 771 | Ga0501073_0003818 | 3300049589 | Bacteria | 11306 |
| 772 | Ga0501074_0023364 | 3300049590 | Bacteria | 4496 |
| 773 | Ga0501074_0045182 | 3300049590 | Bacteria | 3187 |
| 774 | Ga0501075_0006782 | 3300049591 | Bacteria | 7904 |
| 775 | Ga0501075_0010513 | 3300049591 | Bacteria | 6505 |
| 776 | Ga0501075_0125698 | 3300049591 | Bacteria | 1952 |
| 777 | Ga0501076_0001245 | 3300049592 | Bacteria | 16958 |
| 778 | Ga0501076_0085353 | 3300049592 | Bacteria | 2537 |
| 779 | Ga0501076_0090837 | 3300049592 | Bacteria | 2456 |
| 780 | Ga0501077_0000753 | 3300049593 | Bacteria | 19627 |
| 781 | Ga0501079_0002097 | 3300049741 | Bacteria | 14307 |
| 782 | Ga0501079_0002850 | 3300049741 | Bacteria | 12614 |
| 783 | Ga0501079_0025648 | 3300049741 | Bacteria | 4519 |
| 784 | Ga0501079_0111382 | 3300049741 | Bacteria | 2127 |
| 785 | Ga0501080_0000818 | 3300049742 | Bacteria | 25385 |
| 786 | Ga0501080_0003459 | 3300049742 | Bacteria | 13925 |
| 787 | Ga0501080_0019849 | 3300049742 | Bacteria | 6223 |
| 788 | Ga0501080_0304695 | 3300049742 | Bacteria | 1444 |
| 789 | Ga0501081_0000278 | 3300049743 | Bacteria | 26953 |
| 790 | Ga0501081_0001474 | 3300049743 | Bacteria | 14427 |
| 791 | Ga0501083_0027034 | 3300049744 | Bacteria | 3962 |
| 792 | Ga0501083_0045419 | 3300049744 | Bacteria | 2972 |
| 793 | Ga0501035_0067269 | 3300049822 | Bacteria | 3180 |
| 794 | nmdc:mga0k408_5496_c1 | 3300050493 | Bacteria | 6747 |
| 795 | nmdc:mga05p37_1470_c1 | 3300050507 | Bacteria | 27368 |
| 796 | nmdc:mga05p37_6956_c1 | 3300050507 | Bacteria | 13332 |
| 797 | nmdc:mga05p37_88921_c1 | 3300050507 | Unclassified | 3807 |
| 798 | nmdc:mga09592_1178_c1 | 3300050508 | Bacteria | 20862 |
| 799 | nmdc:mga09592_12799_c1 | 3300050508 | Bacteria | 6840 |
| 800 | nmdc:mga09592_235667_c1 | 3300050508 | Bacteria | 1585 |
| 801 | nmdc:mga0qj67_168929_c1 | 3300050509 | Bacteria | 1776 |
| 802 | nmdc:mga0qj67_2826_c1 | 3300050509 | Bacteria | 12455 |
| 803 | nmdc:mga0qj67_66637_c1 | 3300050509 | Bacteria | 2868 |
| 804 | nmdc:mga06r32_1285_c1 | 3300050510 | Bacteria | 22596 |
| 805 | nmdc:mga06r32_17513_c1 | 3300050510 | Bacteria | 6541 |
| 806 | nmdc:mga08y16_2320_c1 | 3300050511 | Bacteria | 15509 |
| 807 | nmdc:mga08y16_47576_c2 | 3300050511 | Bacteria | 4081 |
| 808 | nmdc:mga08y16_62688_c1 | 3300050511 | Bacteria | 3883 |
| 809 | nmdc:mga08y16_867_c1 | 3300050511 | Bacteria | 29137 |
| 810 | nmdc:mga0rr50_78835_c1 | 3300050513 | Bacteria | 2536 |
| 811 | nmdc:mga08x19_1519_c1 | 3300050514 | Bacteria | 14388 |
| 812 | nmdc:mga08x19_53276_c1 | 3300050514 | Bacteria | 2603 |
| 813 | nmdc:mga0a205_194111_c1 | 3300050515 | Bacteria | 1922 |
| 814 | nmdc:mga0a205_61379_c1 | 3300050515 | Unclassified | 3631 |
| 815 | Ga0495601_0040248 | 3300053077 | Bacteria | 2927 |
| 816 | Ga0495595_0103821 | 3300053084 | Bacteria | 1373 |
| 817 | Ga0495619_0004286 | 3300053085 | Bacteria | 9092 |
| 818 | Ga0500556_0000700 | 3300053104 | Bacteria | 20573 |
| 819 | Ga0500617_048158 | 3300053124 | Bacteria | 1905 |
| 820 | Ga0500634_0058877 | 3300053161 | Bacteria | 2046 |
| 821 | Ga0500636_0000423 | 3300053177 | Bacteria | 23230 |
| 822 | Ga0500565_000304 | 3300053734 | Bacteria | 2526 |
| 823 | Ga0501084_0009919 | 3300054114 | Bacteria | 7872 |
| 824 | Ga0501084_0092272 | 3300054114 | Bacteria | 2542 |
| 825 | Ga0590071_004146 | 3300059421 | Bacteria | 3537 |
| 826 | Ga0501082_0000863 | 3300060353 | Bacteria | 26818 |
| 827 | Ga0466962_0063890 | 3300061719 | Bacteria | 1757 |
| 828 | Ga0530510_0005243 | 3300061734 | Bacteria | 8948 |
| 829 | Ga0530510_0058118 | 3300061734 | Bacteria | 2796 |
| 830 | 2643975462 | 2643221593 | Bacteria | 6296053 |
| 831 | 2572256131 | 2571042365 | Bacteria | 3289345 |
| 832 | 2578459088 | 2576861471 | Bacteria | 4648976 |
| 833 | 2643802188 | 2643221556 | Bacteria | 7251154 |
| 834 | 2643815840 | 2643221559 | Bacteria | 4424915 |
| 835 | 2643878026 | 2643221573 | Bacteria | 4784121 |
| 836 | 2643906278 | 2643221579 | Bacteria | 4443405 |
| 837 | 2643915297 | 2643221581 | Bacteria | 3893603 |
| 838 | 2643940650 | 2643221586 | Bacteria | 4446529 |
| 839 | 2644080640 | 2643221612 | Bacteria | 4361984 |
| 840 | 2644475697 | 2643221684 | Bacteria | 7145183 |
| 841 | 2644528466 | 2643221695 | Bacteria | 3441323 |
| 842 | 2644659337 | 2643221720 | Bacteria | 4694283 |
| 843 | 2644695895 | 2643221727 | Bacteria | 4415595 |
| 844 | 2644700919 | 2643221728 | Bacteria | 4797149 |
| 845 | 2748019166 | 2747842501 | Bacteria | 5293829 |
| 846 | 2819663729 | 2818991457 | Bacteria | 5323295 |
| 847 | 2842759457 | 2842757796 | Bacteria | 3981385 |
| 848 | 2842781584 | 2842780639 | Bacteria | 4337790 |
| 849 | 2852686420 | 2852684882 | Bacteria | 5463342 |
| 850 | 2857443181 | 2857442823 | Bacteria | 4562550 |
| 851 | 2891635645 | 2891633521 | Bacteria | 4602265 |
| 852 | 2894024807 | 2894023352 | Bacteria | 5167372 |
| 853 | 2895501220 | 2895498888 | Bacteria | 5283788 |
| 854 | 2895514363 | 2895511927 | Bacteria | 6802080 |
| 855 | 2895524156 | 2895522137 | Bacteria | 3284416 |
| 856 | 2895527643 | 2895525241 | Bacteria | 3388457 |
| 857 | 2919132537 | 2919130084 | Bacteria | 5301837 |
| 858 | 2929196995 | 2929195423 | Bacteria | 5325372 |
| 859 | 2939626459 | 2939622612 | Bacteria | 4698046 |
| 860 | 2941476860 | 2941475908 | Bacteria | 4145589 |
| 861 | 2941494577 | 2941489479 | Bacteria | 6313767 |
| 862 | 2987607643 | 2987605356 | Bacteria | 4187822 |
| 863 | 2995952799 | 2995948881 | Bacteria | 6358104 |
| 864 | 639785179 | 639633007 | Bacteria | 4376040 |
| 865 | 8002869533 | 8002869464 | Bacteria | 3588529 |
| 866 | 8003014927 | 8003014200 | Bacteria | 4059994 |
| 867 | 8047673960 | 8047673197 | Bacteria | 7395230 |
| 868 | 8048749090 | 8048746797 | Bacteria | 3557226 |
| 869 | SwRhRL2b_contig_1672945 | |||
| 870 | JGI25152J39213_1000142 | |||
| 871 | JGI25150J39212_1000204 | |||
| 872 | JGI25150J39212_1000776 | |||
| 873 | JGI25151J46595_10000237 | |||
| 874 | JGI25151J46595_10000530 | |||
| 875 | JGI25406J46586_10027080 | |||
| 876 | JGI25153J46596_10000171 | |||
| 877 | Ga0055525_1000001 | |||
| 878 | Ga0055526_1000011 | |||
| 879 | Ga0055537_1000007 | |||
| 880 | Ga0055524_1000252 | |||
| 881 | Ga0055524_1009708 | |||
| 882 | Ga0055524_1016052 | |||
| 883 | Ga0055536_1002333 | |||
| 884 | Ga0055536_1004882 | |||
| 885 | Ga0055536_1006875 | |||
| 886 | Ga0055534_1000134 | |||
| 887 | Ga0055528_1000005 | |||
| 888 | Ga0055530_10003751 | |||
| 889 | Ga0055530_10003859 | |||
| 890 | Ga0055531_10003052 | |||
| 891 | Ga0055531_10004686 | |||
| 892 | Ga0055531_10005668 | |||
| 893 | Ga0055531_10006402 | |||
| 894 | Ga0055531_10007572 | |||
| 895 | Ga0055531_10024636 | |||
| 896 | Ga0058692_1000020 | |||
| 897 | Ga0065704_10072403 | |||
| 898 | Ga0065704_10075997 | |||
| 899 | Ga0065707_10082801 | |||
| 900 | Ga0070658_10088428 | |||
| 901 | Ga0070690_100000304 | |||
| 902 | Ga0070690_100004891 | |||
| 903 | Ga0070690_100008748 | |||
| 904 | Ga0070670_100051105 | |||
| 905 | Ga0070670_100053604 | |||
| 906 | Ga0068869_100001121 | |||
| 907 | Ga0068869_100002021 | |||
| 908 | Ga0068869_100008179 | |||
| 909 | Ga0068869_100171056 | |||
| 910 | Ga0068869_100193841 | |||
| 911 | Ga0070666_10206907 | |||
| 912 | Ga0070680_100000577 | |||
| 913 | Ga0070680_100136385 | |||
| 914 | Ga0070682_100007634 | |||
| 915 | Ga0068868_100001956 | |||
| 916 | Ga0068868_100190128 | |||
| 917 | Ga0070689_100000495 | |||
| 918 | Ga0070689_100004674 | |||
| 919 | Ga0070689_100195136 | |||
| 920 | Ga0070687_100000550 | |||
| 921 | Ga0070687_100011964 | |||
| 922 | Ga0070661_100000902 | |||
| 923 | Ga0070661_100042119 | |||
| 924 | Ga0070692_10000958 | |||
| 925 | Ga0070669_100011209 | |||
| 926 | Ga0070675_100025842 | |||
| 927 | Ga0070675_100295291 | |||
| 928 | Ga0070671_100006492 | |||
| 929 | Ga0070671_100022859 | |||
| 930 | Ga0070673_100013197 | |||
| 931 | Ga0070688_100022441 | |||
| 932 | Ga0070659_100012772 | |||
| 933 | Ga0070659_100289793 | |||
| 934 | Ga0070667_100046068 | |||
| 935 | Ga0070667_100214983 | |||
| 936 | Ga0070714_100009958 | |||
| 937 | Ga0070713_100161211 | |||
| 938 | Ga0070701_10002048 | |||
| 939 | Ga0070705_100001366 | |||
| 940 | Ga0070705_100124375 | |||
| 941 | Ga0070700_100009789 | |||
| 942 | Ga0070700_100019061 | |||
| 943 | Ga0070694_100003452 | |||
| 944 | Ga0070662_100004627 | |||
| 945 | Ga0070681_10005492 | |||
| 946 | Ga0068867_100005182 | |||
| 947 | Ga0068867_100006856 | |||
| 948 | Ga0068867_100017877 | |||
| 949 | Ga0068867_100066009 | |||
| 950 | Ga0070685_10030763 | |||
| 951 | Ga0070706_100030805 | |||
| 952 | Ga0070706_100085528 | |||
| 953 | Ga0070707_100024555 | |||
| 954 | Ga0068853_100005626 | |||
| 955 | Ga0068853_100017678 | |||
| 956 | Ga0068853_100033254 | |||
| 957 | Ga0068853_100035939 | |||
| 958 | Ga0068853_100100529 | |||
| 959 | Ga0070672_100131654 | |||
| 960 | Ga0070686_100000422 | |||
| 961 | Ga0070686_100000547 | |||
| 962 | Ga0070695_100000545 | |||
| 963 | Ga0070696_100004990 | |||
| 964 | Ga0070693_100000217 | |||
| 965 | Ga0070693_100008113 | |||
| 966 | Ga0070665_100014118 | |||
| 967 | Ga0070665_100287866 | |||
| 968 | Ga0070704_100001284 | |||
| 969 | Ga0068855_100010002 | |||
| 970 | Ga0068855_100028998 | |||
| 971 | Ga0068855_100157396 | |||
| 972 | Ga0068855_100159538 | |||
| 973 | Ga0068855_100302869 | |||
| 974 | Ga0070664_100001457 | |||
| 975 | Ga0070664_100070200 | |||
| 976 | Ga0070664_100178109 | |||
| 977 | Ga0068857_100006759 | |||
| 978 | Ga0068857_100014875 | |||
| 979 | Ga0068854_100073833 | |||
| 980 | Ga0068856_100028193 | |||
| 981 | Ga0068856_100241183 | |||
| 982 | Ga0070702_100000054 | |||
| 983 | Ga0068859_100010162 | |||
| 984 | Ga0068859_100044017 | |||
| 985 | Ga0068859_100119817 | |||
| 986 | Ga0068864_100001460 | |||
| 987 | Ga0068864_100113405 | |||
| 988 | Ga0068866_10006629 | |||
| 989 | Ga0068866_10012069 | |||
| 990 | Ga0068861_100000451 | |||
| 991 | Ga0068861_100003216 | |||
| 992 | Ga0068861_100004280 | |||
| 993 | Ga0068861_100012205 | |||
| 994 | Ga0068870_10003143 | |||
| 995 | Ga0068870_10053884 | |||
| 996 | Ga0068863_100000931 | |||
| 997 | Ga0068858_100001326 | |||
| 998 | Ga0068858_100008731 | |||
| 999 | Ga0068858_100024304 | |||
| 1000 | Ga0068858_100116032 | |||
| 1001 | Ga0068860_100104821 | |||
| 1002 | Ga0068860_100121252 | |||
| 1003 | Ga0068860_100231045 | |||
| 1004 | Ga0068862_100000298 | |||
| 1005 | Ga0068862_100001914 | |||
| 1006 | Ga0068862_100063541 | |||
| 1007 | Ga0081455_10002298 | |||
| 1008 | Ga0081539_10006699 | |||
| 1009 | Ga0070717_10014065 | |||
| 1010 | Ga0075432_10016650 | |||
| 1011 | Ga0070716_100042222 | |||
| 1012 | Ga0070712_100086673 | |||
| 1013 | Ga0075366_10035159 | |||
| 1014 | Ga0097621_100000597 | |||
| 1015 | Ga0097621_100001777 | |||
| 1016 | Ga0097621_100014685 | |||
| 1017 | Ga0068871_100000468 | |||
| 1018 | Ga0068871_100051922 | |||
| 1019 | Ga0068871_100278172 | |||
| 1020 | Ga0075428_100001778 | |||
| 1021 | Ga0075428_100002997 | |||
| 1022 | Ga0075428_100004615 | |||
| 1023 | Ga0075428_100026828 | |||
| 1024 | Ga0075428_100035227 | |||
| 1025 | Ga0075428_100107742 | |||
| 1026 | Ga0075430_100010916 | |||
| 1027 | Ga0075430_100020910 | |||
| 1028 | Ga0075430_100055650 | |||
| 1029 | Ga0075430_100143248 | |||
| 1030 | Ga0075431_100000055 | |||
| 1031 | Ga0075431_100041495 | |||
| 1032 | Ga0075433_10312398 | |||
| 1033 | Ga0075434_100000663 | |||
| 1034 | Ga0075429_100001097 | |||
| 1035 | Ga0075429_100002231 | |||
| 1036 | Ga0075429_100010147 | |||
| 1037 | Ga0075429_100088568 | |||
| 1038 | Ga0068865_100002672 | |||
| 1039 | Ga0068865_100003241 | |||
| 1040 | Ga0075436_100004535 | |||
| 1041 | Ga0075436_100013037 | |||
| 1042 | Ga0097620_100010162 | |||
| 1043 | Ga0097620_100044019 | |||
| 1044 | Ga0097620_100119815 | |||
| 1045 | Ga0075435_100011822 | |||
| 1046 | Ga0105240_10092762 | |||
| 1047 | Ga0111539_10000195 | |||
| 1048 | Ga0111539_10001799 | |||
| 1049 | Ga0111539_10008308 | |||
| 1050 | Ga0111539_10010549 | |||
| 1051 | Ga0111539_10027811 | |||
| 1052 | Ga0111539_10103404 | |||
| 1053 | Ga0105245_10001316 | |||
| 1054 | Ga0105245_10410099 | |||
| 1055 | Ga0114129_10003595 | |||
| 1056 | Ga0114129_10005295 | |||
| 1057 | Ga0114129_10008084 | |||
| 1058 | Ga0114129_10023893 | |||
| 1059 | Ga0114129_10131625 | |||
| 1060 | Ga0114129_10135271 | |||
| 1061 | Ga0105243_10006259 | |||
| 1062 | Ga0105243_10009756 | |||
| 1063 | Ga0105241_10004480 | |||
| 1064 | Ga0105241_10039779 | |||
| 1065 | Ga0105241_10096754 | |||
| 1066 | Ga0105242_10006575 | |||
| 1067 | Ga0105242_10010463 | |||
| 1068 | Ga0105242_10033774 | |||
| 1069 | Ga0105248_10006517 | |||
| 1070 | Ga0105248_10120679 | |||
| 1071 | Ga0105248_10241757 | |||
| 1072 | Ga0105237_10008329 | |||
| 1073 | Ga0105237_10245588 | |||
| 1074 | Ga0105238_10001013 | |||
| 1075 | Ga0105238_10090531 | |||
| 1076 | Ga0105238_10286608 | |||
| 1077 | Ga0105249_10015181 | |||
| 1078 | Ga0105249_10031801 | |||
| 1079 | Ga0105249_10062625 | |||
| 1080 | Ga0105239_10049990 | |||
| 1081 | Ga0105239_10163868 | |||
| 1082 | Ga0105239_10474150 | |||
| 1083 | Ga0157371_10000001 | |||
| 1084 | Ga0157369_10001365 | |||
| 1085 | Ga0157369_10058667 | |||
| 1086 | Ga0157374_10172211 | |||
| 1087 | Ga0157378_10018590 | |||
| 1088 | Ga0157378_10024328 | |||
| 1089 | Ga0157378_10048035 | |||
| 1090 | Ga0157378_10087372 | |||
| 1091 | Ga0163162_10069963 | |||
| 1092 | Ga0163162_10211135 | |||
| 1093 | Ga0163162_10282648 | |||
| 1094 | Ga0157372_10001111 | |||
| 1095 | Ga0157375_10061558 | |||
| 1096 | Ga0163163_10002436 | |||
| 1097 | Ga0163163_10038360 | |||
| 1098 | Ga0157380_10006169 | |||
| 1099 | Ga0157377_10000910 | |||
| 1100 | Ga0157379_10048974 | |||
| 1101 | Ga0157376_10004528 | |||
| 1102 | Ga0182006_1045299 | |||
| 1103 | Ga0182005_1002026 | |||
| 1104 | Ga0183360_10001 | |||
| 1105 | Ga0163161_10005636 | |||
| 1106 | Ga0209563_100007 | |||
| 1107 | Ga0207425_1000079 | |||
| 1108 | Ga0209677_102546 | |||
| 1109 | Ga0209129_1000087 | |||
| 1110 | Ga0209565_1000005 | |||
| 1111 | Ga0209565_1003659 | |||
| 1112 | Ga0209673_1000011 | |||
| 1113 | Ga0209675_1000004 | |||
| 1114 | Ga0209676_1000156 | |||
| 1115 | Ga0209676_1000203 | |||
| 1116 | Ga0209676_1000609 | |||
| 1117 | Ga0209676_1003754 | |||
| 1118 | Ga0209676_1004542 | |||
| 1119 | Ga0209676_1005536 | |||
| 1120 | Ga0209676_1006844 | |||
| 1121 | Ga0209676_1006998 | |||
| 1122 | Ga0209025_1000013 | |||
| 1123 | Ga0209025_1000036 | |||
| 1124 | Ga0209025_1002886 | |||
| 1125 | Ga0209025_1017088 | |||
| 1126 | Ga0209025_1030122 | |||
| 1127 | Ga0209564_1000018 | |||
| 1128 | Ga0209564_1010973 | |||
| 1129 | Ga0209564_1014819 | |||
| 1130 | Ga0209758_1000014 | |||
| 1131 | Ga0209050_1000847 | |||
| 1132 | Ga0209256_1000021 | |||
| 1133 | Ga0209256_1001858 | |||
| 1134 | Ga0209256_1002522 | |||
| 1135 | Ga0209256_1012686 | |||
| 1136 | Ga0209257_1000204 | |||
| 1137 | Ga0209257_1000278 | |||
| 1138 | Ga0209257_1000298 | |||
| 1139 | Ga0209257_1000560 | |||
| 1140 | Ga0209257_1001509 | |||
| 1141 | Ga0209257_1002023 | |||
| 1142 | Ga0209257_1009232 | |||
| 1143 | Ga0209257_1013026 | |||
| 1144 | Ga0207699_10097921 | |||
| 1145 | Ga0207645_10053878 | |||
| 1146 | Ga0207643_10007055 | |||
| 1147 | Ga0207643_10008392 | |||
| 1148 | Ga0207643_10040665 | |||
| 1149 | Ga0207705_10064544 | |||
| 1150 | Ga0207654_10020774 | |||
| 1151 | Ga0207654_10023382 | |||
| 1152 | Ga0207707_10122355 | |||
| 1153 | Ga0207695_10086458 | |||
| 1154 | Ga0207660_10111642 | |||
| 1155 | Ga0207662_10000065 | |||
| 1156 | Ga0207662_10017035 | |||
| 1157 | Ga0207657_10022867 | |||
| 1158 | Ga0207657_10059339 | |||
| 1159 | Ga0207652_10007811 | |||
| 1160 | Ga0207652_10310392 | |||
| 1161 | Ga0207646_10176877 | |||
| 1162 | Ga0207681_10020732 | |||
| 1163 | Ga0207681_10122430 | |||
| 1164 | Ga0207694_10056163 | |||
| 1165 | Ga0207650_10055634 | |||
| 1166 | Ga0207687_10006825 | |||
| 1167 | Ga0207687_10012880 | |||
| 1168 | Ga0207700_10068908 | |||
| 1169 | Ga0207700_10233810 | |||
| 1170 | Ga0207664_10008044 | |||
| 1171 | Ga0207664_10087880 | |||
| 1172 | Ga0207644_10012180 | |||
| 1173 | Ga0207644_10242524 | |||
| 1174 | Ga0207690_10023150 | |||
| 1175 | Ga0207706_10009902 | |||
| 1176 | Ga0207686_10004486 | |||
| 1177 | Ga0207686_10014581 | |||
| 1178 | Ga0207686_10015596 | |||
| 1179 | Ga0207686_10020225 | |||
| 1180 | Ga0207709_10014765 | |||
| 1181 | Ga0207709_10024250 | |||
| 1182 | Ga0207670_10003608 | |||
| 1183 | Ga0207670_10022483 | |||
| 1184 | Ga0207670_10159522 | |||
| 1185 | Ga0207669_10104456 | |||
| 1186 | Ga0207704_10004634 | |||
| 1187 | Ga0207704_10017058 | |||
| 1188 | Ga0207691_10031193 | |||
| 1189 | Ga0207711_10047023 | |||
| 1190 | Ga0207689_10000438 | |||
| 1191 | Ga0207689_10001253 | |||
| 1192 | Ga0207689_10008058 | |||
| 1193 | Ga0207689_10012172 | |||
| 1194 | Ga0207661_10121443 | |||
| 1195 | Ga0207679_10000868 | |||
| 1196 | Ga0207679_10175012 | |||
| 1197 | Ga0207667_10030247 | |||
| 1198 | Ga0207667_10031724 | |||
| 1199 | Ga0207667_10043635 | |||
| 1200 | Ga0207667_10075259 | |||
| 1201 | Ga0207667_10201151 | |||
| 1202 | Ga0207667_10215268 | |||
| 1203 | Ga0207651_10105716 | |||
| 1204 | Ga0207712_10015142 | |||
| 1205 | Ga0207712_10019015 | |||
| 1206 | Ga0207712_10036715 | |||
| 1207 | Ga0207668_10039451 | |||
| 1208 | Ga0207640_10075069 | |||
| 1209 | Ga0207658_10060125 | |||
| 1210 | Ga0207658_10115960 | |||
| 1211 | Ga0207677_10031620 | |||
| 1212 | Ga0207677_10164122 | |||
| 1213 | Ga0207703_10009529 | |||
| 1214 | Ga0207703_10014337 | |||
| 1215 | Ga0207703_10031893 | |||
| 1216 | Ga0207639_10082438 | |||
| 1217 | Ga0207639_10103793 | |||
| 1218 | Ga0207639_10129614 | |||
| 1219 | Ga0207639_10144482 | |||
| 1220 | Ga0207708_10001339 | |||
| 1221 | Ga0207708_10002598 | |||
| 1222 | Ga0207708_10007127 | |||
| 1223 | Ga0207708_10029108 | |||
| 1224 | Ga0207708_10066637 | |||
| 1225 | Ga0207702_10022350 | |||
| 1226 | Ga0207702_10072693 | |||
| 1227 | Ga0207641_10007484 | |||
| 1228 | Ga0207648_10000210 | |||
| 1229 | Ga0207648_10010754 | |||
| 1230 | Ga0207648_10020796 | |||
| 1231 | Ga0207648_10022023 | |||
| 1232 | Ga0207676_10009255 | |||
| 1233 | Ga0207676_10191479 | |||
| 1234 | Ga0207674_10006930 | |||
| 1235 | Ga0207674_10049876 | |||
| 1236 | Ga0207675_100000473 | |||
| 1237 | Ga0207675_100001723 | |||
| 1238 | Ga0207675_100006339 | |||
| 1239 | Ga0207675_100007508 | |||
| 1240 | Ga0207675_100033212 | |||
| 1241 | Ga0207675_100104177 | |||
| 1242 | Ga0207683_10021613 | |||
| 1243 | Ga0207698_10251199 | |||
| 1244 | Ga0209371_1000011 | |||
| 1245 | Ga0207428_10002394 | |||
| 1246 | Ga0207428_10002532 | |||
| 1247 | Ga0207428_10006537 | |||
| 1248 | Ga0207428_10011963 | |||
| 1249 | Ga0207428_10031760 | |||
| 1250 | Ga0268266_10204645 | |||
| 1251 | Ga0268266_10233216 | |||
| 1252 | Ga0268265_10000660 | |||
| 1253 | Ga0268265_10002301 | |||
| 1254 | Ga0268265_10145138 | |||
| 1255 | Ga0268264_10001208 | |||
| 1256 | Ga0268264_10044636 | |||
| 1257 | Ga0268264_10079305 | |||
| 1258 | Ga0307517_10055704 | |||
| 1259 | Ga0268256_1000011 | |||
| 1260 | Ga0265332_10000069 | |||
| 1261 | Ga0265332_10000621 | |||
| 1262 | Ga0307513_10023088 | |||
| 1263 | Ga0307509_10000018 | |||
| 1264 | Ga0307408_100025705 | |||
| 1265 | Ga0307408_100032572 | |||
| 1266 | Ga0307408_100235001 | |||
| 1267 | Ga0307516_10000386 | |||
| 1268 | Ga0307405_10113600 | |||
| 1269 | Ga0307406_10006187 | |||
| 1270 | Ga0307406_10091313 | |||
| 1271 | Ga0307412_10160809 | |||
| 1272 | Ga0307416_100087570 | |||
| 1273 | Ga0307416_100162015 | |||
| 1274 | Ga0307414_10001391 | |||
| 1275 | Ga0307414_10006012 | |||
| 1276 | Ga0307414_10084205 | |||
| 1277 | Ga0307414_10114634 | |||
| 1278 | Ga0307415_100100841 | |||
| 1279 | Ga0307415_100303440 | |||
| 1280 | Ga0373930_0009534 | |||
| 1281 | Ga0373944_0006240 | |||
| 1282 | Ga0373944_0008043 | |||
| 1283 | Ga0373951_0004172 | |||
| 1284 | Ga0373936_0012991 | |||
| 1285 | Ga0373936_0017154 | |||
| 1286 | Ga0373941_0011718 | |||
| 1287 | Ga0373954_0119238 | |||
| 1288 | Ga0373943_0035841 | |||
| 1289 | Ga0373946_0010135 | |||
| 1290 | Ga0373924_0025154 | |||
| 1291 | Ga0373931_0002144 | |||
| 1292 | Ga0373931_0019321 | |||
| 1293 | Ga0373931_0028292 | |||
| 1294 | Ga0373931_0078431 | |||
| 1295 | Ga0373927_0025191 | |||
| 1296 | Ga0373927_0111029 | |||
| 1297 | Ga0373947_0024346 | |||
| 1298 | Ga0373947_0082933 | |||
| 1299 | Ga0373937_0049066 | |||
| 1300 | Ga0373937_0063534 | |||
| 1301 | Ga0373937_0246309 | |||
| 1302 | Ga0373925_0014689 | |||
| 1303 | Ga0373925_0046526 | |||
| 1304 | Ga0395899_0010581 | |||
| 1305 | Ga0395899_0030172 | |||
| 1306 | Ga0395900_0119979 | |||
| 1307 | Ga0395900_0147671 | |||
| 1308 | Ga0395900_0271731 | |||
| 1309 | Ga0395898_0248791 | |||
| 1310 | Ga0395905_0000760 | |||
| 1311 | Ga0395905_0033313 | |||
| 1312 | Ga0395905_0037797 | |||
| 1313 | Ga0395905_0080591 | |||
| 1314 | Ga0395905_0140442 | |||
| 1315 | Ga0395905_0244814 | |||
| 1316 | Ga0395901_0002258 | |||
| 1317 | Ga0395901_0011885 | |||
| 1318 | Ga0237819_00457 | |||
| 1319 | Ga0237816_00019 | |||
| 1320 | Ga0436360_0453682 | |||
| 1321 | Ga0439436_0006667 | |||
| 1322 | Ga0439439_0000762 | |||
| 1323 | Ga0439465_0000341 | |||
| 1324 | Ga0439465_0001011 | |||
| 1325 | Ga0439465_0015568 | |||
| 1326 | Ga0451795_0730108 | |||
| 1327 | Ga0451798_0102601 | |||
| 1328 | Ga0451802_1477178 | |||
| 1329 | Ga0451807_0329075 | |||
| 1330 | Ga0451807_0460780 | |||
| 1331 | Ga0451807_1430651 | |||
| 1332 | Ga0439431_0005416 | |||
| 1333 | Ga0439445_0000418 | |||
| 1334 | Ga0439445_0008016 | |||
| 1335 | Ga0439448_0001012 | |||
| 1336 | Ga0439449_0000054 | |||
| 1337 | Ga0450904_000561 | |||
| 1338 | Ga0451577_0002661 | |||
| 1339 | Ga0451577_0005688 | |||
| 1340 | Ga0451577_0047571 | |||
| 1341 | Ga0451577_0152483 | |||
| 1342 | Ga0466972_0001868 | |||
| 1343 | Ga0453683_0160379 | |||
| 1344 | Ga0466965_0001068 | |||
| 1345 | Ga0466966_0002614 | |||
| 1346 | Ga0466966_0059519 | |||
| 1347 | Ga0466966_0061420 | |||
| 1348 | Ga0466961_0069181 | |||
| 1349 | Ga0466964_0000439 | |||
| 1350 | Ga0466968_0001260 | |||
| 1351 | Ga0466959_0017154 | |||
| 1352 | Ga0451576_0000675 | |||
| 1353 | Ga0451576_0002092 | |||
| 1354 | Ga0451576_0006176 | |||
| 1355 | Ga0451576_0090949 | |||
| 1356 | Ga0451576_0105681 | |||
| 1357 | Ga0451576_0238812 | |||
| 1358 | Ga0451576_0312658 | |||
| 1359 | Ga0466967_0339935 | |||
| 1360 | Ga0495617_000940 | |||
| 1361 | Ga0495627_008987 | |||
| 1362 | Ga0495592_0176358 | |||
| 1363 | Ga0495603_0100907 | |||
| 1364 | Ga0495590_0024555 | |||
| 1365 | Ga0495591_027772 | |||
| 1366 | Ga0495629_0041452 | |||
| 1367 | Ga0495638_0001975 | |||
| 1368 | Ga0495638_0066413 | |||
| 1369 | Ga0495650_0000048 | |||
| 1370 | Ga0495650_0000292 | |||
| 1371 | Ga0495650_0011282 | |||
| 1372 | Ga0495605_0000652 | |||
| 1373 | Ga0495605_0010723 | |||
| 1374 | Ga0495605_0048675 | |||
| 1375 | Ga0495584_0000006 | |||
| 1376 | Ga0495584_0000495 | |||
| 1377 | Ga0495584_0002112 | |||
| 1378 | Ga0495584_0024537 | |||
| 1379 | Ga0495584_0045621 | |||
| 1380 | Ga0495585_0000061 | |||
| 1381 | Ga0495585_0000207 | |||
| 1382 | Ga0495585_0000265 | |||
| 1383 | Ga0495585_0000972 | |||
| 1384 | Ga0495585_0036102 | |||
| 1385 | Ga0495594_0002393 | |||
| 1386 | Ga0495594_0051460 | |||
| 1387 | Ga0495594_0119125 | |||
| 1388 | Ga0495596_0001025 | |||
| 1389 | Ga0495596_0001109 | |||
| 1390 | Ga0495596_0004521 | |||
| 1391 | Ga0495607_0002364 | |||
| 1392 | Ga0495607_0004272 | |||
| 1393 | Ga0495607_0005188 | |||
| 1394 | Ga0495607_0005552 | |||
| 1395 | Ga0495607_0032942 | |||
| 1396 | Ga0495583_0000941 | |||
| 1397 | Ga0495583_0001016 | |||
| 1398 | Ga0495583_0009279 | |||
| 1399 | Ga0495583_0011121 | |||
| 1400 | Ga0495583_0015704 | |||
| 1401 | Ga0495606_0004606 | |||
| 1402 | Ga0495606_0009601 | |||
| 1403 | Ga0495606_0023823 | |||
| 1404 | Ga0495606_0104058 | |||
| 1405 | Ga0495606_0130137 | |||
| 1406 | Ga0495610_0008048 | |||
| 1407 | Ga0495616_0000097 | |||
| 1408 | Ga0495616_0000827 | |||
| 1409 | Ga0495616_0004577 | |||
| 1410 | Ga0495616_0015904 | |||
| 1411 | Ga0495616_0023743 | |||
| 1412 | Ga0495616_0061112 | |||
| 1413 | Ga0495631_0003948 | |||
| 1414 | Ga0495631_0010256 | |||
| 1415 | Ga0495631_0011067 | |||
| 1416 | Ga0495631_0018703 | |||
| 1417 | Ga0495631_0024570 | |||
| 1418 | Ga0495632_0000267 | |||
| 1419 | Ga0495632_0000604 | |||
| 1420 | Ga0495632_0003433 | |||
| 1421 | Ga0495632_0037304 | |||
| 1422 | Ga0495632_0040941 | |||
| 1423 | Ga0495637_0039022 | |||
| 1424 | Ga0495643_0000432 | |||
| 1425 | Ga0495643_0001321 | |||
| 1426 | Ga0495643_0006079 | |||
| 1427 | Ga0495643_0007868 | |||
| 1428 | Ga0495643_0008842 | |||
| 1429 | Ga0495643_0019290 | |||
| 1430 | Ga0495644_0017595 | |||
| 1431 | Ga0495648_0000096 | |||
| 1432 | Ga0495648_0035332 | |||
| 1433 | Ga0495648_0098884 | |||
| 1434 | Ga0495663_0001704 | |||
| 1435 | Ga0495663_0004634 | |||
| 1436 | Ga0495663_0005706 | |||
| 1437 | Ga0495663_0015893 | |||
| 1438 | Ga0495642_0000746 | |||
| 1439 | Ga0495642_0009192 | |||
| 1440 | Ga0495642_0016654 | |||
| 1441 | Ga0495642_0019073 | |||
| 1442 | Ga0495642_0027377 | |||
| 1443 | Ga0495665_0003914 | |||
| 1444 | Ga0495586_0022463 | |||
| 1445 | Ga0495586_0038008 | |||
| 1446 | Ga0495587_0165012 | |||
| 1447 | Ga0495609_0000731 | |||
| 1448 | Ga0495609_0000857 | |||
| 1449 | Ga0495609_0002565 | |||
| 1450 | Ga0495609_0036870 | |||
| 1451 | Ga0495609_0063676 | |||
| 1452 | Ga0495597_0002776 | |||
| 1453 | Ga0495597_0005968 | |||
| 1454 | Ga0495597_0021087 | |||
| 1455 | Ga0495645_0038819 | |||
| 1456 | Ga0495622_0001642 | |||
| 1457 | Ga0495622_0018356 | |||
| 1458 | Ga0495622_0101857 | |||
| 1459 | Ga0495622_0110027 | |||
| 1460 | Ga0495633_0004334 | |||
| 1461 | Ga0495633_0006439 | |||
| 1462 | Ga0495633_0008724 | |||
| 1463 | Ga0495667_0077035 | |||
| 1464 | Ga0495668_0001114 | |||
| 1465 | Ga0495668_0002176 | |||
| 1466 | Ga0495668_0007237 | |||
| 1467 | Ga0495668_0015647 | |||
| 1468 | Ga0495668_0125926 | |||
| 1469 | Ga0495668_0133182 | |||
| 1470 | Ga0495611_0006802 | |||
| 1471 | Ga0495611_0012508 | |||
| 1472 | Ga0495625_0182908 | |||
| 1473 | Ga0495661_0000894 | |||
| 1474 | Ga0495661_0002340 | |||
| 1475 | Ga0495661_0004974 | |||
| 1476 | Ga0495661_0005871 | |||
| 1477 | Ga0495661_0008538 | |||
| 1478 | Ga0495661_0010678 | |||
| 1479 | Ga0495661_0038966 | |||
| 1480 | Ga0495661_0056703 | |||
| 1481 | Ga0495661_0121889 | |||
| 1482 | Ga0495588_0000174 | |||
| 1483 | Ga0495588_0052754 | |||
| 1484 | Ga0495669_0007006 | |||
| 1485 | Ga0495624_0010461 | |||
| 1486 | Ga0495670_0005413 | |||
| 1487 | Ga0495671_0001737 | |||
| 1488 | Ga0495671_0003344 | |||
| 1489 | Ga0495671_0017420 | |||
| 1490 | Ga0495649_0039193 | |||
| 1491 | Ga0495589_0000693 | |||
| 1492 | Ga0495589_0000990 | |||
| 1493 | Ga0495589_0020146 | |||
| 1494 | Ga0495589_0029408 | |||
| 1495 | Ga0495660_0000157 | |||
| 1496 | Ga0495660_0038108 | |||
| 1497 | Ga0495660_0087114 | |||
| 1498 | Ga0495581_0016929 | |||
| 1499 | Ga0495636_0000593 | |||
| 1500 | Ga0495674_0005713 | |||
| 1501 | Ga0495672_0000333 | |||
| 1502 | Ga0495672_0003512 | |||
| 1503 | Ga0495672_0009609 | |||
| 1504 | Ga0495672_0018529 | |||
| 1505 | Ga0495672_0027488 | |||
| 1506 | Ga0495680_0060320 | |||
| 1507 | Ga0495683_0000041 | |||
| 1508 | Ga0495683_0020521 | |||
| 1509 | Ga0495683_0022080 | |||
| 1510 | Ga0495687_000215 | |||
| 1511 | Ga0495687_000457 | |||
| 1512 | Ga0495687_001337 | |||
| 1513 | Ga0495687_006930 | |||
| 1514 | Ga0495687_021704 | |||
| 1515 | Ga0495687_036968 | |||
| 1516 | Ga0495675_0115874 | |||
| 1517 | Ga0495677_0000259 | |||
| 1518 | Ga0495677_0000915 | |||
| 1519 | Ga0495677_0001756 | |||
| 1520 | Ga0495677_0005432 | |||
| 1521 | Ga0495677_0024538 | |||
| 1522 | Ga0495673_0008170 | |||
| 1523 | Ga0495681_0000629 | |||
| 1524 | Ga0495681_0018454 | |||
| 1525 | Ga0495681_0020724 | |||
| 1526 | Ga0495681_0021411 | |||
| 1527 | Ga0495681_0061283 | |||
| 1528 | Ga0495686_0000356 | |||
| 1529 | Ga0495686_0011389 | |||
| 1530 | Ga0495593_0028400 | |||
| 1531 | Ga0495614_0068694 | |||
| 1532 | Ga0495626_0000016 | |||
| 1533 | Ga0495626_0000640 | |||
| 1534 | Ga0495626_0001380 | |||
| 1535 | Ga0495626_0002008 | |||
| 1536 | Ga0495626_0002438 | |||
| 1537 | Ga0495626_0002604 | |||
| 1538 | Ga0495626_0006273 | |||
| 1539 | Ga0495626_0011312 | |||
| 1540 | Ga0495626_0019856 | |||
| 1541 | Ga0496100_0105627 | |||
| 1542 | Ga0496100_0167502 | |||
| 1543 | Ga0496102_0023234 | |||
| 1544 | Ga0496102_0044099 | |||
| 1545 | Ga0496102_0482136 | |||
| 1546 | Ga0496103_0010228 | |||
| 1547 | Ga0496104_0051477 | |||
| 1548 | Ga0496106_0084488 | |||
| 1549 | Ga0496106_0099602 | |||
| 1550 | Ga0496107_0058584 | |||
| 1551 | Ga0496108_0255380 | |||
| 1552 | Ga0496109_0080458 | |||
| 1553 | Ga0496109_0112533 | |||
| 1554 | Ga0496109_0253372 | |||
| 1555 | Ga0496110_0017299 | |||
| 1556 | Ga0496111_0014500 | |||
| 1557 | Ga0496111_0048076 | |||
| 1558 | Ga0496113_0001052 | |||
| 1559 | Ga0496113_0031830 | |||
| 1560 | Ga0496113_0034554 | |||
| 1561 | Ga0496113_0043642 | |||
| 1562 | Ga0496114_0002540 | |||
| 1563 | Ga0496115_0001055 | |||
| 1564 | Ga0496115_0150027 | |||
| 1565 | Ga0496116_0018948 | |||
| 1566 | Ga0496117_0010323 | |||
| 1567 | Ga0496117_0015652 | |||
| 1568 | Ga0496117_0017213 | |||
| 1569 | Ga0496117_0018365 | |||
| 1570 | Ga0496117_0052830 | |||
| 1571 | Ga0496118_0013416 | |||
| 1572 | Ga0496118_0016030 | |||
| 1573 | Ga0496118_0016359 | |||
| 1574 | Ga0496118_0018462 | |||
| 1575 | Ga0496118_0037647 | |||
| 1576 | Ga0496118_0051396 | |||
| 1577 | Ga0496118_0092489 | |||
| 1578 | Ga0496121_0033648 | |||
| 1579 | Ga0496121_0190246 | |||
| 1580 | Ga0496122_0003343 | |||
| 1581 | Ga0496122_0013150 | |||
| 1582 | Ga0496122_0014643 | |||
| 1583 | Ga0496122_0025680 | |||
| 1584 | Ga0496122_0108151 | |||
| 1585 | Ga0496123_0001399 | |||
| 1586 | Ga0496123_0002772 | |||
| 1587 | Ga0496123_0006033 | |||
| 1588 | Ga0496123_0020992 | |||
| 1589 | Ga0496124_0000018 | |||
| 1590 | Ga0496124_0002026 | |||
| 1591 | Ga0496124_0005171 | |||
| 1592 | Ga0496124_0006351 | |||
| 1593 | Ga0496124_0017367 | |||
| 1594 | Ga0496124_0022379 | |||
| 1595 | Ga0496124_0023215 | |||
| 1596 | Ga0496124_0026567 | |||
| 1597 | Ga0496124_0091350 | |||
| 1598 | Ga0496124_0115839 | |||
| 1599 | Ga0496124_0125716 | |||
| 1600 | Ga0496125_0000954 | |||
| 1601 | Ga0496125_0001095 | |||
| 1602 | Ga0496125_0011785 | |||
| 1603 | Ga0496125_0065938 | |||
| 1604 | Ga0496126_0004287 | |||
| 1605 | Ga0496126_0018169 | |||
| 1606 | Ga0496126_0069132 | |||
| 1607 | Ga0495678_002888 | |||
| 1608 | Ga0495678_007954 | |||
| 1609 | Ga0501299_002715 | |||
| 1610 | Ga0501033_0030923 | |||
| 1611 | Ga0501034_0000458 | |||
| 1612 | Ga0501034_0035041 | |||
| 1613 | Ga0501036_0022362 | |||
| 1614 | Ga0501036_0148311 | |||
| 1615 | Ga0501037_0031215 | |||
| 1616 | Ga0501038_0010174 | |||
| 1617 | Ga0501039_0008418 | |||
| 1618 | Ga0501040_0000273 | |||
| 1619 | Ga0501041_0000391 | |||
| 1620 | Ga0501041_0022733 | |||
| 1621 | Ga0501042_0001697 | |||
| 1622 | Ga0501043_0001632 | |||
| 1623 | Ga0501046_0008085 | |||
| 1624 | Ga0501048_0003439 | |||
| 1625 | Ga0501067_0059046 | |||
| 1626 | Ga0501068_0007720 | |||
| 1627 | Ga0501068_0015391 | |||
| 1628 | Ga0501068_0018426 | |||
| 1629 | Ga0501069_0107720 | |||
| 1630 | Ga0501070_0007880 | |||
| 1631 | Ga0501070_0019761 | |||
| 1632 | Ga0501070_0057050 | |||
| 1633 | Ga0501071_0006024 | |||
| 1634 | Ga0501071_0018711 | |||
| 1635 | Ga0501072_0002420 | |||
| 1636 | Ga0501072_0003820 | |||
| 1637 | Ga0501072_0080930 | |||
| 1638 | Ga0501073_0001960 | |||
| 1639 | Ga0501073_0003818 | |||
| 1640 | Ga0501074_0023364 | |||
| 1641 | Ga0501074_0045182 | |||
| 1642 | Ga0501075_0006782 | |||
| 1643 | Ga0501075_0010513 | |||
| 1644 | Ga0501075_0125698 | |||
| 1645 | Ga0501076_0001245 | |||
| 1646 | Ga0501076_0085353 | |||
| 1647 | Ga0501076_0090837 | |||
| 1648 | Ga0501077_0000753 | |||
| 1649 | Ga0501079_0002097 | |||
| 1650 | Ga0501079_0002850 | |||
| 1651 | Ga0501079_0025648 | |||
| 1652 | Ga0501079_0111382 | |||
| 1653 | Ga0501080_0000818 | |||
| 1654 | Ga0501080_0003459 | |||
| 1655 | Ga0501080_0019849 | |||
| 1656 | Ga0501080_0304695 | |||
| 1657 | Ga0501081_0000278 | |||
| 1658 | Ga0501081_0001474 | |||
| 1659 | Ga0501083_0027034 | |||
| 1660 | Ga0501083_0045419 | |||
| 1661 | Ga0501035_0067269 | |||
| 1662 | nmdc:mga0k408_5496_c1 | |||
| 1663 | nmdc:mga05p37_1470_c1 | |||
| 1664 | nmdc:mga05p37_6956_c1 | |||
| 1665 | nmdc:mga05p37_88921_c1 | |||
| 1666 | nmdc:mga09592_1178_c1 | |||
| 1667 | nmdc:mga09592_12799_c1 | |||
| 1668 | nmdc:mga09592_235667_c1 | |||
| 1669 | nmdc:mga0qj67_168929_c1 | |||
| 1670 | nmdc:mga0qj67_2826_c1 | |||
| 1671 | nmdc:mga0qj67_66637_c1 | |||
| 1672 | nmdc:mga06r32_1285_c1 | |||
| 1673 | nmdc:mga06r32_17513_c1 | |||
| 1674 | nmdc:mga08y16_2320_c1 | |||
| 1675 | nmdc:mga08y16_47576_c2 | |||
| 1676 | nmdc:mga08y16_62688_c1 | |||
| 1677 | nmdc:mga08y16_867_c1 | |||
| 1678 | nmdc:mga0rr50_78835_c1 | |||
| 1679 | nmdc:mga08x19_1519_c1 | |||
| 1680 | nmdc:mga08x19_53276_c1 | |||
| 1681 | nmdc:mga0a205_194111_c1 | |||
| 1682 | nmdc:mga0a205_61379_c1 | |||
| 1683 | Ga0495601_0040248 | |||
| 1684 | Ga0495595_0103821 | |||
| 1685 | Ga0495619_0004286 | |||
| 1686 | Ga0500556_0000700 | |||
| 1687 | Ga0500617_048158 | |||
| 1688 | Ga0500634_0058877 | |||
| 1689 | Ga0500636_0000423 | |||
| 1690 | Ga0500565_000304 | |||
| 1691 | Ga0501084_0009919 | |||
| 1692 | Ga0501084_0092272 | |||
| 1693 | Ga0590071_004146 | |||
| 1694 | Ga0501082_0000863 | |||
| 1695 | Ga0466962_0063890 | |||
| 1696 | Ga0530510_0005243 | |||
| 1697 | Ga0530510_0058118 | |||
| 1698 | 2643975462 | |||
| 1699 | 2572256131 | |||
| 1700 | 2578459088 | |||
| 1701 | 2643802188 | |||
| 1702 | 2643815840 | |||
| 1703 | 2643878026 | |||
| 1704 | 2643906278 | |||
| 1705 | 2643915297 | |||
| 1706 | 2643940650 | |||
| 1707 | 2644080640 | |||
| 1708 | 2644475697 | |||
| 1709 | 2644528466 | |||
| 1710 | 2644659337 | |||
| 1711 | 2644695895 | |||
| 1712 | 2644700919 | |||
| 1713 | 2748019166 | |||
| 1714 | 2819663729 | |||
| 1715 | 2842759457 | |||
| 1716 | 2842781584 | |||
| 1717 | 2852686420 | |||
| 1718 | 2857443181 | |||
| 1719 | 2891635645 | |||
| 1720 | 2894024807 | |||
| 1721 | 2895501220 | |||
| 1722 | 2895514363 | |||
| 1723 | 2895524156 | |||
| 1724 | 2895527643 | |||
| 1725 | 2919132537 | |||
| 1726 | 2929196995 | |||
| 1727 | 2939626459 | |||
| 1728 | 2941476860 | |||
| 1729 | 2941494577 | |||
| 1730 | 2987607643 | |||
| 1731 | 2995952799 | |||
| 1732 | 639785179 | |||
| 1733 | 8002869533 | |||
| 1734 | 8003014927 | |||
| 1735 | 8047673960 | |||
| 1736 | 8048749090 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hpk-assembly1.cif.gz_A | crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form | 0.8962 | 3 | 394 |
| 8hpk-assembly1.cif.gz_A | crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form | 0.881 | 3 | 394 |
| 7yr5-assembly1.cif.gz_A | embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state | 0.8773 | 3 | 385 |
| 6kki-assembly1.cif.gz_A | crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation | 0.8695 | 1 | 388 |
| 6kkj-assembly1.cif.gz_B | crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation | 0.8687 | 3 | 388 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8T043_137_396_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9494 | 3 | 182 | 1.20.1250.20 |
| af_Q5NC32_11_193_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9333 | 3 | 182 | 1.20.1250.20 |
| af_H2L0E6_75_299_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9326 | 3 | 182 | 1.20.1250.20 |
| af_Q8BGC3_15_203_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9268 | 3 | 182 | 1.20.1250.20 |
| af_E7FGJ9_71_276_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9215 | 3 | 186 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S6M6N0-F1-model_v4 | MFS transporter | 0.8967 | 3 | 180 |
GO:0005886
GO:0022857 |
| AF-A0A511KIA1-F1-model_v4 | MFS transporter, monocarboxylate permease-like protein | 0.8952 | 3 | 386 |
GO:0016020
GO:0022857 |
| AF-A0A5E3XLK8-F1-model_v4 | Major facilitator superfamily (MFS) profile domain-containing protein | 0.8856 | 3 | 385 |
GO:0016020
GO:0022857 |
| AF-A0A382GL38-F1-model_v4 | Major facilitator superfamily (MFS) profile domain-containing protein | 0.8848 | 3 | 191 |
GO:0016020
GO:0022857 |
| AF-V5HX55-F1-model_v4 | Putative monocarboxylate transporter | 0.8834 | 6 | 187 |
GO:0008028
GO:0016020 |