F484104

General Info

Members Datasets Scaffolds Average Seq Length
868 421 1736 394

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221593|2643975462
Length 455
Sequence PTASLGPKPTSYWPLLLAATAMLMITMGIRQSQGLLIKPIGHSTGLGIAEISFALAIGQFVWGAVQPVFGALADQRGPGRVLVFGGVLLIAGMALTPLVSSQWGLIVTLGLLGAAGAGAGSFSILIGATAQRLPAEKRSMAAGVINAGGSMGQFVFAPLVQAVIAAAGWMAAMWTLAAAAVATLPLAWPLRRRAEIATASTTTPAAPPGIGLREQLRIALRDRSYWMLHVGFFTCGFHIAFLVTHLPGEIALCGLSDNVSAMALALIGLFNVAGSLAAGWLGQRYRMKHLLALMYASRAAMIAIYLISPPTPLTFYLFAAGLGVTWLATVPPTAGLVGKLFGPRYLGTLFGLTLLSHQIGGFFGAWLGGLAMAKFGDYTWMWYADIALALIAALANLPIREARPMRVSGLAAAXXXIRDSGFGIRESGIGNRESGIGGDGSMLGAGCRARNEPHP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
117 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
118 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
122 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
124 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
189 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
190 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
202 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
203 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
204 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
206 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
221 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
222 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
223 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
224 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
225 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
226 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
227 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
228 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
229 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
230 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
231 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
232 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
233 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
234 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
235 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
236 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
237 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
238 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
239 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
240 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
241 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
242 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
243 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
244 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
245 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
246 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
247 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
248 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
249 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
250 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
251 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
255 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
256 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
257 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
258 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
259 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
260 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
261 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
262 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
263 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
264 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
265 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
266 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
267 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
268 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
269 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
270 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
271 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
272 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
273 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
274 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
275 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
276 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
277 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
278 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
279 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
280 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
281 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
282 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
283 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
284 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
285 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
286 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
287 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
290 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
291 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
292 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
293 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
294 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
295 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
296 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
297 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
298 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
299 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
300 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
301 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
302 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
303 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
304 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
305 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
308 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
309 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
312 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
313 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
314 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
315 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
316 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
317 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
318 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
319 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
320 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
321 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
322 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
323 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
324 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
325 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
326 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
327 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
328 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
329 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
330 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
331 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
332 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
333 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
346 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
347 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
348 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
349 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
350 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
351 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
352 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
353 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
354 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
355 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
356 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
357 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
358 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
359 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
360 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
361 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
362 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
363 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
364 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
365 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
366 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
367 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
368 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
369 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
370 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
371 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
372 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
373 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
374 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
375 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
376 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
377 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
378 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
379 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
380 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
381 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
382 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
383 2643221593 Lysobacter sp. Root690 Isolate Unclassified
384 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
385 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
386 2643221556 Massilia sp. Root1485 Isolate Unclassified
387 2643221559 Lysobacter sp. Root559 Isolate Unclassified
388 2643221573 Lysobacter sp. Root604 Isolate Unclassified
389 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
390 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
391 2643221586 Lysobacter sp. Root667 Isolate Unclassified
392 2643221612 Lysobacter sp. Root76 Isolate Unclassified
393 2643221684 Massilia sp. Root133 Isolate Unclassified
394 2643221695 Lysobacter sp. Root494 Isolate Unclassified
395 2643221720 Lysobacter sp. Root916 Isolate Unclassified
396 2643221727 Lysobacter sp. Root96 Isolate Unclassified
397 2643221728 Lysobacter sp. Root983 Isolate Unclassified
398 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
399 2818991457 Xanthomonas translucens 569 Isolate Unclassified
400 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
401 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
402 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
403 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
404 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
405 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
406 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
407 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
408 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
409 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
410 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
411 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
412 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
413 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
414 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
415 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
416 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
417 639633007 Azoarcus olearius BH72 Isolate Unclassified
418 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
419 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
420 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
421 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.51
Metatranscriptomes 0
Isolates 4.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.06
Nodule 0.12
Rhizoplane 3.46
Rhizosphere 80.07
Stem 0
Stem Tuber 0
Unclassified 1.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1672945 2162886007 Bacteria 2348
2 JGI25152J39213_1000142 3300002773 Bacteria 49042
3 JGI25150J39212_1000204 3300002774 Bacteria 32292
4 JGI25150J39212_1000776 3300002774 Bacteria 10987
5 JGI25151J46595_10000237 3300003187 Bacteria 64983
6 JGI25151J46595_10000530 3300003187 Bacteria 35539
7 JGI25406J46586_10027080 3300003203 Bacteria 2203
8 JGI25153J46596_10000171 3300003215 Bacteria 64983
9 Ga0055525_1000001 3300003759 Bacteria 1016948
10 Ga0055526_1000011 3300003771 Bacteria 236316
11 Ga0055537_1000007 3300003773 Bacteria 144691
12 Ga0055524_1000252 3300003775 Bacteria 55567
13 Ga0055524_1009708 3300003775 Bacteria 3889
14 Ga0055524_1016052 3300003775 Bacteria 2703
15 Ga0055536_1002333 3300003781 Bacteria 10737
16 Ga0055536_1004882 3300003781 Bacteria 6695
17 Ga0055536_1006875 3300003781 Bacteria 5196
18 Ga0055534_1000134 3300003784 Bacteria 55567
19 Ga0055528_1000005 3300003790 Bacteria 236316
20 Ga0055530_10003751 3300003791 Bacteria 8391
21 Ga0055530_10003859 3300003791 Bacteria 8212
22 Ga0055531_10003052 3300003794 Bacteria 10849
23 Ga0055531_10004686 3300003794 Bacteria 8195
24 Ga0055531_10005668 3300003794 Bacteria 7252
25 Ga0055531_10006402 3300003794 Bacteria 6695
26 Ga0055531_10007572 3300003794 Bacteria 5887
27 Ga0055531_10024636 3300003794 Bacteria 2212
28 Ga0058692_1000020 3300003856 Bacteria 250589
29 Ga0065704_10072403 3300005289 Bacteria 8595
30 Ga0065704_10075997 3300005289 Bacteria 5312
31 Ga0065707_10082801 3300005295 Bacteria 12010
32 Ga0070658_10088428 3300005327 Bacteria 2551
33 Ga0070690_100000304 3300005330 Bacteria 25349
34 Ga0070690_100004891 3300005330 Bacteria 7489
35 Ga0070690_100008748 3300005330 Bacteria 5844
36 Ga0070670_100051105 3300005331 Bacteria 3551
37 Ga0070670_100053604 3300005331 Bacteria 3463
38 Ga0068869_100001121 3300005334 Bacteria 15610
39 Ga0068869_100002021 3300005334 Bacteria 12203
40 Ga0068869_100008179 3300005334 Bacteria 6730
41 Ga0068869_100171056 3300005334 Bacteria 1697
42 Ga0068869_100193841 3300005334 Bacteria 1599
43 Ga0070666_10206907 3300005335 Bacteria 1381
44 Ga0070680_100000577 3300005336 Bacteria 25228
45 Ga0070680_100136385 3300005336 Bacteria 2056
46 Ga0070682_100007634 3300005337 Bacteria 6093
47 Ga0068868_100001956 3300005338 Bacteria 14133
48 Ga0068868_100190128 3300005338 Bacteria 1707
49 Ga0070689_100000495 3300005340 Bacteria 23187
50 Ga0070689_100004674 3300005340 Bacteria 9278
51 Ga0070689_100195136 3300005340 Bacteria 1650
52 Ga0070687_100000550 3300005343 Bacteria 12563
53 Ga0070687_100011964 3300005343 Bacteria 3814
54 Ga0070661_100000902 3300005344 Bacteria 21298
55 Ga0070661_100042119 3300005344 Bacteria 3332
56 Ga0070692_10000958 3300005345 Bacteria 9830
57 Ga0070669_100011209 3300005353 Bacteria 6362
58 Ga0070675_100025842 3300005354 Bacteria 4708
59 Ga0070675_100295291 3300005354 Bacteria 1427
60 Ga0070671_100006492 3300005355 Bacteria 9354
61 Ga0070671_100022859 3300005355 Bacteria 5109
62 Ga0070673_100013197 3300005364 Bacteria 5703
63 Ga0070688_100022441 3300005365 Bacteria 3699
64 Ga0070659_100012772 3300005366 Bacteria 6236
65 Ga0070659_100289793 3300005366 Bacteria 1363
66 Ga0070667_100046068 3300005367 Bacteria 3667
67 Ga0070667_100214983 3300005367 Bacteria 1710
68 Ga0070714_100009958 3300005435 Bacteria 7497
69 Ga0070713_100161211 3300005436 Bacteria 2002
70 Ga0070701_10002048 3300005438 Bacteria 7659
71 Ga0070705_100001366 3300005440 Bacteria 13013
72 Ga0070705_100124375 3300005440 Bacteria 1671
73 Ga0070700_100009789 3300005441 Bacteria 5271
74 Ga0070700_100019061 3300005441 Bacteria 3955
75 Ga0070694_100003452 3300005444 Bacteria 9469
76 Ga0070662_100004627 3300005457 Bacteria 8720
77 Ga0070681_10005492 3300005458 Bacteria 12248
78 Ga0068867_100005182 3300005459 Bacteria 9194
79 Ga0068867_100006856 3300005459 Bacteria 8056
80 Ga0068867_100017877 3300005459 Bacteria 5036
81 Ga0068867_100066009 3300005459 Unclassified 2694
82 Ga0070685_10030763 3300005466 Bacteria 2994
83 Ga0070706_100030805 3300005467 Bacteria 4945
84 Ga0070706_100085528 3300005467 Bacteria 2922
85 Ga0070707_100024555 3300005468 Bacteria 5709
86 Ga0068853_100005626 3300005539 Bacteria 9843
87 Ga0068853_100017678 3300005539 Bacteria 5885
88 Ga0068853_100033254 3300005539 Bacteria 4374
89 Ga0068853_100035939 3300005539 Bacteria 4210
90 Ga0068853_100100529 3300005539 Bacteria 2556
91 Ga0070672_100131654 3300005543 Unclassified 2056
92 Ga0070686_100000422 3300005544 Bacteria 26627
93 Ga0070686_100000547 3300005544 Bacteria 22480
94 Ga0070695_100000545 3300005545 Bacteria 19908
95 Ga0070696_100004990 3300005546 Bacteria 8865
96 Ga0070693_100000217 3300005547 Bacteria 26662
97 Ga0070693_100008113 3300005547 Bacteria 5158
98 Ga0070665_100014118 3300005548 Bacteria 8025
99 Ga0070665_100287866 3300005548 Bacteria 1645
100 Ga0070704_100001284 3300005549 Bacteria 13271
101 Ga0068855_100010002 3300005563 Bacteria 11428
102 Ga0068855_100028998 3300005563 Bacteria 6620
103 Ga0068855_100157396 3300005563 Bacteria 2580
104 Ga0068855_100159538 3300005563 Bacteria 2561
105 Ga0068855_100302869 3300005563 Bacteria 1770
106 Ga0070664_100001457 3300005564 Bacteria 18851
107 Ga0070664_100070200 3300005564 Bacteria 2999
108 Ga0070664_100178109 3300005564 Bacteria 1889
109 Ga0068857_100006759 3300005577 Bacteria 9865
110 Ga0068857_100014875 3300005577 Bacteria 6786
111 Ga0068854_100073833 3300005578 Bacteria 2501
112 Ga0068856_100028193 3300005614 Bacteria 5481
113 Ga0068856_100241183 3300005614 Bacteria 1823
114 Ga0070702_100000054 3300005615 Bacteria 32217
115 Ga0068859_100010162 3300005617 Bacteria 9477
116 Ga0068859_100044017 3300005617 Bacteria 4486
117 Ga0068859_100119817 3300005617 Unclassified 2698
118 Ga0068864_100001460 3300005618 Bacteria 19482
119 Ga0068864_100113405 3300005618 Unclassified 2416
120 Ga0068866_10006629 3300005718 Bacteria 4827
121 Ga0068866_10012069 3300005718 Bacteria 3758
122 Ga0068861_100000451 3300005719 Bacteria 23896
123 Ga0068861_100003216 3300005719 Bacteria 10806
124 Ga0068861_100004280 3300005719 Bacteria 9570
125 Ga0068861_100012205 3300005719 Bacteria 5990
126 Ga0068870_10003143 3300005840 Bacteria 6964
127 Ga0068870_10053884 3300005840 Unclassified 2138
128 Ga0068863_100000931 3300005841 Bacteria 29369
129 Ga0068858_100001326 3300005842 Bacteria 25540
130 Ga0068858_100008731 3300005842 Bacteria 9730
131 Ga0068858_100024304 3300005842 Bacteria 5647
132 Ga0068858_100116032 3300005842 Bacteria 2502
133 Ga0068860_100104821 3300005843 Bacteria 2700
134 Ga0068860_100121252 3300005843 Bacteria 2504
135 Ga0068860_100231045 3300005843 Bacteria 1798
136 Ga0068862_100000298 3300005844 Bacteria 54436
137 Ga0068862_100001914 3300005844 Bacteria 18898
138 Ga0068862_100063541 3300005844 Bacteria 3176
139 Ga0081455_10002298 3300005937 Bacteria 22769
140 Ga0081539_10006699 3300005985 Bacteria 10864
141 Ga0070717_10014065 3300006028 Bacteria 6151
142 Ga0075432_10016650 3300006058 Bacteria 2509
143 Ga0070716_100042222 3300006173 Bacteria 2545
144 Ga0070712_100086673 3300006175 Bacteria 2283
145 Ga0075366_10035159 3300006195 Bacteria 2954
146 Ga0097621_100000597 3300006237 Bacteria 25447
147 Ga0097621_100001777 3300006237 Bacteria 14789
148 Ga0097621_100014685 3300006237 Bacteria 5869
149 Ga0068871_100000468 3300006358 Bacteria 27659
150 Ga0068871_100051922 3300006358 Bacteria 3319
151 Ga0068871_100278172 3300006358 Bacteria 1463
152 Ga0075428_100001778 3300006844 Bacteria 23015
153 Ga0075428_100002997 3300006844 Bacteria 18422
154 Ga0075428_100004615 3300006844 Bacteria 15239
155 Ga0075428_100026828 3300006844 Bacteria 6378
156 Ga0075428_100035227 3300006844 Bacteria 5518
157 Ga0075428_100107742 3300006844 Bacteria 3036
158 Ga0075430_100010916 3300006846 Bacteria 7695
159 Ga0075430_100020910 3300006846 Bacteria 5563
160 Ga0075430_100055650 3300006846 Bacteria 3326
161 Ga0075430_100143248 3300006846 Bacteria 1990
162 Ga0075431_100000055 3300006847 Bacteria 62773
163 Ga0075431_100041495 3300006847 Bacteria 4744
164 Ga0075433_10312398 3300006852 Bacteria 1391
165 Ga0075434_100000663 3300006871 Bacteria 26680
166 Ga0075429_100001097 3300006880 Bacteria 21808
167 Ga0075429_100002231 3300006880 Bacteria 16196
168 Ga0075429_100010147 3300006880 Bacteria 8159
169 Ga0075429_100088568 3300006880 Bacteria 2698
170 Ga0068865_100002672 3300006881 Bacteria 10583
171 Ga0068865_100003241 3300006881 Bacteria 9750
172 Ga0075436_100004535 3300006914 Bacteria 9519
173 Ga0075436_100013037 3300006914 Bacteria 5699
174 Ga0097620_100010162 3300006931 Bacteria 9477
175 Ga0097620_100044019 3300006931 Bacteria 4486
176 Ga0097620_100119815 3300006931 Unclassified 2698
177 Ga0075435_100011822 3300007076 Bacteria 6444
178 Ga0105240_10092762 3300009093 Bacteria 3686
179 Ga0111539_10000195 3300009094 Bacteria 71206
180 Ga0111539_10001799 3300009094 Bacteria 28539
181 Ga0111539_10008308 3300009094 Bacteria 13214
182 Ga0111539_10010549 3300009094 Bacteria 11633
183 Ga0111539_10027811 3300009094 Bacteria 6905
184 Ga0111539_10103404 3300009094 Bacteria 3343
185 Ga0105245_10001316 3300009098 Bacteria 22443
186 Ga0105245_10410099 3300009098 Bacteria 1356
187 Ga0114129_10003595 3300009147 Bacteria 21800
188 Ga0114129_10005295 3300009147 Bacteria 18203
189 Ga0114129_10008084 3300009147 Bacteria 14988
190 Ga0114129_10023893 3300009147 Bacteria 8662
191 Ga0114129_10131625 3300009147 Bacteria 3435
192 Ga0114129_10135271 3300009147 Unclassified 3382
193 Ga0105243_10006259 3300009148 Bacteria 9194
194 Ga0105243_10009756 3300009148 Bacteria 7307
195 Ga0105241_10004480 3300009174 Bacteria 10328
196 Ga0105241_10039779 3300009174 Bacteria 3548
197 Ga0105241_10096754 3300009174 Bacteria 2339
198 Ga0105242_10006575 3300009176 Bacteria 8952
199 Ga0105242_10010463 3300009176 Bacteria 7119
200 Ga0105242_10033774 3300009176 Bacteria 4099
201 Ga0105248_10006517 3300009177 Bacteria 12798
202 Ga0105248_10120679 3300009177 Bacteria 2958
203 Ga0105248_10241757 3300009177 Bacteria 2032
204 Ga0105237_10008329 3300009545 Bacteria 11250
205 Ga0105237_10245588 3300009545 Bacteria 1792
206 Ga0105238_10001013 3300009551 Bacteria 28671
207 Ga0105238_10090531 3300009551 Bacteria 3046
208 Ga0105238_10286608 3300009551 Bacteria 1629
209 Ga0105249_10015181 3300009553 Bacteria 6816
210 Ga0105249_10031801 3300009553 Bacteria 4774
211 Ga0105249_10062625 3300009553 Bacteria 3416
212 Ga0105239_10049990 3300010375 Bacteria 4585
213 Ga0105239_10163868 3300010375 Bacteria 2485
214 Ga0105239_10474150 3300010375 Bacteria 1421
215 Ga0157371_10000001 3300013102 Bacteria 1162285
216 Ga0157369_10001365 3300013105 Bacteria 30097
217 Ga0157369_10058667 3300013105 Bacteria 4151
218 Ga0157374_10172211 3300013296 Bacteria 2112
219 Ga0157378_10018590 3300013297 Bacteria 6110
220 Ga0157378_10024328 3300013297 Bacteria 5326
221 Ga0157378_10048035 3300013297 Bacteria 3795
222 Ga0157378_10087372 3300013297 Bacteria 2828
223 Ga0163162_10069963 3300013306 Bacteria 3561
224 Ga0163162_10211135 3300013306 Unclassified 2071
225 Ga0163162_10282648 3300013306 Bacteria 1791
226 Ga0157372_10001111 3300013307 Bacteria 29223
227 Ga0157375_10061558 3300013308 Unclassified 3727
228 Ga0163163_10002436 3300014325 Bacteria 15739
229 Ga0163163_10038360 3300014325 Bacteria 4669
230 Ga0157380_10006169 3300014326 Bacteria 8408
231 Ga0157377_10000910 3300014745 Bacteria 12344
232 Ga0157379_10048974 3300014968 Bacteria 3772
233 Ga0157376_10004528 3300014969 Bacteria 9685
234 Ga0182006_1045299 3300015261 Bacteria 1712
235 Ga0182005_1002026 3300015265 Bacteria 7603
236 Ga0183360_10001 3300015689 Bacteria 3943671
237 Ga0163161_10005636 3300017792 Bacteria 8684
238 Ga0209563_100007 3300025230 Bacteria 1579402
239 Ga0207425_1000079 3300025245 Bacteria 101495
240 Ga0209677_102546 3300025253 Bacteria 6732
241 Ga0209129_1000087 3300025258 Bacteria 179582
242 Ga0209565_1000005 3300025263 Bacteria 947317
243 Ga0209565_1003659 3300025263 Bacteria 4891
244 Ga0209673_1000011 3300025273 Bacteria 586604
245 Ga0209675_1000004 3300025291 Bacteria 947166
246 Ga0209676_1000156 3300025292 Bacteria 163255
247 Ga0209676_1000203 3300025292 Bacteria 132949
248 Ga0209676_1000609 3300025292 Bacteria 52392
249 Ga0209676_1003754 3300025292 Bacteria 9017
250 Ga0209676_1004542 3300025292 Bacteria 7693
251 Ga0209676_1005536 3300025292 Bacteria 6549
252 Ga0209676_1006844 3300025292 Bacteria 5525
253 Ga0209676_1006998 3300025292 Bacteria 5419
254 Ga0209025_1000013 3300025294 Bacteria 871757
255 Ga0209025_1000036 3300025294 Bacteria 404113
256 Ga0209025_1002886 3300025294 Bacteria 17213
257 Ga0209025_1017088 3300025294 Bacteria 4220
258 Ga0209025_1030122 3300025294 Bacteria 2605
259 Ga0209564_1000018 3300025295 Bacteria 586913
260 Ga0209564_1010973 3300025295 Bacteria 4112
261 Ga0209564_1014819 3300025295 Bacteria 3214
262 Ga0209758_1000014 3300025297 Bacteria 871757
263 Ga0209050_1000847 3300025298 Bacteria 41758
264 Ga0209256_1000021 3300025299 Bacteria 537097
265 Ga0209256_1001858 3300025299 Bacteria 19531
266 Ga0209256_1002522 3300025299 Bacteria 14708
267 Ga0209256_1012686 3300025299 Bacteria 3194
268 Ga0209257_1000204 3300025304 Bacteria 143800
269 Ga0209257_1000278 3300025304 Bacteria 114707
270 Ga0209257_1000298 3300025304 Bacteria 109259
271 Ga0209257_1000560 3300025304 Bacteria 63396
272 Ga0209257_1001509 3300025304 Bacteria 27348
273 Ga0209257_1002023 3300025304 Bacteria 21654
274 Ga0209257_1009232 3300025304 Bacteria 5346
275 Ga0209257_1013026 3300025304 Bacteria 3753
276 Ga0207699_10097921 3300025906 Bacteria 1854
277 Ga0207645_10053878 3300025907 Bacteria 2569
278 Ga0207643_10007055 3300025908 Bacteria 6020
279 Ga0207643_10008392 3300025908 Bacteria 5540
280 Ga0207643_10040665 3300025908 Bacteria 2618
281 Ga0207705_10064544 3300025909 Bacteria 2646
282 Ga0207654_10020774 3300025911 Bacteria 3486
283 Ga0207654_10023382 3300025911 Bacteria 3310
284 Ga0207707_10122355 3300025912 Bacteria 2275
285 Ga0207695_10086458 3300025913 Bacteria 3162
286 Ga0207660_10111642 3300025917 Bacteria 2058
287 Ga0207662_10000065 3300025918 Bacteria 46256
288 Ga0207662_10017035 3300025918 Bacteria 4105
289 Ga0207657_10022867 3300025919 Bacteria 5835
290 Ga0207657_10059339 3300025919 Bacteria 3288
291 Ga0207652_10007811 3300025921 Bacteria 8591
292 Ga0207652_10310392 3300025921 Bacteria 1424
293 Ga0207646_10176877 3300025922 Bacteria 1927
294 Ga0207681_10020732 3300025923 Bacteria 4170
295 Ga0207681_10122430 3300025923 Bacteria 1910
296 Ga0207694_10056163 3300025924 Bacteria 3058
297 Ga0207650_10055634 3300025925 Bacteria 2937
298 Ga0207687_10006825 3300025927 Bacteria 7520
299 Ga0207687_10012880 3300025927 Bacteria 5467
300 Ga0207700_10068908 3300025928 Bacteria 2713
301 Ga0207700_10233810 3300025928 Bacteria 1564
302 Ga0207664_10008044 3300025929 Bacteria 7331
303 Ga0207664_10087880 3300025929 Bacteria 2542
304 Ga0207644_10012180 3300025931 Bacteria 5708
305 Ga0207644_10242524 3300025931 Bacteria 1435
306 Ga0207690_10023150 3300025932 Bacteria 3874
307 Ga0207706_10009902 3300025933 Bacteria 8740
308 Ga0207686_10004486 3300025934 Bacteria 7477
309 Ga0207686_10014581 3300025934 Bacteria 4379
310 Ga0207686_10015596 3300025934 Bacteria 4251
311 Ga0207686_10020225 3300025934 Bacteria 3799
312 Ga0207709_10014765 3300025935 Bacteria 4318
313 Ga0207709_10024250 3300025935 Bacteria 3462
314 Ga0207670_10003608 3300025936 Bacteria 8208
315 Ga0207670_10022483 3300025936 Bacteria 3909
316 Ga0207670_10159522 3300025936 Bacteria 1682
317 Ga0207669_10104456 3300025937 Bacteria 1882
318 Ga0207704_10004634 3300025938 Bacteria 6303
319 Ga0207704_10017058 3300025938 Bacteria 3752
320 Ga0207691_10031193 3300025940 Unclassified 4976
321 Ga0207711_10047023 3300025941 Bacteria 3688
322 Ga0207689_10000438 3300025942 Bacteria 39053
323 Ga0207689_10001253 3300025942 Bacteria 24466
324 Ga0207689_10008058 3300025942 Bacteria 9195
325 Ga0207689_10012172 3300025942 Bacteria 7363
326 Ga0207661_10121443 3300025944 Bacteria 2225
327 Ga0207679_10000868 3300025945 Bacteria 19329
328 Ga0207679_10175012 3300025945 Bacteria 1771
329 Ga0207667_10030247 3300025949 Bacteria 5861
330 Ga0207667_10031724 3300025949 Bacteria 5702
331 Ga0207667_10043635 3300025949 Bacteria 4758
332 Ga0207667_10075259 3300025949 Bacteria 3506
333 Ga0207667_10201151 3300025949 Bacteria 2044
334 Ga0207667_10215268 3300025949 Bacteria 1969
335 Ga0207651_10105716 3300025960 Bacteria 2100
336 Ga0207712_10015142 3300025961 Bacteria 4970
337 Ga0207712_10019015 3300025961 Bacteria 4481
338 Ga0207712_10036715 3300025961 Bacteria 3339
339 Ga0207668_10039451 3300025972 Bacteria 3179
340 Ga0207640_10075069 3300025981 Bacteria 2290
341 Ga0207658_10060125 3300025986 Bacteria 2834
342 Ga0207658_10115960 3300025986 Bacteria 2127
343 Ga0207677_10031620 3300026023 Bacteria 3391
344 Ga0207677_10164122 3300026023 Bacteria 1729
345 Ga0207703_10009529 3300026035 Bacteria 7620
346 Ga0207703_10014337 3300026035 Bacteria 6182
347 Ga0207703_10031893 3300026035 Bacteria 4169
348 Ga0207639_10082438 3300026041 Bacteria 2550
349 Ga0207639_10103793 3300026041 Bacteria 2304
350 Ga0207639_10129614 3300026041 Bacteria 2086
351 Ga0207639_10144482 3300026041 Bacteria 1986
352 Ga0207708_10001339 3300026075 Bacteria 18550
353 Ga0207708_10002598 3300026075 Bacteria 13291
354 Ga0207708_10007127 3300026075 Bacteria 8262
355 Ga0207708_10029108 3300026075 Bacteria 4184
356 Ga0207708_10066637 3300026075 Unclassified 2753
357 Ga0207702_10022350 3300026078 Bacteria 5243
358 Ga0207702_10072693 3300026078 Bacteria 2965
359 Ga0207641_10007484 3300026088 Bacteria 9088
360 Ga0207648_10000210 3300026089 Bacteria 62827
361 Ga0207648_10010754 3300026089 Bacteria 8647
362 Ga0207648_10020796 3300026089 Bacteria 5907
363 Ga0207648_10022023 3300026089 Bacteria 5724
364 Ga0207676_10009255 3300026095 Bacteria 7007
365 Ga0207676_10191479 3300026095 Bacteria 1800
366 Ga0207674_10006930 3300026116 Bacteria 13276
367 Ga0207674_10049876 3300026116 Bacteria 4278
368 Ga0207675_100000473 3300026118 Bacteria 39053
369 Ga0207675_100001723 3300026118 Bacteria 21906
370 Ga0207675_100006339 3300026118 Bacteria 11215
371 Ga0207675_100007508 3300026118 Bacteria 10300
372 Ga0207675_100033212 3300026118 Bacteria 4808
373 Ga0207675_100104177 3300026118 Bacteria 2674
374 Ga0207683_10021613 3300026121 Bacteria 5514
375 Ga0207698_10251199 3300026142 Bacteria 1618
376 Ga0209371_1000011 3300027312 Bacteria 848456
377 Ga0207428_10002394 3300027907 Bacteria 18742
378 Ga0207428_10002532 3300027907 Bacteria 18239
379 Ga0207428_10006537 3300027907 Bacteria 10750
380 Ga0207428_10011963 3300027907 Bacteria 7638
381 Ga0207428_10031760 3300027907 Bacteria 4352
382 Ga0268266_10204645 3300028379 Bacteria 1808
383 Ga0268266_10233216 3300028379 Bacteria 1696
384 Ga0268265_10000660 3300028380 Bacteria 34200
385 Ga0268265_10002301 3300028380 Bacteria 14543
386 Ga0268265_10145138 3300028380 Bacteria 1993
387 Ga0268264_10001208 3300028381 Bacteria 24876
388 Ga0268264_10044636 3300028381 Bacteria 3677
389 Ga0268264_10079305 3300028381 Bacteria 2801
390 Ga0307517_10055704 3300028786 Bacteria 3876
391 Ga0268256_1000011 3300030500 Bacteria 848625
392 Ga0265332_10000069 3300031238 Bacteria 88113
393 Ga0265332_10000621 3300031238 Bacteria 23112
394 Ga0307513_10023088 3300031456 Bacteria 7280
395 Ga0307509_10000018 3300031507 Bacteria 258998
396 Ga0307408_100025705 3300031548 Bacteria 4035
397 Ga0307408_100032572 3300031548 Bacteria 3635
398 Ga0307408_100235001 3300031548 Bacteria 1503
399 Ga0307516_10000386 3300031730 Bacteria 57562
400 Ga0307405_10113600 3300031731 Bacteria 1839
401 Ga0307406_10006187 3300031901 Bacteria 6587
402 Ga0307406_10091313 3300031901 Bacteria 2051
403 Ga0307412_10160809 3300031911 Bacteria 1668
404 Ga0307416_100087570 3300032002 Bacteria 2659
405 Ga0307416_100162015 3300032002 Bacteria 2069
406 Ga0307414_10001391 3300032004 Bacteria 12530
407 Ga0307414_10006012 3300032004 Bacteria 6730
408 Ga0307414_10084205 3300032004 Bacteria 2338
409 Ga0307414_10114634 3300032004 Bacteria 2059
410 Ga0307415_100100841 3300032126 Bacteria 2117
411 Ga0307415_100303440 3300032126 Bacteria 1324
412 Ga0373930_0009534 3300034816 Bacteria 1719
413 Ga0373944_0006240 3300035089 Bacteria 3161
414 Ga0373944_0008043 3300035089 Bacteria 2844
415 Ga0373951_0004172 3300035091 Bacteria 3450
416 Ga0373936_0012991 3300035113 Bacteria 3175
417 Ga0373936_0017154 3300035113 Bacteria 2786
418 Ga0373941_0011718 3300035115 Bacteria 2273
419 Ga0373954_0119238 3300035118 Bacteria 1280
420 Ga0373943_0035841 3300035170 Bacteria 2373
421 Ga0373946_0010135 3300035171 Bacteria 3485
422 Ga0373924_0025154 3300035410 Bacteria 2352
423 Ga0373931_0002144 3300035691 Bacteria 8690
424 Ga0373931_0019321 3300035691 Bacteria 3400
425 Ga0373931_0028292 3300035691 Bacteria 2868
426 Ga0373931_0078431 3300035691 Bacteria 1817
427 Ga0373927_0025191 3300035695 Bacteria 3889
428 Ga0373927_0111029 3300035695 Bacteria 1786
429 Ga0373947_0024346 3300035725 Bacteria 3527
430 Ga0373947_0082933 3300035725 Bacteria 1987
431 Ga0373937_0049066 3300036401 Bacteria 3866
432 Ga0373937_0063534 3300036401 Bacteria 3396
433 Ga0373937_0246309 3300036401 Bacteria 1684
434 Ga0373925_0014689 3300037068 Bacteria 5656
435 Ga0373925_0046526 3300037068 Bacteria 3226
436 Ga0395899_0010581 3300037312 Bacteria 7070
437 Ga0395899_0030172 3300037312 Bacteria 4078
438 Ga0395900_0119979 3300037418 Bacteria 2698
439 Ga0395900_0147671 3300037418 Bacteria 2403
440 Ga0395900_0271731 3300037418 Bacteria 1689
441 Ga0395898_0248791 3300037466 Bacteria 1695
442 Ga0395905_0000760 3300037471 Bacteria 42467
443 Ga0395905_0033313 3300037471 Bacteria 4841
444 Ga0395905_0037797 3300037471 Bacteria 4531
445 Ga0395905_0080591 3300037471 Bacteria 3050
446 Ga0395905_0140442 3300037471 Bacteria 2272
447 Ga0395905_0244814 3300037471 Bacteria 1675
448 Ga0395901_0002258 3300038443 Bacteria 19672
449 Ga0395901_0011885 3300038443 Bacteria 8830
450 Ga0237819_00457 3300038705 Bacteria 13925
451 Ga0237816_00019 3300039145 Bacteria 9443
452 Ga0436360_0453682 3300039438 Bacteria 9051
453 Ga0439436_0006667 3300041404 Bacteria 3548
454 Ga0439439_0000762 3300041406 Bacteria 5802
455 Ga0439465_0000341 3300041413 Bacteria 13349
456 Ga0439465_0001011 3300041413 Bacteria 8944
457 Ga0439465_0015568 3300041413 Bacteria 2373
458 Ga0451795_0730108 3300041456 Bacteria 2279
459 Ga0451798_0102601 3300041458 Bacteria 1778
460 Ga0451802_1477178 3300041460 Bacteria 2330
461 Ga0451807_0329075 3300041486 Bacteria 4529
462 Ga0451807_0460780 3300041486 Bacteria 3912
463 Ga0451807_1430651 3300041486 Bacteria 2415
464 Ga0439431_0005416 3300041997 Bacteria 2818
465 Ga0439445_0000418 3300042004 Bacteria 8547
466 Ga0439445_0008016 3300042004 Bacteria 2464
467 Ga0439448_0001012 3300042005 Bacteria 7019
468 Ga0439449_0000054 3300042007 Bacteria 34695
469 Ga0450904_000561 3300042139 Bacteria 7005
470 Ga0451577_0002661 3300042876 Bacteria 20878
471 Ga0451577_0005688 3300042876 Bacteria 12649
472 Ga0451577_0047571 3300042876 Bacteria 3835
473 Ga0451577_0152483 3300042876 Bacteria 2079
474 Ga0466972_0001868 3300044658 Bacteria 10322
475 Ga0453683_0160379 3300044673 Unclassified 1423
476 Ga0466965_0001068 3300044683 Bacteria 10641
477 Ga0466966_0002614 3300044684 Bacteria 11807
478 Ga0466966_0059519 3300044684 Bacteria 2412
479 Ga0466966_0061420 3300044684 Bacteria 2370
480 Ga0466961_0069181 3300044693 Bacteria 2241
481 Ga0466964_0000439 3300044706 Bacteria 12668
482 Ga0466968_0001260 3300044735 Bacteria 9011
483 Ga0466959_0017154 3300045049 Bacteria 5303
484 Ga0451576_0000675 3300045051 Bacteria 69506
485 Ga0451576_0002092 3300045051 Bacteria 31120
486 Ga0451576_0006176 3300045051 Bacteria 14752
487 Ga0451576_0090949 3300045051 Bacteria 3174
488 Ga0451576_0105681 3300045051 Bacteria 2929
489 Ga0451576_0238812 3300045051 Bacteria 1898
490 Ga0451576_0312658 3300045051 Bacteria 1643
491 Ga0466967_0339935 3300045976 Bacteria 1451
492 Ga0495617_000940 3300046452 Bacteria 13541
493 Ga0495627_008987 3300046453 Bacteria 3694
494 Ga0495592_0176358 3300046454 Bacteria 1459
495 Ga0495603_0100907 3300046455 Bacteria 1684
496 Ga0495590_0024555 3300046457 Bacteria 2124
497 Ga0495591_027772 3300046458 Bacteria 1740
498 Ga0495629_0041452 3300046459 Bacteria 3239
499 Ga0495638_0001975 3300046460 Bacteria 17522
500 Ga0495638_0066413 3300046460 Bacteria 2217
501 Ga0495650_0000048 3300046471 Bacteria 334427
502 Ga0495650_0000292 3300046471 Bacteria 92418
503 Ga0495650_0011282 3300046471 Bacteria 4907
504 Ga0495605_0000652 3300046474 Bacteria 26506
505 Ga0495605_0010723 3300046474 Bacteria 5122
506 Ga0495605_0048675 3300046474 Bacteria 2074
507 Ga0495584_0000006 3300046491 Bacteria 301775
508 Ga0495584_0000495 3300046491 Bacteria 27066
509 Ga0495584_0002112 3300046491 Bacteria 11381
510 Ga0495584_0024537 3300046491 Bacteria 3058
511 Ga0495584_0045621 3300046491 Bacteria 2211
512 Ga0495585_0000061 3300046492 Bacteria 110727
513 Ga0495585_0000207 3300046492 Bacteria 61587
514 Ga0495585_0000265 3300046492 Bacteria 52393
515 Ga0495585_0000972 3300046492 Bacteria 24063
516 Ga0495585_0036102 3300046492 Bacteria 2790
517 Ga0495594_0002393 3300046499 Bacteria 9768
518 Ga0495594_0051460 3300046499 Bacteria 2266
519 Ga0495594_0119125 3300046499 Bacteria 1491
520 Ga0495596_0001025 3300046500 Bacteria 16597
521 Ga0495596_0001109 3300046500 Bacteria 15950
522 Ga0495596_0004521 3300046500 Bacteria 6763
523 Ga0495607_0002364 3300046501 Bacteria 15407
524 Ga0495607_0004272 3300046501 Bacteria 10573
525 Ga0495607_0005188 3300046501 Bacteria 9391
526 Ga0495607_0005552 3300046501 Bacteria 8994
527 Ga0495607_0032942 3300046501 Bacteria 3156
528 Ga0495583_0000941 3300046506 Bacteria 33886
529 Ga0495583_0001016 3300046506 Bacteria 32027
530 Ga0495583_0009279 3300046506 Bacteria 5894
531 Ga0495583_0011121 3300046506 Bacteria 5186
532 Ga0495583_0015704 3300046506 Bacteria 4103
533 Ga0495606_0004606 3300046507 Bacteria 13660
534 Ga0495606_0009601 3300046507 Bacteria 8155
535 Ga0495606_0023823 3300046507 Bacteria 4426
536 Ga0495606_0104058 3300046507 Bacteria 1723
537 Ga0495606_0130137 3300046507 Bacteria 1497
538 Ga0495610_0008048 3300046512 Bacteria 6898
539 Ga0495616_0000097 3300046513 Bacteria 74443
540 Ga0495616_0000827 3300046513 Bacteria 22588
541 Ga0495616_0004577 3300046513 Bacteria 8702
542 Ga0495616_0015904 3300046513 Bacteria 4171
543 Ga0495616_0023743 3300046513 Bacteria 3296
544 Ga0495616_0061112 3300046513 Bacteria 1848
545 Ga0495631_0003948 3300046518 Bacteria 8008
546 Ga0495631_0010256 3300046518 Bacteria 4641
547 Ga0495631_0011067 3300046518 Bacteria 4450
548 Ga0495631_0018703 3300046518 Bacteria 3258
549 Ga0495631_0024570 3300046518 Bacteria 2782
550 Ga0495632_0000267 3300046519 Bacteria 52020
551 Ga0495632_0000604 3300046519 Bacteria 33295
552 Ga0495632_0003433 3300046519 Bacteria 11251
553 Ga0495632_0037304 3300046519 Bacteria 2467
554 Ga0495632_0040941 3300046519 Bacteria 2330
555 Ga0495637_0039022 3300046520 Bacteria 2053
556 Ga0495643_0000432 3300046522 Bacteria 54506
557 Ga0495643_0001321 3300046522 Bacteria 23458
558 Ga0495643_0006079 3300046522 Bacteria 8039
559 Ga0495643_0007868 3300046522 Bacteria 6814
560 Ga0495643_0008842 3300046522 Bacteria 6340
561 Ga0495643_0019290 3300046522 Bacteria 3948
562 Ga0495644_0017595 3300046523 Bacteria 2732
563 Ga0495648_0000096 3300046524 Bacteria 110227
564 Ga0495648_0035332 3300046524 Bacteria 3241
565 Ga0495648_0098884 3300046524 Bacteria 1615
566 Ga0495663_0001704 3300046525 Bacteria 6851
567 Ga0495663_0004634 3300046525 Bacteria 3852
568 Ga0495663_0005706 3300046525 Bacteria 3446
569 Ga0495663_0015893 3300046525 Bacteria 2125
570 Ga0495642_0000746 3300046528 Bacteria 16051
571 Ga0495642_0009192 3300046528 Bacteria 3783
572 Ga0495642_0016654 3300046528 Bacteria 2867
573 Ga0495642_0019073 3300046528 Bacteria 2686
574 Ga0495642_0027377 3300046528 Bacteria 2268
575 Ga0495665_0003914 3300046531 Bacteria 8059
576 Ga0495586_0022463 3300046535 Bacteria 3367
577 Ga0495586_0038008 3300046535 Bacteria 2584
578 Ga0495587_0165012 3300046536 Bacteria 1259
579 Ga0495609_0000731 3300046538 Bacteria 24981
580 Ga0495609_0000857 3300046538 Bacteria 22430
581 Ga0495609_0002565 3300046538 Bacteria 11083
582 Ga0495609_0036870 3300046538 Bacteria 2206
583 Ga0495609_0063676 3300046538 Bacteria 1627
584 Ga0495597_0002776 3300046542 Bacteria 10780
585 Ga0495597_0005968 3300046542 Bacteria 6357
586 Ga0495597_0021087 3300046542 Bacteria 3029
587 Ga0495645_0038819 3300046543 Bacteria 3473
588 Ga0495622_0001642 3300046557 Bacteria 11054
589 Ga0495622_0018356 3300046557 Bacteria 3257
590 Ga0495622_0101857 3300046557 Bacteria 1316
591 Ga0495622_0110027 3300046557 Bacteria 1261
592 Ga0495633_0004334 3300046558 Bacteria 9059
593 Ga0495633_0006439 3300046558 Bacteria 6961
594 Ga0495633_0008724 3300046558 Bacteria 5681
595 Ga0495667_0077035 3300046559 Bacteria 2169
596 Ga0495668_0001114 3300046616 Bacteria 27719
597 Ga0495668_0002176 3300046616 Bacteria 16784
598 Ga0495668_0007237 3300046616 Bacteria 7121
599 Ga0495668_0015647 3300046616 Bacteria 4425
600 Ga0495668_0125926 3300046616 Bacteria 1402
601 Ga0495668_0133182 3300046616 Bacteria 1360
602 Ga0495611_0006802 3300046648 Bacteria 4858
603 Ga0495611_0012508 3300046648 Bacteria 3608
604 Ga0495625_0182908 3300046660 Bacteria 1392
605 Ga0495661_0000894 3300046665 Bacteria 27503
606 Ga0495661_0002340 3300046665 Bacteria 14620
607 Ga0495661_0004974 3300046665 Bacteria 9492
608 Ga0495661_0005871 3300046665 Bacteria 8675
609 Ga0495661_0008538 3300046665 Bacteria 7079
610 Ga0495661_0010678 3300046665 Bacteria 6256
611 Ga0495661_0038966 3300046665 Bacteria 2956
612 Ga0495661_0056703 3300046665 Bacteria 2342
613 Ga0495661_0121889 3300046665 Bacteria 1439
614 Ga0495588_0000174 3300046674 Bacteria 81329
615 Ga0495588_0052754 3300046674 Bacteria 2096
616 Ga0495669_0007006 3300046684 Bacteria 4719
617 Ga0495624_0010461 3300046690 Bacteria 6395
618 Ga0495670_0005413 3300046691 Bacteria 6266
619 Ga0495671_0001737 3300046692 Bacteria 14121
620 Ga0495671_0003344 3300046692 Bacteria 9901
621 Ga0495671_0017420 3300046692 Bacteria 3825
622 Ga0495649_0039193 3300046694 Bacteria 2598
623 Ga0495589_0000693 3300046794 Bacteria 21927
624 Ga0495589_0000990 3300046794 Bacteria 17241
625 Ga0495589_0020146 3300046794 Bacteria 3412
626 Ga0495589_0029408 3300046794 Bacteria 2770
627 Ga0495660_0000157 3300046810 Bacteria 73772
628 Ga0495660_0038108 3300046810 Bacteria 2674
629 Ga0495660_0087114 3300046810 Bacteria 1629
630 Ga0495581_0016929 3300047315 Bacteria 4236
631 Ga0495636_0000593 3300047318 Bacteria 13310
632 Ga0495674_0005713 3300047319 Bacteria 11916
633 Ga0495672_0000333 3300047320 Bacteria 61835
634 Ga0495672_0003512 3300047320 Bacteria 13363
635 Ga0495672_0009609 3300047320 Bacteria 6983
636 Ga0495672_0018529 3300047320 Bacteria 4616
637 Ga0495672_0027488 3300047320 Bacteria 3614
638 Ga0495680_0060320 3300047322 Bacteria 2925
639 Ga0495683_0000041 3300047323 Bacteria 137557
640 Ga0495683_0020521 3300047323 Bacteria 3407
641 Ga0495683_0022080 3300047323 Bacteria 3274
642 Ga0495687_000215 3300047443 Bacteria 82752
643 Ga0495687_000457 3300047443 Bacteria 49882
644 Ga0495687_001337 3300047443 Bacteria 22967
645 Ga0495687_006930 3300047443 Bacteria 6817
646 Ga0495687_021704 3300047443 Bacteria 3099
647 Ga0495687_036968 3300047443 Bacteria 2179
648 Ga0495675_0115874 3300047444 Bacteria 1671
649 Ga0495677_0000259 3300047445 Bacteria 23264
650 Ga0495677_0000915 3300047445 Bacteria 11884
651 Ga0495677_0001756 3300047445 Bacteria 8684
652 Ga0495677_0005432 3300047445 Bacteria 4831
653 Ga0495677_0024538 3300047445 Bacteria 2187
654 Ga0495673_0008170 3300047469 Bacteria 5918
655 Ga0495681_0000629 3300047470 Bacteria 26892
656 Ga0495681_0018454 3300047470 Bacteria 3843
657 Ga0495681_0020724 3300047470 Bacteria 3558
658 Ga0495681_0021411 3300047470 Bacteria 3486
659 Ga0495681_0061283 3300047470 Bacteria 1733
660 Ga0495686_0000356 3300047472 Bacteria 74751
661 Ga0495686_0011389 3300047472 Bacteria 6268
662 Ga0495593_0028400 3300047673 Bacteria 3072
663 Ga0495614_0068694 3300048089 Bacteria 1526
664 Ga0495626_0000016 3300048091 Bacteria 232214
665 Ga0495626_0000640 3300048091 Bacteria 33839
666 Ga0495626_0001380 3300048091 Bacteria 19523
667 Ga0495626_0002008 3300048091 Bacteria 14997
668 Ga0495626_0002438 3300048091 Bacteria 12914
669 Ga0495626_0002604 3300048091 Bacteria 12318
670 Ga0495626_0006273 3300048091 Bacteria 6787
671 Ga0495626_0011312 3300048091 Bacteria 4724
672 Ga0495626_0019856 3300048091 Bacteria 3354
673 Ga0496100_0105627 3300048903 Bacteria 1948
674 Ga0496100_0167502 3300048903 Bacteria 1580
675 Ga0496102_0023234 3300048905 Bacteria 5503
676 Ga0496102_0044099 3300048905 Bacteria 4046
677 Ga0496102_0482136 3300048905 Bacteria 1161
678 Ga0496103_0010228 3300048906 Bacteria 5549
679 Ga0496104_0051477 3300048907 Bacteria 3887
680 Ga0496106_0084488 3300048909 Bacteria 2443
681 Ga0496106_0099602 3300048909 Bacteria 2253
682 Ga0496107_0058584 3300048910 Bacteria 2785
683 Ga0496108_0255380 3300048911 Bacteria 1525
684 Ga0496109_0080458 3300048912 Bacteria 3002
685 Ga0496109_0112533 3300048912 Bacteria 2531
686 Ga0496109_0253372 3300048912 Bacteria 1658
687 Ga0496110_0017299 3300048913 Bacteria 6032
688 Ga0496111_0014500 3300048914 Bacteria 5386
689 Ga0496111_0048076 3300048914 Bacteria 3073
690 Ga0496113_0001052 3300048916 Bacteria 14902
691 Ga0496113_0031830 3300048916 Bacteria 3831
692 Ga0496113_0034554 3300048916 Bacteria 3689
693 Ga0496113_0043642 3300048916 Bacteria 3319
694 Ga0496114_0002540 3300048917 Bacteria 13926
695 Ga0496115_0001055 3300048918 Bacteria 19985
696 Ga0496115_0150027 3300048918 Bacteria 1925
697 Ga0496116_0018948 3300048919 Bacteria 5285
698 Ga0496117_0010323 3300048920 Bacteria 8535
699 Ga0496117_0015652 3300048920 Bacteria 6447
700 Ga0496117_0017213 3300048920 Bacteria 6048
701 Ga0496117_0018365 3300048920 Bacteria 5794
702 Ga0496117_0052830 3300048920 Bacteria 2860
703 Ga0496118_0013416 3300048921 Bacteria 7754
704 Ga0496118_0016030 3300048921 Bacteria 6899
705 Ga0496118_0016359 3300048921 Bacteria 6808
706 Ga0496118_0018462 3300048921 Bacteria 6293
707 Ga0496118_0037647 3300048921 Bacteria 3890
708 Ga0496118_0051396 3300048921 Bacteria 3153
709 Ga0496118_0092489 3300048921 Bacteria 2075
710 Ga0496121_0033648 3300048924 Bacteria 4633
711 Ga0496121_0190246 3300048924 Bacteria 1472
712 Ga0496122_0003343 3300048925 Bacteria 21158
713 Ga0496122_0013150 3300048925 Bacteria 8134
714 Ga0496122_0014643 3300048925 Bacteria 7568
715 Ga0496122_0025680 3300048925 Bacteria 5106
716 Ga0496122_0108151 3300048925 Bacteria 1835
717 Ga0496123_0001399 3300048926 Bacteria 33811
718 Ga0496123_0002772 3300048926 Bacteria 20912
719 Ga0496123_0006033 3300048926 Bacteria 11910
720 Ga0496123_0020992 3300048926 Bacteria 5089
721 Ga0496124_0000018 3300048927 Bacteria 442940
722 Ga0496124_0002026 3300048927 Bacteria 27552
723 Ga0496124_0005171 3300048927 Bacteria 14846
724 Ga0496124_0006351 3300048927 Bacteria 12900
725 Ga0496124_0017367 3300048927 Bacteria 6781
726 Ga0496124_0022379 3300048927 Bacteria 5795
727 Ga0496124_0023215 3300048927 Bacteria 5668
728 Ga0496124_0026567 3300048927 Bacteria 5217
729 Ga0496124_0091350 3300048927 Bacteria 2481
730 Ga0496124_0115839 3300048927 Bacteria 2150
731 Ga0496124_0125716 3300048927 Bacteria 2043
732 Ga0496125_0000954 3300048928 Bacteria 45477
733 Ga0496125_0001095 3300048928 Bacteria 41736
734 Ga0496125_0011785 3300048928 Bacteria 8712
735 Ga0496125_0065938 3300048928 Bacteria 2864
736 Ga0496126_0004287 3300048929 Bacteria 17153
737 Ga0496126_0018169 3300048929 Bacteria 6977
738 Ga0496126_0069132 3300048929 Bacteria 3151
739 Ga0495678_002888 3300049459 Bacteria 11064
740 Ga0495678_007954 3300049459 Bacteria 5428
741 Ga0501299_002715 3300049522 Bacteria 2479
742 Ga0501033_0030923 3300049570 Bacteria 4024
743 Ga0501034_0000458 3300049571 Bacteria 67394
744 Ga0501034_0035041 3300049571 Bacteria 5090
745 Ga0501036_0022362 3300049572 Bacteria 5318
746 Ga0501036_0148311 3300049572 Bacteria 1979
747 Ga0501037_0031215 3300049573 Bacteria 3934
748 Ga0501038_0010174 3300049574 Bacteria 8609
749 Ga0501039_0008418 3300049575 Bacteria 7860
750 Ga0501040_0000273 3300049576 Bacteria 30160
751 Ga0501041_0000391 3300049577 Bacteria 22011
752 Ga0501041_0022733 3300049577 Bacteria 3756
753 Ga0501042_0001697 3300049578 Bacteria 13144
754 Ga0501043_0001632 3300049579 Bacteria 19502
755 Ga0501046_0008085 3300049580 Bacteria 9193
756 Ga0501048_0003439 3300049582 Bacteria 12026
757 Ga0501067_0059046 3300049583 Bacteria 2124
758 Ga0501068_0007720 3300049584 Bacteria 5952
759 Ga0501068_0015391 3300049584 Bacteria 4391
760 Ga0501068_0018426 3300049584 Bacteria 4043
761 Ga0501069_0107720 3300049585 Bacteria 1585
762 Ga0501070_0007880 3300049586 Bacteria 9028
763 Ga0501070_0019761 3300049586 Bacteria 5650
764 Ga0501070_0057050 3300049586 Bacteria 3237
765 Ga0501071_0006024 3300049587 Bacteria 7852
766 Ga0501071_0018711 3300049587 Bacteria 4802
767 Ga0501072_0002420 3300049588 Bacteria 13967
768 Ga0501072_0003820 3300049588 Bacteria 11373
769 Ga0501072_0080930 3300049588 Bacteria 2574
770 Ga0501073_0001960 3300049589 Bacteria 15345
771 Ga0501073_0003818 3300049589 Bacteria 11306
772 Ga0501074_0023364 3300049590 Bacteria 4496
773 Ga0501074_0045182 3300049590 Bacteria 3187
774 Ga0501075_0006782 3300049591 Bacteria 7904
775 Ga0501075_0010513 3300049591 Bacteria 6505
776 Ga0501075_0125698 3300049591 Bacteria 1952
777 Ga0501076_0001245 3300049592 Bacteria 16958
778 Ga0501076_0085353 3300049592 Bacteria 2537
779 Ga0501076_0090837 3300049592 Bacteria 2456
780 Ga0501077_0000753 3300049593 Bacteria 19627
781 Ga0501079_0002097 3300049741 Bacteria 14307
782 Ga0501079_0002850 3300049741 Bacteria 12614
783 Ga0501079_0025648 3300049741 Bacteria 4519
784 Ga0501079_0111382 3300049741 Bacteria 2127
785 Ga0501080_0000818 3300049742 Bacteria 25385
786 Ga0501080_0003459 3300049742 Bacteria 13925
787 Ga0501080_0019849 3300049742 Bacteria 6223
788 Ga0501080_0304695 3300049742 Bacteria 1444
789 Ga0501081_0000278 3300049743 Bacteria 26953
790 Ga0501081_0001474 3300049743 Bacteria 14427
791 Ga0501083_0027034 3300049744 Bacteria 3962
792 Ga0501083_0045419 3300049744 Bacteria 2972
793 Ga0501035_0067269 3300049822 Bacteria 3180
794 nmdc:mga0k408_5496_c1 3300050493 Bacteria 6747
795 nmdc:mga05p37_1470_c1 3300050507 Bacteria 27368
796 nmdc:mga05p37_6956_c1 3300050507 Bacteria 13332
797 nmdc:mga05p37_88921_c1 3300050507 Unclassified 3807
798 nmdc:mga09592_1178_c1 3300050508 Bacteria 20862
799 nmdc:mga09592_12799_c1 3300050508 Bacteria 6840
800 nmdc:mga09592_235667_c1 3300050508 Bacteria 1585
801 nmdc:mga0qj67_168929_c1 3300050509 Bacteria 1776
802 nmdc:mga0qj67_2826_c1 3300050509 Bacteria 12455
803 nmdc:mga0qj67_66637_c1 3300050509 Bacteria 2868
804 nmdc:mga06r32_1285_c1 3300050510 Bacteria 22596
805 nmdc:mga06r32_17513_c1 3300050510 Bacteria 6541
806 nmdc:mga08y16_2320_c1 3300050511 Bacteria 15509
807 nmdc:mga08y16_47576_c2 3300050511 Bacteria 4081
808 nmdc:mga08y16_62688_c1 3300050511 Bacteria 3883
809 nmdc:mga08y16_867_c1 3300050511 Bacteria 29137
810 nmdc:mga0rr50_78835_c1 3300050513 Bacteria 2536
811 nmdc:mga08x19_1519_c1 3300050514 Bacteria 14388
812 nmdc:mga08x19_53276_c1 3300050514 Bacteria 2603
813 nmdc:mga0a205_194111_c1 3300050515 Bacteria 1922
814 nmdc:mga0a205_61379_c1 3300050515 Unclassified 3631
815 Ga0495601_0040248 3300053077 Bacteria 2927
816 Ga0495595_0103821 3300053084 Bacteria 1373
817 Ga0495619_0004286 3300053085 Bacteria 9092
818 Ga0500556_0000700 3300053104 Bacteria 20573
819 Ga0500617_048158 3300053124 Bacteria 1905
820 Ga0500634_0058877 3300053161 Bacteria 2046
821 Ga0500636_0000423 3300053177 Bacteria 23230
822 Ga0500565_000304 3300053734 Bacteria 2526
823 Ga0501084_0009919 3300054114 Bacteria 7872
824 Ga0501084_0092272 3300054114 Bacteria 2542
825 Ga0590071_004146 3300059421 Bacteria 3537
826 Ga0501082_0000863 3300060353 Bacteria 26818
827 Ga0466962_0063890 3300061719 Bacteria 1757
828 Ga0530510_0005243 3300061734 Bacteria 8948
829 Ga0530510_0058118 3300061734 Bacteria 2796
830 2643975462 2643221593 Bacteria 6296053
831 2572256131 2571042365 Bacteria 3289345
832 2578459088 2576861471 Bacteria 4648976
833 2643802188 2643221556 Bacteria 7251154
834 2643815840 2643221559 Bacteria 4424915
835 2643878026 2643221573 Bacteria 4784121
836 2643906278 2643221579 Bacteria 4443405
837 2643915297 2643221581 Bacteria 3893603
838 2643940650 2643221586 Bacteria 4446529
839 2644080640 2643221612 Bacteria 4361984
840 2644475697 2643221684 Bacteria 7145183
841 2644528466 2643221695 Bacteria 3441323
842 2644659337 2643221720 Bacteria 4694283
843 2644695895 2643221727 Bacteria 4415595
844 2644700919 2643221728 Bacteria 4797149
845 2748019166 2747842501 Bacteria 5293829
846 2819663729 2818991457 Bacteria 5323295
847 2842759457 2842757796 Bacteria 3981385
848 2842781584 2842780639 Bacteria 4337790
849 2852686420 2852684882 Bacteria 5463342
850 2857443181 2857442823 Bacteria 4562550
851 2891635645 2891633521 Bacteria 4602265
852 2894024807 2894023352 Bacteria 5167372
853 2895501220 2895498888 Bacteria 5283788
854 2895514363 2895511927 Bacteria 6802080
855 2895524156 2895522137 Bacteria 3284416
856 2895527643 2895525241 Bacteria 3388457
857 2919132537 2919130084 Bacteria 5301837
858 2929196995 2929195423 Bacteria 5325372
859 2939626459 2939622612 Bacteria 4698046
860 2941476860 2941475908 Bacteria 4145589
861 2941494577 2941489479 Bacteria 6313767
862 2987607643 2987605356 Bacteria 4187822
863 2995952799 2995948881 Bacteria 6358104
864 639785179 639633007 Bacteria 4376040
865 8002869533 8002869464 Bacteria 3588529
866 8003014927 8003014200 Bacteria 4059994
867 8047673960 8047673197 Bacteria 7395230
868 8048749090 8048746797 Bacteria 3557226
869 SwRhRL2b_contig_1672945
870 JGI25152J39213_1000142
871 JGI25150J39212_1000204
872 JGI25150J39212_1000776
873 JGI25151J46595_10000237
874 JGI25151J46595_10000530
875 JGI25406J46586_10027080
876 JGI25153J46596_10000171
877 Ga0055525_1000001
878 Ga0055526_1000011
879 Ga0055537_1000007
880 Ga0055524_1000252
881 Ga0055524_1009708
882 Ga0055524_1016052
883 Ga0055536_1002333
884 Ga0055536_1004882
885 Ga0055536_1006875
886 Ga0055534_1000134
887 Ga0055528_1000005
888 Ga0055530_10003751
889 Ga0055530_10003859
890 Ga0055531_10003052
891 Ga0055531_10004686
892 Ga0055531_10005668
893 Ga0055531_10006402
894 Ga0055531_10007572
895 Ga0055531_10024636
896 Ga0058692_1000020
897 Ga0065704_10072403
898 Ga0065704_10075997
899 Ga0065707_10082801
900 Ga0070658_10088428
901 Ga0070690_100000304
902 Ga0070690_100004891
903 Ga0070690_100008748
904 Ga0070670_100051105
905 Ga0070670_100053604
906 Ga0068869_100001121
907 Ga0068869_100002021
908 Ga0068869_100008179
909 Ga0068869_100171056
910 Ga0068869_100193841
911 Ga0070666_10206907
912 Ga0070680_100000577
913 Ga0070680_100136385
914 Ga0070682_100007634
915 Ga0068868_100001956
916 Ga0068868_100190128
917 Ga0070689_100000495
918 Ga0070689_100004674
919 Ga0070689_100195136
920 Ga0070687_100000550
921 Ga0070687_100011964
922 Ga0070661_100000902
923 Ga0070661_100042119
924 Ga0070692_10000958
925 Ga0070669_100011209
926 Ga0070675_100025842
927 Ga0070675_100295291
928 Ga0070671_100006492
929 Ga0070671_100022859
930 Ga0070673_100013197
931 Ga0070688_100022441
932 Ga0070659_100012772
933 Ga0070659_100289793
934 Ga0070667_100046068
935 Ga0070667_100214983
936 Ga0070714_100009958
937 Ga0070713_100161211
938 Ga0070701_10002048
939 Ga0070705_100001366
940 Ga0070705_100124375
941 Ga0070700_100009789
942 Ga0070700_100019061
943 Ga0070694_100003452
944 Ga0070662_100004627
945 Ga0070681_10005492
946 Ga0068867_100005182
947 Ga0068867_100006856
948 Ga0068867_100017877
949 Ga0068867_100066009
950 Ga0070685_10030763
951 Ga0070706_100030805
952 Ga0070706_100085528
953 Ga0070707_100024555
954 Ga0068853_100005626
955 Ga0068853_100017678
956 Ga0068853_100033254
957 Ga0068853_100035939
958 Ga0068853_100100529
959 Ga0070672_100131654
960 Ga0070686_100000422
961 Ga0070686_100000547
962 Ga0070695_100000545
963 Ga0070696_100004990
964 Ga0070693_100000217
965 Ga0070693_100008113
966 Ga0070665_100014118
967 Ga0070665_100287866
968 Ga0070704_100001284
969 Ga0068855_100010002
970 Ga0068855_100028998
971 Ga0068855_100157396
972 Ga0068855_100159538
973 Ga0068855_100302869
974 Ga0070664_100001457
975 Ga0070664_100070200
976 Ga0070664_100178109
977 Ga0068857_100006759
978 Ga0068857_100014875
979 Ga0068854_100073833
980 Ga0068856_100028193
981 Ga0068856_100241183
982 Ga0070702_100000054
983 Ga0068859_100010162
984 Ga0068859_100044017
985 Ga0068859_100119817
986 Ga0068864_100001460
987 Ga0068864_100113405
988 Ga0068866_10006629
989 Ga0068866_10012069
990 Ga0068861_100000451
991 Ga0068861_100003216
992 Ga0068861_100004280
993 Ga0068861_100012205
994 Ga0068870_10003143
995 Ga0068870_10053884
996 Ga0068863_100000931
997 Ga0068858_100001326
998 Ga0068858_100008731
999 Ga0068858_100024304
1000 Ga0068858_100116032
1001 Ga0068860_100104821
1002 Ga0068860_100121252
1003 Ga0068860_100231045
1004 Ga0068862_100000298
1005 Ga0068862_100001914
1006 Ga0068862_100063541
1007 Ga0081455_10002298
1008 Ga0081539_10006699
1009 Ga0070717_10014065
1010 Ga0075432_10016650
1011 Ga0070716_100042222
1012 Ga0070712_100086673
1013 Ga0075366_10035159
1014 Ga0097621_100000597
1015 Ga0097621_100001777
1016 Ga0097621_100014685
1017 Ga0068871_100000468
1018 Ga0068871_100051922
1019 Ga0068871_100278172
1020 Ga0075428_100001778
1021 Ga0075428_100002997
1022 Ga0075428_100004615
1023 Ga0075428_100026828
1024 Ga0075428_100035227
1025 Ga0075428_100107742
1026 Ga0075430_100010916
1027 Ga0075430_100020910
1028 Ga0075430_100055650
1029 Ga0075430_100143248
1030 Ga0075431_100000055
1031 Ga0075431_100041495
1032 Ga0075433_10312398
1033 Ga0075434_100000663
1034 Ga0075429_100001097
1035 Ga0075429_100002231
1036 Ga0075429_100010147
1037 Ga0075429_100088568
1038 Ga0068865_100002672
1039 Ga0068865_100003241
1040 Ga0075436_100004535
1041 Ga0075436_100013037
1042 Ga0097620_100010162
1043 Ga0097620_100044019
1044 Ga0097620_100119815
1045 Ga0075435_100011822
1046 Ga0105240_10092762
1047 Ga0111539_10000195
1048 Ga0111539_10001799
1049 Ga0111539_10008308
1050 Ga0111539_10010549
1051 Ga0111539_10027811
1052 Ga0111539_10103404
1053 Ga0105245_10001316
1054 Ga0105245_10410099
1055 Ga0114129_10003595
1056 Ga0114129_10005295
1057 Ga0114129_10008084
1058 Ga0114129_10023893
1059 Ga0114129_10131625
1060 Ga0114129_10135271
1061 Ga0105243_10006259
1062 Ga0105243_10009756
1063 Ga0105241_10004480
1064 Ga0105241_10039779
1065 Ga0105241_10096754
1066 Ga0105242_10006575
1067 Ga0105242_10010463
1068 Ga0105242_10033774
1069 Ga0105248_10006517
1070 Ga0105248_10120679
1071 Ga0105248_10241757
1072 Ga0105237_10008329
1073 Ga0105237_10245588
1074 Ga0105238_10001013
1075 Ga0105238_10090531
1076 Ga0105238_10286608
1077 Ga0105249_10015181
1078 Ga0105249_10031801
1079 Ga0105249_10062625
1080 Ga0105239_10049990
1081 Ga0105239_10163868
1082 Ga0105239_10474150
1083 Ga0157371_10000001
1084 Ga0157369_10001365
1085 Ga0157369_10058667
1086 Ga0157374_10172211
1087 Ga0157378_10018590
1088 Ga0157378_10024328
1089 Ga0157378_10048035
1090 Ga0157378_10087372
1091 Ga0163162_10069963
1092 Ga0163162_10211135
1093 Ga0163162_10282648
1094 Ga0157372_10001111
1095 Ga0157375_10061558
1096 Ga0163163_10002436
1097 Ga0163163_10038360
1098 Ga0157380_10006169
1099 Ga0157377_10000910
1100 Ga0157379_10048974
1101 Ga0157376_10004528
1102 Ga0182006_1045299
1103 Ga0182005_1002026
1104 Ga0183360_10001
1105 Ga0163161_10005636
1106 Ga0209563_100007
1107 Ga0207425_1000079
1108 Ga0209677_102546
1109 Ga0209129_1000087
1110 Ga0209565_1000005
1111 Ga0209565_1003659
1112 Ga0209673_1000011
1113 Ga0209675_1000004
1114 Ga0209676_1000156
1115 Ga0209676_1000203
1116 Ga0209676_1000609
1117 Ga0209676_1003754
1118 Ga0209676_1004542
1119 Ga0209676_1005536
1120 Ga0209676_1006844
1121 Ga0209676_1006998
1122 Ga0209025_1000013
1123 Ga0209025_1000036
1124 Ga0209025_1002886
1125 Ga0209025_1017088
1126 Ga0209025_1030122
1127 Ga0209564_1000018
1128 Ga0209564_1010973
1129 Ga0209564_1014819
1130 Ga0209758_1000014
1131 Ga0209050_1000847
1132 Ga0209256_1000021
1133 Ga0209256_1001858
1134 Ga0209256_1002522
1135 Ga0209256_1012686
1136 Ga0209257_1000204
1137 Ga0209257_1000278
1138 Ga0209257_1000298
1139 Ga0209257_1000560
1140 Ga0209257_1001509
1141 Ga0209257_1002023
1142 Ga0209257_1009232
1143 Ga0209257_1013026
1144 Ga0207699_10097921
1145 Ga0207645_10053878
1146 Ga0207643_10007055
1147 Ga0207643_10008392
1148 Ga0207643_10040665
1149 Ga0207705_10064544
1150 Ga0207654_10020774
1151 Ga0207654_10023382
1152 Ga0207707_10122355
1153 Ga0207695_10086458
1154 Ga0207660_10111642
1155 Ga0207662_10000065
1156 Ga0207662_10017035
1157 Ga0207657_10022867
1158 Ga0207657_10059339
1159 Ga0207652_10007811
1160 Ga0207652_10310392
1161 Ga0207646_10176877
1162 Ga0207681_10020732
1163 Ga0207681_10122430
1164 Ga0207694_10056163
1165 Ga0207650_10055634
1166 Ga0207687_10006825
1167 Ga0207687_10012880
1168 Ga0207700_10068908
1169 Ga0207700_10233810
1170 Ga0207664_10008044
1171 Ga0207664_10087880
1172 Ga0207644_10012180
1173 Ga0207644_10242524
1174 Ga0207690_10023150
1175 Ga0207706_10009902
1176 Ga0207686_10004486
1177 Ga0207686_10014581
1178 Ga0207686_10015596
1179 Ga0207686_10020225
1180 Ga0207709_10014765
1181 Ga0207709_10024250
1182 Ga0207670_10003608
1183 Ga0207670_10022483
1184 Ga0207670_10159522
1185 Ga0207669_10104456
1186 Ga0207704_10004634
1187 Ga0207704_10017058
1188 Ga0207691_10031193
1189 Ga0207711_10047023
1190 Ga0207689_10000438
1191 Ga0207689_10001253
1192 Ga0207689_10008058
1193 Ga0207689_10012172
1194 Ga0207661_10121443
1195 Ga0207679_10000868
1196 Ga0207679_10175012
1197 Ga0207667_10030247
1198 Ga0207667_10031724
1199 Ga0207667_10043635
1200 Ga0207667_10075259
1201 Ga0207667_10201151
1202 Ga0207667_10215268
1203 Ga0207651_10105716
1204 Ga0207712_10015142
1205 Ga0207712_10019015
1206 Ga0207712_10036715
1207 Ga0207668_10039451
1208 Ga0207640_10075069
1209 Ga0207658_10060125
1210 Ga0207658_10115960
1211 Ga0207677_10031620
1212 Ga0207677_10164122
1213 Ga0207703_10009529
1214 Ga0207703_10014337
1215 Ga0207703_10031893
1216 Ga0207639_10082438
1217 Ga0207639_10103793
1218 Ga0207639_10129614
1219 Ga0207639_10144482
1220 Ga0207708_10001339
1221 Ga0207708_10002598
1222 Ga0207708_10007127
1223 Ga0207708_10029108
1224 Ga0207708_10066637
1225 Ga0207702_10022350
1226 Ga0207702_10072693
1227 Ga0207641_10007484
1228 Ga0207648_10000210
1229 Ga0207648_10010754
1230 Ga0207648_10020796
1231 Ga0207648_10022023
1232 Ga0207676_10009255
1233 Ga0207676_10191479
1234 Ga0207674_10006930
1235 Ga0207674_10049876
1236 Ga0207675_100000473
1237 Ga0207675_100001723
1238 Ga0207675_100006339
1239 Ga0207675_100007508
1240 Ga0207675_100033212
1241 Ga0207675_100104177
1242 Ga0207683_10021613
1243 Ga0207698_10251199
1244 Ga0209371_1000011
1245 Ga0207428_10002394
1246 Ga0207428_10002532
1247 Ga0207428_10006537
1248 Ga0207428_10011963
1249 Ga0207428_10031760
1250 Ga0268266_10204645
1251 Ga0268266_10233216
1252 Ga0268265_10000660
1253 Ga0268265_10002301
1254 Ga0268265_10145138
1255 Ga0268264_10001208
1256 Ga0268264_10044636
1257 Ga0268264_10079305
1258 Ga0307517_10055704
1259 Ga0268256_1000011
1260 Ga0265332_10000069
1261 Ga0265332_10000621
1262 Ga0307513_10023088
1263 Ga0307509_10000018
1264 Ga0307408_100025705
1265 Ga0307408_100032572
1266 Ga0307408_100235001
1267 Ga0307516_10000386
1268 Ga0307405_10113600
1269 Ga0307406_10006187
1270 Ga0307406_10091313
1271 Ga0307412_10160809
1272 Ga0307416_100087570
1273 Ga0307416_100162015
1274 Ga0307414_10001391
1275 Ga0307414_10006012
1276 Ga0307414_10084205
1277 Ga0307414_10114634
1278 Ga0307415_100100841
1279 Ga0307415_100303440
1280 Ga0373930_0009534
1281 Ga0373944_0006240
1282 Ga0373944_0008043
1283 Ga0373951_0004172
1284 Ga0373936_0012991
1285 Ga0373936_0017154
1286 Ga0373941_0011718
1287 Ga0373954_0119238
1288 Ga0373943_0035841
1289 Ga0373946_0010135
1290 Ga0373924_0025154
1291 Ga0373931_0002144
1292 Ga0373931_0019321
1293 Ga0373931_0028292
1294 Ga0373931_0078431
1295 Ga0373927_0025191
1296 Ga0373927_0111029
1297 Ga0373947_0024346
1298 Ga0373947_0082933
1299 Ga0373937_0049066
1300 Ga0373937_0063534
1301 Ga0373937_0246309
1302 Ga0373925_0014689
1303 Ga0373925_0046526
1304 Ga0395899_0010581
1305 Ga0395899_0030172
1306 Ga0395900_0119979
1307 Ga0395900_0147671
1308 Ga0395900_0271731
1309 Ga0395898_0248791
1310 Ga0395905_0000760
1311 Ga0395905_0033313
1312 Ga0395905_0037797
1313 Ga0395905_0080591
1314 Ga0395905_0140442
1315 Ga0395905_0244814
1316 Ga0395901_0002258
1317 Ga0395901_0011885
1318 Ga0237819_00457
1319 Ga0237816_00019
1320 Ga0436360_0453682
1321 Ga0439436_0006667
1322 Ga0439439_0000762
1323 Ga0439465_0000341
1324 Ga0439465_0001011
1325 Ga0439465_0015568
1326 Ga0451795_0730108
1327 Ga0451798_0102601
1328 Ga0451802_1477178
1329 Ga0451807_0329075
1330 Ga0451807_0460780
1331 Ga0451807_1430651
1332 Ga0439431_0005416
1333 Ga0439445_0000418
1334 Ga0439445_0008016
1335 Ga0439448_0001012
1336 Ga0439449_0000054
1337 Ga0450904_000561
1338 Ga0451577_0002661
1339 Ga0451577_0005688
1340 Ga0451577_0047571
1341 Ga0451577_0152483
1342 Ga0466972_0001868
1343 Ga0453683_0160379
1344 Ga0466965_0001068
1345 Ga0466966_0002614
1346 Ga0466966_0059519
1347 Ga0466966_0061420
1348 Ga0466961_0069181
1349 Ga0466964_0000439
1350 Ga0466968_0001260
1351 Ga0466959_0017154
1352 Ga0451576_0000675
1353 Ga0451576_0002092
1354 Ga0451576_0006176
1355 Ga0451576_0090949
1356 Ga0451576_0105681
1357 Ga0451576_0238812
1358 Ga0451576_0312658
1359 Ga0466967_0339935
1360 Ga0495617_000940
1361 Ga0495627_008987
1362 Ga0495592_0176358
1363 Ga0495603_0100907
1364 Ga0495590_0024555
1365 Ga0495591_027772
1366 Ga0495629_0041452
1367 Ga0495638_0001975
1368 Ga0495638_0066413
1369 Ga0495650_0000048
1370 Ga0495650_0000292
1371 Ga0495650_0011282
1372 Ga0495605_0000652
1373 Ga0495605_0010723
1374 Ga0495605_0048675
1375 Ga0495584_0000006
1376 Ga0495584_0000495
1377 Ga0495584_0002112
1378 Ga0495584_0024537
1379 Ga0495584_0045621
1380 Ga0495585_0000061
1381 Ga0495585_0000207
1382 Ga0495585_0000265
1383 Ga0495585_0000972
1384 Ga0495585_0036102
1385 Ga0495594_0002393
1386 Ga0495594_0051460
1387 Ga0495594_0119125
1388 Ga0495596_0001025
1389 Ga0495596_0001109
1390 Ga0495596_0004521
1391 Ga0495607_0002364
1392 Ga0495607_0004272
1393 Ga0495607_0005188
1394 Ga0495607_0005552
1395 Ga0495607_0032942
1396 Ga0495583_0000941
1397 Ga0495583_0001016
1398 Ga0495583_0009279
1399 Ga0495583_0011121
1400 Ga0495583_0015704
1401 Ga0495606_0004606
1402 Ga0495606_0009601
1403 Ga0495606_0023823
1404 Ga0495606_0104058
1405 Ga0495606_0130137
1406 Ga0495610_0008048
1407 Ga0495616_0000097
1408 Ga0495616_0000827
1409 Ga0495616_0004577
1410 Ga0495616_0015904
1411 Ga0495616_0023743
1412 Ga0495616_0061112
1413 Ga0495631_0003948
1414 Ga0495631_0010256
1415 Ga0495631_0011067
1416 Ga0495631_0018703
1417 Ga0495631_0024570
1418 Ga0495632_0000267
1419 Ga0495632_0000604
1420 Ga0495632_0003433
1421 Ga0495632_0037304
1422 Ga0495632_0040941
1423 Ga0495637_0039022
1424 Ga0495643_0000432
1425 Ga0495643_0001321
1426 Ga0495643_0006079
1427 Ga0495643_0007868
1428 Ga0495643_0008842
1429 Ga0495643_0019290
1430 Ga0495644_0017595
1431 Ga0495648_0000096
1432 Ga0495648_0035332
1433 Ga0495648_0098884
1434 Ga0495663_0001704
1435 Ga0495663_0004634
1436 Ga0495663_0005706
1437 Ga0495663_0015893
1438 Ga0495642_0000746
1439 Ga0495642_0009192
1440 Ga0495642_0016654
1441 Ga0495642_0019073
1442 Ga0495642_0027377
1443 Ga0495665_0003914
1444 Ga0495586_0022463
1445 Ga0495586_0038008
1446 Ga0495587_0165012
1447 Ga0495609_0000731
1448 Ga0495609_0000857
1449 Ga0495609_0002565
1450 Ga0495609_0036870
1451 Ga0495609_0063676
1452 Ga0495597_0002776
1453 Ga0495597_0005968
1454 Ga0495597_0021087
1455 Ga0495645_0038819
1456 Ga0495622_0001642
1457 Ga0495622_0018356
1458 Ga0495622_0101857
1459 Ga0495622_0110027
1460 Ga0495633_0004334
1461 Ga0495633_0006439
1462 Ga0495633_0008724
1463 Ga0495667_0077035
1464 Ga0495668_0001114
1465 Ga0495668_0002176
1466 Ga0495668_0007237
1467 Ga0495668_0015647
1468 Ga0495668_0125926
1469 Ga0495668_0133182
1470 Ga0495611_0006802
1471 Ga0495611_0012508
1472 Ga0495625_0182908
1473 Ga0495661_0000894
1474 Ga0495661_0002340
1475 Ga0495661_0004974
1476 Ga0495661_0005871
1477 Ga0495661_0008538
1478 Ga0495661_0010678
1479 Ga0495661_0038966
1480 Ga0495661_0056703
1481 Ga0495661_0121889
1482 Ga0495588_0000174
1483 Ga0495588_0052754
1484 Ga0495669_0007006
1485 Ga0495624_0010461
1486 Ga0495670_0005413
1487 Ga0495671_0001737
1488 Ga0495671_0003344
1489 Ga0495671_0017420
1490 Ga0495649_0039193
1491 Ga0495589_0000693
1492 Ga0495589_0000990
1493 Ga0495589_0020146
1494 Ga0495589_0029408
1495 Ga0495660_0000157
1496 Ga0495660_0038108
1497 Ga0495660_0087114
1498 Ga0495581_0016929
1499 Ga0495636_0000593
1500 Ga0495674_0005713
1501 Ga0495672_0000333
1502 Ga0495672_0003512
1503 Ga0495672_0009609
1504 Ga0495672_0018529
1505 Ga0495672_0027488
1506 Ga0495680_0060320
1507 Ga0495683_0000041
1508 Ga0495683_0020521
1509 Ga0495683_0022080
1510 Ga0495687_000215
1511 Ga0495687_000457
1512 Ga0495687_001337
1513 Ga0495687_006930
1514 Ga0495687_021704
1515 Ga0495687_036968
1516 Ga0495675_0115874
1517 Ga0495677_0000259
1518 Ga0495677_0000915
1519 Ga0495677_0001756
1520 Ga0495677_0005432
1521 Ga0495677_0024538
1522 Ga0495673_0008170
1523 Ga0495681_0000629
1524 Ga0495681_0018454
1525 Ga0495681_0020724
1526 Ga0495681_0021411
1527 Ga0495681_0061283
1528 Ga0495686_0000356
1529 Ga0495686_0011389
1530 Ga0495593_0028400
1531 Ga0495614_0068694
1532 Ga0495626_0000016
1533 Ga0495626_0000640
1534 Ga0495626_0001380
1535 Ga0495626_0002008
1536 Ga0495626_0002438
1537 Ga0495626_0002604
1538 Ga0495626_0006273
1539 Ga0495626_0011312
1540 Ga0495626_0019856
1541 Ga0496100_0105627
1542 Ga0496100_0167502
1543 Ga0496102_0023234
1544 Ga0496102_0044099
1545 Ga0496102_0482136
1546 Ga0496103_0010228
1547 Ga0496104_0051477
1548 Ga0496106_0084488
1549 Ga0496106_0099602
1550 Ga0496107_0058584
1551 Ga0496108_0255380
1552 Ga0496109_0080458
1553 Ga0496109_0112533
1554 Ga0496109_0253372
1555 Ga0496110_0017299
1556 Ga0496111_0014500
1557 Ga0496111_0048076
1558 Ga0496113_0001052
1559 Ga0496113_0031830
1560 Ga0496113_0034554
1561 Ga0496113_0043642
1562 Ga0496114_0002540
1563 Ga0496115_0001055
1564 Ga0496115_0150027
1565 Ga0496116_0018948
1566 Ga0496117_0010323
1567 Ga0496117_0015652
1568 Ga0496117_0017213
1569 Ga0496117_0018365
1570 Ga0496117_0052830
1571 Ga0496118_0013416
1572 Ga0496118_0016030
1573 Ga0496118_0016359
1574 Ga0496118_0018462
1575 Ga0496118_0037647
1576 Ga0496118_0051396
1577 Ga0496118_0092489
1578 Ga0496121_0033648
1579 Ga0496121_0190246
1580 Ga0496122_0003343
1581 Ga0496122_0013150
1582 Ga0496122_0014643
1583 Ga0496122_0025680
1584 Ga0496122_0108151
1585 Ga0496123_0001399
1586 Ga0496123_0002772
1587 Ga0496123_0006033
1588 Ga0496123_0020992
1589 Ga0496124_0000018
1590 Ga0496124_0002026
1591 Ga0496124_0005171
1592 Ga0496124_0006351
1593 Ga0496124_0017367
1594 Ga0496124_0022379
1595 Ga0496124_0023215
1596 Ga0496124_0026567
1597 Ga0496124_0091350
1598 Ga0496124_0115839
1599 Ga0496124_0125716
1600 Ga0496125_0000954
1601 Ga0496125_0001095
1602 Ga0496125_0011785
1603 Ga0496125_0065938
1604 Ga0496126_0004287
1605 Ga0496126_0018169
1606 Ga0496126_0069132
1607 Ga0495678_002888
1608 Ga0495678_007954
1609 Ga0501299_002715
1610 Ga0501033_0030923
1611 Ga0501034_0000458
1612 Ga0501034_0035041
1613 Ga0501036_0022362
1614 Ga0501036_0148311
1615 Ga0501037_0031215
1616 Ga0501038_0010174
1617 Ga0501039_0008418
1618 Ga0501040_0000273
1619 Ga0501041_0000391
1620 Ga0501041_0022733
1621 Ga0501042_0001697
1622 Ga0501043_0001632
1623 Ga0501046_0008085
1624 Ga0501048_0003439
1625 Ga0501067_0059046
1626 Ga0501068_0007720
1627 Ga0501068_0015391
1628 Ga0501068_0018426
1629 Ga0501069_0107720
1630 Ga0501070_0007880
1631 Ga0501070_0019761
1632 Ga0501070_0057050
1633 Ga0501071_0006024
1634 Ga0501071_0018711
1635 Ga0501072_0002420
1636 Ga0501072_0003820
1637 Ga0501072_0080930
1638 Ga0501073_0001960
1639 Ga0501073_0003818
1640 Ga0501074_0023364
1641 Ga0501074_0045182
1642 Ga0501075_0006782
1643 Ga0501075_0010513
1644 Ga0501075_0125698
1645 Ga0501076_0001245
1646 Ga0501076_0085353
1647 Ga0501076_0090837
1648 Ga0501077_0000753
1649 Ga0501079_0002097
1650 Ga0501079_0002850
1651 Ga0501079_0025648
1652 Ga0501079_0111382
1653 Ga0501080_0000818
1654 Ga0501080_0003459
1655 Ga0501080_0019849
1656 Ga0501080_0304695
1657 Ga0501081_0000278
1658 Ga0501081_0001474
1659 Ga0501083_0027034
1660 Ga0501083_0045419
1661 Ga0501035_0067269
1662 nmdc:mga0k408_5496_c1
1663 nmdc:mga05p37_1470_c1
1664 nmdc:mga05p37_6956_c1
1665 nmdc:mga05p37_88921_c1
1666 nmdc:mga09592_1178_c1
1667 nmdc:mga09592_12799_c1
1668 nmdc:mga09592_235667_c1
1669 nmdc:mga0qj67_168929_c1
1670 nmdc:mga0qj67_2826_c1
1671 nmdc:mga0qj67_66637_c1
1672 nmdc:mga06r32_1285_c1
1673 nmdc:mga06r32_17513_c1
1674 nmdc:mga08y16_2320_c1
1675 nmdc:mga08y16_47576_c2
1676 nmdc:mga08y16_62688_c1
1677 nmdc:mga08y16_867_c1
1678 nmdc:mga0rr50_78835_c1
1679 nmdc:mga08x19_1519_c1
1680 nmdc:mga08x19_53276_c1
1681 nmdc:mga0a205_194111_c1
1682 nmdc:mga0a205_61379_c1
1683 Ga0495601_0040248
1684 Ga0495595_0103821
1685 Ga0495619_0004286
1686 Ga0500556_0000700
1687 Ga0500617_048158
1688 Ga0500634_0058877
1689 Ga0500636_0000423
1690 Ga0500565_000304
1691 Ga0501084_0009919
1692 Ga0501084_0092272
1693 Ga0590071_004146
1694 Ga0501082_0000863
1695 Ga0466962_0063890
1696 Ga0530510_0005243
1697 Ga0530510_0058118
1698 2643975462
1699 2572256131
1700 2578459088
1701 2643802188
1702 2643815840
1703 2643878026
1704 2643906278
1705 2643915297
1706 2643940650
1707 2644080640
1708 2644475697
1709 2644528466
1710 2644659337
1711 2644695895
1712 2644700919
1713 2748019166
1714 2819663729
1715 2842759457
1716 2842781584
1717 2852686420
1718 2857443181
1719 2891635645
1720 2894024807
1721 2895501220
1722 2895514363
1723 2895524156
1724 2895527643
1725 2919132537
1726 2929196995
1727 2939626459
1728 2941476860
1729 2941494577
1730 2987607643
1731 2995952799
1732 639785179
1733 8002869533
1734 8003014927
1735 8047673960
1736 8048749090

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

254

424

0.87

PF07690

MFS_1

Major Facilitator Superfamily

16

365

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpk-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form 0.8962 3 394
8hpk-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form 0.881 3 394
7yr5-assembly1.cif.gz_A embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state 0.8773 3 385
6kki-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation 0.8695 1 388
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8687 3 388
ID Description Score Start End Superfamily
af_Q8T043_137_396_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9494 3 182 1.20.1250.20
af_Q5NC32_11_193_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9333 3 182 1.20.1250.20
af_H2L0E6_75_299_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9326 3 182 1.20.1250.20
af_Q8BGC3_15_203_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9268 3 182 1.20.1250.20
af_E7FGJ9_71_276_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9215 3 186 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2S6M6N0-F1-model_v4 MFS transporter 0.8967 3 180 GO:0005886
GO:0022857
AF-A0A511KIA1-F1-model_v4 MFS transporter, monocarboxylate permease-like protein 0.8952 3 386 GO:0016020
GO:0022857
AF-A0A5E3XLK8-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.8856 3 385 GO:0016020
GO:0022857
AF-A0A382GL38-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.8848 3 191 GO:0016020
GO:0022857
AF-V5HX55-F1-model_v4 Putative monocarboxylate transporter 0.8834 6 187 GO:0008028
GO:0016020

Map