F484109

General Info

Members Datasets Scaffolds Average Seq Length
869 291 1738 205

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100226048|Ga0070682_1002260481
Length 196
Sequence MNNVLLTAAAYLIGSISFAVVVSKLFRLADPRTYGSKNPGATNVLRSGNKAAAVLTLLGDGAKGWFAVWLAQQYGADDTGLALVSLAVFLGHLWPVFFRFVGGKGVATALGVLLGLNVWLGLATLATWLVIAYAFRYSSLAALIAAVFAPFYYGLLFGTDTKLLAVLAMSALLIYRHRQNIANLMAGKEGRIGGKK

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
42 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
60 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
69 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
74 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
75 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
101 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
102 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
114 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
115 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
116 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
117 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
125 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
132 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
135 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
145 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
148 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
149 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
150 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
151 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
152 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
153 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
156 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
157 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
171 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
182 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
185 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
190 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
191 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
192 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
203 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
206 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
207 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
208 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
209 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
210 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
214 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
215 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
229 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
234 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
235 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
236 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
237 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
238 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
239 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
240 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
244 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
245 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
246 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
247 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
248 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
249 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
250 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
251 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
252 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
253 2643221638 Duganella sp. Root336D2 Isolate Unclassified
254 2643221645 Massilia sp. Root351 Isolate Unclassified
255 2643221664 Massilia sp. Root418 Isolate Unclassified
256 2738541280 Massilia sp. GV090 Isolate Unclassified
257 2738541297 Duganella sp. GV083 Isolate Unclassified
258 2738541300 Massilia sp. GV016 Isolate Unclassified
259 2738541357 Duganella sp. GV053 Isolate Unclassified
260 2738543003 Duganella sp. GV066 Isolate Unclassified
261 2738543018 Massilia sp. GV045 Isolate Unclassified
262 2738543026 Duganella sp. GV089 Isolate Unclassified
263 2738543029 Duganella sp. GV039 Isolate Unclassified
264 2738543030 Massilia sp. GV097 Isolate Unclassified
265 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
266 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
267 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
268 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
269 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
270 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
271 2821131069 Duganella sp. 1224 Isolate Unclassified
272 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
273 2842711865 Duganella sp. R-73148 Isolate Unclassified
274 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
275 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
276 2857564685 Duganella sp. R-74599 Isolate Unclassified
277 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
278 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
279 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
280 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
281 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
282 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
283 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
284 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
285 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
286 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
287 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
288 2919476304 Duganella sp. 3397 Isolate Unclassified
289 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
290 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
291 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.94
Metatranscriptomes 0
Isolates 5.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.55
Nodule 0.81
Rhizoplane 2.88
Rhizosphere 78.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100226048 3300005337 Bacteria 1335
2 JGI25155J39150_1000136 3300002704 Bacteria 34706
3 JGI25155J39150_1000346 3300002704 Bacteria 14831
4 JGI25156J39149_1000156 3300002705 Bacteria 50177
5 JGI25156J39149_1017737 3300002705 Bacteria 1339
6 JGI25162J39368_1007673 3300002737 Bacteria 1644
7 JGI25154J39366_1000430 3300002738 Bacteria 22349
8 JGI25154J39366_1000531 3300002738 Bacteria 19097
9 JGI25157J39369_1000277 3300002741 Bacteria 37605
10 JGI25152J39213_1005883 3300002773 Bacteria 3468
11 JGI25150J39212_1005303 3300002774 Bacteria 2767
12 JGI25150J39212_1005343 3300002774 Bacteria 2752
13 JGI25159J45721_1002907 3300002987 Bacteria 6250
14 JGI25153J46596_10003648 3300003215 Bacteria 8524
15 rootL2_10059938 3300003322 Bacteria 2799
16 rootL2_10059939 3300003322 Bacteria 3070
17 rootH1_10077050 3300003323 Bacteria 2698
18 JGI25161J50226_1002299 3300003374 Bacteria 4984
19 Ga0055539_1000012 3300003752 Bacteria 398547
20 Ga0055533_1000015 3300003756 Bacteria 398547
21 Ga0055532_1000005 3300003758 Bacteria 458107
22 Ga0055525_1000017 3300003759 Bacteria 398547
23 Ga0055535_1004655 3300003761 Bacteria 3254
24 Ga0055542_1010166 3300003762 Bacteria 1735
25 Ga0055529_1000559 3300003763 Bacteria 30993
26 Ga0055526_1002342 3300003771 Bacteria 12875
27 Ga0055526_1016003 3300003771 Bacteria 2971
28 Ga0055526_1017619 3300003771 Bacteria 2718
29 Ga0055537_1000156 3300003773 Bacteria 51559
30 Ga0055537_1000223 3300003773 Bacteria 41876
31 Ga0055537_1002247 3300003773 Bacteria 6650
32 Ga0055537_1006413 3300003773 Bacteria 2989
33 Ga0055524_1000029 3300003775 Bacteria 201332
34 Ga0055524_1000911 3300003775 Bacteria 19092
35 Ga0055524_1001135 3300003775 Bacteria 16015
36 Ga0055524_1001937 3300003775 Bacteria 11143
37 Ga0055534_1000059 3300003784 Bacteria 84386
38 Ga0055534_1001040 3300003784 Bacteria 12153
39 Ga0055528_1000341 3300003790 Bacteria 38736
40 Ga0055530_10001933 3300003791 Bacteria 14134
41 Ga0055531_10034895 3300003794 Bacteria 1586
42 Ga0055541_1000009 3300003841 Bacteria 398547
43 Ga0065165_1022035 3300005262 Bacteria 2196
44 Ga0065165_1044075 3300005262 Bacteria 1307
45 Ga0065715_10002863 3300005293 Bacteria 5164
46 Ga0070658_10399480 3300005327 Bacteria 1180
47 Ga0070658_10637338 3300005327 Bacteria 924
48 Ga0070682_100149952 3300005337 Bacteria 1599
49 Ga0070660_100379102 3300005339 Bacteria 1167
50 Ga0070661_100159617 3300005344 Bacteria 1707
51 Ga0070659_100171919 3300005366 Bacteria 1775
52 Ga0068855_100014961 3300005563 Bacteria 9345
53 Ga0068855_100051205 3300005563 Bacteria 4864
54 Ga0070664_100107001 3300005564 Bacteria 2437
55 Ga0068854_100001881 3300005578 Bacteria 12806
56 Ga0068856_100826377 3300005614 Bacteria 946
57 Ga0068852_100036184 3300005616 Bacteria 4128
58 Ga0068871_100143560 3300006358 Bacteria 2031
59 Ga0079104_1013514 3300006946 Bacteria 2510
60 Ga0099826_10000003 3300006948 Bacteria 1067817
61 Ga0105251_10040692 3300009011 Bacteria 2266
62 Ga0105244_10000480 3300009036 Bacteria 36191
63 Ga0105244_10106896 3300009036 Bacteria 1365
64 Ga0105240_10001345 3300009093 Bacteria 42171
65 Ga0105240_10016284 3300009093 Bacteria 10071
66 Ga0105240_10505360 3300009093 Bacteria 1343
67 Ga0105243_10022107 3300009148 Bacteria 4833
68 Ga0105242_10066580 3300009176 Bacteria 2976
69 Ga0105242_10095195 3300009176 Bacteria 2513
70 Ga0105237_10192516 3300009545 Bacteria 2039
71 Ga0105237_10321740 3300009545 Bacteria 1550
72 Ga0105238_10000155 3300009551 Bacteria 74637
73 Ga0105238_10045973 3300009551 Bacteria 4408
74 Ga0105239_10046442 3300010375 Bacteria 4759
75 Ga0105246_10071910 3300011119 Bacteria 2437
76 Ga0105246_10758885 3300011119 Bacteria 856
77 Ga0157371_10000001 3300013102 Bacteria 1162285
78 Ga0182008_10000831 3300014497 Bacteria 21530
79 Ga0182006_1000014 3300015261 Bacteria 340159
80 Ga0182006_1000044 3300015261 Bacteria 197442
81 Ga0182006_1038997 3300015261 Bacteria 1877
82 Ga0182006_1109604 3300015261 Bacteria 970
83 Ga0182007_10000011 3300015262 Bacteria 264045
84 Ga0182007_10025303 3300015262 Bacteria 2069
85 Ga0182005_1000014 3300015265 Bacteria 389763
86 Ga0182005_1000052 3300015265 Bacteria 113532
87 Ga0163161_10094707 3300017792 Bacteria 2214
88 Ga0163161_10118078 3300017792 Bacteria 1990
89 Ga0213872_10000002 3300021361 Bacteria 554092
90 Ga0213872_10002383 3300021361 Bacteria 11110
91 Ga0213872_10011337 3300021361 Bacteria 4218
92 Ga0213872_10022211 3300021361 Bacteria 2922
93 Ga0213872_10159183 3300021361 Bacteria 983
94 Ga0209435_100004 3300025206 Bacteria 633417
95 Ga0209435_100156 3300025206 Bacteria 22357
96 Ga0209436_100207 3300025208 Bacteria 27286
97 Ga0209784_100005 3300025224 Bacteria 1040422
98 Ga0209566_100005 3300025225 Bacteria 1040422
99 Ga0209674_100009 3300025226 Bacteria 1040422
100 Ga0209147_100011 3300025229 Bacteria 702140
101 Ga0209563_100012 3300025230 Bacteria 1040422
102 Ga0209437_100084 3300025233 Bacteria 255423
103 Ga0209437_104942 3300025233 Bacteria 2308
104 Ga0209437_109794 3300025233 Bacteria 1483
105 Ga0209258_100264 3300025242 Bacteria 90298
106 Ga0207425_1000006 3300025245 Bacteria 808854
107 Ga0207425_1000136 3300025245 Bacteria 65594
108 Ga0207425_1000533 3300025245 Bacteria 23036
109 Ga0207425_1000745 3300025245 Bacteria 16950
110 Ga0209646_1000032 3300025246 Bacteria 375315
111 Ga0209646_1000052 3300025246 Bacteria 286370
112 Ga0209646_1000228 3300025246 Bacteria 59550
113 Ga0209026_1000062 3300025250 Bacteria 213298
114 Ga0209026_1002562 3300025250 Bacteria 6701
115 Ga0209677_100006 3300025253 Bacteria 1040422
116 Ga0209148_1000708 3300025254 Bacteria 26773
117 Ga0209759_1000054 3300025256 Bacteria 211422
118 Ga0209759_1000514 3300025256 Bacteria 41893
119 Ga0209129_1000090 3300025258 Bacteria 175755
120 Ga0209129_1000921 3300025258 Bacteria 17923
121 Ga0209565_1000006 3300025263 Bacteria 897294
122 Ga0209565_1000382 3300025263 Bacteria 37853
123 Ga0209565_1004245 3300025263 Bacteria 4427
124 Ga0209565_1004283 3300025263 Bacteria 4393
125 Ga0209565_1007626 3300025263 Bacteria 2901
126 Ga0209455_1000051 3300025272 Bacteria 369818
127 Ga0209673_1000004 3300025273 Bacteria 896155
128 Ga0209673_1019827 3300025273 Bacteria 2402
129 Ga0209130_1002373 3300025284 Bacteria 9546
130 Ga0209675_1000006 3300025291 Bacteria 732267
131 Ga0209675_1000410 3300025291 Bacteria 35247
132 Ga0209675_1016205 3300025291 Bacteria 2179
133 Ga0209025_1004541 3300025294 Bacteria 11963
134 Ga0209564_1000006 3300025295 Bacteria 1100927
135 Ga0209564_1000064 3300025295 Bacteria 316431
136 Ga0209564_1000639 3300025295 Bacteria 53129
137 Ga0209564_1000888 3300025295 Bacteria 39497
138 Ga0209564_1043182 3300025295 Bacteria 1186
139 Ga0209758_1000047 3300025297 Bacteria 360971
140 Ga0209758_1001064 3300025297 Bacteria 35767
141 Ga0209050_1000469 3300025298 Bacteria 71511
142 Ga0209050_1002061 3300025298 Bacteria 18514
143 Ga0209256_1000013 3300025299 Bacteria 689442
144 Ga0209256_1001427 3300025299 Bacteria 24751
145 Ga0209256_1001603 3300025299 Bacteria 22130
146 Ga0209256_1001909 3300025299 Bacteria 19072
147 Ga0209256_1002561 3300025299 Bacteria 14526
148 Ga0207426_1001538 3300025302 Bacteria 18766
149 Ga0209257_1000010 3300025304 Bacteria 1158682
150 Ga0207655_1003539 3300025728 Bacteria 11572
151 Ga0207705_10002897 3300025909 Bacteria 13128
152 Ga0207695_10001257 3300025913 Bacteria 43221
153 Ga0207695_10002162 3300025913 Bacteria 29707
154 Ga0207695_10055225 3300025913 Bacteria 4140
155 Ga0207671_10106159 3300025914 Bacteria 2132
156 Ga0207657_10061945 3300025919 Bacteria 3204
157 Ga0207649_10510026 3300025920 Bacteria 916
158 Ga0207694_10000625 3300025924 Bacteria 32139
159 Ga0207694_10676326 3300025924 Bacteria 870
160 Ga0207686_10107941 3300025934 Bacteria 1872
161 Ga0207679_10422723 3300025945 Bacteria 1176
162 Ga0207667_10006079 3300025949 Bacteria 14670
163 Ga0207667_10028495 3300025949 Bacteria 6066
164 Ga0207667_10035515 3300025949 Bacteria 5347
165 Ga0207640_10002110 3300025981 Bacteria 10678
166 Ga0207674_10078354 3300026116 Bacteria 3309
167 Ga0207698_10033350 3300026142 Bacteria 3741
168 Ga0207698_10535666 3300026142 Bacteria 1145
169 Ga0209281_1008838 3300027111 Bacteria 2409
170 Ga0209282_1000002 3300027666 Bacteria 1067825
171 Ga0316181_1128485 3300030744 Bacteria 1742
172 Ga0307408_100000331 3300031548 Bacteria 45112
173 Ga0307408_100124446 3300031548 Bacteria 2002
174 Ga0307406_10216473 3300031901 Bacteria 1421
175 Ga0307416_100548526 3300032002 Bacteria 1229
176 Ga0307414_10003756 3300032004 Bacteria 8155
177 Ga0395899_0001136 3300037312 Bacteria 23550
178 Ga0395899_0013433 3300037312 Bacteria 6264
179 Ga0395899_0017193 3300037312 Bacteria 5509
180 Ga0395899_0044535 3300037312 Bacteria 3306
181 Ga0395899_0048034 3300037312 Bacteria 3176
182 Ga0395899_0056524 3300037312 Bacteria 2900
183 Ga0395899_0160071 3300037312 Bacteria 1591
184 Ga0395900_0004042 3300037418 Bacteria 15653
185 Ga0395900_0004356 3300037418 Bacteria 15021
186 Ga0395900_0012554 3300037418 Bacteria 8667
187 Ga0395900_0070922 3300037418 Bacteria 3581
188 Ga0395900_0123921 3300037418 Bacteria 2650
189 Ga0395900_0248848 3300037418 Bacteria 1779
190 Ga0395900_0401544 3300037418 Bacteria 1334
191 Ga0395898_0016407 3300037466 Bacteria 7580
192 Ga0395898_0037964 3300037466 Bacteria 4775
193 Ga0395898_0130301 3300037466 Bacteria 2409
194 Ga0395898_0188585 3300037466 Bacteria 1970
195 Ga0395898_0286136 3300037466 Bacteria 1572
196 Ga0395898_0338226 3300037466 Bacteria 1435
197 Ga0395905_0001136 3300037471 Bacteria 33276
198 Ga0395905_0008938 3300037471 Bacteria 9836
199 Ga0395905_0038162 3300037471 Bacteria 4506
200 Ga0395905_0077263 3300037471 Bacteria 3119
201 Ga0395905_0083009 3300037471 Bacteria 3002
202 Ga0395905_0115612 3300037471 Bacteria 2521
203 Ga0395905_0455355 3300037471 Bacteria 1178
204 Ga0395901_0000073 3300038443 Bacteria 139769
205 Ga0395901_0000839 3300038443 Bacteria 33897
206 Ga0395901_0001782 3300038443 Bacteria 22209
207 Ga0395901_0004488 3300038443 Bacteria 14071
208 Ga0395901_0362116 3300038443 Bacteria 1495
209 Ga0395901_0398003 3300038443 Bacteria 1415
210 Ga0395901_1097195 3300038443 Bacteria 766
211 Ga0436361_0101333 3300039447 Bacteria 28993
212 Ga0436361_0334934 3300039447 Bacteria 33477
213 Ga0436361_0372384 3300039447 Bacteria 12311
214 Ga0436361_0649917 3300039447 Bacteria 7738
215 Ga0439448_0001936 3300042005 Bacteria 5517
216 Ga0439448_0076141 3300042005 Bacteria 1122
217 Ga0439449_0108121 3300042007 Bacteria 1029
218 Ga0439450_038919 3300042008 Bacteria 1097
219 Ga0450904_000596 3300042139 Bacteria 6715
220 Ga0450906_018297 3300042145 Bacteria 1258
221 Ga0466969_0124630 3300044656 Bacteria 1197
222 Ga0466969_0197762 3300044656 Bacteria 917
223 Ga0466972_0002922 3300044658 Bacteria 8466
224 Ga0466965_0004505 3300044683 Bacteria 6202
225 Ga0466965_0008870 3300044683 Bacteria 4661
226 Ga0466965_0080762 3300044683 Bacteria 1643
227 Ga0466965_0099196 3300044683 Bacteria 1488
228 Ga0466965_0483040 3300044683 Bacteria 693
229 Ga0466966_0008545 3300044684 Bacteria 6777
230 Ga0466966_0071099 3300044684 Bacteria 2180
231 Ga0466966_0218382 3300044684 Bacteria 1151
232 Ga0466961_0181536 3300044693 Bacteria 1306
233 Ga0466964_0000728 3300044706 Bacteria 10682
234 Ga0466964_0003729 3300044706 Bacteria 5581
235 Ga0466964_0010785 3300044706 Bacteria 3449
236 Ga0466964_0012676 3300044706 Bacteria 3192
237 Ga0466964_0248084 3300044706 Bacteria 876
238 Ga0466971_0130201 3300044719 Bacteria 1167
239 Ga0466968_0000386 3300044735 Bacteria 14481
240 Ga0466968_0003278 3300044735 Bacteria 5964
241 Ga0466968_0093507 3300044735 Bacteria 1335
242 Ga0466968_0322567 3300044735 Bacteria 746
243 Ga0466970_0064029 3300044765 Bacteria 1971
244 Ga0466957_0002985 3300044842 Bacteria 9183
245 Ga0466957_0034651 3300044842 Bacteria 3028
246 Ga0466957_0123799 3300044842 Bacteria 1650
247 Ga0466957_0225572 3300044842 Bacteria 1238
248 Ga0466959_0026664 3300045049 Bacteria 4283
249 Ga0466959_0027535 3300045049 Bacteria 4215
250 Ga0466959_0125787 3300045049 Bacteria 1819
251 Ga0466958_0078224 3300045836 Bacteria 2032
252 Ga0466958_0188162 3300045836 Bacteria 1311
253 Ga0466967_0375580 3300045976 Bacteria 1379
254 Ga0495617_000002 3300046452 Bacteria 710121
255 Ga0495617_000007 3300046452 Bacteria 369986
256 Ga0495617_000098 3300046452 Bacteria 62441
257 Ga0495617_000715 3300046452 Bacteria 16433
258 Ga0495617_015804 3300046452 Bacteria 2554
259 Ga0495617_036655 3300046452 Bacteria 1643
260 Ga0495617_104313 3300046452 Bacteria 920
261 Ga0495627_000339 3300046453 Bacteria 44178
262 Ga0495627_016787 3300046453 Bacteria 2501
263 Ga0495627_037169 3300046453 Bacteria 1510
264 Ga0495627_077369 3300046453 Bacteria 967
265 Ga0495603_0009020 3300046455 Bacteria 6033
266 Ga0495603_0029552 3300046455 Bacteria 3304
267 Ga0495603_0138959 3300046455 Bacteria 1413
268 Ga0495603_0425777 3300046455 Bacteria 760
269 Ga0495590_0000004 3300046457 Bacteria 402091
270 Ga0495590_0000007 3300046457 Bacteria 331108
271 Ga0495590_0004462 3300046457 Bacteria 5644
272 Ga0495591_000039 3300046458 Bacteria 156460
273 Ga0495629_0143427 3300046459 Bacteria 1661
274 Ga0495629_0149520 3300046459 Bacteria 1623
275 Ga0495638_0000023 3300046460 Bacteria 363063
276 Ga0495638_0026707 3300046460 Bacteria 3741
277 Ga0495638_0030121 3300046460 Bacteria 3496
278 Ga0495638_0034211 3300046460 Bacteria 3245
279 Ga0495638_0235693 3300046460 Bacteria 1016
280 Ga0495653_0000042 3300046463 Bacteria 117284
281 Ga0495653_0053086 3300046463 Bacteria 3102
282 Ga0495650_0000215 3300046471 Bacteria 122533
283 Ga0495650_0000357 3300046471 Bacteria 80726
284 Ga0495650_0000407 3300046471 Bacteria 70819
285 Ga0495650_0005301 3300046471 Bacteria 8438
286 Ga0495650_0005887 3300046471 Bacteria 7793
287 Ga0495650_0034855 3300046471 Bacteria 2221
288 Ga0495580_0036686 3300046472 Bacteria 3518
289 Ga0495580_0118710 3300046472 Bacteria 1836
290 Ga0495582_0002580 3300046473 Bacteria 10077
291 Ga0495582_0009872 3300046473 Bacteria 5254
292 Ga0495582_0040891 3300046473 Bacteria 2554
293 Ga0495605_0000015 3300046474 Bacteria 300227
294 Ga0495605_0000108 3300046474 Bacteria 104865
295 Ga0495605_0004791 3300046474 Bacteria 7909
296 Ga0495605_0019924 3300046474 Bacteria 3571
297 Ga0495605_0031545 3300046474 Bacteria 2706
298 Ga0495605_0034607 3300046474 Bacteria 2557
299 Ga0495605_0040365 3300046474 Bacteria 2331
300 Ga0495639_0036814 3300046475 Bacteria 2193
301 Ga0495639_0303784 3300046475 Bacteria 796
302 Ga0495584_0000022 3300046491 Bacteria 128471
303 Ga0495584_0000095 3300046491 Bacteria 60048
304 Ga0495584_0000282 3300046491 Bacteria 35813
305 Ga0495584_0000662 3300046491 Bacteria 22895
306 Ga0495584_0000712 3300046491 Bacteria 21938
307 Ga0495584_0005119 3300046491 Bacteria 6963
308 Ga0495584_0007950 3300046491 Bacteria 5513
309 Ga0495584_0009279 3300046491 Bacteria 5071
310 Ga0495584_0019996 3300046491 Bacteria 3401
311 Ga0495584_0021376 3300046491 Bacteria 3288
312 Ga0495584_0025629 3300046491 Bacteria 2989
313 Ga0495584_0025824 3300046491 Bacteria 2977
314 Ga0495584_0033309 3300046491 Bacteria 2606
315 Ga0495584_0034276 3300046491 Bacteria 2569
316 Ga0495584_0035692 3300046491 Bacteria 2512
317 Ga0495584_0091903 3300046491 Bacteria 1530
318 Ga0495585_0000004 3300046492 Bacteria 348260
319 Ga0495585_0000172 3300046492 Bacteria 69900
320 Ga0495585_0000511 3300046492 Bacteria 36704
321 Ga0495585_0002480 3300046492 Bacteria 13169
322 Ga0495585_0005383 3300046492 Bacteria 8075
323 Ga0495585_0006370 3300046492 Bacteria 7332
324 Ga0495585_0013031 3300046492 Bacteria 4879
325 Ga0495585_0015424 3300046492 Bacteria 4440
326 Ga0495585_0018380 3300046492 Bacteria 4032
327 Ga0495585_0041943 3300046492 Bacteria 2565
328 Ga0495585_0052381 3300046492 Bacteria 2259
329 Ga0495585_0067397 3300046492 Bacteria 1957
330 Ga0495585_0079327 3300046492 Bacteria 1780
331 Ga0495585_0098172 3300046492 Bacteria 1569
332 Ga0495585_0118791 3300046492 Bacteria 1400
333 Ga0495585_0209779 3300046492 Bacteria 988
334 Ga0495594_0010527 3300046499 Bacteria 4797
335 Ga0495594_0015842 3300046499 Bacteria 3965
336 Ga0495594_0016705 3300046499 Bacteria 3868
337 Ga0495594_0117322 3300046499 Bacteria 1503
338 Ga0495596_0001624 3300046500 Bacteria 12773
339 Ga0495596_0002560 3300046500 Bacteria 9677
340 Ga0495596_0003214 3300046500 Bacteria 8393
341 Ga0495596_0007934 3300046500 Bacteria 4751
342 Ga0495596_0011020 3300046500 Bacteria 3914
343 Ga0495596_0022450 3300046500 Bacteria 2569
344 Ga0495596_0065053 3300046500 Bacteria 1418
345 Ga0495596_0080856 3300046500 Bacteria 1261
346 Ga0495607_0002838 3300046501 Bacteria 13749
347 Ga0495607_0010459 3300046501 Bacteria 6237
348 Ga0495607_0013173 3300046501 Bacteria 5430
349 Ga0495607_0016161 3300046501 Bacteria 4819
350 Ga0495607_0052612 3300046501 Bacteria 2357
351 Ga0495607_0184576 3300046501 Bacteria 1043
352 Ga0495607_0236213 3300046501 Bacteria 886
353 Ga0495583_0000004 3300046506 Bacteria 655287
354 Ga0495583_0000093 3300046506 Bacteria 158708
355 Ga0495583_0000503 3300046506 Bacteria 56256
356 Ga0495583_0001608 3300046506 Bacteria 22146
357 Ga0495583_0001962 3300046506 Bacteria 18882
358 Ga0495583_0002077 3300046506 Bacteria 18070
359 Ga0495583_0009479 3300046506 Bacteria 5810
360 Ga0495583_0014697 3300046506 Bacteria 4302
361 Ga0495583_0018446 3300046506 Bacteria 3673
362 Ga0495583_0125465 3300046506 Bacteria 1077
363 Ga0495606_0000290 3300046507 Bacteria 87022
364 Ga0495606_0000659 3300046507 Bacteria 54217
365 Ga0495606_0002252 3300046507 Bacteria 22956
366 Ga0495606_0002286 3300046507 Bacteria 22645
367 Ga0495606_0003192 3300046507 Bacteria 17680
368 Ga0495606_0004115 3300046507 Bacteria 14769
369 Ga0495606_0006618 3300046507 Bacteria 10635
370 Ga0495606_0009080 3300046507 Bacteria 8474
371 Ga0495606_0016176 3300046507 Bacteria 5703
372 Ga0495606_0040792 3300046507 Bacteria 3118
373 Ga0495606_0134753 3300046507 Bacteria 1464
374 Ga0495606_0179702 3300046507 Bacteria 1221
375 Ga0495606_0235228 3300046507 Bacteria 1024
376 Ga0495606_0259312 3300046507 Bacteria 960
377 Ga0495606_0308080 3300046507 Bacteria 855
378 Ga0495606_0324681 3300046507 Bacteria 825
379 Ga0495606_0457397 3300046507 Bacteria 652
380 Ga0495610_0000004 3300046512 Bacteria 1006135
381 Ga0495610_0002370 3300046512 Bacteria 15919
382 Ga0495610_0007231 3300046512 Bacteria 7445
383 Ga0495610_0009578 3300046512 Bacteria 6109
384 Ga0495610_0014149 3300046512 Bacteria 4702
385 Ga0495610_0047193 3300046512 Bacteria 2120
386 Ga0495610_0052242 3300046512 Bacteria 1985
387 Ga0495610_0098222 3300046512 Bacteria 1315
388 Ga0495616_0000412 3300046513 Bacteria 33007
389 Ga0495616_0001908 3300046513 Bacteria 14064
390 Ga0495616_0006029 3300046513 Bacteria 7386
391 Ga0495616_0006111 3300046513 Bacteria 7334
392 Ga0495616_0006650 3300046513 Bacteria 6981
393 Ga0495616_0009969 3300046513 Bacteria 5522
394 Ga0495616_0019651 3300046513 Bacteria 3684
395 Ga0495616_0023073 3300046513 Bacteria 3352
396 Ga0495616_0023467 3300046513 Bacteria 3318
397 Ga0495616_0023937 3300046513 Bacteria 3281
398 Ga0495616_0030640 3300046513 Bacteria 2824
399 Ga0495616_0034737 3300046513 Bacteria 2615
400 Ga0495616_0247815 3300046513 Bacteria 766
401 Ga0495620_0028891 3300046515 Bacteria 2572
402 Ga0495620_0251612 3300046515 Bacteria 674
403 Ga0495630_0112698 3300046517 Bacteria 2060
404 Ga0495630_0159396 3300046517 Bacteria 1718
405 Ga0495631_0000109 3300046518 Bacteria 54778
406 Ga0495631_0003940 3300046518 Bacteria 8019
407 Ga0495631_0005545 3300046518 Bacteria 6598
408 Ga0495631_0005666 3300046518 Bacteria 6516
409 Ga0495631_0012615 3300046518 Bacteria 4124
410 Ga0495631_0024567 3300046518 Bacteria 2782
411 Ga0495631_0042379 3300046518 Bacteria 2011
412 Ga0495631_0104868 3300046518 Bacteria 1216
413 Ga0495632_0000374 3300046519 Bacteria 42607
414 Ga0495632_0000837 3300046519 Bacteria 27084
415 Ga0495632_0000878 3300046519 Bacteria 26434
416 Ga0495632_0002007 3300046519 Bacteria 16066
417 Ga0495632_0034059 3300046519 Bacteria 2609
418 Ga0495632_0094625 3300046519 Bacteria 1412
419 Ga0495637_0000006 3300046520 Bacteria 435763
420 Ga0495637_0000523 3300046520 Bacteria 27954
421 Ga0495637_0000936 3300046520 Bacteria 18657
422 Ga0495643_0000183 3300046522 Bacteria 100113
423 Ga0495643_0000681 3300046522 Bacteria 39588
424 Ga0495643_0001242 3300046522 Bacteria 24461
425 Ga0495643_0004391 3300046522 Bacteria 9879
426 Ga0495643_0016438 3300046522 Bacteria 4345
427 Ga0495643_0023678 3300046522 Bacteria 3488
428 Ga0495643_0062754 3300046522 Bacteria 1966
429 Ga0495643_0081424 3300046522 Bacteria 1683
430 Ga0495644_0005851 3300046523 Bacteria 4803
431 Ga0495644_0007618 3300046523 Bacteria 4172
432 Ga0495644_0008196 3300046523 Bacteria 4021
433 Ga0495644_0011990 3300046523 Bacteria 3330
434 Ga0495644_0015622 3300046523 Bacteria 2909
435 Ga0495644_0020393 3300046523 Bacteria 2529
436 Ga0495648_0000025 3300046524 Bacteria 233415
437 Ga0495648_0000044 3300046524 Bacteria 175587
438 Ga0495648_0000220 3300046524 Bacteria 65480
439 Ga0495648_0001016 3300046524 Bacteria 28723
440 Ga0495648_0001128 3300046524 Bacteria 27039
441 Ga0495648_0002296 3300046524 Bacteria 17826
442 Ga0495648_0006986 3300046524 Bacteria 9103
443 Ga0495648_0023328 3300046524 Bacteria 4240
444 Ga0495648_0026302 3300046524 Bacteria 3919
445 Ga0495648_0027947 3300046524 Bacteria 3766
446 Ga0495648_0048569 3300046524 Bacteria 2611
447 Ga0495648_0178770 3300046524 Bacteria 1080
448 Ga0495648_0187807 3300046524 Bacteria 1045
449 Ga0495663_0004070 3300046525 Bacteria 4141
450 Ga0495663_0031282 3300046525 Bacteria 1580
451 Ga0495663_0055029 3300046525 Bacteria 1240
452 Ga0495666_0002219 3300046526 Bacteria 9680
453 Ga0495666_0017875 3300046526 Bacteria 3531
454 Ga0495666_0039197 3300046526 Bacteria 2301
455 Ga0495666_0109552 3300046526 Bacteria 1297
456 Ga0495642_0000345 3300046528 Bacteria 25250
457 Ga0495642_0000855 3300046528 Bacteria 14486
458 Ga0495642_0000973 3300046528 Bacteria 13340
459 Ga0495642_0004594 3300046528 Bacteria 5348
460 Ga0495642_0006545 3300046528 Bacteria 4470
461 Ga0495642_0014029 3300046528 Bacteria 3105
462 Ga0495642_0035100 3300046528 Bacteria 2022
463 Ga0495642_0132194 3300046528 Bacteria 1074
464 Ga0495642_0135402 3300046528 Bacteria 1062
465 Ga0495642_0208232 3300046528 Bacteria 853
466 Ga0495642_0247041 3300046528 Bacteria 780
467 Ga0495652_0040140 3300046529 Bacteria 4045
468 Ga0495654_0000004 3300046530 Bacteria 515304
469 Ga0495654_0010780 3300046530 Bacteria 4965
470 Ga0495654_0015494 3300046530 Bacteria 4046
471 Ga0495654_0031008 3300046530 Bacteria 2715
472 Ga0495654_0036676 3300046530 Bacteria 2463
473 Ga0495654_0055220 3300046530 Bacteria 1923
474 Ga0495654_0188754 3300046530 Bacteria 888
475 Ga0495665_0011566 3300046531 Bacteria 4777
476 Ga0495665_0016817 3300046531 Bacteria 3937
477 Ga0495665_0190736 3300046531 Bacteria 1063
478 Ga0495640_0006222 3300046533 Bacteria 9446
479 Ga0495640_0519171 3300046533 Bacteria 724
480 Ga0495586_0001597 3300046535 Bacteria 12462
481 Ga0495586_0034215 3300046535 Bacteria 2728
482 Ga0495586_0082429 3300046535 Bacteria 1768
483 Ga0495586_0193111 3300046535 Bacteria 1153
484 Ga0495587_0116977 3300046536 Bacteria 1528
485 Ga0495609_0000268 3300046538 Bacteria 48889
486 Ga0495609_0003491 3300046538 Bacteria 8983
487 Ga0495609_0005062 3300046538 Bacteria 7033
488 Ga0495609_0009020 3300046538 Bacteria 4848
489 Ga0495609_0009241 3300046538 Bacteria 4776
490 Ga0495609_0010157 3300046538 Bacteria 4527
491 Ga0495609_0013657 3300046538 Bacteria 3832
492 Ga0495609_0026878 3300046538 Bacteria 2632
493 Ga0495609_0066358 3300046538 Bacteria 1589
494 Ga0495609_0075136 3300046538 Bacteria 1481
495 Ga0495609_0087433 3300046538 Bacteria 1357
496 Ga0495609_0120480 3300046538 Bacteria 1128
497 Ga0495597_0000295 3300046542 Bacteria 44823
498 Ga0495597_0000629 3300046542 Bacteria 28799
499 Ga0495597_0000728 3300046542 Bacteria 26264
500 Ga0495597_0005222 3300046542 Bacteria 6904
501 Ga0495597_0009769 3300046542 Bacteria 4724
502 Ga0495597_0012372 3300046542 Bacteria 4117
503 Ga0495597_0013875 3300046542 Bacteria 3851
504 Ga0495597_0053597 3300046542 Bacteria 1773
505 Ga0495597_0069081 3300046542 Bacteria 1525
506 Ga0495597_0069802 3300046542 Bacteria 1515
507 Ga0495597_0221426 3300046542 Bacteria 751
508 Ga0495597_0229766 3300046542 Bacteria 734
509 Ga0495645_0167613 3300046543 Bacteria 1514
510 Ga0495622_0000063 3300046557 Bacteria 95713
511 Ga0495622_0011236 3300046557 Bacteria 4134
512 Ga0495622_0015781 3300046557 Bacteria 3512
513 Ga0495622_0073500 3300046557 Bacteria 1577
514 Ga0495622_0127714 3300046557 Bacteria 1159
515 Ga0495633_0000107 3300046558 Bacteria 111541
516 Ga0495633_0000317 3300046558 Bacteria 54706
517 Ga0495633_0002136 3300046558 Bacteria 14168
518 Ga0495633_0006080 3300046558 Bacteria 7234
519 Ga0495633_0011681 3300046558 Bacteria 4716
520 Ga0495633_0012418 3300046558 Bacteria 4531
521 Ga0495633_0016582 3300046558 Bacteria 3793
522 Ga0495633_0029045 3300046558 Bacteria 2691
523 Ga0495633_0056848 3300046558 Bacteria 1838
524 Ga0495633_0066025 3300046558 Bacteria 1690
525 Ga0495633_0080768 3300046558 Bacteria 1513
526 Ga0495633_0085530 3300046558 Bacteria 1466
527 Ga0495633_0087635 3300046558 Bacteria 1447
528 Ga0495633_0093262 3300046558 Bacteria 1399
529 Ga0495633_0138567 3300046558 Bacteria 1125
530 Ga0495656_0092643 3300046615 Bacteria 1384
531 Ga0495656_0156566 3300046615 Bacteria 1104
532 Ga0495656_0314886 3300046615 Bacteria 805
533 Ga0495668_0000049 3300046616 Bacteria 217657
534 Ga0495668_0000177 3300046616 Bacteria 94811
535 Ga0495668_0000198 3300046616 Bacteria 88730
536 Ga0495668_0000381 3300046616 Bacteria 58825
537 Ga0495668_0001610 3300046616 Bacteria 21126
538 Ga0495668_0003532 3300046616 Bacteria 11642
539 Ga0495668_0009144 3300046616 Bacteria 6105
540 Ga0495668_0013569 3300046616 Bacteria 4800
541 Ga0495668_0016302 3300046616 Bacteria 4318
542 Ga0495668_0019242 3300046616 Bacteria 3938
543 Ga0495668_0071128 3300046616 Bacteria 1912
544 Ga0495668_0316739 3300046616 Bacteria 855
545 Ga0495634_0034848 3300046642 Bacteria 3451
546 Ga0495634_0154028 3300046642 Bacteria 1452
547 Ga0495611_0000792 3300046648 Bacteria 17558
548 Ga0495611_0006401 3300046648 Bacteria 5018
549 Ga0495611_0014135 3300046648 Bacteria 3406
550 Ga0495611_0024531 3300046648 Bacteria 2623
551 Ga0495611_0077830 3300046648 Bacteria 1521
552 Ga0495611_0078596 3300046648 Bacteria 1514
553 Ga0495625_0000123 3300046660 Bacteria 120958
554 Ga0495625_0002502 3300046660 Bacteria 19799
555 Ga0495625_0008021 3300046660 Bacteria 9064
556 Ga0495625_0014139 3300046660 Bacteria 6387
557 Ga0495625_0025266 3300046660 Bacteria 4507
558 Ga0495625_0032646 3300046660 Bacteria 3858
559 Ga0495625_0036276 3300046660 Bacteria 3625
560 Ga0495625_0161768 3300046660 Bacteria 1499
561 Ga0495625_0294606 3300046660 Bacteria 1040
562 Ga0495625_0616627 3300046660 Bacteria 650
563 Ga0495635_0000550 3300046663 Bacteria 23878
564 Ga0495659_0000297 3300046664 Bacteria 19750
565 Ga0495659_0001108 3300046664 Bacteria 9381
566 Ga0495659_0001966 3300046664 Bacteria 6763
567 Ga0495659_0072252 3300046664 Bacteria 1294
568 Ga0495661_0000669 3300046665 Bacteria 34300
569 Ga0495661_0001851 3300046665 Bacteria 16899
570 Ga0495661_0002269 3300046665 Bacteria 14874
571 Ga0495661_0002553 3300046665 Bacteria 13961
572 Ga0495661_0013647 3300046665 Bacteria 5454
573 Ga0495661_0014635 3300046665 Bacteria 5254
574 Ga0495661_0020472 3300046665 Bacteria 4318
575 Ga0495661_0033698 3300046665 Bacteria 3228
576 Ga0495661_0033979 3300046665 Bacteria 3212
577 Ga0495661_0053205 3300046665 Bacteria 2435
578 Ga0495661_0077497 3300046665 Bacteria 1925
579 Ga0495661_0128354 3300046665 Bacteria 1392
580 Ga0495661_0129455 3300046665 Bacteria 1384
581 Ga0495661_0148115 3300046665 Bacteria 1270
582 Ga0495661_0188832 3300046665 Bacteria 1086
583 Ga0495588_0000135 3300046674 Bacteria 117387
584 Ga0495588_0012486 3300046674 Bacteria 4016
585 Ga0495588_0031315 3300046674 Bacteria 2676
586 Ga0495588_0048940 3300046674 Bacteria 2172
587 Ga0495588_0058779 3300046674 Bacteria 1987
588 Ga0495588_0112003 3300046674 Bacteria 1437
589 Ga0495588_0257089 3300046674 Bacteria 920
590 Ga0495588_0276665 3300046674 Bacteria 884
591 Ga0495623_0001059 3300046679 Bacteria 18646
592 Ga0495646_0271581 3300046680 Bacteria 903
593 Ga0495669_0000305 3300046684 Bacteria 27179
594 Ga0495669_0000799 3300046684 Bacteria 13449
595 Ga0495669_0005774 3300046684 Bacteria 5160
596 Ga0495669_0159476 3300046684 Bacteria 1070
597 Ga0495669_0188759 3300046684 Bacteria 983
598 Ga0495613_0038792 3300046689 Bacteria 3531
599 Ga0495624_0014318 3300046690 Bacteria 5385
600 Ga0495624_0090065 3300046690 Bacteria 1893
601 Ga0495670_0000228 3300046691 Bacteria 25521
602 Ga0495670_0000798 3300046691 Bacteria 15155
603 Ga0495670_0003938 3300046691 Bacteria 7289
604 Ga0495670_0016153 3300046691 Bacteria 3670
605 Ga0495670_0019950 3300046691 Bacteria 3303
606 Ga0495670_0024011 3300046691 Bacteria 3010
607 Ga0495670_0080852 3300046691 Bacteria 1655
608 Ga0495670_0107840 3300046691 Bacteria 1439
609 Ga0495670_0141631 3300046691 Bacteria 1257
610 Ga0495671_0000318 3300046692 Bacteria 40825
611 Ga0495671_0001337 3300046692 Bacteria 16719
612 Ga0495671_0003333 3300046692 Bacteria 9922
613 Ga0495671_0044194 3300046692 Bacteria 2234
614 Ga0495671_0117980 3300046692 Bacteria 1295
615 Ga0495671_0151098 3300046692 Bacteria 1130
616 Ga0495649_0000183 3300046694 Bacteria 54730
617 Ga0495649_0007999 3300046694 Bacteria 6391
618 Ga0495649_0022047 3300046694 Bacteria 3567
619 Ga0495649_0031127 3300046694 Bacteria 2943
620 Ga0495649_0032307 3300046694 Bacteria 2883
621 Ga0495589_0000569 3300046794 Bacteria 25465
622 Ga0495589_0000651 3300046794 Bacteria 22766
623 Ga0495589_0008207 3300046794 Bacteria 5460
624 Ga0495589_0008627 3300046794 Bacteria 5315
625 Ga0495589_0038429 3300046794 Bacteria 2395
626 Ga0495589_0072773 3300046794 Bacteria 1678
627 Ga0495589_0108057 3300046794 Bacteria 1344
628 Ga0495600_0002426 3300046809 Bacteria 10699
629 Ga0495600_0022603 3300046809 Bacteria 4039
630 Ga0495600_0425080 3300046809 Bacteria 824
631 Ga0495660_0001078 3300046810 Bacteria 19547
632 Ga0495660_0006077 3300046810 Bacteria 7171
633 Ga0495660_0006880 3300046810 Bacteria 6696
634 Ga0495660_0007399 3300046810 Bacteria 6447
635 Ga0495660_0017630 3300046810 Bacteria 4109
636 Ga0495660_0021905 3300046810 Bacteria 3654
637 Ga0495660_0038115 3300046810 Bacteria 2674
638 Ga0495660_0040808 3300046810 Bacteria 2571
639 Ga0495660_0045979 3300046810 Bacteria 2395
640 Ga0495660_0052906 3300046810 Bacteria 2205
641 Ga0495660_0075385 3300046810 Bacteria 1780
642 Ga0495660_0084010 3300046810 Bacteria 1665
643 Ga0495660_0088801 3300046810 Bacteria 1610
644 Ga0495660_0122103 3300046810 Bacteria 1316
645 Ga0495581_0004900 3300047315 Bacteria 7742
646 Ga0495581_0177433 3300047315 Bacteria 1245
647 Ga0495604_0003344 3300047317 Bacteria 12784
648 Ga0495636_0004778 3300047318 Bacteria 5309
649 Ga0495636_0011362 3300047318 Bacteria 3524
650 Ga0495636_0019690 3300047318 Bacteria 2714
651 Ga0495636_0052557 3300047318 Bacteria 1709
652 Ga0495636_0182024 3300047318 Bacteria 954
653 Ga0495674_0746625 3300047319 Bacteria 765
654 Ga0495672_0000060 3300047320 Bacteria 214547
655 Ga0495672_0000118 3300047320 Bacteria 124396
656 Ga0495672_0000159 3300047320 Bacteria 98262
657 Ga0495672_0002309 3300047320 Bacteria 17689
658 Ga0495672_0002552 3300047320 Bacteria 16600
659 Ga0495672_0004007 3300047320 Bacteria 12321
660 Ga0495672_0007939 3300047320 Bacteria 7912
661 Ga0495672_0015919 3300047320 Bacteria 5091
662 Ga0495672_0029735 3300047320 Bacteria 3436
663 Ga0495672_0063115 3300047320 Bacteria 2127
664 Ga0495672_0095107 3300047320 Bacteria 1627
665 Ga0495672_0214998 3300047320 Bacteria 952
666 Ga0495672_0272268 3300047320 Bacteria 812
667 Ga0495676_0000014 3300047321 Bacteria 203356
668 Ga0495676_0041546 3300047321 Bacteria 3783
669 Ga0495676_0081218 3300047321 Bacteria 2458
670 Ga0495676_0105349 3300047321 Bacteria 2079
671 Ga0495680_0004551 3300047322 Bacteria 13247
672 Ga0495680_0007141 3300047322 Bacteria 10289
673 Ga0495680_0552002 3300047322 Bacteria 776
674 Ga0495683_0000157 3300047323 Bacteria 66884
675 Ga0495683_0001362 3300047323 Bacteria 16270
676 Ga0495683_0007170 3300047323 Bacteria 6047
677 Ga0495683_0010144 3300047323 Bacteria 4993
678 Ga0495683_0012774 3300047323 Bacteria 4405
679 Ga0495683_0024963 3300047323 Bacteria 3064
680 Ga0495683_0033787 3300047323 Bacteria 2601
681 Ga0495683_0180806 3300047323 Bacteria 963
682 Ga0495687_000049 3300047443 Bacteria 205432
683 Ga0495687_000112 3300047443 Bacteria 124725
684 Ga0495687_000832 3300047443 Bacteria 32951
685 Ga0495687_002296 3300047443 Bacteria 15633
686 Ga0495687_002751 3300047443 Bacteria 13635
687 Ga0495687_004364 3300047443 Bacteria 9619
688 Ga0495687_084355 3300047443 Bacteria 1235
689 Ga0495687_150005 3300047443 Bacteria 798
690 Ga0495675_0002690 3300047444 Bacteria 10648
691 Ga0495675_0005401 3300047444 Bacteria 7787
692 Ga0495677_0000267 3300047445 Bacteria 22920
693 Ga0495677_0000597 3300047445 Bacteria 14827
694 Ga0495677_0001133 3300047445 Bacteria 10638
695 Ga0495677_0002482 3300047445 Bacteria 7240
696 Ga0495677_0014446 3300047445 Bacteria 2874
697 Ga0495677_0017053 3300047445 Bacteria 2632
698 Ga0495677_0026056 3300047445 Bacteria 2122
699 Ga0495677_0070275 3300047445 Bacteria 1304
700 Ga0495677_0104981 3300047445 Bacteria 1071
701 Ga0495679_002450 3300047446 Bacteria 9451
702 Ga0495679_021483 3300047446 Bacteria 2227
703 Ga0495679_033265 3300047446 Bacteria 1648
704 Ga0495679_104635 3300047446 Bacteria 783
705 Ga0495685_000297 3300047447 Bacteria 16386
706 Ga0495685_005376 3300047447 Bacteria 4178
707 Ga0495685_005761 3300047447 Bacteria 4046
708 Ga0495685_013729 3300047447 Bacteria 2749
709 Ga0495685_048782 3300047447 Bacteria 1439
710 Ga0495685_115634 3300047447 Bacteria 881
711 Ga0495673_0000017 3300047469 Bacteria 574970
712 Ga0495673_0003502 3300047469 Bacteria 10329
713 Ga0495673_0017617 3300047469 Bacteria 3620
714 Ga0495681_0000494 3300047470 Bacteria 30235
715 Ga0495681_0002931 3300047470 Bacteria 12061
716 Ga0495681_0026373 3300047470 Bacteria 3025
717 Ga0495681_0034546 3300047470 Bacteria 2518
718 Ga0495681_0078792 3300047470 Bacteria 1475
719 Ga0495681_0084863 3300047470 Bacteria 1407
720 Ga0495681_0088986 3300047470 Bacteria 1366
721 Ga0495686_0000140 3300047472 Bacteria 144956
722 Ga0495686_0002406 3300047472 Bacteria 17757
723 Ga0495686_0012836 3300047472 Bacteria 5843
724 Ga0495686_0031771 3300047472 Bacteria 3420
725 Ga0495686_0173165 3300047472 Bacteria 1254
726 Ga0495686_0199052 3300047472 Bacteria 1151
727 Ga0495686_0242526 3300047472 Bacteria 1015
728 Ga0495593_0000527 3300047673 Bacteria 21657
729 Ga0495593_0055200 3300047673 Bacteria 2091
730 Ga0495602_0025977 3300048088 Bacteria 5658
731 Ga0495602_0344774 3300048088 Bacteria 1076
732 Ga0495614_0000102 3300048089 Bacteria 29128
733 Ga0495614_0135029 3300048089 Bacteria 1094
734 Ga0495615_0006367 3300048090 Bacteria 2182
735 Ga0495615_0018968 3300048090 Bacteria 1521
736 Ga0495626_0005480 3300048091 Bacteria 7405
737 Ga0495626_0006856 3300048091 Bacteria 6427
738 Ga0495626_0007513 3300048091 Bacteria 6056
739 Ga0495626_0013767 3300048091 Bacteria 4195
740 Ga0495626_0016227 3300048091 Bacteria 3787
741 Ga0495626_0016713 3300048091 Bacteria 3721
742 Ga0495626_0017401 3300048091 Bacteria 3630
743 Ga0495626_0019913 3300048091 Bacteria 3347
744 Ga0495626_0020154 3300048091 Bacteria 3326
745 Ga0495626_0029639 3300048091 Bacteria 2646
746 Ga0495626_0030999 3300048091 Bacteria 2576
747 Ga0495626_0041353 3300048091 Bacteria 2171
748 Ga0495626_0086826 3300048091 Bacteria 1381
749 Ga0495626_0097294 3300048091 Bacteria 1287
750 Ga0495626_0100242 3300048091 Bacteria 1263
751 Ga0495626_0161115 3300048091 Bacteria 940
752 Ga0496100_0970753 3300048903 Bacteria 668
753 Ga0496101_0022215 3300048904 Bacteria 4366
754 Ga0496101_0494171 3300048904 Bacteria 966
755 Ga0496102_0000098 3300048905 Bacteria 123789
756 Ga0496102_0000220 3300048905 Bacteria 75547
757 Ga0496102_0033169 3300048905 Bacteria 4639
758 Ga0496102_0034795 3300048905 Bacteria 4533
759 Ga0496103_0034671 3300048906 Bacteria 3087
760 Ga0496103_0089409 3300048906 Bacteria 1943
761 Ga0496103_0121085 3300048906 Bacteria 1666
762 Ga0496104_0077552 3300048907 Bacteria 3166
763 Ga0496106_0013411 3300048909 Bacteria 6050
764 Ga0496106_0062533 3300048909 Bacteria 2827
765 Ga0496107_0126250 3300048910 Bacteria 1887
766 Ga0496109_0211166 3300048912 Bacteria 1825
767 Ga0496109_0220657 3300048912 Bacteria 1783
768 Ga0496110_0002669 3300048913 Bacteria 13468
769 Ga0496110_0045966 3300048913 Bacteria 3818
770 Ga0496111_0030269 3300048914 Bacteria 3849
771 Ga0496111_0208352 3300048914 Bacteria 1452
772 Ga0496113_0017843 3300048916 Bacteria 4934
773 Ga0496113_0237182 3300048916 Bacteria 1455
774 Ga0496115_0210419 3300048918 Bacteria 1606
775 Ga0496115_0856674 3300048918 Bacteria 703
776 Ga0496116_0010251 3300048919 Bacteria 7878
777 Ga0496116_0039327 3300048919 Bacteria 3272
778 Ga0496117_0000001 3300048920 Bacteria 2526244
779 Ga0496118_0000008 3300048921 Bacteria 644537
780 Ga0496120_0048125 3300048923 Bacteria 2455
781 Ga0496121_0011103 3300048924 Bacteria 10053
782 Ga0496121_0015331 3300048924 Bacteria 8042
783 Ga0496121_0018459 3300048924 Bacteria 7031
784 Ga0496121_0089518 3300048924 Bacteria 2409
785 Ga0496121_0191248 3300048924 Bacteria 1467
786 Ga0496122_0000169 3300048925 Bacteria 155380
787 Ga0496122_0000249 3300048925 Bacteria 121066
788 Ga0496122_0000847 3300048925 Bacteria 57788
789 Ga0496122_0018521 3300048925 Bacteria 6427
790 Ga0496122_0026183 3300048925 Bacteria 5039
791 Ga0496122_0126105 3300048925 Bacteria 1638
792 Ga0496123_0002226 3300048926 Bacteria 24595
793 Ga0496123_0005545 3300048926 Bacteria 12652
794 Ga0496123_0005792 3300048926 Bacteria 12268
795 Ga0496123_0008550 3300048926 Bacteria 9385
796 Ga0496123_0022133 3300048926 Bacteria 4910
797 Ga0496124_0009352 3300048927 Bacteria 10098
798 Ga0496124_0131246 3300048927 Bacteria 1990
799 Ga0496124_0180149 3300048927 Bacteria 1627
800 Ga0496124_0274945 3300048927 Bacteria 1231
801 Ga0496125_0006783 3300048928 Bacteria 12294
802 Ga0496125_0011048 3300048928 Bacteria 9061
803 Ga0496125_0059606 3300048928 Bacteria 3074
804 Ga0495678_000056 3300049459 Bacteria 149598
805 Ga0495678_000079 3300049459 Bacteria 122038
806 Ga0495678_000424 3300049459 Bacteria 42503
807 Ga0495678_000981 3300049459 Bacteria 24425
808 Ga0495678_001101 3300049459 Bacteria 22735
809 Ga0495678_002357 3300049459 Bacteria 12968
810 Ga0495678_003821 3300049459 Bacteria 9067
811 Ga0495682_0000448 3300049460 Bacteria 28585
812 Ga0495682_0001431 3300049460 Bacteria 12906
813 Ga0495682_0005202 3300049460 Bacteria 5433
814 Ga0495682_0006255 3300049460 Bacteria 4839
815 Ga0495682_0012758 3300049460 Bacteria 3214
816 Ga0501238_000845 3300049671 Bacteria 3484
817 Ga0501269_000103 3300049766 Bacteria 26706
818 Ga0501269_002216 3300049766 Bacteria 2416
819 Ga0501035_0001651 3300049822 Bacteria 22551
820 Ga0501044_0117837 3300049823 Bacteria 2659
821 Ga0495655_0046717 3300053083 Bacteria 1130
822 Ga0500594_0010409 3300053118 Bacteria 2159
823 Ga0500618_000965 3300053125 Bacteria 14663
824 Ga0500586_000082 3300053145 Bacteria 16424
825 Ga0466962_0280736 3300061719 Bacteria 822
826 2511248145 2511231003 Bacteria 5606035
827 2511387016 2511231026 Bacteria 5225445
828 2550697284 2548876994 Bacteria 4904866
829 2553004539 2551306416 Bacteria 6152985
830 2601670658 2600255292 Bacteria 6300551
831 2644213395 2643221638 Bacteria 6579467
832 2644250897 2643221645 Bacteria 7207331
833 2644356316 2643221664 Bacteria 7272945
834 2738739042 2738541280 Bacteria 6630198
835 2738825443 2738541297 Bacteria 6549566
836 2738846274 2738541300 Bacteria 6675882
837 2739149240 2738541357 Bacteria 6549408
838 2739191159 2738543003 Bacteria 6549560
839 2739275077 2738543018 Bacteria 6718814
840 2739317636 2738543026 Bacteria 6549408
841 2739335877 2738543029 Bacteria 6549249
842 2739344121 2738543030 Bacteria 6719714
843 2765567965 2765235838 Bacteria 5445269
844 2808983811 2808606386 Bacteria 4471946
845 2809129483 2808606415 Bacteria 4576710
846 2809144353 2808606418 Bacteria 6724496
847 2809149462 2808606419 Bacteria 4576925
848 2819592491 2818991445 Bacteria 4955017
849 2821134036 2821131069 Bacteria 6108407
850 2839097745 2839094727 Bacteria 5534556
851 2842717923 2842711865 Bacteria 7155354
852 2852619609 2852618963 Bacteria 4577824
853 2857547997 2857547612 Bacteria 6179999
854 2857565848 2857564685 Bacteria 6290584
855 2884814662 2884811622 Bacteria 5552861
856 2884839021 2884836552 Bacteria 5219991
857 2884855312 2884852848 Bacteria 5221161
858 2885083590 2885080285 Bacteria 6355622
859 2896159181 2896154374 Bacteria 5221518
860 2904440650 2904439833 Bacteria 5931679
861 2904535758 2904530477 Bacteria 5876334
862 2904586081 2904584206 Bacteria 6028872
863 2904592106 2904589729 Bacteria 6113573
864 2904601737 2904601388 Bacteria 5884906
865 2919084808 2919079590 Bacteria 5946433
866 2919480743 2919476304 Bacteria 5888696
867 2923515365 2923510766 Bacteria 5926163
868 2932412588 2932410948 Bacteria 6312192
869 2932420103 2932416698 Bacteria 6315112
870 Ga0070682_100226048
871 JGI25155J39150_1000136
872 JGI25155J39150_1000346
873 JGI25156J39149_1000156
874 JGI25156J39149_1017737
875 JGI25162J39368_1007673
876 JGI25154J39366_1000430
877 JGI25154J39366_1000531
878 JGI25157J39369_1000277
879 JGI25152J39213_1005883
880 JGI25150J39212_1005303
881 JGI25150J39212_1005343
882 JGI25159J45721_1002907
883 JGI25153J46596_10003648
884 rootL2_10059938
885 rootL2_10059939
886 rootH1_10077050
887 JGI25161J50226_1002299
888 Ga0055539_1000012
889 Ga0055533_1000015
890 Ga0055532_1000005
891 Ga0055525_1000017
892 Ga0055535_1004655
893 Ga0055542_1010166
894 Ga0055529_1000559
895 Ga0055526_1002342
896 Ga0055526_1016003
897 Ga0055526_1017619
898 Ga0055537_1000156
899 Ga0055537_1000223
900 Ga0055537_1002247
901 Ga0055537_1006413
902 Ga0055524_1000029
903 Ga0055524_1000911
904 Ga0055524_1001135
905 Ga0055524_1001937
906 Ga0055534_1000059
907 Ga0055534_1001040
908 Ga0055528_1000341
909 Ga0055530_10001933
910 Ga0055531_10034895
911 Ga0055541_1000009
912 Ga0065165_1022035
913 Ga0065165_1044075
914 Ga0065715_10002863
915 Ga0070658_10399480
916 Ga0070658_10637338
917 Ga0070682_100149952
918 Ga0070660_100379102
919 Ga0070661_100159617
920 Ga0070659_100171919
921 Ga0068855_100014961
922 Ga0068855_100051205
923 Ga0070664_100107001
924 Ga0068854_100001881
925 Ga0068856_100826377
926 Ga0068852_100036184
927 Ga0068871_100143560
928 Ga0079104_1013514
929 Ga0099826_10000003
930 Ga0105251_10040692
931 Ga0105244_10000480
932 Ga0105244_10106896
933 Ga0105240_10001345
934 Ga0105240_10016284
935 Ga0105240_10505360
936 Ga0105243_10022107
937 Ga0105242_10066580
938 Ga0105242_10095195
939 Ga0105237_10192516
940 Ga0105237_10321740
941 Ga0105238_10000155
942 Ga0105238_10045973
943 Ga0105239_10046442
944 Ga0105246_10071910
945 Ga0105246_10758885
946 Ga0157371_10000001
947 Ga0182008_10000831
948 Ga0182006_1000014
949 Ga0182006_1000044
950 Ga0182006_1038997
951 Ga0182006_1109604
952 Ga0182007_10000011
953 Ga0182007_10025303
954 Ga0182005_1000014
955 Ga0182005_1000052
956 Ga0163161_10094707
957 Ga0163161_10118078
958 Ga0213872_10000002
959 Ga0213872_10002383
960 Ga0213872_10011337
961 Ga0213872_10022211
962 Ga0213872_10159183
963 Ga0209435_100004
964 Ga0209435_100156
965 Ga0209436_100207
966 Ga0209784_100005
967 Ga0209566_100005
968 Ga0209674_100009
969 Ga0209147_100011
970 Ga0209563_100012
971 Ga0209437_100084
972 Ga0209437_104942
973 Ga0209437_109794
974 Ga0209258_100264
975 Ga0207425_1000006
976 Ga0207425_1000136
977 Ga0207425_1000533
978 Ga0207425_1000745
979 Ga0209646_1000032
980 Ga0209646_1000052
981 Ga0209646_1000228
982 Ga0209026_1000062
983 Ga0209026_1002562
984 Ga0209677_100006
985 Ga0209148_1000708
986 Ga0209759_1000054
987 Ga0209759_1000514
988 Ga0209129_1000090
989 Ga0209129_1000921
990 Ga0209565_1000006
991 Ga0209565_1000382
992 Ga0209565_1004245
993 Ga0209565_1004283
994 Ga0209565_1007626
995 Ga0209455_1000051
996 Ga0209673_1000004
997 Ga0209673_1019827
998 Ga0209130_1002373
999 Ga0209675_1000006
1000 Ga0209675_1000410
1001 Ga0209675_1016205
1002 Ga0209025_1004541
1003 Ga0209564_1000006
1004 Ga0209564_1000064
1005 Ga0209564_1000639
1006 Ga0209564_1000888
1007 Ga0209564_1043182
1008 Ga0209758_1000047
1009 Ga0209758_1001064
1010 Ga0209050_1000469
1011 Ga0209050_1002061
1012 Ga0209256_1000013
1013 Ga0209256_1001427
1014 Ga0209256_1001603
1015 Ga0209256_1001909
1016 Ga0209256_1002561
1017 Ga0207426_1001538
1018 Ga0209257_1000010
1019 Ga0207655_1003539
1020 Ga0207705_10002897
1021 Ga0207695_10001257
1022 Ga0207695_10002162
1023 Ga0207695_10055225
1024 Ga0207671_10106159
1025 Ga0207657_10061945
1026 Ga0207649_10510026
1027 Ga0207694_10000625
1028 Ga0207694_10676326
1029 Ga0207686_10107941
1030 Ga0207679_10422723
1031 Ga0207667_10006079
1032 Ga0207667_10028495
1033 Ga0207667_10035515
1034 Ga0207640_10002110
1035 Ga0207674_10078354
1036 Ga0207698_10033350
1037 Ga0207698_10535666
1038 Ga0209281_1008838
1039 Ga0209282_1000002
1040 Ga0316181_1128485
1041 Ga0307408_100000331
1042 Ga0307408_100124446
1043 Ga0307406_10216473
1044 Ga0307416_100548526
1045 Ga0307414_10003756
1046 Ga0395899_0001136
1047 Ga0395899_0013433
1048 Ga0395899_0017193
1049 Ga0395899_0044535
1050 Ga0395899_0048034
1051 Ga0395899_0056524
1052 Ga0395899_0160071
1053 Ga0395900_0004042
1054 Ga0395900_0004356
1055 Ga0395900_0012554
1056 Ga0395900_0070922
1057 Ga0395900_0123921
1058 Ga0395900_0248848
1059 Ga0395900_0401544
1060 Ga0395898_0016407
1061 Ga0395898_0037964
1062 Ga0395898_0130301
1063 Ga0395898_0188585
1064 Ga0395898_0286136
1065 Ga0395898_0338226
1066 Ga0395905_0001136
1067 Ga0395905_0008938
1068 Ga0395905_0038162
1069 Ga0395905_0077263
1070 Ga0395905_0083009
1071 Ga0395905_0115612
1072 Ga0395905_0455355
1073 Ga0395901_0000073
1074 Ga0395901_0000839
1075 Ga0395901_0001782
1076 Ga0395901_0004488
1077 Ga0395901_0362116
1078 Ga0395901_0398003
1079 Ga0395901_1097195
1080 Ga0436361_0101333
1081 Ga0436361_0334934
1082 Ga0436361_0372384
1083 Ga0436361_0649917
1084 Ga0439448_0001936
1085 Ga0439448_0076141
1086 Ga0439449_0108121
1087 Ga0439450_038919
1088 Ga0450904_000596
1089 Ga0450906_018297
1090 Ga0466969_0124630
1091 Ga0466969_0197762
1092 Ga0466972_0002922
1093 Ga0466965_0004505
1094 Ga0466965_0008870
1095 Ga0466965_0080762
1096 Ga0466965_0099196
1097 Ga0466965_0483040
1098 Ga0466966_0008545
1099 Ga0466966_0071099
1100 Ga0466966_0218382
1101 Ga0466961_0181536
1102 Ga0466964_0000728
1103 Ga0466964_0003729
1104 Ga0466964_0010785
1105 Ga0466964_0012676
1106 Ga0466964_0248084
1107 Ga0466971_0130201
1108 Ga0466968_0000386
1109 Ga0466968_0003278
1110 Ga0466968_0093507
1111 Ga0466968_0322567
1112 Ga0466970_0064029
1113 Ga0466957_0002985
1114 Ga0466957_0034651
1115 Ga0466957_0123799
1116 Ga0466957_0225572
1117 Ga0466959_0026664
1118 Ga0466959_0027535
1119 Ga0466959_0125787
1120 Ga0466958_0078224
1121 Ga0466958_0188162
1122 Ga0466967_0375580
1123 Ga0495617_000002
1124 Ga0495617_000007
1125 Ga0495617_000098
1126 Ga0495617_000715
1127 Ga0495617_015804
1128 Ga0495617_036655
1129 Ga0495617_104313
1130 Ga0495627_000339
1131 Ga0495627_016787
1132 Ga0495627_037169
1133 Ga0495627_077369
1134 Ga0495603_0009020
1135 Ga0495603_0029552
1136 Ga0495603_0138959
1137 Ga0495603_0425777
1138 Ga0495590_0000004
1139 Ga0495590_0000007
1140 Ga0495590_0004462
1141 Ga0495591_000039
1142 Ga0495629_0143427
1143 Ga0495629_0149520
1144 Ga0495638_0000023
1145 Ga0495638_0026707
1146 Ga0495638_0030121
1147 Ga0495638_0034211
1148 Ga0495638_0235693
1149 Ga0495653_0000042
1150 Ga0495653_0053086
1151 Ga0495650_0000215
1152 Ga0495650_0000357
1153 Ga0495650_0000407
1154 Ga0495650_0005301
1155 Ga0495650_0005887
1156 Ga0495650_0034855
1157 Ga0495580_0036686
1158 Ga0495580_0118710
1159 Ga0495582_0002580
1160 Ga0495582_0009872
1161 Ga0495582_0040891
1162 Ga0495605_0000015
1163 Ga0495605_0000108
1164 Ga0495605_0004791
1165 Ga0495605_0019924
1166 Ga0495605_0031545
1167 Ga0495605_0034607
1168 Ga0495605_0040365
1169 Ga0495639_0036814
1170 Ga0495639_0303784
1171 Ga0495584_0000022
1172 Ga0495584_0000095
1173 Ga0495584_0000282
1174 Ga0495584_0000662
1175 Ga0495584_0000712
1176 Ga0495584_0005119
1177 Ga0495584_0007950
1178 Ga0495584_0009279
1179 Ga0495584_0019996
1180 Ga0495584_0021376
1181 Ga0495584_0025629
1182 Ga0495584_0025824
1183 Ga0495584_0033309
1184 Ga0495584_0034276
1185 Ga0495584_0035692
1186 Ga0495584_0091903
1187 Ga0495585_0000004
1188 Ga0495585_0000172
1189 Ga0495585_0000511
1190 Ga0495585_0002480
1191 Ga0495585_0005383
1192 Ga0495585_0006370
1193 Ga0495585_0013031
1194 Ga0495585_0015424
1195 Ga0495585_0018380
1196 Ga0495585_0041943
1197 Ga0495585_0052381
1198 Ga0495585_0067397
1199 Ga0495585_0079327
1200 Ga0495585_0098172
1201 Ga0495585_0118791
1202 Ga0495585_0209779
1203 Ga0495594_0010527
1204 Ga0495594_0015842
1205 Ga0495594_0016705
1206 Ga0495594_0117322
1207 Ga0495596_0001624
1208 Ga0495596_0002560
1209 Ga0495596_0003214
1210 Ga0495596_0007934
1211 Ga0495596_0011020
1212 Ga0495596_0022450
1213 Ga0495596_0065053
1214 Ga0495596_0080856
1215 Ga0495607_0002838
1216 Ga0495607_0010459
1217 Ga0495607_0013173
1218 Ga0495607_0016161
1219 Ga0495607_0052612
1220 Ga0495607_0184576
1221 Ga0495607_0236213
1222 Ga0495583_0000004
1223 Ga0495583_0000093
1224 Ga0495583_0000503
1225 Ga0495583_0001608
1226 Ga0495583_0001962
1227 Ga0495583_0002077
1228 Ga0495583_0009479
1229 Ga0495583_0014697
1230 Ga0495583_0018446
1231 Ga0495583_0125465
1232 Ga0495606_0000290
1233 Ga0495606_0000659
1234 Ga0495606_0002252
1235 Ga0495606_0002286
1236 Ga0495606_0003192
1237 Ga0495606_0004115
1238 Ga0495606_0006618
1239 Ga0495606_0009080
1240 Ga0495606_0016176
1241 Ga0495606_0040792
1242 Ga0495606_0134753
1243 Ga0495606_0179702
1244 Ga0495606_0235228
1245 Ga0495606_0259312
1246 Ga0495606_0308080
1247 Ga0495606_0324681
1248 Ga0495606_0457397
1249 Ga0495610_0000004
1250 Ga0495610_0002370
1251 Ga0495610_0007231
1252 Ga0495610_0009578
1253 Ga0495610_0014149
1254 Ga0495610_0047193
1255 Ga0495610_0052242
1256 Ga0495610_0098222
1257 Ga0495616_0000412
1258 Ga0495616_0001908
1259 Ga0495616_0006029
1260 Ga0495616_0006111
1261 Ga0495616_0006650
1262 Ga0495616_0009969
1263 Ga0495616_0019651
1264 Ga0495616_0023073
1265 Ga0495616_0023467
1266 Ga0495616_0023937
1267 Ga0495616_0030640
1268 Ga0495616_0034737
1269 Ga0495616_0247815
1270 Ga0495620_0028891
1271 Ga0495620_0251612
1272 Ga0495630_0112698
1273 Ga0495630_0159396
1274 Ga0495631_0000109
1275 Ga0495631_0003940
1276 Ga0495631_0005545
1277 Ga0495631_0005666
1278 Ga0495631_0012615
1279 Ga0495631_0024567
1280 Ga0495631_0042379
1281 Ga0495631_0104868
1282 Ga0495632_0000374
1283 Ga0495632_0000837
1284 Ga0495632_0000878
1285 Ga0495632_0002007
1286 Ga0495632_0034059
1287 Ga0495632_0094625
1288 Ga0495637_0000006
1289 Ga0495637_0000523
1290 Ga0495637_0000936
1291 Ga0495643_0000183
1292 Ga0495643_0000681
1293 Ga0495643_0001242
1294 Ga0495643_0004391
1295 Ga0495643_0016438
1296 Ga0495643_0023678
1297 Ga0495643_0062754
1298 Ga0495643_0081424
1299 Ga0495644_0005851
1300 Ga0495644_0007618
1301 Ga0495644_0008196
1302 Ga0495644_0011990
1303 Ga0495644_0015622
1304 Ga0495644_0020393
1305 Ga0495648_0000025
1306 Ga0495648_0000044
1307 Ga0495648_0000220
1308 Ga0495648_0001016
1309 Ga0495648_0001128
1310 Ga0495648_0002296
1311 Ga0495648_0006986
1312 Ga0495648_0023328
1313 Ga0495648_0026302
1314 Ga0495648_0027947
1315 Ga0495648_0048569
1316 Ga0495648_0178770
1317 Ga0495648_0187807
1318 Ga0495663_0004070
1319 Ga0495663_0031282
1320 Ga0495663_0055029
1321 Ga0495666_0002219
1322 Ga0495666_0017875
1323 Ga0495666_0039197
1324 Ga0495666_0109552
1325 Ga0495642_0000345
1326 Ga0495642_0000855
1327 Ga0495642_0000973
1328 Ga0495642_0004594
1329 Ga0495642_0006545
1330 Ga0495642_0014029
1331 Ga0495642_0035100
1332 Ga0495642_0132194
1333 Ga0495642_0135402
1334 Ga0495642_0208232
1335 Ga0495642_0247041
1336 Ga0495652_0040140
1337 Ga0495654_0000004
1338 Ga0495654_0010780
1339 Ga0495654_0015494
1340 Ga0495654_0031008
1341 Ga0495654_0036676
1342 Ga0495654_0055220
1343 Ga0495654_0188754
1344 Ga0495665_0011566
1345 Ga0495665_0016817
1346 Ga0495665_0190736
1347 Ga0495640_0006222
1348 Ga0495640_0519171
1349 Ga0495586_0001597
1350 Ga0495586_0034215
1351 Ga0495586_0082429
1352 Ga0495586_0193111
1353 Ga0495587_0116977
1354 Ga0495609_0000268
1355 Ga0495609_0003491
1356 Ga0495609_0005062
1357 Ga0495609_0009020
1358 Ga0495609_0009241
1359 Ga0495609_0010157
1360 Ga0495609_0013657
1361 Ga0495609_0026878
1362 Ga0495609_0066358
1363 Ga0495609_0075136
1364 Ga0495609_0087433
1365 Ga0495609_0120480
1366 Ga0495597_0000295
1367 Ga0495597_0000629
1368 Ga0495597_0000728
1369 Ga0495597_0005222
1370 Ga0495597_0009769
1371 Ga0495597_0012372
1372 Ga0495597_0013875
1373 Ga0495597_0053597
1374 Ga0495597_0069081
1375 Ga0495597_0069802
1376 Ga0495597_0221426
1377 Ga0495597_0229766
1378 Ga0495645_0167613
1379 Ga0495622_0000063
1380 Ga0495622_0011236
1381 Ga0495622_0015781
1382 Ga0495622_0073500
1383 Ga0495622_0127714
1384 Ga0495633_0000107
1385 Ga0495633_0000317
1386 Ga0495633_0002136
1387 Ga0495633_0006080
1388 Ga0495633_0011681
1389 Ga0495633_0012418
1390 Ga0495633_0016582
1391 Ga0495633_0029045
1392 Ga0495633_0056848
1393 Ga0495633_0066025
1394 Ga0495633_0080768
1395 Ga0495633_0085530
1396 Ga0495633_0087635
1397 Ga0495633_0093262
1398 Ga0495633_0138567
1399 Ga0495656_0092643
1400 Ga0495656_0156566
1401 Ga0495656_0314886
1402 Ga0495668_0000049
1403 Ga0495668_0000177
1404 Ga0495668_0000198
1405 Ga0495668_0000381
1406 Ga0495668_0001610
1407 Ga0495668_0003532
1408 Ga0495668_0009144
1409 Ga0495668_0013569
1410 Ga0495668_0016302
1411 Ga0495668_0019242
1412 Ga0495668_0071128
1413 Ga0495668_0316739
1414 Ga0495634_0034848
1415 Ga0495634_0154028
1416 Ga0495611_0000792
1417 Ga0495611_0006401
1418 Ga0495611_0014135
1419 Ga0495611_0024531
1420 Ga0495611_0077830
1421 Ga0495611_0078596
1422 Ga0495625_0000123
1423 Ga0495625_0002502
1424 Ga0495625_0008021
1425 Ga0495625_0014139
1426 Ga0495625_0025266
1427 Ga0495625_0032646
1428 Ga0495625_0036276
1429 Ga0495625_0161768
1430 Ga0495625_0294606
1431 Ga0495625_0616627
1432 Ga0495635_0000550
1433 Ga0495659_0000297
1434 Ga0495659_0001108
1435 Ga0495659_0001966
1436 Ga0495659_0072252
1437 Ga0495661_0000669
1438 Ga0495661_0001851
1439 Ga0495661_0002269
1440 Ga0495661_0002553
1441 Ga0495661_0013647
1442 Ga0495661_0014635
1443 Ga0495661_0020472
1444 Ga0495661_0033698
1445 Ga0495661_0033979
1446 Ga0495661_0053205
1447 Ga0495661_0077497
1448 Ga0495661_0128354
1449 Ga0495661_0129455
1450 Ga0495661_0148115
1451 Ga0495661_0188832
1452 Ga0495588_0000135
1453 Ga0495588_0012486
1454 Ga0495588_0031315
1455 Ga0495588_0048940
1456 Ga0495588_0058779
1457 Ga0495588_0112003
1458 Ga0495588_0257089
1459 Ga0495588_0276665
1460 Ga0495623_0001059
1461 Ga0495646_0271581
1462 Ga0495669_0000305
1463 Ga0495669_0000799
1464 Ga0495669_0005774
1465 Ga0495669_0159476
1466 Ga0495669_0188759
1467 Ga0495613_0038792
1468 Ga0495624_0014318
1469 Ga0495624_0090065
1470 Ga0495670_0000228
1471 Ga0495670_0000798
1472 Ga0495670_0003938
1473 Ga0495670_0016153
1474 Ga0495670_0019950
1475 Ga0495670_0024011
1476 Ga0495670_0080852
1477 Ga0495670_0107840
1478 Ga0495670_0141631
1479 Ga0495671_0000318
1480 Ga0495671_0001337
1481 Ga0495671_0003333
1482 Ga0495671_0044194
1483 Ga0495671_0117980
1484 Ga0495671_0151098
1485 Ga0495649_0000183
1486 Ga0495649_0007999
1487 Ga0495649_0022047
1488 Ga0495649_0031127
1489 Ga0495649_0032307
1490 Ga0495589_0000569
1491 Ga0495589_0000651
1492 Ga0495589_0008207
1493 Ga0495589_0008627
1494 Ga0495589_0038429
1495 Ga0495589_0072773
1496 Ga0495589_0108057
1497 Ga0495600_0002426
1498 Ga0495600_0022603
1499 Ga0495600_0425080
1500 Ga0495660_0001078
1501 Ga0495660_0006077
1502 Ga0495660_0006880
1503 Ga0495660_0007399
1504 Ga0495660_0017630
1505 Ga0495660_0021905
1506 Ga0495660_0038115
1507 Ga0495660_0040808
1508 Ga0495660_0045979
1509 Ga0495660_0052906
1510 Ga0495660_0075385
1511 Ga0495660_0084010
1512 Ga0495660_0088801
1513 Ga0495660_0122103
1514 Ga0495581_0004900
1515 Ga0495581_0177433
1516 Ga0495604_0003344
1517 Ga0495636_0004778
1518 Ga0495636_0011362
1519 Ga0495636_0019690
1520 Ga0495636_0052557
1521 Ga0495636_0182024
1522 Ga0495674_0746625
1523 Ga0495672_0000060
1524 Ga0495672_0000118
1525 Ga0495672_0000159
1526 Ga0495672_0002309
1527 Ga0495672_0002552
1528 Ga0495672_0004007
1529 Ga0495672_0007939
1530 Ga0495672_0015919
1531 Ga0495672_0029735
1532 Ga0495672_0063115
1533 Ga0495672_0095107
1534 Ga0495672_0214998
1535 Ga0495672_0272268
1536 Ga0495676_0000014
1537 Ga0495676_0041546
1538 Ga0495676_0081218
1539 Ga0495676_0105349
1540 Ga0495680_0004551
1541 Ga0495680_0007141
1542 Ga0495680_0552002
1543 Ga0495683_0000157
1544 Ga0495683_0001362
1545 Ga0495683_0007170
1546 Ga0495683_0010144
1547 Ga0495683_0012774
1548 Ga0495683_0024963
1549 Ga0495683_0033787
1550 Ga0495683_0180806
1551 Ga0495687_000049
1552 Ga0495687_000112
1553 Ga0495687_000832
1554 Ga0495687_002296
1555 Ga0495687_002751
1556 Ga0495687_004364
1557 Ga0495687_084355
1558 Ga0495687_150005
1559 Ga0495675_0002690
1560 Ga0495675_0005401
1561 Ga0495677_0000267
1562 Ga0495677_0000597
1563 Ga0495677_0001133
1564 Ga0495677_0002482
1565 Ga0495677_0014446
1566 Ga0495677_0017053
1567 Ga0495677_0026056
1568 Ga0495677_0070275
1569 Ga0495677_0104981
1570 Ga0495679_002450
1571 Ga0495679_021483
1572 Ga0495679_033265
1573 Ga0495679_104635
1574 Ga0495685_000297
1575 Ga0495685_005376
1576 Ga0495685_005761
1577 Ga0495685_013729
1578 Ga0495685_048782
1579 Ga0495685_115634
1580 Ga0495673_0000017
1581 Ga0495673_0003502
1582 Ga0495673_0017617
1583 Ga0495681_0000494
1584 Ga0495681_0002931
1585 Ga0495681_0026373
1586 Ga0495681_0034546
1587 Ga0495681_0078792
1588 Ga0495681_0084863
1589 Ga0495681_0088986
1590 Ga0495686_0000140
1591 Ga0495686_0002406
1592 Ga0495686_0012836
1593 Ga0495686_0031771
1594 Ga0495686_0173165
1595 Ga0495686_0199052
1596 Ga0495686_0242526
1597 Ga0495593_0000527
1598 Ga0495593_0055200
1599 Ga0495602_0025977
1600 Ga0495602_0344774
1601 Ga0495614_0000102
1602 Ga0495614_0135029
1603 Ga0495615_0006367
1604 Ga0495615_0018968
1605 Ga0495626_0005480
1606 Ga0495626_0006856
1607 Ga0495626_0007513
1608 Ga0495626_0013767
1609 Ga0495626_0016227
1610 Ga0495626_0016713
1611 Ga0495626_0017401
1612 Ga0495626_0019913
1613 Ga0495626_0020154
1614 Ga0495626_0029639
1615 Ga0495626_0030999
1616 Ga0495626_0041353
1617 Ga0495626_0086826
1618 Ga0495626_0097294
1619 Ga0495626_0100242
1620 Ga0495626_0161115
1621 Ga0496100_0970753
1622 Ga0496101_0022215
1623 Ga0496101_0494171
1624 Ga0496102_0000098
1625 Ga0496102_0000220
1626 Ga0496102_0033169
1627 Ga0496102_0034795
1628 Ga0496103_0034671
1629 Ga0496103_0089409
1630 Ga0496103_0121085
1631 Ga0496104_0077552
1632 Ga0496106_0013411
1633 Ga0496106_0062533
1634 Ga0496107_0126250
1635 Ga0496109_0211166
1636 Ga0496109_0220657
1637 Ga0496110_0002669
1638 Ga0496110_0045966
1639 Ga0496111_0030269
1640 Ga0496111_0208352
1641 Ga0496113_0017843
1642 Ga0496113_0237182
1643 Ga0496115_0210419
1644 Ga0496115_0856674
1645 Ga0496116_0010251
1646 Ga0496116_0039327
1647 Ga0496117_0000001
1648 Ga0496118_0000008
1649 Ga0496120_0048125
1650 Ga0496121_0011103
1651 Ga0496121_0015331
1652 Ga0496121_0018459
1653 Ga0496121_0089518
1654 Ga0496121_0191248
1655 Ga0496122_0000169
1656 Ga0496122_0000249
1657 Ga0496122_0000847
1658 Ga0496122_0018521
1659 Ga0496122_0026183
1660 Ga0496122_0126105
1661 Ga0496123_0002226
1662 Ga0496123_0005545
1663 Ga0496123_0005792
1664 Ga0496123_0008550
1665 Ga0496123_0022133
1666 Ga0496124_0009352
1667 Ga0496124_0131246
1668 Ga0496124_0180149
1669 Ga0496124_0274945
1670 Ga0496125_0006783
1671 Ga0496125_0011048
1672 Ga0496125_0059606
1673 Ga0495678_000056
1674 Ga0495678_000079
1675 Ga0495678_000424
1676 Ga0495678_000981
1677 Ga0495678_001101
1678 Ga0495678_002357
1679 Ga0495678_003821
1680 Ga0495682_0000448
1681 Ga0495682_0001431
1682 Ga0495682_0005202
1683 Ga0495682_0006255
1684 Ga0495682_0012758
1685 Ga0501238_000845
1686 Ga0501269_000103
1687 Ga0501269_002216
1688 Ga0501035_0001651
1689 Ga0501044_0117837
1690 Ga0495655_0046717
1691 Ga0500594_0010409
1692 Ga0500618_000965
1693 Ga0500586_000082
1694 Ga0466962_0280736
1695 2511248145
1696 2511387016
1697 2550697284
1698 2553004539
1699 2601670658
1700 2644213395
1701 2644250897
1702 2644356316
1703 2738739042
1704 2738825443
1705 2738846274
1706 2739149240
1707 2739191159
1708 2739275077
1709 2739317636
1710 2739335877
1711 2739344121
1712 2765567965
1713 2808983811
1714 2809129483
1715 2809144353
1716 2809149462
1717 2819592491
1718 2821134036
1719 2839097745
1720 2842717923
1721 2852619609
1722 2857547997
1723 2857565848
1724 2884814662
1725 2884839021
1726 2884855312
1727 2885083590
1728 2896159181
1729 2904440650
1730 2904535758
1731 2904586081
1732 2904592106
1733 2904601737
1734 2919084808
1735 2919480743
1736 2923515365
1737 2932412588
1738 2932420103

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02660

G3P_acyltransf

Glycerol-3-phosphate acyltransferase

9

184

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.8802 1 196
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.862 3 198
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.8465 1 196
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.8336 3 198
2vjh-assembly1.cif.gz_A the structure of phycoerythrin from gloeobacter violaceus 0.3527 4 180
ID Description Score Start End Superfamily
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8484 10 186 1.10.1760.20
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8349 10 186 1.10.1760.20
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8054 10 186 1.10.1760.20
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7778 10 186 1.10.1760.20
af_A0A1D8PQN5_5_154_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6173 45 101 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A3D3PR66-F1-model_v4 Glycerol-3-phosphate acyltransferase 0.9767 58 200 GO:0005886
GO:0008654
GO:0043772
AF-A0A660NJR0-F1-model_v4 Glycerol-3-phosphate 1-O-acyltransferase (EC 2.3.1.15) 0.9507 48 200 GO:0004366
GO:0005886
GO:0008654
GO:0043772
AF-A0A3D3PR66-F1-model_v4 Glycerol-3-phosphate acyltransferase 0.9505 58 200 GO:0005886
GO:0008654
GO:0043772
AF-E6MXG3-F1-model_v4 Glycerol-3-phosphate acyltransferase 0.9417 59 199 GO:0005886
GO:0008654
GO:0043772
AF-A0A3D1J0V7-F1-model_v4 Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) 0.9259 1 200 GO:0005886
GO:0008654
GO:0043772

Map