F484110
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 869 | 548 | 1738 | 168 |
Family's Representative Sequence
| Representative Sequence | 3300005340|Ga0070689_100676291|Ga0070689_1006762912 |
| Length | 201 |
| Sequence | MSRASGCRYRDKGCAQAAGRLNGARPLYNFRMKIIGIAGFSGSGKTTLVEKVIPLLVAEGLRVSLIKHAHHEFDVDQPGKDSYRHRHAGASEVLVSSSKRWALMHELRGAAEPTLEDQLKQLSPCDVVLVEGYKTAPIPKVEVHRRDNTTPLLYPEDEHVVAVATDEALDTTLPQLDIDDAPAVARFIIQHLGLNRARLVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 114 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 115 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 116 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 117 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 118 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 119 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 170 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 177 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 183 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 184 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 185 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 186 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 189 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 190 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 191 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 192 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 193 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 194 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 195 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 196 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 197 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 198 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 199 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 200 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 201 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 208 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 209 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 213 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 219 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 220 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 222 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 223 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 224 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 225 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 226 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 227 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 228 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 229 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 230 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 231 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 232 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 233 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 234 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 235 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 236 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 237 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 238 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 239 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 240 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 241 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 242 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 243 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 244 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 279 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 304 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 317 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 318 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 319 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 321 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 322 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 324 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 325 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 326 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 327 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 328 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 329 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 330 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 331 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 332 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 333 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 334 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 335 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 336 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 337 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 338 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 339 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 340 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 341 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 342 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 343 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 344 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 345 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 346 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 347 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 348 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 349 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 350 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 351 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 352 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 353 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 354 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 355 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 356 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 357 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 358 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 359 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 360 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 361 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 362 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 363 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 364 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 365 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 366 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 367 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 368 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 369 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 370 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 371 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 372 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 373 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 374 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 375 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 376 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 377 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 378 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 379 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 380 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 381 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 382 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 383 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 384 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 385 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 386 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 387 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 388 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 389 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 390 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 391 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 392 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 393 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 394 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 395 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 396 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 397 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 398 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 399 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 400 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 401 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 402 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 403 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 404 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 405 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 406 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 407 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 408 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 409 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 410 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 411 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 412 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 413 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 414 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 415 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 416 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 417 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 418 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 419 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 420 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 421 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 422 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 423 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 424 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 425 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 426 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 427 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 428 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 429 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 430 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 431 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 432 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 433 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 434 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 435 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 436 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 437 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 438 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 439 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 440 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 441 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 442 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 443 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 444 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 445 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 446 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 447 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 448 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 449 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 450 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 451 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 452 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 453 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 454 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 455 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 456 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 457 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 458 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 459 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 460 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 461 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 462 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 463 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 464 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 465 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 466 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 467 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 468 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 469 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 470 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 471 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 472 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 473 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 474 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 475 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 476 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 477 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 478 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 479 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 480 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 481 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 482 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 483 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 484 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 485 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 486 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 487 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 488 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 489 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 490 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 491 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 492 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 493 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 494 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 495 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 496 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 497 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 498 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 499 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 500 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 501 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 502 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 503 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 504 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 505 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 506 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 507 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 508 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 509 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 510 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 511 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 512 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 513 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 514 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 515 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 516 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 517 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 518 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 519 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 520 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 521 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 522 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 523 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 524 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 525 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 526 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 527 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 528 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 529 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 530 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 531 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 532 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 533 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 534 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 535 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 536 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 537 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 538 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 539 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 540 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 541 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 542 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 543 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 544 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 545 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 546 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 547 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 548 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 74.11 |
| Metatranscriptomes | 0 |
| Isolates | 25.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.58 |
| Nodule | 25.89 |
| Rhizoplane | 0.12 |
| Rhizosphere | 71.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070689_100676291 | 3300005340 | Bacteria | 900 |
| 2 | JGI24742J22300_10070681 | 3300002244 | Bacteria | 650 |
| 3 | Ga0065712_10122077 | 3300005290 | Bacteria | 1656 |
| 4 | Ga0065707_10538935 | 3300005295 | Bacteria | 729 |
| 5 | Ga0070658_10010004 | 3300005327 | Bacteria | 7618 |
| 6 | Ga0070658_10075444 | 3300005327 | Bacteria | 2766 |
| 7 | Ga0070658_11377934 | 3300005327 | Bacteria | 612 |
| 8 | Ga0070676_10794085 | 3300005328 | Bacteria | 698 |
| 9 | Ga0070683_100135633 | 3300005329 | Bacteria | 2330 |
| 10 | Ga0070690_100000148 | 3300005330 | Bacteria | 35769 |
| 11 | Ga0070690_100071630 | 3300005330 | Bacteria | 2252 |
| 12 | Ga0070670_100480948 | 3300005331 | Bacteria | 1103 |
| 13 | Ga0070670_100704208 | 3300005331 | Bacteria | 908 |
| 14 | Ga0070677_10527158 | 3300005333 | Bacteria | 644 |
| 15 | Ga0068869_100000103 | 3300005334 | Bacteria | 39927 |
| 16 | Ga0068869_100063869 | 3300005334 | Bacteria | 2707 |
| 17 | Ga0070680_100000882 | 3300005336 | Bacteria | 21272 |
| 18 | Ga0070682_100008721 | 3300005337 | Bacteria | 5719 |
| 19 | Ga0070682_100931071 | 3300005337 | Bacteria | 716 |
| 20 | Ga0068868_100001076 | 3300005338 | Bacteria | 18727 |
| 21 | Ga0068868_100270401 | 3300005338 | Bacteria | 1436 |
| 22 | Ga0068868_100413471 | 3300005338 | Bacteria | 1166 |
| 23 | Ga0070660_100428494 | 3300005339 | Bacteria | 1096 |
| 24 | Ga0070689_100002361 | 3300005340 | Bacteria | 12297 |
| 25 | Ga0070689_100108737 | 3300005340 | Bacteria | 2203 |
| 26 | Ga0070689_100160901 | 3300005340 | Bacteria | 1815 |
| 27 | Ga0070689_100170739 | 3300005340 | Bacteria | 1762 |
| 28 | Ga0070691_10003035 | 3300005341 | Bacteria | 7519 |
| 29 | Ga0070691_10160365 | 3300005341 | Bacteria | 1159 |
| 30 | Ga0070691_10442088 | 3300005341 | Bacteria | 741 |
| 31 | Ga0070687_100000105 | 3300005343 | Bacteria | 28128 |
| 32 | Ga0070687_100024661 | 3300005343 | Bacteria | 2875 |
| 33 | Ga0070687_100126534 | 3300005343 | Bacteria | 1469 |
| 34 | Ga0070692_10005261 | 3300005345 | Bacteria | 5494 |
| 35 | Ga0070692_10028792 | 3300005345 | Bacteria | 2764 |
| 36 | Ga0070668_100009368 | 3300005347 | Bacteria | 7263 |
| 37 | Ga0070668_100016417 | 3300005347 | Bacteria | 5536 |
| 38 | Ga0070669_100002037 | 3300005353 | Bacteria | 14620 |
| 39 | Ga0070669_100405369 | 3300005353 | Bacteria | 1116 |
| 40 | Ga0070675_100036014 | 3300005354 | Bacteria | 4025 |
| 41 | Ga0070671_100264110 | 3300005355 | Bacteria | 1463 |
| 42 | Ga0070671_100435214 | 3300005355 | Bacteria | 1124 |
| 43 | Ga0070674_100056367 | 3300005356 | Bacteria | 2725 |
| 44 | Ga0070674_100059160 | 3300005356 | Bacteria | 2667 |
| 45 | Ga0070673_100273397 | 3300005364 | Bacteria | 1479 |
| 46 | Ga0070673_100352279 | 3300005364 | Bacteria | 1307 |
| 47 | Ga0070673_100532402 | 3300005364 | Bacteria | 1066 |
| 48 | Ga0070688_100052888 | 3300005365 | Bacteria | 2539 |
| 49 | Ga0070688_100171705 | 3300005365 | Bacteria | 1497 |
| 50 | Ga0070659_100264025 | 3300005366 | Bacteria | 1429 |
| 51 | Ga0070703_10362501 | 3300005406 | Bacteria | 622 |
| 52 | Ga0070714_100198431 | 3300005435 | Bacteria | 1835 |
| 53 | Ga0070714_100384122 | 3300005435 | Bacteria | 1324 |
| 54 | Ga0070714_100412585 | 3300005435 | Bacteria | 1278 |
| 55 | Ga0070713_100403414 | 3300005436 | Bacteria | 1277 |
| 56 | Ga0070713_101182719 | 3300005436 | Bacteria | 740 |
| 57 | Ga0070710_10689498 | 3300005437 | Bacteria | 720 |
| 58 | Ga0070701_10182682 | 3300005438 | Bacteria | 1229 |
| 59 | Ga0070701_10204055 | 3300005438 | Bacteria | 1170 |
| 60 | Ga0070701_10656736 | 3300005438 | Bacteria | 701 |
| 61 | Ga0070705_100001061 | 3300005440 | Bacteria | 15312 |
| 62 | Ga0070705_100005767 | 3300005440 | Bacteria | 6052 |
| 63 | Ga0070705_100075917 | 3300005440 | Bacteria | 2048 |
| 64 | Ga0070705_100133086 | 3300005440 | Bacteria | 1625 |
| 65 | Ga0070705_100212680 | 3300005440 | Bacteria | 1334 |
| 66 | Ga0070705_100368473 | 3300005440 | Bacteria | 1053 |
| 67 | Ga0070700_100001887 | 3300005441 | Bacteria | 10592 |
| 68 | Ga0070700_100009399 | 3300005441 | Bacteria | 5364 |
| 69 | Ga0070694_100000110 | 3300005444 | Bacteria | 39928 |
| 70 | Ga0070694_100002797 | 3300005444 | Bacteria | 10358 |
| 71 | Ga0070694_100013506 | 3300005444 | Bacteria | 5100 |
| 72 | Ga0070694_100365442 | 3300005444 | Bacteria | 1122 |
| 73 | Ga0070694_100583412 | 3300005444 | Bacteria | 899 |
| 74 | Ga0070708_100207175 | 3300005445 | Bacteria | 1837 |
| 75 | Ga0070708_100614047 | 3300005445 | Bacteria | 1025 |
| 76 | Ga0070662_100164412 | 3300005457 | Bacteria | 1738 |
| 77 | Ga0070662_101016463 | 3300005457 | Bacteria | 710 |
| 78 | Ga0070681_10118573 | 3300005458 | Bacteria | 2583 |
| 79 | Ga0070681_10211062 | 3300005458 | Bacteria | 1858 |
| 80 | Ga0070681_10301517 | 3300005458 | Bacteria | 1512 |
| 81 | Ga0070681_11321818 | 3300005458 | Bacteria | 644 |
| 82 | Ga0068867_100000441 | 3300005459 | Bacteria | 27580 |
| 83 | Ga0068867_100001737 | 3300005459 | Bacteria | 15180 |
| 84 | Ga0068867_100305924 | 3300005459 | Bacteria | 1312 |
| 85 | Ga0070706_100830358 | 3300005467 | Bacteria | 855 |
| 86 | Ga0070707_100443939 | 3300005468 | Bacteria | 1258 |
| 87 | Ga0070698_100193154 | 3300005471 | Bacteria | 1973 |
| 88 | Ga0070698_100701983 | 3300005471 | Bacteria | 954 |
| 89 | Ga0070699_100046681 | 3300005518 | Bacteria | 3748 |
| 90 | Ga0070699_100154507 | 3300005518 | Bacteria | 2030 |
| 91 | Ga0070699_100379676 | 3300005518 | Bacteria | 1276 |
| 92 | Ga0070679_100057268 | 3300005530 | Bacteria | 3885 |
| 93 | Ga0070684_100020331 | 3300005535 | Bacteria | 5508 |
| 94 | Ga0070684_100478817 | 3300005535 | Bacteria | 1152 |
| 95 | Ga0070684_101019853 | 3300005535 | Bacteria | 777 |
| 96 | Ga0070697_100203191 | 3300005536 | Bacteria | 1684 |
| 97 | Ga0070697_100223627 | 3300005536 | Bacteria | 1604 |
| 98 | Ga0070697_100476188 | 3300005536 | Bacteria | 1090 |
| 99 | Ga0070697_100480525 | 3300005536 | Bacteria | 1085 |
| 100 | Ga0068853_100064747 | 3300005539 | Bacteria | 3171 |
| 101 | Ga0070672_100130429 | 3300005543 | Bacteria | 2065 |
| 102 | Ga0070672_100149330 | 3300005543 | Bacteria | 1932 |
| 103 | Ga0070686_100000563 | 3300005544 | Bacteria | 22161 |
| 104 | Ga0070686_100054520 | 3300005544 | Bacteria | 2557 |
| 105 | Ga0070695_100000512 | 3300005545 | Bacteria | 20355 |
| 106 | Ga0070695_100064882 | 3300005545 | Bacteria | 2376 |
| 107 | Ga0070695_100189216 | 3300005545 | Bacteria | 1463 |
| 108 | Ga0070695_100206318 | 3300005545 | Bacteria | 1408 |
| 109 | Ga0070695_100228624 | 3300005545 | Bacteria | 1344 |
| 110 | Ga0070696_100009252 | 3300005546 | Bacteria | 6596 |
| 111 | Ga0070696_100015140 | 3300005546 | Bacteria | 5179 |
| 112 | Ga0070696_100040726 | 3300005546 | Bacteria | 3208 |
| 113 | Ga0070696_100076603 | 3300005546 | Bacteria | 2362 |
| 114 | Ga0070696_100083654 | 3300005546 | Bacteria | 2264 |
| 115 | Ga0070696_100288699 | 3300005546 | Bacteria | 1252 |
| 116 | Ga0070693_100000101 | 3300005547 | Bacteria | 37995 |
| 117 | Ga0070693_100014688 | 3300005547 | Bacteria | 4019 |
| 118 | Ga0070665_100563839 | 3300005548 | Bacteria | 1151 |
| 119 | Ga0070704_100000220 | 3300005549 | Bacteria | 24002 |
| 120 | Ga0070704_100001535 | 3300005549 | Bacteria | 12465 |
| 121 | Ga0070704_100012096 | 3300005549 | Bacteria | 5322 |
| 122 | Ga0070704_100017031 | 3300005549 | Bacteria | 4609 |
| 123 | Ga0070704_100104157 | 3300005549 | Bacteria | 2145 |
| 124 | Ga0070704_100660563 | 3300005549 | Bacteria | 924 |
| 125 | Ga0068855_100001986 | 3300005563 | Bacteria | 25406 |
| 126 | Ga0068855_100010909 | 3300005563 | Bacteria | 10969 |
| 127 | Ga0068855_100030675 | 3300005563 | Bacteria | 6427 |
| 128 | Ga0068855_100169283 | 3300005563 | Bacteria | 2475 |
| 129 | Ga0068857_100495085 | 3300005577 | Bacteria | 1146 |
| 130 | Ga0068857_100526291 | 3300005577 | Bacteria | 1112 |
| 131 | Ga0068857_101310592 | 3300005577 | Bacteria | 703 |
| 132 | Ga0068854_100005853 | 3300005578 | Bacteria | 7787 |
| 133 | Ga0068854_100812516 | 3300005578 | Bacteria | 816 |
| 134 | Ga0068856_100009739 | 3300005614 | Bacteria | 9335 |
| 135 | Ga0068856_100037843 | 3300005614 | Bacteria | 4734 |
| 136 | Ga0068856_100251353 | 3300005614 | Bacteria | 1783 |
| 137 | Ga0070702_100000096 | 3300005615 | Bacteria | 26117 |
| 138 | Ga0070702_100375112 | 3300005615 | Bacteria | 1010 |
| 139 | Ga0068852_100001888 | 3300005616 | Bacteria | 14274 |
| 140 | Ga0068852_100205376 | 3300005616 | Bacteria | 1866 |
| 141 | Ga0068852_100250388 | 3300005616 | Bacteria | 1697 |
| 142 | Ga0068859_100004200 | 3300005617 | Bacteria | 14703 |
| 143 | Ga0068859_100179362 | 3300005617 | Bacteria | 2201 |
| 144 | Ga0068859_100599324 | 3300005617 | Bacteria | 1195 |
| 145 | Ga0068864_100541723 | 3300005618 | Bacteria | 1124 |
| 146 | Ga0068866_10000893 | 3300005718 | Bacteria | 13164 |
| 147 | Ga0068866_10227104 | 3300005718 | Bacteria | 1130 |
| 148 | Ga0068861_100000826 | 3300005719 | Bacteria | 18701 |
| 149 | Ga0068861_100003187 | 3300005719 | Bacteria | 10851 |
| 150 | Ga0068851_10093381 | 3300005834 | Bacteria | 1587 |
| 151 | Ga0068870_10058985 | 3300005840 | Bacteria | 2056 |
| 152 | Ga0068863_100904215 | 3300005841 | Bacteria | 883 |
| 153 | Ga0068863_101264015 | 3300005841 | Bacteria | 745 |
| 154 | Ga0068858_100002013 | 3300005842 | Bacteria | 20783 |
| 155 | Ga0068858_100007196 | 3300005842 | Bacteria | 10790 |
| 156 | Ga0068860_100001309 | 3300005843 | Bacteria | 27054 |
| 157 | Ga0068862_100001947 | 3300005844 | Bacteria | 18715 |
| 158 | Ga0068862_100006062 | 3300005844 | Bacteria | 10066 |
| 159 | Ga0068862_100569450 | 3300005844 | Bacteria | 1084 |
| 160 | Ga0081539_10001473 | 3300005985 | Bacteria | 39944 |
| 161 | Ga0075364_10255516 | 3300006051 | Bacteria | 1191 |
| 162 | Ga0070715_10019529 | 3300006163 | Bacteria | 2601 |
| 163 | Ga0070715_10052773 | 3300006163 | Bacteria | 1755 |
| 164 | Ga0070712_100396333 | 3300006175 | Bacteria | 1139 |
| 165 | Ga0070712_100642458 | 3300006175 | Bacteria | 901 |
| 166 | Ga0097621_100000106 | 3300006237 | Bacteria | 47435 |
| 167 | Ga0097621_100006960 | 3300006237 | Bacteria | 8053 |
| 168 | Ga0097621_100012268 | 3300006237 | Bacteria | 6341 |
| 169 | Ga0097621_100050892 | 3300006237 | Bacteria | 3369 |
| 170 | Ga0097621_100287557 | 3300006237 | Bacteria | 1448 |
| 171 | Ga0068871_100002446 | 3300006358 | Bacteria | 12683 |
| 172 | Ga0068871_100008532 | 3300006358 | Bacteria | 7365 |
| 173 | Ga0068871_100017675 | 3300006358 | Bacteria | 5401 |
| 174 | Ga0068871_100182020 | 3300006358 | Bacteria | 1806 |
| 175 | Ga0068871_101188804 | 3300006358 | Bacteria | 715 |
| 176 | Ga0075428_100000134 | 3300006844 | Bacteria | 65107 |
| 177 | Ga0075428_100047461 | 3300006844 | Bacteria | 4717 |
| 178 | Ga0075430_100060701 | 3300006846 | Bacteria | 3177 |
| 179 | Ga0075431_100014959 | 3300006847 | Bacteria | 7854 |
| 180 | Ga0075431_100209478 | 3300006847 | Bacteria | 1992 |
| 181 | Ga0075433_10001519 | 3300006852 | Bacteria | 17149 |
| 182 | Ga0075433_10056858 | 3300006852 | Bacteria | 3419 |
| 183 | Ga0075433_10140793 | 3300006852 | Bacteria | 2144 |
| 184 | Ga0075433_10363736 | 3300006852 | Bacteria | 1278 |
| 185 | Ga0075433_10398836 | 3300006852 | Bacteria | 1214 |
| 186 | Ga0075433_10594228 | 3300006852 | Bacteria | 972 |
| 187 | Ga0075433_10692785 | 3300006852 | Bacteria | 893 |
| 188 | Ga0075433_10808494 | 3300006852 | Bacteria | 819 |
| 189 | Ga0075433_10911110 | 3300006852 | Bacteria | 767 |
| 190 | Ga0075434_100000699 | 3300006871 | Bacteria | 26231 |
| 191 | Ga0075434_100000813 | 3300006871 | Bacteria | 24754 |
| 192 | Ga0075434_100134764 | 3300006871 | Bacteria | 2489 |
| 193 | Ga0075434_100348944 | 3300006871 | Bacteria | 1501 |
| 194 | Ga0075429_100000271 | 3300006880 | Bacteria | 36263 |
| 195 | Ga0075429_100000975 | 3300006880 | Bacteria | 22709 |
| 196 | Ga0068865_100000231 | 3300006881 | Bacteria | 31031 |
| 197 | Ga0068865_100057228 | 3300006881 | Bacteria | 2719 |
| 198 | Ga0068865_100717876 | 3300006881 | Bacteria | 856 |
| 199 | Ga0068865_100775400 | 3300006881 | Bacteria | 825 |
| 200 | Ga0068865_100950084 | 3300006881 | Bacteria | 750 |
| 201 | Ga0075436_100002436 | 3300006914 | Bacteria | 12815 |
| 202 | Ga0075436_100004776 | 3300006914 | Bacteria | 9305 |
| 203 | Ga0075436_100006862 | 3300006914 | Bacteria | 7787 |
| 204 | Ga0075436_100012375 | 3300006914 | Bacteria | 5849 |
| 205 | Ga0075436_100016124 | 3300006914 | Bacteria | 5115 |
| 206 | Ga0075436_100076041 | 3300006914 | Bacteria | 2325 |
| 207 | Ga0075436_100291279 | 3300006914 | Bacteria | 1169 |
| 208 | Ga0097620_100004200 | 3300006931 | Bacteria | 14703 |
| 209 | Ga0097620_100179358 | 3300006931 | Bacteria | 2201 |
| 210 | Ga0097620_100599261 | 3300006931 | Bacteria | 1195 |
| 211 | Ga0079104_1007232 | 3300006946 | Bacteria | 4062 |
| 212 | Ga0079104_1008431 | 3300006946 | Bacteria | 3605 |
| 213 | Ga0075435_100002136 | 3300007076 | Bacteria | 13025 |
| 214 | Ga0075435_100035972 | 3300007076 | Bacteria | 3932 |
| 215 | Ga0075435_100083482 | 3300007076 | Bacteria | 2627 |
| 216 | Ga0075435_100134671 | 3300007076 | Bacteria | 2069 |
| 217 | Ga0075435_100672997 | 3300007076 | Bacteria | 899 |
| 218 | Ga0099794_10201826 | 3300007265 | Bacteria | 1018 |
| 219 | Ga0105240_10002895 | 3300009093 | Bacteria | 27079 |
| 220 | Ga0105240_10061715 | 3300009093 | Bacteria | 4670 |
| 221 | Ga0105240_10071509 | 3300009093 | Bacteria | 4290 |
| 222 | Ga0105240_10161885 | 3300009093 | Bacteria | 2657 |
| 223 | Ga0111539_10008776 | 3300009094 | Bacteria | 12816 |
| 224 | Ga0111539_10305362 | 3300009094 | Bacteria | 1852 |
| 225 | Ga0105245_10000347 | 3300009098 | Bacteria | 43236 |
| 226 | Ga0105245_10042334 | 3300009098 | Bacteria | 4063 |
| 227 | Ga0105245_10489525 | 3300009098 | Bacteria | 1244 |
| 228 | Ga0114129_10005561 | 3300009147 | Bacteria | 17827 |
| 229 | Ga0114129_10474621 | 3300009147 | Bacteria | 1637 |
| 230 | Ga0105243_10000535 | 3300009148 | Bacteria | 38636 |
| 231 | Ga0105243_10004257 | 3300009148 | Bacteria | 11335 |
| 232 | Ga0105243_11054664 | 3300009148 | Bacteria | 819 |
| 233 | Ga0105241_10010941 | 3300009174 | Bacteria | 6654 |
| 234 | Ga0105241_10265525 | 3300009174 | Bacteria | 1460 |
| 235 | Ga0105241_11244082 | 3300009174 | Bacteria | 707 |
| 236 | Ga0105242_10000905 | 3300009176 | Bacteria | 23036 |
| 237 | Ga0105242_10001512 | 3300009176 | Bacteria | 18280 |
| 238 | Ga0105242_10002624 | 3300009176 | Bacteria | 14100 |
| 239 | Ga0105242_10013578 | 3300009176 | Bacteria | 6301 |
| 240 | Ga0105242_10017281 | 3300009176 | Bacteria | 5618 |
| 241 | Ga0105242_10136475 | 3300009176 | Bacteria | 2124 |
| 242 | Ga0105242_10777000 | 3300009176 | Bacteria | 946 |
| 243 | Ga0105242_11123883 | 3300009176 | Bacteria | 801 |
| 244 | Ga0105248_10020172 | 3300009177 | Bacteria | 7384 |
| 245 | Ga0105248_10159204 | 3300009177 | Bacteria | 2547 |
| 246 | Ga0105248_10633277 | 3300009177 | Bacteria | 1207 |
| 247 | Ga0105248_10975333 | 3300009177 | Bacteria | 957 |
| 248 | Ga0105238_10020415 | 3300009551 | Bacteria | 6744 |
| 249 | Ga0105238_10140266 | 3300009551 | Bacteria | 2394 |
| 250 | Ga0105249_10005947 | 3300009553 | Bacteria | 10571 |
| 251 | Ga0105249_10032433 | 3300009553 | Bacteria | 4726 |
| 252 | Ga0105249_10124436 | 3300009553 | Bacteria | 2454 |
| 253 | Ga0105249_12034013 | 3300009553 | Bacteria | 647 |
| 254 | Ga0105239_10110995 | 3300010375 | Bacteria | 3040 |
| 255 | Ga0105246_10394906 | 3300011119 | Bacteria | 1147 |
| 256 | Ga0157370_10001416 | 3300013104 | Bacteria | 29771 |
| 257 | Ga0157370_10147777 | 3300013104 | Bacteria | 2188 |
| 258 | Ga0157370_10207967 | 3300013104 | Bacteria | 1814 |
| 259 | Ga0157369_10047888 | 3300013105 | Bacteria | 4640 |
| 260 | Ga0157369_10223677 | 3300013105 | Bacteria | 1969 |
| 261 | Ga0157374_10087241 | 3300013296 | Bacteria | 2970 |
| 262 | Ga0157374_11017934 | 3300013296 | Bacteria | 848 |
| 263 | Ga0157378_10000447 | 3300013297 | Bacteria | 39662 |
| 264 | Ga0157378_10072444 | 3300013297 | Bacteria | 3096 |
| 265 | Ga0157378_10884520 | 3300013297 | Bacteria | 923 |
| 266 | Ga0163162_10085969 | 3300013306 | Bacteria | 3222 |
| 267 | Ga0163162_10169220 | 3300013306 | Bacteria | 2309 |
| 268 | Ga0163162_10658305 | 3300013306 | Bacteria | 1171 |
| 269 | Ga0163162_10936126 | 3300013306 | Bacteria | 978 |
| 270 | Ga0157372_10011227 | 3300013307 | Bacteria | 9528 |
| 271 | Ga0157372_10016533 | 3300013307 | Bacteria | 7917 |
| 272 | Ga0157375_10390359 | 3300013308 | Bacteria | 1559 |
| 273 | Ga0157375_10474713 | 3300013308 | Bacteria | 1416 |
| 274 | Ga0163163_11692111 | 3300014325 | Bacteria | 693 |
| 275 | Ga0157380_10012418 | 3300014326 | Bacteria | 6180 |
| 276 | Ga0157380_10157007 | 3300014326 | Bacteria | 1973 |
| 277 | Ga0157380_10215074 | 3300014326 | Bacteria | 1716 |
| 278 | Ga0157380_10936208 | 3300014326 | Bacteria | 895 |
| 279 | Ga0157377_10126523 | 3300014745 | Bacteria | 1555 |
| 280 | Ga0157379_10035647 | 3300014968 | Bacteria | 4436 |
| 281 | Ga0157379_10380073 | 3300014968 | Bacteria | 1296 |
| 282 | Ga0157376_10002088 | 3300014969 | Bacteria | 13437 |
| 283 | Ga0163161_11204082 | 3300017792 | Unclassified | 655 |
| 284 | Ga0214544_1000158 | 3300021320 | Bacteria | 101943 |
| 285 | Ga0214542_1001567 | 3300021321 | Bacteria | 47020 |
| 286 | Ga0214543_1000011 | 3300021327 | Bacteria | 344093 |
| 287 | Ga0214543_1000234 | 3300021327 | Bacteria | 84243 |
| 288 | Ga0213876_10203956 | 3300021384 | Bacteria | 1051 |
| 289 | Ga0228711_1000007 | 3300022739 | Bacteria | 202413 |
| 290 | Ga0228710_1000007 | 3300022740 | Bacteria | 189104 |
| 291 | Ga0207653_10010388 | 3300025885 | Bacteria | 2903 |
| 292 | Ga0207692_10033185 | 3300025898 | Bacteria | 2488 |
| 293 | Ga0207642_10018538 | 3300025899 | Bacteria | 2674 |
| 294 | Ga0207642_10555749 | 3300025899 | Bacteria | 709 |
| 295 | Ga0207688_10009633 | 3300025901 | Bacteria | 5261 |
| 296 | Ga0207685_10016491 | 3300025905 | Bacteria | 2366 |
| 297 | Ga0207685_10168466 | 3300025905 | Bacteria | 1006 |
| 298 | Ga0207699_10458149 | 3300025906 | Bacteria | 916 |
| 299 | Ga0207645_10653619 | 3300025907 | Bacteria | 714 |
| 300 | Ga0207643_10034065 | 3300025908 | Bacteria | 2852 |
| 301 | Ga0207705_10055223 | 3300025909 | Bacteria | 2863 |
| 302 | Ga0207705_10067749 | 3300025909 | Bacteria | 2584 |
| 303 | Ga0207684_10733100 | 3300025910 | Bacteria | 838 |
| 304 | Ga0207654_10425853 | 3300025911 | Bacteria | 927 |
| 305 | Ga0207695_10003454 | 3300025913 | Bacteria | 22268 |
| 306 | Ga0207695_10148941 | 3300025913 | Bacteria | 2281 |
| 307 | Ga0207660_10065878 | 3300025917 | Bacteria | 2619 |
| 308 | Ga0207660_11153753 | 3300025917 | Bacteria | 631 |
| 309 | Ga0207662_10000109 | 3300025918 | Bacteria | 39758 |
| 310 | Ga0207662_10051386 | 3300025918 | Bacteria | 2452 |
| 311 | Ga0207652_10030375 | 3300025921 | Bacteria | 4525 |
| 312 | Ga0207646_10301703 | 3300025922 | Bacteria | 1447 |
| 313 | Ga0207646_10368302 | 3300025922 | Bacteria | 1298 |
| 314 | Ga0207681_10005710 | 3300025923 | Bacteria | 7636 |
| 315 | Ga0207694_10146947 | 3300025924 | Bacteria | 1898 |
| 316 | Ga0207650_10690226 | 3300025925 | Bacteria | 862 |
| 317 | Ga0207659_10027967 | 3300025926 | Bacteria | 3825 |
| 318 | Ga0207659_10290999 | 3300025926 | Bacteria | 1338 |
| 319 | Ga0207687_10010136 | 3300025927 | Bacteria | 6162 |
| 320 | Ga0207687_10073432 | 3300025927 | Bacteria | 2449 |
| 321 | Ga0207687_10172205 | 3300025927 | Bacteria | 1671 |
| 322 | Ga0207687_10449317 | 3300025927 | Bacteria | 1069 |
| 323 | Ga0207664_10592560 | 3300025929 | Bacteria | 995 |
| 324 | Ga0207690_10082586 | 3300025932 | Bacteria | 2248 |
| 325 | Ga0207706_10088982 | 3300025933 | Bacteria | 2714 |
| 326 | Ga0207706_10131628 | 3300025933 | Bacteria | 2200 |
| 327 | Ga0207686_10001982 | 3300025934 | Bacteria | 11281 |
| 328 | Ga0207686_10018157 | 3300025934 | Bacteria | 3977 |
| 329 | Ga0207686_10086270 | 3300025934 | Bacteria | 2061 |
| 330 | Ga0207686_10100601 | 3300025934 | Bacteria | 1929 |
| 331 | Ga0207686_10190999 | 3300025934 | Bacteria | 1460 |
| 332 | Ga0207686_10628660 | 3300025934 | Bacteria | 847 |
| 333 | Ga0207709_10002130 | 3300025935 | Bacteria | 12715 |
| 334 | Ga0207709_10003201 | 3300025935 | Bacteria | 9840 |
| 335 | Ga0207709_10313750 | 3300025935 | Bacteria | 1171 |
| 336 | Ga0207670_10009930 | 3300025936 | Bacteria | 5455 |
| 337 | Ga0207670_10121748 | 3300025936 | Bacteria | 1898 |
| 338 | Ga0207670_10222450 | 3300025936 | Bacteria | 1446 |
| 339 | Ga0207670_10426811 | 3300025936 | Bacteria | 1065 |
| 340 | Ga0207670_10452459 | 3300025936 | Bacteria | 1035 |
| 341 | Ga0207670_10573986 | 3300025936 | Bacteria | 924 |
| 342 | Ga0207669_10017503 | 3300025937 | Bacteria | 3679 |
| 343 | Ga0207669_10036799 | 3300025937 | Bacteria | 2801 |
| 344 | Ga0207704_10008864 | 3300025938 | Bacteria | 4831 |
| 345 | Ga0207704_10023598 | 3300025938 | Bacteria | 3318 |
| 346 | Ga0207704_10821733 | 3300025938 | Bacteria | 777 |
| 347 | Ga0207704_10872868 | 3300025938 | Bacteria | 755 |
| 348 | Ga0207665_10882135 | 3300025939 | Bacteria | 709 |
| 349 | Ga0207691_10057987 | 3300025940 | Bacteria | 3522 |
| 350 | Ga0207691_10336608 | 3300025940 | Bacteria | 1292 |
| 351 | Ga0207711_10067898 | 3300025941 | Bacteria | 3087 |
| 352 | Ga0207711_10693143 | 3300025941 | Bacteria | 950 |
| 353 | Ga0207689_10000532 | 3300025942 | Bacteria | 36122 |
| 354 | Ga0207689_10044044 | 3300025942 | Bacteria | 3689 |
| 355 | Ga0207661_10093302 | 3300025944 | Bacteria | 2512 |
| 356 | Ga0207667_10026319 | 3300025949 | Bacteria | 6358 |
| 357 | Ga0207667_10091486 | 3300025949 | Bacteria | 3143 |
| 358 | Ga0207667_10296342 | 3300025949 | Bacteria | 1652 |
| 359 | Ga0207667_10370534 | 3300025949 | Bacteria | 1459 |
| 360 | Ga0207667_10709918 | 3300025949 | Bacteria | 1007 |
| 361 | Ga0207712_10003243 | 3300025961 | Bacteria | 10338 |
| 362 | Ga0207712_10065714 | 3300025961 | Bacteria | 2590 |
| 363 | Ga0207712_10188043 | 3300025961 | Bacteria | 1628 |
| 364 | Ga0207712_11481257 | 3300025961 | Bacteria | 608 |
| 365 | Ga0207668_10015526 | 3300025972 | Bacteria | 4734 |
| 366 | Ga0207668_10152942 | 3300025972 | Bacteria | 1788 |
| 367 | Ga0207640_10136945 | 3300025981 | Bacteria | 1779 |
| 368 | Ga0207677_10007130 | 3300026023 | Bacteria | 6154 |
| 369 | Ga0207677_10191492 | 3300026023 | Bacteria | 1618 |
| 370 | Ga0207677_10736880 | 3300026023 | Bacteria | 877 |
| 371 | Ga0207703_10026056 | 3300026035 | Bacteria | 4601 |
| 372 | Ga0207703_10861590 | 3300026035 | Bacteria | 867 |
| 373 | Ga0207703_11321356 | 3300026035 | Bacteria | 693 |
| 374 | Ga0207639_10115403 | 3300026041 | Bacteria | 2196 |
| 375 | Ga0207639_10183033 | 3300026041 | Bacteria | 1784 |
| 376 | Ga0207639_10794125 | 3300026041 | Bacteria | 882 |
| 377 | Ga0207708_10000712 | 3300026075 | Bacteria | 25051 |
| 378 | Ga0207708_10003441 | 3300026075 | Bacteria | 11663 |
| 379 | Ga0207708_10312524 | 3300026075 | Bacteria | 1280 |
| 380 | Ga0207708_10421411 | 3300026075 | Bacteria | 1107 |
| 381 | Ga0207708_10966896 | 3300026075 | Bacteria | 739 |
| 382 | Ga0207702_10009029 | 3300026078 | Bacteria | 8396 |
| 383 | Ga0207702_10040144 | 3300026078 | Bacteria | 3923 |
| 384 | Ga0207702_10146020 | 3300026078 | Bacteria | 2146 |
| 385 | Ga0207641_11149338 | 3300026088 | Bacteria | 775 |
| 386 | Ga0207648_10000505 | 3300026089 | Bacteria | 43495 |
| 387 | Ga0207648_10188736 | 3300026089 | Bacteria | 1826 |
| 388 | Ga0207648_10283810 | 3300026089 | Bacteria | 1481 |
| 389 | Ga0207676_10707698 | 3300026095 | Bacteria | 976 |
| 390 | Ga0207674_10482920 | 3300026116 | Bacteria | 1198 |
| 391 | Ga0207674_10527796 | 3300026116 | Bacteria | 1140 |
| 392 | Ga0207675_100000625 | 3300026118 | Bacteria | 34684 |
| 393 | Ga0207675_100000760 | 3300026118 | Bacteria | 32073 |
| 394 | Ga0207675_100460148 | 3300026118 | Bacteria | 1262 |
| 395 | Ga0207683_10122736 | 3300026121 | Bacteria | 2333 |
| 396 | Ga0207698_10061806 | 3300026142 | Bacteria | 2921 |
| 397 | Ga0207698_10105045 | 3300026142 | Bacteria | 2352 |
| 398 | Ga0209281_1000128 | 3300027111 | Bacteria | 199265 |
| 399 | Ga0209281_1000483 | 3300027111 | Bacteria | 55407 |
| 400 | Ga0209969_1015731 | 3300027360 | Bacteria | 1107 |
| 401 | Ga0209967_1001411 | 3300027364 | Bacteria | 3068 |
| 402 | Ga0209981_1002546 | 3300027378 | Bacteria | 2326 |
| 403 | Ga0209981_1017810 | 3300027378 | Bacteria | 1004 |
| 404 | Ga0210000_1007602 | 3300027462 | Bacteria | 1584 |
| 405 | Ga0209968_1005587 | 3300027526 | Bacteria | 1889 |
| 406 | Ga0209999_1007649 | 3300027543 | Bacteria | 1944 |
| 407 | Ga0209282_1000034 | 3300027666 | Bacteria | 140100 |
| 408 | Ga0209971_1038064 | 3300027682 | Bacteria | 1158 |
| 409 | Ga0209998_10079843 | 3300027717 | Bacteria | 792 |
| 410 | Ga0207428_10004302 | 3300027907 | Bacteria | 13600 |
| 411 | Ga0207428_10170429 | 3300027907 | Bacteria | 1649 |
| 412 | Ga0207428_10221607 | 3300027907 | Bacteria | 1418 |
| 413 | Ga0268265_10004002 | 3300028380 | Bacteria | 10375 |
| 414 | Ga0268265_10034846 | 3300028380 | Bacteria | 3672 |
| 415 | Ga0268264_10015338 | 3300028381 | Bacteria | 6283 |
| 416 | Ga0268264_10794170 | 3300028381 | Bacteria | 945 |
| 417 | Ga0307515_10000945 | 3300028794 | Bacteria | 66458 |
| 418 | Ga0307408_100160940 | 3300031548 | Bacteria | 1783 |
| 419 | Ga0307408_100347367 | 3300031548 | Bacteria | 1258 |
| 420 | Ga0316579_10002021 | 3300031691 | Bacteria | 7595 |
| 421 | Ga0316578_10029888 | 3300031728 | Bacteria | 3095 |
| 422 | Ga0307405_10664978 | 3300031731 | Bacteria | 858 |
| 423 | Ga0307412_10405676 | 3300031911 | Bacteria | 1111 |
| 424 | Ga0315914_1000010 | 3300031967 | Bacteria | 171642 |
| 425 | Ga0307409_100167378 | 3300031995 | Bacteria | 1931 |
| 426 | Ga0307409_100752514 | 3300031995 | Bacteria | 978 |
| 427 | Ga0307416_100093272 | 3300032002 | Bacteria | 2593 |
| 428 | Ga0307416_100397069 | 3300032002 | Bacteria | 1415 |
| 429 | Ga0307411_10498057 | 3300032005 | Bacteria | 1029 |
| 430 | Ga0307411_10764858 | 3300032005 | Bacteria | 847 |
| 431 | Ga0307411_11853126 | 3300032005 | Bacteria | 561 |
| 432 | Ga0316583_10004918 | 3300032133 | Bacteria | 4777 |
| 433 | Ga0316583_10007067 | 3300032133 | Bacteria | 4038 |
| 434 | Ga0315913_1000005 | 3300033430 | Bacteria | 171651 |
| 435 | Ga0315915_1000012 | 3300033464 | Bacteria | 199284 |
| 436 | Ga0373958_0082813 | 3300034819 | Bacteria | 729 |
| 437 | Ga0373959_0014773 | 3300034820 | Bacteria | 1426 |
| 438 | Ga0373959_0070637 | 3300034820 | Bacteria | 789 |
| 439 | Ga0373938_0057225 | 3300034957 | Bacteria | 904 |
| 440 | Ga0373926_0000860 | 3300035083 | Bacteria | 8683 |
| 441 | Ga0373928_0021740 | 3300035084 | Bacteria | 1355 |
| 442 | Ga0373929_0033902 | 3300035085 | Bacteria | 1105 |
| 443 | Ga0373940_0149405 | 3300035088 | Bacteria | 743 |
| 444 | Ga0373944_0003250 | 3300035089 | Bacteria | 4180 |
| 445 | Ga0373949_0008285 | 3300035090 | Bacteria | 2276 |
| 446 | Ga0373951_0075804 | 3300035091 | Bacteria | 863 |
| 447 | Ga0373923_0173607 | 3300035111 | Bacteria | 988 |
| 448 | Ga0373932_0021715 | 3300035112 | Bacteria | 1697 |
| 449 | Ga0373936_0015541 | 3300035113 | Bacteria | 2917 |
| 450 | Ga0373939_0175761 | 3300035114 | Bacteria | 795 |
| 451 | Ga0373945_0100842 | 3300035116 | Bacteria | 1129 |
| 452 | Ga0373953_0066757 | 3300035117 | Bacteria | 1479 |
| 453 | Ga0373956_0031880 | 3300035119 | Bacteria | 2311 |
| 454 | Ga0373956_0138156 | 3300035119 | Bacteria | 1143 |
| 455 | Ga0373943_0014896 | 3300035170 | Bacteria | 3528 |
| 456 | Ga0373946_0027606 | 3300035171 | Bacteria | 2246 |
| 457 | Ga0373961_0043149 | 3300035241 | Bacteria | 1310 |
| 458 | Ga0373924_0090529 | 3300035410 | Bacteria | 1308 |
| 459 | Ga0373924_0140078 | 3300035410 | Bacteria | 1055 |
| 460 | Ga0373931_0021431 | 3300035691 | Bacteria | 3242 |
| 461 | Ga0373931_0159308 | 3300035691 | Bacteria | 1322 |
| 462 | Ga0373931_0173253 | 3300035691 | Bacteria | 1273 |
| 463 | Ga0373931_0783976 | 3300035691 | Bacteria | 634 |
| 464 | Ga0373935_0003949 | 3300035692 | Bacteria | 8659 |
| 465 | Ga0373927_0009382 | 3300035695 | Bacteria | 6564 |
| 466 | Ga0373927_0095449 | 3300035695 | Bacteria | 1933 |
| 467 | Ga0373947_0009088 | 3300035725 | Bacteria | 5710 |
| 468 | Ga0373937_0012385 | 3300036401 | Bacteria | 7500 |
| 469 | Ga0373937_0193022 | 3300036401 | Bacteria | 1914 |
| 470 | Ga0316582_0044224 | 3300036647 | Bacteria | 2798 |
| 471 | Ga0395900_0398199 | 3300037418 | Bacteria | 1342 |
| 472 | Ga0436365_1397623 | 3300039437 | Bacteria | 7292 |
| 473 | Ga0436360_0549273 | 3300039438 | Bacteria | 1716 |
| 474 | Ga0436362_0387917 | 3300039453 | Bacteria | 567 |
| 475 | Ga0439453_0012544 | 3300041408 | Bacteria | 1428 |
| 476 | Ga0439461_0008132 | 3300041410 | Bacteria | 1874 |
| 477 | Ga0451845_0782002 | 3300041501 | Bacteria | 802 |
| 478 | Ga0439441_000556 | 3300042001 | Bacteria | 4136 |
| 479 | Ga0439432_056806 | 3300042006 | Bacteria | 1212 |
| 480 | Ga0439449_0051120 | 3300042007 | Bacteria | 1529 |
| 481 | Ga0439462_0003827 | 3300042015 | Bacteria | 3632 |
| 482 | Ga0439462_0223826 | 3300042015 | Bacteria | 538 |
| 483 | Ga0439446_0012744 | 3300042156 | Bacteria | 2299 |
| 484 | Ga0439435_0002663 | 3300042436 | Bacteria | 3589 |
| 485 | Ga0439460_0005924 | 3300042461 | Bacteria | 3013 |
| 486 | Ga0450893_0017625 | 3300042532 | Bacteria | 1214 |
| 487 | Ga0451577_0029192 | 3300042876 | Bacteria | 4984 |
| 488 | Ga0451577_1427551 | 3300042876 | Bacteria | 613 |
| 489 | Ga0466966_0042939 | 3300044684 | Bacteria | 2900 |
| 490 | Ga0466966_0195470 | 3300044684 | Bacteria | 1225 |
| 491 | Ga0466964_0347144 | 3300044706 | Bacteria | 761 |
| 492 | Ga0466959_0172851 | 3300045049 | Bacteria | 1515 |
| 493 | Ga0451576_0005592 | 3300045051 | Bacteria | 15703 |
| 494 | Ga0451576_0023317 | 3300045051 | Bacteria | 6701 |
| 495 | Ga0451576_0044258 | 3300045051 | Bacteria | 4693 |
| 496 | Ga0451576_0444608 | 3300045051 | Bacteria | 1361 |
| 497 | Ga0451576_0961944 | 3300045051 | Bacteria | 895 |
| 498 | Ga0466958_0417679 | 3300045836 | Bacteria | 867 |
| 499 | Ga0466967_0043252 | 3300045976 | Bacteria | 3899 |
| 500 | Ga0495592_0056995 | 3300046454 | Bacteria | 2885 |
| 501 | Ga0495603_0014327 | 3300046455 | Bacteria | 4794 |
| 502 | Ga0495590_0198529 | 3300046457 | Bacteria | 737 |
| 503 | Ga0495651_0087495 | 3300046462 | Bacteria | 2343 |
| 504 | Ga0495580_0010043 | 3300046472 | Bacteria | 7399 |
| 505 | Ga0495582_0070394 | 3300046473 | Bacteria | 1935 |
| 506 | Ga0495639_0011028 | 3300046475 | Bacteria | 3894 |
| 507 | Ga0495607_0000252 | 3300046501 | Bacteria | 57555 |
| 508 | Ga0495610_0002342 | 3300046512 | Bacteria | 16022 |
| 509 | Ga0495628_0050060 | 3300046516 | Bacteria | 3306 |
| 510 | Ga0495630_0070696 | 3300046517 | Bacteria | 2626 |
| 511 | Ga0495644_0123118 | 3300046523 | Bacteria | 987 |
| 512 | Ga0495666_0024995 | 3300046526 | Bacteria | 2951 |
| 513 | Ga0495586_0018472 | 3300046535 | Bacteria | 3712 |
| 514 | Ga0495587_0019410 | 3300046536 | Bacteria | 4207 |
| 515 | Ga0495621_0328780 | 3300046539 | Bacteria | 638 |
| 516 | Ga0495645_0021953 | 3300046543 | Bacteria | 4616 |
| 517 | Ga0495645_0645820 | 3300046543 | Bacteria | 647 |
| 518 | Ga0495667_0095135 | 3300046559 | Bacteria | 1929 |
| 519 | Ga0495667_0148633 | 3300046559 | Bacteria | 1509 |
| 520 | Ga0495656_0027754 | 3300046615 | Bacteria | 2264 |
| 521 | Ga0495668_0505675 | 3300046616 | Bacteria | 666 |
| 522 | Ga0495634_0004662 | 3300046642 | Bacteria | 10673 |
| 523 | Ga0495588_0026638 | 3300046674 | Bacteria | 2888 |
| 524 | Ga0495599_0025674 | 3300046678 | Bacteria | 3689 |
| 525 | Ga0495623_0026028 | 3300046679 | Bacteria | 3768 |
| 526 | Ga0495647_0009745 | 3300046681 | Bacteria | 3260 |
| 527 | Ga0495658_0011063 | 3300046683 | Bacteria | 4528 |
| 528 | Ga0495600_0047585 | 3300046809 | Bacteria | 2798 |
| 529 | Ga0495581_0202956 | 3300047315 | Bacteria | 1160 |
| 530 | Ga0495636_0034583 | 3300047318 | Bacteria | 2080 |
| 531 | Ga0495674_0316150 | 3300047319 | Bacteria | 1273 |
| 532 | Ga0495676_0052952 | 3300047321 | Bacteria | 3237 |
| 533 | Ga0495680_0535178 | 3300047322 | Bacteria | 791 |
| 534 | Ga0495675_0481843 | 3300047444 | Bacteria | 714 |
| 535 | Ga0495602_0276733 | 3300048088 | Bacteria | 1238 |
| 536 | Ga0495602_0375412 | 3300048088 | Bacteria | 1020 |
| 537 | Ga0496106_0000050 | 3300048909 | Bacteria | 96126 |
| 538 | Ga0501031_0493777 | 3300049568 | Bacteria | 790 |
| 539 | Ga0501031_0509811 | 3300049568 | Bacteria | 776 |
| 540 | Ga0501033_0143727 | 3300049570 | Bacteria | 1724 |
| 541 | Ga0501033_0195046 | 3300049570 | Bacteria | 1448 |
| 542 | Ga0501036_0001519 | 3300049572 | Bacteria | 17901 |
| 543 | Ga0501036_0081257 | 3300049572 | Bacteria | 2739 |
| 544 | Ga0501036_0646894 | 3300049572 | Bacteria | 875 |
| 545 | Ga0501036_0718779 | 3300049572 | Bacteria | 825 |
| 546 | Ga0501037_0093288 | 3300049573 | Bacteria | 2177 |
| 547 | Ga0501037_0277826 | 3300049573 | Bacteria | 1167 |
| 548 | Ga0501038_0001082 | 3300049574 | Bacteria | 24639 |
| 549 | Ga0501039_0000168 | 3300049575 | Bacteria | 45750 |
| 550 | Ga0501039_0096719 | 3300049575 | Bacteria | 2302 |
| 551 | Ga0501040_0001149 | 3300049576 | Bacteria | 16836 |
| 552 | Ga0501040_0015585 | 3300049576 | Bacteria | 5024 |
| 553 | Ga0501040_0196526 | 3300049576 | Bacteria | 1432 |
| 554 | Ga0501040_0205722 | 3300049576 | Bacteria | 1398 |
| 555 | Ga0501041_0000623 | 3300049577 | Bacteria | 18476 |
| 556 | Ga0501041_0136412 | 3300049577 | Bacteria | 1529 |
| 557 | Ga0501042_0010653 | 3300049578 | Bacteria | 6177 |
| 558 | Ga0501042_0046342 | 3300049578 | Bacteria | 3099 |
| 559 | Ga0501042_0080229 | 3300049578 | Bacteria | 2338 |
| 560 | Ga0501042_0409191 | 3300049578 | Bacteria | 983 |
| 561 | Ga0501043_0137507 | 3300049579 | Bacteria | 1914 |
| 562 | Ga0501046_0000480 | 3300049580 | Bacteria | 39915 |
| 563 | Ga0501046_0241570 | 3300049580 | Bacteria | 1332 |
| 564 | Ga0501048_0000896 | 3300049582 | Bacteria | 21988 |
| 565 | Ga0501048_0618750 | 3300049582 | Bacteria | 777 |
| 566 | Ga0501067_0029549 | 3300049583 | Bacteria | 3038 |
| 567 | Ga0501068_0024852 | 3300049584 | Bacteria | 3520 |
| 568 | Ga0501071_0134164 | 3300049587 | Bacteria | 1841 |
| 569 | Ga0501071_0944765 | 3300049587 | Bacteria | 665 |
| 570 | Ga0501072_0060341 | 3300049588 | Bacteria | 2991 |
| 571 | Ga0501072_0119918 | 3300049588 | Bacteria | 2096 |
| 572 | Ga0501074_0130568 | 3300049590 | Bacteria | 1797 |
| 573 | Ga0501074_0834396 | 3300049590 | Bacteria | 649 |
| 574 | Ga0501075_0000046 | 3300049591 | Bacteria | 50813 |
| 575 | Ga0501075_0066463 | 3300049591 | Bacteria | 2721 |
| 576 | Ga0501076_0000566 | 3300049592 | Bacteria | 23610 |
| 577 | Ga0501077_0004244 | 3300049593 | Bacteria | 8660 |
| 578 | Ga0501077_0104385 | 3300049593 | Bacteria | 1796 |
| 579 | Ga0501079_0000808 | 3300049741 | Bacteria | 21315 |
| 580 | Ga0501081_0001689 | 3300049743 | Bacteria | 13675 |
| 581 | Ga0501035_0004374 | 3300049822 | Bacteria | 13419 |
| 582 | Ga0501045_0000436 | 3300049824 | Bacteria | 25558 |
| 583 | Ga0501045_0019929 | 3300049824 | Bacteria | 4787 |
| 584 | nmdc:mga00v17_256636_c1 | 3300050491 | Bacteria | 1134 |
| 585 | nmdc:mga05p37_1059_c1 | 3300050507 | Bacteria | 31441 |
| 586 | nmdc:mga05p37_2687_c1 | 3300050507 | Bacteria | 20683 |
| 587 | nmdc:mga05p37_454651_c1 | 3300050507 | Bacteria | 1481 |
| 588 | nmdc:mga09592_417012_c1 | 3300050508 | Bacteria | 1160 |
| 589 | nmdc:mga09592_438_c1 | 3300050508 | Bacteria | 30676 |
| 590 | nmdc:mga09592_61_c1 | 3300050508 | Bacteria | 60866 |
| 591 | nmdc:mga09592_622892_c1 | 3300050508 | Bacteria | 923 |
| 592 | nmdc:mga0qj67_112210_c1 | 3300050509 | Bacteria | 2201 |
| 593 | nmdc:mga0qj67_574707_c1 | 3300050509 | Bacteria | 903 |
| 594 | nmdc:mga0qj67_795943_c1 | 3300050509 | Bacteria | 749 |
| 595 | nmdc:mga06r32_11848_c1 | 3300050510 | Bacteria | 7853 |
| 596 | nmdc:mga06r32_332627_c1 | 3300050510 | Bacteria | 1504 |
| 597 | nmdc:mga06r32_914978_c1 | 3300050510 | Bacteria | 833 |
| 598 | nmdc:mga08y16_334659_c1 | 3300050511 | Bacteria | 1557 |
| 599 | nmdc:mga08y16_46313_c1 | 3300050511 | Bacteria | 4553 |
| 600 | nmdc:mga08y16_48826_c1 | 3300050511 | Bacteria | 4429 |
| 601 | nmdc:mga08y16_707660_c1 | 3300050511 | Bacteria | 1006 |
| 602 | nmdc:mga08y16_7845_c1 | 3300050511 | Bacteria | 11181 |
| 603 | nmdc:mga0n895_10713_c1 | 3300050512 | Bacteria | 8124 |
| 604 | nmdc:mga0n895_11009_c1 | 3300050512 | Bacteria | 8039 |
| 605 | nmdc:mga0n895_186096_c1 | 3300050512 | Bacteria | 2108 |
| 606 | nmdc:mga0n895_218696_c1 | 3300050512 | Bacteria | 1934 |
| 607 | nmdc:mga0n895_3867_c1 | 3300050512 | Bacteria | 12157 |
| 608 | nmdc:mga0n895_968802_c1 | 3300050512 | Bacteria | 833 |
| 609 | nmdc:mga0rr50_123773_c1 | 3300050513 | Bacteria | 2062 |
| 610 | nmdc:mga0rr50_16364_c1 | 3300050513 | Bacteria | 4924 |
| 611 | nmdc:mga0rr50_319066_c1 | 3300050513 | Bacteria | 1302 |
| 612 | nmdc:mga0rr50_386804_c1 | 3300050513 | Bacteria | 1180 |
| 613 | nmdc:mga0rr50_569018_c1 | 3300050513 | Bacteria | 965 |
| 614 | nmdc:mga0rr50_90379_c1 | 3300050513 | Bacteria | 2383 |
| 615 | nmdc:mga08x19_127739_c1 | 3300050514 | Bacteria | 1708 |
| 616 | nmdc:mga08x19_200146_c1 | 3300050514 | Bacteria | 1369 |
| 617 | nmdc:mga08x19_375_c1 | 3300050514 | Bacteria | 31351 |
| 618 | nmdc:mga08x19_4952_c1 | 3300050514 | Bacteria | 7865 |
| 619 | nmdc:mga08x19_591298_c1 | 3300050514 | Bacteria | 786 |
| 620 | nmdc:mga08x19_62866_c1 | 3300050514 | Bacteria | 2408 |
| 621 | nmdc:mga0a205_1027619_c1 | 3300050515 | Bacteria | 671 |
| 622 | nmdc:mga0a205_1599_c1 | 3300050515 | Bacteria | 19462 |
| 623 | nmdc:mga0a205_211694_c1 | 3300050515 | Bacteria | 1826 |
| 624 | nmdc:mga0a205_57835_c1 | 3300050515 | Bacteria | 3744 |
| 625 | nmdc:mga0a205_651264_c1 | 3300050515 | Bacteria | 905 |
| 626 | nmdc:mga0a205_742087_c1 | 3300050515 | Bacteria | 831 |
| 627 | nmdc:mga0a205_745504_c1 | 3300050515 | Bacteria | 828 |
| 628 | nmdc:mga0a205_76699_c1 | 3300050515 | Bacteria | 3230 |
| 629 | Ga0495601_0010036 | 3300053077 | Bacteria | 5619 |
| 630 | Ga0495595_0015779 | 3300053084 | Bacteria | 3225 |
| 631 | Ga0495595_0182921 | 3300053084 | Bacteria | 1040 |
| 632 | Ga0495619_0082090 | 3300053085 | Bacteria | 2172 |
| 633 | Ga0500641_0016899 | 3300053096 | Bacteria | 2721 |
| 634 | Ga0500658_0005736 | 3300053134 | Bacteria | 4624 |
| 635 | Ga0500568_0001502 | 3300053139 | Bacteria | 14909 |
| 636 | Ga0501084_0034303 | 3300054114 | Bacteria | 4243 |
| 637 | Ga0501084_0934115 | 3300054114 | Bacteria | 729 |
| 638 | Ga0590071_042212 | 3300059421 | Bacteria | 1098 |
| 639 | Ga0590075_026696 | 3300059424 | Bacteria | 1454 |
| 640 | Ga0501082_0002802 | 3300060353 | Bacteria | 15217 |
| 641 | Ga0466962_0117165 | 3300061719 | Bacteria | 1284 |
| 642 | Ga0530510_0025258 | 3300061734 | Bacteria | 4246 |
| 643 | Ga0530510_0303098 | 3300061734 | Bacteria | 1196 |
| 644 | Ga0530510_0741910 | 3300061734 | Bacteria | 749 |
| 645 | 2509107478 | 2508501122 | Bacteria | 6292184 |
| 646 | 2509375813 | 2509276019 | Bacteria | 6802256 |
| 647 | 2510303345 | 2510065057 | Bacteria | 6649661 |
| 648 | 2511501838 | 2511231052 | Bacteria | 6974333 |
| 649 | 2512533276 | 2512047086 | Bacteria | 6850303 |
| 650 | 2513584697 | 2513237086 | Bacteria | 7265287 |
| 651 | 2513603939 | 2513237089 | Bacteria | 6553624 |
| 652 | 2513615407 | 2513237091 | Bacteria | 6900273 |
| 653 | 2513881195 | 2513237140 | Bacteria | 7076289 |
| 654 | 2513905664 | 2513237143 | Bacteria | 6664116 |
| 655 | 2513984377 | 2513237156 | Bacteria | 6402557 |
| 656 | 2514006164 | 2513237160 | Bacteria | 6650282 |
| 657 | 2515608701 | 2515154107 | Bacteria | 6795637 |
| 658 | 2516209632 | 2516143018 | Bacteria | 6951533 |
| 659 | 2516893133 | 2516653046 | Bacteria | 6989037 |
| 660 | 2517569889 | 2517487022 | Bacteria | 7227575 |
| 661 | 2524448896 | 2524023207 | Bacteria | 6813453 |
| 662 | 2551677973 | 2551306084 | Bacteria | 8942552 |
| 663 | 2551686754 | 2551306085 | Bacteria | 7347181 |
| 664 | 2551690979 | 2551306086 | Bacteria | 6843938 |
| 665 | 2551698954 | 2551306087 | Bacteria | 7351905 |
| 666 | 2551713829 | 2551306089 | Bacteria | 7162724 |
| 667 | 2551717857 | 2551306090 | Bacteria | 7953713 |
| 668 | 2551719337 | 2551306090 | Bacteria | 7953713 |
| 669 | 2551727830 | 2551306091 | Bacteria | 7086830 |
| 670 | 2551736530 | 2551306092 | Bacteria | 6992595 |
| 671 | 2551743891 | 2551306093 | Bacteria | 7064773 |
| 672 | 2558868082 | 2558860100 | Bacteria | 8458965 |
| 673 | 2585846773 | 2585427594 | Bacteria | 6180594 |
| 674 | 2657685865 | 2657244999 | Bacteria | 5946535 |
| 675 | 2692315908 | 2690316117 | Bacteria | 6800650 |
| 676 | 2753458826 | 2751185821 | Bacteria | 6189929 |
| 677 | 2792581857 | 2791355082 | Bacteria | 5973319 |
| 678 | 2792620097 | 2791355091 | Bacteria | 6135441 |
| 679 | 2792626484 | 2791355092 | Bacteria | 6248105 |
| 680 | 2792639414 | 2791355094 | Bacteria | 7011481 |
| 681 | 2802719163 | 2802428858 | Bacteria | 6636079 |
| 682 | 2802727394 | 2802428859 | Bacteria | 6667919 |
| 683 | 2802732176 | 2802428860 | Bacteria | 6525526 |
| 684 | 2802739106 | 2802428861 | Bacteria | 6534206 |
| 685 | 2802745006 | 2802428862 | Bacteria | 6633353 |
| 686 | 2802752281 | 2802428863 | Bacteria | 6410669 |
| 687 | 2804752312 | 2802429268 | Bacteria | 6094027 |
| 688 | 2838078940 | 2838074704 | Bacteria | 6785777 |
| 689 | 2847419027 | 2847417321 | Bacteria | 6913799 |
| 690 | 2848994059 | 2848992105 | Bacteria | 6810864 |
| 691 | 2850082075 | 2850079185 | Bacteria | 6848280 |
| 692 | 2855825934 | 2855825444 | Bacteria | 6785811 |
| 693 | 2855841284 | 2855839649 | Bacteria | 7135830 |
| 694 | 2855876702 | 2855872281 | Bacteria | 6964271 |
| 695 | 2857580398 | 2857576091 | Bacteria | 5465855 |
| 696 | 2858802262 | 2858800743 | Bacteria | 6603254 |
| 697 | 2896390806 | 2896384573 | Bacteria | 7700774 |
| 698 | 2913300911 | 2913295892 | Bacteria | 6333755 |
| 699 | 2915985531 | 2915980308 | Bacteria | 6624279 |
| 700 | 2915990346 | 2915986958 | Bacteria | 6739310 |
| 701 | 2915994855 | 2915993759 | Bacteria | 7016183 |
| 702 | 2916002763 | 2916000859 | Bacteria | 6865702 |
| 703 | 2916014479 | 2916007675 | Bacteria | 6898660 |
| 704 | 2916017363 | 2916014648 | Bacteria | 6946486 |
| 705 | 2916024018 | 2916021584 | Bacteria | 6854472 |
| 706 | 2916033220 | 2916028427 | Bacteria | 6748433 |
| 707 | 2916036720 | 2916035215 | Bacteria | 6755766 |
| 708 | 2916044288 | 2916041962 | Bacteria | 6820487 |
| 709 | 2916052226 | 2916048683 | Bacteria | 6543552 |
| 710 | 2916055545 | 2916055098 | Bacteria | 6758838 |
| 711 | 2916065285 | 2916061851 | Bacteria | 6737736 |
| 712 | 2916072084 | 2916068649 | Bacteria | 6943657 |
| 713 | 2916080920 | 2916076590 | Bacteria | 6596108 |
| 714 | 2920766149 | 2920760137 | Bacteria | 7427611 |
| 715 | 2921204855 | 2921201388 | Bacteria | 6926299 |
| 716 | 2921212602 | 2921208531 | Bacteria | 6745326 |
| 717 | 2921242346 | 2921237296 | Bacteria | 6876710 |
| 718 | 2921246571 | 2921244191 | Bacteria | 6568419 |
| 719 | 2921255175 | 2921250672 | Bacteria | 6677771 |
| 720 | 2921259603 | 2921257292 | Bacteria | 6808382 |
| 721 | 2921266966 | 2921263974 | Bacteria | 6864552 |
| 722 | 2921287354 | 2921282425 | Bacteria | 6826397 |
| 723 | 2921294138 | 2921289301 | Bacteria | 7316391 |
| 724 | 2921302602 | 2921296804 | Bacteria | 7176999 |
| 725 | 2924145997 | 2924144063 | Bacteria | 6883928 |
| 726 | 2924154545 | 2924150972 | Bacteria | 7169444 |
| 727 | 2924163062 | 2924158325 | Bacteria | 7188855 |
| 728 | 2924170308 | 2924165586 | Bacteria | 7260590 |
| 729 | 2924176344 | 2924172951 | Bacteria | 6749356 |
| 730 | 2924181399 | 2924179722 | Bacteria | 6843264 |
| 731 | 2924189846 | 2924186466 | Bacteria | 6876637 |
| 732 | 2924196544 | 2924193448 | Bacteria | 6955718 |
| 733 | 2924205828 | 2924200457 | Bacteria | 6757188 |
| 734 | 2924211221 | 2924207177 | Bacteria | 6917007 |
| 735 | 2924217378 | 2924214083 | Bacteria | 7080103 |
| 736 | 2924225027 | 2924221636 | Bacteria | 7113495 |
| 737 | 2924231441 | 2924228884 | Bacteria | 6633132 |
| 738 | 2936999585 | 2936996657 | Bacteria | 6298727 |
| 739 | 2937005985 | 2937002841 | Bacteria | 6934057 |
| 740 | 2937013275 | 2937009748 | Bacteria | 6746052 |
| 741 | 2937019340 | 2937016420 | Bacteria | 6782579 |
| 742 | 2937028915 | 2937023124 | Bacteria | 6815156 |
| 743 | 2937033651 | 2937029754 | Bacteria | 6424026 |
| 744 | 2937037151 | 2937036028 | Bacteria | 6846469 |
| 745 | 2937047512 | 2937042894 | Bacteria | 6741576 |
| 746 | 2937052468 | 2937049772 | Bacteria | 6757901 |
| 747 | 2937063616 | 2937056579 | Bacteria | 7107896 |
| 748 | 2937068092 | 2937063883 | Bacteria | 7199456 |
| 749 | 2937072992 | 2937071275 | Bacteria | 6984483 |
| 750 | 2937079318 | 2937078374 | Bacteria | 6610289 |
| 751 | 2937087871 | 2937084907 | Bacteria | 6618516 |
| 752 | 2937094088 | 2937091812 | Bacteria | 6979387 |
| 753 | 2937106237 | 2937098957 | Bacteria | 7249374 |
| 754 | 2937107998 | 2937106411 | Bacteria | 6947143 |
| 755 | 2937115222 | 2937113482 | Bacteria | 6505872 |
| 756 | 2937123351 | 2937119839 | Bacteria | 6597547 |
| 757 | 2937129112 | 2937126314 | Bacteria | 6771275 |
| 758 | 2957381476 | 2957375807 | Bacteria | 6425588 |
| 759 | 2957387511 | 2957382221 | Bacteria | 6737050 |
| 760 | 2957391795 | 2957388812 | Bacteria | 6778072 |
| 761 | 2957396630 | 2957395598 | Bacteria | 6822399 |
| 762 | 2957404883 | 2957402308 | Bacteria | 6741770 |
| 763 | 2957410920 | 2957408893 | Bacteria | 6558585 |
| 764 | 2957420142 | 2957415311 | Bacteria | 6991633 |
| 765 | 2957426249 | 2957422303 | Bacteria | 7172205 |
| 766 | 2957433926 | 2957430029 | Bacteria | 7022557 |
| 767 | 2957441132 | 2957437181 | Bacteria | 6568994 |
| 768 | 2957445705 | 2957443900 | Bacteria | 6869977 |
| 769 | 2957454639 | 2957450854 | Bacteria | 6765715 |
| 770 | 2957464006 | 2957457609 | Bacteria | 6967680 |
| 771 | 2957467828 | 2957464669 | Bacteria | 6568877 |
| 772 | 2957472447 | 2957471148 | Bacteria | 6797643 |
| 773 | 2957480715 | 2957478035 | Bacteria | 6756658 |
| 774 | 2957488539 | 2957484790 | Bacteria | 6703082 |
| 775 | 2957496654 | 2957491536 | Bacteria | 6695180 |
| 776 | 2957502659 | 2957498199 | Bacteria | 7126688 |
| 777 | 2957506827 | 2957505466 | Bacteria | 7253085 |
| 778 | 2960590096 | 2960584000 | Bacteria | 6864594 |
| 779 | 2960597316 | 2960591022 | Bacteria | 6622873 |
| 780 | 2960598263 | 2960597568 | Bacteria | 6550735 |
| 781 | 2960609660 | 2960603979 | Bacteria | 6898737 |
| 782 | 2960615174 | 2960610863 | Bacteria | 6691244 |
| 783 | 2960620883 | 2960617483 | Bacteria | 6727748 |
| 784 | 2960627587 | 2960624210 | Bacteria | 6875384 |
| 785 | 2960635920 | 2960631154 | Bacteria | 6732508 |
| 786 | 2960644681 | 2960637947 | Bacteria | 7296468 |
| 787 | 2960649029 | 2960645483 | Bacteria | 7211087 |
| 788 | 2960659241 | 2960652885 | Bacteria | 7083688 |
| 789 | 2960662178 | 2960660292 | Bacteria | 7041660 |
| 790 | 2960672717 | 2960667422 | Bacteria | 6763020 |
| 791 | 2960676456 | 2960674078 | Bacteria | 6609048 |
| 792 | 2960687268 | 2960680706 | Bacteria | 6624464 |
| 793 | 2960689918 | 2960687367 | Bacteria | 6535474 |
| 794 | 2960698407 | 2960693952 | Bacteria | 6749742 |
| 795 | 2964611738 | 2964607997 | Bacteria | 7101408 |
| 796 | 2964616928 | 2964615318 | Bacteria | 6809089 |
| 797 | 2964624616 | 2964621998 | Bacteria | 6834995 |
| 798 | 2964631106 | 2964628898 | Bacteria | 7083044 |
| 799 | 2964637556 | 2964636051 | Bacteria | 7091832 |
| 800 | 2964646449 | 2964643177 | Bacteria | 6820887 |
| 801 | 2964651670 | 2964649959 | Bacteria | 6675118 |
| 802 | 2964661622 | 2964656573 | Bacteria | 7100150 |
| 803 | 2964669891 | 2964663802 | Bacteria | 7019362 |
| 804 | 2964673903 | 2964670856 | Bacteria | 6851364 |
| 805 | 2964678476 | 2964678106 | Bacteria | 6792020 |
| 806 | 2964686878 | 2964685014 | Bacteria | 6839111 |
| 807 | 2964694396 | 2964691889 | Bacteria | 6802758 |
| 808 | 2964701579 | 2964698721 | Bacteria | 6765331 |
| 809 | 2964710989 | 2964705432 | Bacteria | 7114648 |
| 810 | 2964714168 | 2964712639 | Bacteria | 6695970 |
| 811 | 2964723453 | 2964719344 | Bacteria | 7286602 |
| 812 | 2967665128 | 2967664464 | Bacteria | 6948836 |
| 813 | 2967675530 | 2967671571 | Bacteria | 7021409 |
| 814 | 2967686167 | 2967678726 | Bacteria | 7264382 |
| 815 | 2967690101 | 2967686174 | Bacteria | 6678622 |
| 816 | 2967697464 | 2967693043 | Bacteria | 6804451 |
| 817 | 2967702835 | 2967699805 | Bacteria | 6854538 |
| 818 | 2967709051 | 2967706974 | Bacteria | 7186053 |
| 819 | 2967716822 | 2967714385 | Bacteria | 7000047 |
| 820 | 2967726371 | 2967721400 | Bacteria | 7073753 |
| 821 | 2967732734 | 2967728569 | Bacteria | 6641507 |
| 822 | 2967740057 | 2967735183 | Bacteria | 6827012 |
| 823 | 2967743298 | 2967742019 | Bacteria | 6794534 |
| 824 | 2967753747 | 2967748971 | Bacteria | 6733771 |
| 825 | 2967758692 | 2967755722 | Bacteria | 6814706 |
| 826 | 2967769276 | 2967762386 | Bacteria | 6923502 |
| 827 | 2967770917 | 2967769361 | Bacteria | 6587838 |
| 828 | 2967780318 | 2967775926 | Bacteria | 6738189 |
| 829 | 2970020397 | 2970019648 | Bacteria | 7072033 |
| 830 | 2970030842 | 2970026789 | Bacteria | 6785236 |
| 831 | 2970034448 | 2970033650 | Bacteria | 7118744 |
| 832 | 2970042539 | 2970040964 | Bacteria | 6731123 |
| 833 | 2970048930 | 2970047711 | Bacteria | 7088379 |
| 834 | 2970057098 | 2970054988 | Bacteria | 6611507 |
| 835 | 2970066184 | 2970061556 | Bacteria | 7099761 |
| 836 | 2970070859 | 2970068827 | Bacteria | 7123112 |
| 837 | 2970079274 | 2970076120 | Bacteria | 6697332 |
| 838 | 2970083688 | 2970082768 | Bacteria | 6183754 |
| 839 | 2970090454 | 2970088815 | Bacteria | 6933825 |
| 840 | 2970099190 | 2970095765 | Bacteria | 6936963 |
| 841 | 2970107442 | 2970102677 | Bacteria | 6812532 |
| 842 | 2970111642 | 2970109326 | Bacteria | 6863976 |
| 843 | 2970121938 | 2970116247 | Bacteria | 6501857 |
| 844 | 2970126719 | 2970122695 | Bacteria | 6625855 |
| 845 | 2970133426 | 2970129317 | Bacteria | 6806560 |
| 846 | 2970143235 | 2970136068 | Bacteria | 7207982 |
| 847 | 2970148090 | 2970143518 | Bacteria | 6446480 |
| 848 | 2970156379 | 2970149975 | Bacteria | 6779706 |
| 849 | 2970161623 | 2970156795 | Bacteria | 7168044 |
| 850 | 2970168176 | 2970164137 | Bacteria | 6861252 |
| 851 | 2970174712 | 2970170962 | Bacteria | 6876229 |
| 852 | 2970180538 | 2970177841 | Bacteria | 6768001 |
| 853 | 2970189331 | 2970184632 | Bacteria | 7054431 |
| 854 | 2970195806 | 2970191845 | Bacteria | 7032787 |
| 855 | 2977521416 | 2977516862 | Bacteria | 6940108 |
| 856 | 2977529295 | 2977523885 | Bacteria | 6960446 |
| 857 | 2977534801 | 2977530762 | Bacteria | 6951399 |
| 858 | 2977542572 | 2977537788 | Bacteria | 6929320 |
| 859 | 2977547763 | 2977544691 | Bacteria | 6875412 |
| 860 | 2977556381 | 2977551784 | Bacteria | 7125765 |
| 861 | 2977560941 | 2977558990 | Bacteria | 6863948 |
| 862 | 2977567910 | 2977565890 | Bacteria | 6901543 |
| 863 | 2977575179 | 2977572785 | Bacteria | 6763888 |
| 864 | 2977584246 | 2977579622 | Bacteria | 6772100 |
| 865 | 643825915 | 643692032 | Bacteria | 6891900 |
| 866 | 648737502 | 648276728 | Bacteria | 6968865 |
| 867 | 8003993789 | 8003992118 | Bacteria | 7266902 |
| 868 | 8049294869 | 8049293176 | Bacteria | 6128433 |
| 869 | 8054559902 | 8054558443 | Bacteria | 5204801 |
| 870 | Ga0070689_100676291 | |||
| 871 | JGI24742J22300_10070681 | |||
| 872 | Ga0065712_10122077 | |||
| 873 | Ga0065707_10538935 | |||
| 874 | Ga0070658_10010004 | |||
| 875 | Ga0070658_10075444 | |||
| 876 | Ga0070658_11377934 | |||
| 877 | Ga0070676_10794085 | |||
| 878 | Ga0070683_100135633 | |||
| 879 | Ga0070690_100000148 | |||
| 880 | Ga0070690_100071630 | |||
| 881 | Ga0070670_100480948 | |||
| 882 | Ga0070670_100704208 | |||
| 883 | Ga0070677_10527158 | |||
| 884 | Ga0068869_100000103 | |||
| 885 | Ga0068869_100063869 | |||
| 886 | Ga0070680_100000882 | |||
| 887 | Ga0070682_100008721 | |||
| 888 | Ga0070682_100931071 | |||
| 889 | Ga0068868_100001076 | |||
| 890 | Ga0068868_100270401 | |||
| 891 | Ga0068868_100413471 | |||
| 892 | Ga0070660_100428494 | |||
| 893 | Ga0070689_100002361 | |||
| 894 | Ga0070689_100108737 | |||
| 895 | Ga0070689_100160901 | |||
| 896 | Ga0070689_100170739 | |||
| 897 | Ga0070691_10003035 | |||
| 898 | Ga0070691_10160365 | |||
| 899 | Ga0070691_10442088 | |||
| 900 | Ga0070687_100000105 | |||
| 901 | Ga0070687_100024661 | |||
| 902 | Ga0070687_100126534 | |||
| 903 | Ga0070692_10005261 | |||
| 904 | Ga0070692_10028792 | |||
| 905 | Ga0070668_100009368 | |||
| 906 | Ga0070668_100016417 | |||
| 907 | Ga0070669_100002037 | |||
| 908 | Ga0070669_100405369 | |||
| 909 | Ga0070675_100036014 | |||
| 910 | Ga0070671_100264110 | |||
| 911 | Ga0070671_100435214 | |||
| 912 | Ga0070674_100056367 | |||
| 913 | Ga0070674_100059160 | |||
| 914 | Ga0070673_100273397 | |||
| 915 | Ga0070673_100352279 | |||
| 916 | Ga0070673_100532402 | |||
| 917 | Ga0070688_100052888 | |||
| 918 | Ga0070688_100171705 | |||
| 919 | Ga0070659_100264025 | |||
| 920 | Ga0070703_10362501 | |||
| 921 | Ga0070714_100198431 | |||
| 922 | Ga0070714_100384122 | |||
| 923 | Ga0070714_100412585 | |||
| 924 | Ga0070713_100403414 | |||
| 925 | Ga0070713_101182719 | |||
| 926 | Ga0070710_10689498 | |||
| 927 | Ga0070701_10182682 | |||
| 928 | Ga0070701_10204055 | |||
| 929 | Ga0070701_10656736 | |||
| 930 | Ga0070705_100001061 | |||
| 931 | Ga0070705_100005767 | |||
| 932 | Ga0070705_100075917 | |||
| 933 | Ga0070705_100133086 | |||
| 934 | Ga0070705_100212680 | |||
| 935 | Ga0070705_100368473 | |||
| 936 | Ga0070700_100001887 | |||
| 937 | Ga0070700_100009399 | |||
| 938 | Ga0070694_100000110 | |||
| 939 | Ga0070694_100002797 | |||
| 940 | Ga0070694_100013506 | |||
| 941 | Ga0070694_100365442 | |||
| 942 | Ga0070694_100583412 | |||
| 943 | Ga0070708_100207175 | |||
| 944 | Ga0070708_100614047 | |||
| 945 | Ga0070662_100164412 | |||
| 946 | Ga0070662_101016463 | |||
| 947 | Ga0070681_10118573 | |||
| 948 | Ga0070681_10211062 | |||
| 949 | Ga0070681_10301517 | |||
| 950 | Ga0070681_11321818 | |||
| 951 | Ga0068867_100000441 | |||
| 952 | Ga0068867_100001737 | |||
| 953 | Ga0068867_100305924 | |||
| 954 | Ga0070706_100830358 | |||
| 955 | Ga0070707_100443939 | |||
| 956 | Ga0070698_100193154 | |||
| 957 | Ga0070698_100701983 | |||
| 958 | Ga0070699_100046681 | |||
| 959 | Ga0070699_100154507 | |||
| 960 | Ga0070699_100379676 | |||
| 961 | Ga0070679_100057268 | |||
| 962 | Ga0070684_100020331 | |||
| 963 | Ga0070684_100478817 | |||
| 964 | Ga0070684_101019853 | |||
| 965 | Ga0070697_100203191 | |||
| 966 | Ga0070697_100223627 | |||
| 967 | Ga0070697_100476188 | |||
| 968 | Ga0070697_100480525 | |||
| 969 | Ga0068853_100064747 | |||
| 970 | Ga0070672_100130429 | |||
| 971 | Ga0070672_100149330 | |||
| 972 | Ga0070686_100000563 | |||
| 973 | Ga0070686_100054520 | |||
| 974 | Ga0070695_100000512 | |||
| 975 | Ga0070695_100064882 | |||
| 976 | Ga0070695_100189216 | |||
| 977 | Ga0070695_100206318 | |||
| 978 | Ga0070695_100228624 | |||
| 979 | Ga0070696_100009252 | |||
| 980 | Ga0070696_100015140 | |||
| 981 | Ga0070696_100040726 | |||
| 982 | Ga0070696_100076603 | |||
| 983 | Ga0070696_100083654 | |||
| 984 | Ga0070696_100288699 | |||
| 985 | Ga0070693_100000101 | |||
| 986 | Ga0070693_100014688 | |||
| 987 | Ga0070665_100563839 | |||
| 988 | Ga0070704_100000220 | |||
| 989 | Ga0070704_100001535 | |||
| 990 | Ga0070704_100012096 | |||
| 991 | Ga0070704_100017031 | |||
| 992 | Ga0070704_100104157 | |||
| 993 | Ga0070704_100660563 | |||
| 994 | Ga0068855_100001986 | |||
| 995 | Ga0068855_100010909 | |||
| 996 | Ga0068855_100030675 | |||
| 997 | Ga0068855_100169283 | |||
| 998 | Ga0068857_100495085 | |||
| 999 | Ga0068857_100526291 | |||
| 1000 | Ga0068857_101310592 | |||
| 1001 | Ga0068854_100005853 | |||
| 1002 | Ga0068854_100812516 | |||
| 1003 | Ga0068856_100009739 | |||
| 1004 | Ga0068856_100037843 | |||
| 1005 | Ga0068856_100251353 | |||
| 1006 | Ga0070702_100000096 | |||
| 1007 | Ga0070702_100375112 | |||
| 1008 | Ga0068852_100001888 | |||
| 1009 | Ga0068852_100205376 | |||
| 1010 | Ga0068852_100250388 | |||
| 1011 | Ga0068859_100004200 | |||
| 1012 | Ga0068859_100179362 | |||
| 1013 | Ga0068859_100599324 | |||
| 1014 | Ga0068864_100541723 | |||
| 1015 | Ga0068866_10000893 | |||
| 1016 | Ga0068866_10227104 | |||
| 1017 | Ga0068861_100000826 | |||
| 1018 | Ga0068861_100003187 | |||
| 1019 | Ga0068851_10093381 | |||
| 1020 | Ga0068870_10058985 | |||
| 1021 | Ga0068863_100904215 | |||
| 1022 | Ga0068863_101264015 | |||
| 1023 | Ga0068858_100002013 | |||
| 1024 | Ga0068858_100007196 | |||
| 1025 | Ga0068860_100001309 | |||
| 1026 | Ga0068862_100001947 | |||
| 1027 | Ga0068862_100006062 | |||
| 1028 | Ga0068862_100569450 | |||
| 1029 | Ga0081539_10001473 | |||
| 1030 | Ga0075364_10255516 | |||
| 1031 | Ga0070715_10019529 | |||
| 1032 | Ga0070715_10052773 | |||
| 1033 | Ga0070712_100396333 | |||
| 1034 | Ga0070712_100642458 | |||
| 1035 | Ga0097621_100000106 | |||
| 1036 | Ga0097621_100006960 | |||
| 1037 | Ga0097621_100012268 | |||
| 1038 | Ga0097621_100050892 | |||
| 1039 | Ga0097621_100287557 | |||
| 1040 | Ga0068871_100002446 | |||
| 1041 | Ga0068871_100008532 | |||
| 1042 | Ga0068871_100017675 | |||
| 1043 | Ga0068871_100182020 | |||
| 1044 | Ga0068871_101188804 | |||
| 1045 | Ga0075428_100000134 | |||
| 1046 | Ga0075428_100047461 | |||
| 1047 | Ga0075430_100060701 | |||
| 1048 | Ga0075431_100014959 | |||
| 1049 | Ga0075431_100209478 | |||
| 1050 | Ga0075433_10001519 | |||
| 1051 | Ga0075433_10056858 | |||
| 1052 | Ga0075433_10140793 | |||
| 1053 | Ga0075433_10363736 | |||
| 1054 | Ga0075433_10398836 | |||
| 1055 | Ga0075433_10594228 | |||
| 1056 | Ga0075433_10692785 | |||
| 1057 | Ga0075433_10808494 | |||
| 1058 | Ga0075433_10911110 | |||
| 1059 | Ga0075434_100000699 | |||
| 1060 | Ga0075434_100000813 | |||
| 1061 | Ga0075434_100134764 | |||
| 1062 | Ga0075434_100348944 | |||
| 1063 | Ga0075429_100000271 | |||
| 1064 | Ga0075429_100000975 | |||
| 1065 | Ga0068865_100000231 | |||
| 1066 | Ga0068865_100057228 | |||
| 1067 | Ga0068865_100717876 | |||
| 1068 | Ga0068865_100775400 | |||
| 1069 | Ga0068865_100950084 | |||
| 1070 | Ga0075436_100002436 | |||
| 1071 | Ga0075436_100004776 | |||
| 1072 | Ga0075436_100006862 | |||
| 1073 | Ga0075436_100012375 | |||
| 1074 | Ga0075436_100016124 | |||
| 1075 | Ga0075436_100076041 | |||
| 1076 | Ga0075436_100291279 | |||
| 1077 | Ga0097620_100004200 | |||
| 1078 | Ga0097620_100179358 | |||
| 1079 | Ga0097620_100599261 | |||
| 1080 | Ga0079104_1007232 | |||
| 1081 | Ga0079104_1008431 | |||
| 1082 | Ga0075435_100002136 | |||
| 1083 | Ga0075435_100035972 | |||
| 1084 | Ga0075435_100083482 | |||
| 1085 | Ga0075435_100134671 | |||
| 1086 | Ga0075435_100672997 | |||
| 1087 | Ga0099794_10201826 | |||
| 1088 | Ga0105240_10002895 | |||
| 1089 | Ga0105240_10061715 | |||
| 1090 | Ga0105240_10071509 | |||
| 1091 | Ga0105240_10161885 | |||
| 1092 | Ga0111539_10008776 | |||
| 1093 | Ga0111539_10305362 | |||
| 1094 | Ga0105245_10000347 | |||
| 1095 | Ga0105245_10042334 | |||
| 1096 | Ga0105245_10489525 | |||
| 1097 | Ga0114129_10005561 | |||
| 1098 | Ga0114129_10474621 | |||
| 1099 | Ga0105243_10000535 | |||
| 1100 | Ga0105243_10004257 | |||
| 1101 | Ga0105243_11054664 | |||
| 1102 | Ga0105241_10010941 | |||
| 1103 | Ga0105241_10265525 | |||
| 1104 | Ga0105241_11244082 | |||
| 1105 | Ga0105242_10000905 | |||
| 1106 | Ga0105242_10001512 | |||
| 1107 | Ga0105242_10002624 | |||
| 1108 | Ga0105242_10013578 | |||
| 1109 | Ga0105242_10017281 | |||
| 1110 | Ga0105242_10136475 | |||
| 1111 | Ga0105242_10777000 | |||
| 1112 | Ga0105242_11123883 | |||
| 1113 | Ga0105248_10020172 | |||
| 1114 | Ga0105248_10159204 | |||
| 1115 | Ga0105248_10633277 | |||
| 1116 | Ga0105248_10975333 | |||
| 1117 | Ga0105238_10020415 | |||
| 1118 | Ga0105238_10140266 | |||
| 1119 | Ga0105249_10005947 | |||
| 1120 | Ga0105249_10032433 | |||
| 1121 | Ga0105249_10124436 | |||
| 1122 | Ga0105249_12034013 | |||
| 1123 | Ga0105239_10110995 | |||
| 1124 | Ga0105246_10394906 | |||
| 1125 | Ga0157370_10001416 | |||
| 1126 | Ga0157370_10147777 | |||
| 1127 | Ga0157370_10207967 | |||
| 1128 | Ga0157369_10047888 | |||
| 1129 | Ga0157369_10223677 | |||
| 1130 | Ga0157374_10087241 | |||
| 1131 | Ga0157374_11017934 | |||
| 1132 | Ga0157378_10000447 | |||
| 1133 | Ga0157378_10072444 | |||
| 1134 | Ga0157378_10884520 | |||
| 1135 | Ga0163162_10085969 | |||
| 1136 | Ga0163162_10169220 | |||
| 1137 | Ga0163162_10658305 | |||
| 1138 | Ga0163162_10936126 | |||
| 1139 | Ga0157372_10011227 | |||
| 1140 | Ga0157372_10016533 | |||
| 1141 | Ga0157375_10390359 | |||
| 1142 | Ga0157375_10474713 | |||
| 1143 | Ga0163163_11692111 | |||
| 1144 | Ga0157380_10012418 | |||
| 1145 | Ga0157380_10157007 | |||
| 1146 | Ga0157380_10215074 | |||
| 1147 | Ga0157380_10936208 | |||
| 1148 | Ga0157377_10126523 | |||
| 1149 | Ga0157379_10035647 | |||
| 1150 | Ga0157379_10380073 | |||
| 1151 | Ga0157376_10002088 | |||
| 1152 | Ga0163161_11204082 | |||
| 1153 | Ga0214544_1000158 | |||
| 1154 | Ga0214542_1001567 | |||
| 1155 | Ga0214543_1000011 | |||
| 1156 | Ga0214543_1000234 | |||
| 1157 | Ga0213876_10203956 | |||
| 1158 | Ga0228711_1000007 | |||
| 1159 | Ga0228710_1000007 | |||
| 1160 | Ga0207653_10010388 | |||
| 1161 | Ga0207692_10033185 | |||
| 1162 | Ga0207642_10018538 | |||
| 1163 | Ga0207642_10555749 | |||
| 1164 | Ga0207688_10009633 | |||
| 1165 | Ga0207685_10016491 | |||
| 1166 | Ga0207685_10168466 | |||
| 1167 | Ga0207699_10458149 | |||
| 1168 | Ga0207645_10653619 | |||
| 1169 | Ga0207643_10034065 | |||
| 1170 | Ga0207705_10055223 | |||
| 1171 | Ga0207705_10067749 | |||
| 1172 | Ga0207684_10733100 | |||
| 1173 | Ga0207654_10425853 | |||
| 1174 | Ga0207695_10003454 | |||
| 1175 | Ga0207695_10148941 | |||
| 1176 | Ga0207660_10065878 | |||
| 1177 | Ga0207660_11153753 | |||
| 1178 | Ga0207662_10000109 | |||
| 1179 | Ga0207662_10051386 | |||
| 1180 | Ga0207652_10030375 | |||
| 1181 | Ga0207646_10301703 | |||
| 1182 | Ga0207646_10368302 | |||
| 1183 | Ga0207681_10005710 | |||
| 1184 | Ga0207694_10146947 | |||
| 1185 | Ga0207650_10690226 | |||
| 1186 | Ga0207659_10027967 | |||
| 1187 | Ga0207659_10290999 | |||
| 1188 | Ga0207687_10010136 | |||
| 1189 | Ga0207687_10073432 | |||
| 1190 | Ga0207687_10172205 | |||
| 1191 | Ga0207687_10449317 | |||
| 1192 | Ga0207664_10592560 | |||
| 1193 | Ga0207690_10082586 | |||
| 1194 | Ga0207706_10088982 | |||
| 1195 | Ga0207706_10131628 | |||
| 1196 | Ga0207686_10001982 | |||
| 1197 | Ga0207686_10018157 | |||
| 1198 | Ga0207686_10086270 | |||
| 1199 | Ga0207686_10100601 | |||
| 1200 | Ga0207686_10190999 | |||
| 1201 | Ga0207686_10628660 | |||
| 1202 | Ga0207709_10002130 | |||
| 1203 | Ga0207709_10003201 | |||
| 1204 | Ga0207709_10313750 | |||
| 1205 | Ga0207670_10009930 | |||
| 1206 | Ga0207670_10121748 | |||
| 1207 | Ga0207670_10222450 | |||
| 1208 | Ga0207670_10426811 | |||
| 1209 | Ga0207670_10452459 | |||
| 1210 | Ga0207670_10573986 | |||
| 1211 | Ga0207669_10017503 | |||
| 1212 | Ga0207669_10036799 | |||
| 1213 | Ga0207704_10008864 | |||
| 1214 | Ga0207704_10023598 | |||
| 1215 | Ga0207704_10821733 | |||
| 1216 | Ga0207704_10872868 | |||
| 1217 | Ga0207665_10882135 | |||
| 1218 | Ga0207691_10057987 | |||
| 1219 | Ga0207691_10336608 | |||
| 1220 | Ga0207711_10067898 | |||
| 1221 | Ga0207711_10693143 | |||
| 1222 | Ga0207689_10000532 | |||
| 1223 | Ga0207689_10044044 | |||
| 1224 | Ga0207661_10093302 | |||
| 1225 | Ga0207667_10026319 | |||
| 1226 | Ga0207667_10091486 | |||
| 1227 | Ga0207667_10296342 | |||
| 1228 | Ga0207667_10370534 | |||
| 1229 | Ga0207667_10709918 | |||
| 1230 | Ga0207712_10003243 | |||
| 1231 | Ga0207712_10065714 | |||
| 1232 | Ga0207712_10188043 | |||
| 1233 | Ga0207712_11481257 | |||
| 1234 | Ga0207668_10015526 | |||
| 1235 | Ga0207668_10152942 | |||
| 1236 | Ga0207640_10136945 | |||
| 1237 | Ga0207677_10007130 | |||
| 1238 | Ga0207677_10191492 | |||
| 1239 | Ga0207677_10736880 | |||
| 1240 | Ga0207703_10026056 | |||
| 1241 | Ga0207703_10861590 | |||
| 1242 | Ga0207703_11321356 | |||
| 1243 | Ga0207639_10115403 | |||
| 1244 | Ga0207639_10183033 | |||
| 1245 | Ga0207639_10794125 | |||
| 1246 | Ga0207708_10000712 | |||
| 1247 | Ga0207708_10003441 | |||
| 1248 | Ga0207708_10312524 | |||
| 1249 | Ga0207708_10421411 | |||
| 1250 | Ga0207708_10966896 | |||
| 1251 | Ga0207702_10009029 | |||
| 1252 | Ga0207702_10040144 | |||
| 1253 | Ga0207702_10146020 | |||
| 1254 | Ga0207641_11149338 | |||
| 1255 | Ga0207648_10000505 | |||
| 1256 | Ga0207648_10188736 | |||
| 1257 | Ga0207648_10283810 | |||
| 1258 | Ga0207676_10707698 | |||
| 1259 | Ga0207674_10482920 | |||
| 1260 | Ga0207674_10527796 | |||
| 1261 | Ga0207675_100000625 | |||
| 1262 | Ga0207675_100000760 | |||
| 1263 | Ga0207675_100460148 | |||
| 1264 | Ga0207683_10122736 | |||
| 1265 | Ga0207698_10061806 | |||
| 1266 | Ga0207698_10105045 | |||
| 1267 | Ga0209281_1000128 | |||
| 1268 | Ga0209281_1000483 | |||
| 1269 | Ga0209969_1015731 | |||
| 1270 | Ga0209967_1001411 | |||
| 1271 | Ga0209981_1002546 | |||
| 1272 | Ga0209981_1017810 | |||
| 1273 | Ga0210000_1007602 | |||
| 1274 | Ga0209968_1005587 | |||
| 1275 | Ga0209999_1007649 | |||
| 1276 | Ga0209282_1000034 | |||
| 1277 | Ga0209971_1038064 | |||
| 1278 | Ga0209998_10079843 | |||
| 1279 | Ga0207428_10004302 | |||
| 1280 | Ga0207428_10170429 | |||
| 1281 | Ga0207428_10221607 | |||
| 1282 | Ga0268265_10004002 | |||
| 1283 | Ga0268265_10034846 | |||
| 1284 | Ga0268264_10015338 | |||
| 1285 | Ga0268264_10794170 | |||
| 1286 | Ga0307515_10000945 | |||
| 1287 | Ga0307408_100160940 | |||
| 1288 | Ga0307408_100347367 | |||
| 1289 | Ga0316579_10002021 | |||
| 1290 | Ga0316578_10029888 | |||
| 1291 | Ga0307405_10664978 | |||
| 1292 | Ga0307412_10405676 | |||
| 1293 | Ga0315914_1000010 | |||
| 1294 | Ga0307409_100167378 | |||
| 1295 | Ga0307409_100752514 | |||
| 1296 | Ga0307416_100093272 | |||
| 1297 | Ga0307416_100397069 | |||
| 1298 | Ga0307411_10498057 | |||
| 1299 | Ga0307411_10764858 | |||
| 1300 | Ga0307411_11853126 | |||
| 1301 | Ga0316583_10004918 | |||
| 1302 | Ga0316583_10007067 | |||
| 1303 | Ga0315913_1000005 | |||
| 1304 | Ga0315915_1000012 | |||
| 1305 | Ga0373958_0082813 | |||
| 1306 | Ga0373959_0014773 | |||
| 1307 | Ga0373959_0070637 | |||
| 1308 | Ga0373938_0057225 | |||
| 1309 | Ga0373926_0000860 | |||
| 1310 | Ga0373928_0021740 | |||
| 1311 | Ga0373929_0033902 | |||
| 1312 | Ga0373940_0149405 | |||
| 1313 | Ga0373944_0003250 | |||
| 1314 | Ga0373949_0008285 | |||
| 1315 | Ga0373951_0075804 | |||
| 1316 | Ga0373923_0173607 | |||
| 1317 | Ga0373932_0021715 | |||
| 1318 | Ga0373936_0015541 | |||
| 1319 | Ga0373939_0175761 | |||
| 1320 | Ga0373945_0100842 | |||
| 1321 | Ga0373953_0066757 | |||
| 1322 | Ga0373956_0031880 | |||
| 1323 | Ga0373956_0138156 | |||
| 1324 | Ga0373943_0014896 | |||
| 1325 | Ga0373946_0027606 | |||
| 1326 | Ga0373961_0043149 | |||
| 1327 | Ga0373924_0090529 | |||
| 1328 | Ga0373924_0140078 | |||
| 1329 | Ga0373931_0021431 | |||
| 1330 | Ga0373931_0159308 | |||
| 1331 | Ga0373931_0173253 | |||
| 1332 | Ga0373931_0783976 | |||
| 1333 | Ga0373935_0003949 | |||
| 1334 | Ga0373927_0009382 | |||
| 1335 | Ga0373927_0095449 | |||
| 1336 | Ga0373947_0009088 | |||
| 1337 | Ga0373937_0012385 | |||
| 1338 | Ga0373937_0193022 | |||
| 1339 | Ga0316582_0044224 | |||
| 1340 | Ga0395900_0398199 | |||
| 1341 | Ga0436365_1397623 | |||
| 1342 | Ga0436360_0549273 | |||
| 1343 | Ga0436362_0387917 | |||
| 1344 | Ga0439453_0012544 | |||
| 1345 | Ga0439461_0008132 | |||
| 1346 | Ga0451845_0782002 | |||
| 1347 | Ga0439441_000556 | |||
| 1348 | Ga0439432_056806 | |||
| 1349 | Ga0439449_0051120 | |||
| 1350 | Ga0439462_0003827 | |||
| 1351 | Ga0439462_0223826 | |||
| 1352 | Ga0439446_0012744 | |||
| 1353 | Ga0439435_0002663 | |||
| 1354 | Ga0439460_0005924 | |||
| 1355 | Ga0450893_0017625 | |||
| 1356 | Ga0451577_0029192 | |||
| 1357 | Ga0451577_1427551 | |||
| 1358 | Ga0466966_0042939 | |||
| 1359 | Ga0466966_0195470 | |||
| 1360 | Ga0466964_0347144 | |||
| 1361 | Ga0466959_0172851 | |||
| 1362 | Ga0451576_0005592 | |||
| 1363 | Ga0451576_0023317 | |||
| 1364 | Ga0451576_0044258 | |||
| 1365 | Ga0451576_0444608 | |||
| 1366 | Ga0451576_0961944 | |||
| 1367 | Ga0466958_0417679 | |||
| 1368 | Ga0466967_0043252 | |||
| 1369 | Ga0495592_0056995 | |||
| 1370 | Ga0495603_0014327 | |||
| 1371 | Ga0495590_0198529 | |||
| 1372 | Ga0495651_0087495 | |||
| 1373 | Ga0495580_0010043 | |||
| 1374 | Ga0495582_0070394 | |||
| 1375 | Ga0495639_0011028 | |||
| 1376 | Ga0495607_0000252 | |||
| 1377 | Ga0495610_0002342 | |||
| 1378 | Ga0495628_0050060 | |||
| 1379 | Ga0495630_0070696 | |||
| 1380 | Ga0495644_0123118 | |||
| 1381 | Ga0495666_0024995 | |||
| 1382 | Ga0495586_0018472 | |||
| 1383 | Ga0495587_0019410 | |||
| 1384 | Ga0495621_0328780 | |||
| 1385 | Ga0495645_0021953 | |||
| 1386 | Ga0495645_0645820 | |||
| 1387 | Ga0495667_0095135 | |||
| 1388 | Ga0495667_0148633 | |||
| 1389 | Ga0495656_0027754 | |||
| 1390 | Ga0495668_0505675 | |||
| 1391 | Ga0495634_0004662 | |||
| 1392 | Ga0495588_0026638 | |||
| 1393 | Ga0495599_0025674 | |||
| 1394 | Ga0495623_0026028 | |||
| 1395 | Ga0495647_0009745 | |||
| 1396 | Ga0495658_0011063 | |||
| 1397 | Ga0495600_0047585 | |||
| 1398 | Ga0495581_0202956 | |||
| 1399 | Ga0495636_0034583 | |||
| 1400 | Ga0495674_0316150 | |||
| 1401 | Ga0495676_0052952 | |||
| 1402 | Ga0495680_0535178 | |||
| 1403 | Ga0495675_0481843 | |||
| 1404 | Ga0495602_0276733 | |||
| 1405 | Ga0495602_0375412 | |||
| 1406 | Ga0496106_0000050 | |||
| 1407 | Ga0501031_0493777 | |||
| 1408 | Ga0501031_0509811 | |||
| 1409 | Ga0501033_0143727 | |||
| 1410 | Ga0501033_0195046 | |||
| 1411 | Ga0501036_0001519 | |||
| 1412 | Ga0501036_0081257 | |||
| 1413 | Ga0501036_0646894 | |||
| 1414 | Ga0501036_0718779 | |||
| 1415 | Ga0501037_0093288 | |||
| 1416 | Ga0501037_0277826 | |||
| 1417 | Ga0501038_0001082 | |||
| 1418 | Ga0501039_0000168 | |||
| 1419 | Ga0501039_0096719 | |||
| 1420 | Ga0501040_0001149 | |||
| 1421 | Ga0501040_0015585 | |||
| 1422 | Ga0501040_0196526 | |||
| 1423 | Ga0501040_0205722 | |||
| 1424 | Ga0501041_0000623 | |||
| 1425 | Ga0501041_0136412 | |||
| 1426 | Ga0501042_0010653 | |||
| 1427 | Ga0501042_0046342 | |||
| 1428 | Ga0501042_0080229 | |||
| 1429 | Ga0501042_0409191 | |||
| 1430 | Ga0501043_0137507 | |||
| 1431 | Ga0501046_0000480 | |||
| 1432 | Ga0501046_0241570 | |||
| 1433 | Ga0501048_0000896 | |||
| 1434 | Ga0501048_0618750 | |||
| 1435 | Ga0501067_0029549 | |||
| 1436 | Ga0501068_0024852 | |||
| 1437 | Ga0501071_0134164 | |||
| 1438 | Ga0501071_0944765 | |||
| 1439 | Ga0501072_0060341 | |||
| 1440 | Ga0501072_0119918 | |||
| 1441 | Ga0501074_0130568 | |||
| 1442 | Ga0501074_0834396 | |||
| 1443 | Ga0501075_0000046 | |||
| 1444 | Ga0501075_0066463 | |||
| 1445 | Ga0501076_0000566 | |||
| 1446 | Ga0501077_0004244 | |||
| 1447 | Ga0501077_0104385 | |||
| 1448 | Ga0501079_0000808 | |||
| 1449 | Ga0501081_0001689 | |||
| 1450 | Ga0501035_0004374 | |||
| 1451 | Ga0501045_0000436 | |||
| 1452 | Ga0501045_0019929 | |||
| 1453 | nmdc:mga00v17_256636_c1 | |||
| 1454 | nmdc:mga05p37_1059_c1 | |||
| 1455 | nmdc:mga05p37_2687_c1 | |||
| 1456 | nmdc:mga05p37_454651_c1 | |||
| 1457 | nmdc:mga09592_417012_c1 | |||
| 1458 | nmdc:mga09592_438_c1 | |||
| 1459 | nmdc:mga09592_61_c1 | |||
| 1460 | nmdc:mga09592_622892_c1 | |||
| 1461 | nmdc:mga0qj67_112210_c1 | |||
| 1462 | nmdc:mga0qj67_574707_c1 | |||
| 1463 | nmdc:mga0qj67_795943_c1 | |||
| 1464 | nmdc:mga06r32_11848_c1 | |||
| 1465 | nmdc:mga06r32_332627_c1 | |||
| 1466 | nmdc:mga06r32_914978_c1 | |||
| 1467 | nmdc:mga08y16_334659_c1 | |||
| 1468 | nmdc:mga08y16_46313_c1 | |||
| 1469 | nmdc:mga08y16_48826_c1 | |||
| 1470 | nmdc:mga08y16_707660_c1 | |||
| 1471 | nmdc:mga08y16_7845_c1 | |||
| 1472 | nmdc:mga0n895_10713_c1 | |||
| 1473 | nmdc:mga0n895_11009_c1 | |||
| 1474 | nmdc:mga0n895_186096_c1 | |||
| 1475 | nmdc:mga0n895_218696_c1 | |||
| 1476 | nmdc:mga0n895_3867_c1 | |||
| 1477 | nmdc:mga0n895_968802_c1 | |||
| 1478 | nmdc:mga0rr50_123773_c1 | |||
| 1479 | nmdc:mga0rr50_16364_c1 | |||
| 1480 | nmdc:mga0rr50_319066_c1 | |||
| 1481 | nmdc:mga0rr50_386804_c1 | |||
| 1482 | nmdc:mga0rr50_569018_c1 | |||
| 1483 | nmdc:mga0rr50_90379_c1 | |||
| 1484 | nmdc:mga08x19_127739_c1 | |||
| 1485 | nmdc:mga08x19_200146_c1 | |||
| 1486 | nmdc:mga08x19_375_c1 | |||
| 1487 | nmdc:mga08x19_4952_c1 | |||
| 1488 | nmdc:mga08x19_591298_c1 | |||
| 1489 | nmdc:mga08x19_62866_c1 | |||
| 1490 | nmdc:mga0a205_1027619_c1 | |||
| 1491 | nmdc:mga0a205_1599_c1 | |||
| 1492 | nmdc:mga0a205_211694_c1 | |||
| 1493 | nmdc:mga0a205_57835_c1 | |||
| 1494 | nmdc:mga0a205_651264_c1 | |||
| 1495 | nmdc:mga0a205_742087_c1 | |||
| 1496 | nmdc:mga0a205_745504_c1 | |||
| 1497 | nmdc:mga0a205_76699_c1 | |||
| 1498 | Ga0495601_0010036 | |||
| 1499 | Ga0495595_0015779 | |||
| 1500 | Ga0495595_0182921 | |||
| 1501 | Ga0495619_0082090 | |||
| 1502 | Ga0500641_0016899 | |||
| 1503 | Ga0500658_0005736 | |||
| 1504 | Ga0500568_0001502 | |||
| 1505 | Ga0501084_0034303 | |||
| 1506 | Ga0501084_0934115 | |||
| 1507 | Ga0590071_042212 | |||
| 1508 | Ga0590075_026696 | |||
| 1509 | Ga0501082_0002802 | |||
| 1510 | Ga0466962_0117165 | |||
| 1511 | Ga0530510_0025258 | |||
| 1512 | Ga0530510_0303098 | |||
| 1513 | Ga0530510_0741910 | |||
| 1514 | 2509107478 | |||
| 1515 | 2509375813 | |||
| 1516 | 2510303345 | |||
| 1517 | 2511501838 | |||
| 1518 | 2512533276 | |||
| 1519 | 2513584697 | |||
| 1520 | 2513603939 | |||
| 1521 | 2513615407 | |||
| 1522 | 2513881195 | |||
| 1523 | 2513905664 | |||
| 1524 | 2513984377 | |||
| 1525 | 2514006164 | |||
| 1526 | 2515608701 | |||
| 1527 | 2516209632 | |||
| 1528 | 2516893133 | |||
| 1529 | 2517569889 | |||
| 1530 | 2524448896 | |||
| 1531 | 2551677973 | |||
| 1532 | 2551686754 | |||
| 1533 | 2551690979 | |||
| 1534 | 2551698954 | |||
| 1535 | 2551713829 | |||
| 1536 | 2551717857 | |||
| 1537 | 2551719337 | |||
| 1538 | 2551727830 | |||
| 1539 | 2551736530 | |||
| 1540 | 2551743891 | |||
| 1541 | 2558868082 | |||
| 1542 | 2585846773 | |||
| 1543 | 2657685865 | |||
| 1544 | 2692315908 | |||
| 1545 | 2753458826 | |||
| 1546 | 2792581857 | |||
| 1547 | 2792620097 | |||
| 1548 | 2792626484 | |||
| 1549 | 2792639414 | |||
| 1550 | 2802719163 | |||
| 1551 | 2802727394 | |||
| 1552 | 2802732176 | |||
| 1553 | 2802739106 | |||
| 1554 | 2802745006 | |||
| 1555 | 2802752281 | |||
| 1556 | 2804752312 | |||
| 1557 | 2838078940 | |||
| 1558 | 2847419027 | |||
| 1559 | 2848994059 | |||
| 1560 | 2850082075 | |||
| 1561 | 2855825934 | |||
| 1562 | 2855841284 | |||
| 1563 | 2855876702 | |||
| 1564 | 2857580398 | |||
| 1565 | 2858802262 | |||
| 1566 | 2896390806 | |||
| 1567 | 2913300911 | |||
| 1568 | 2915985531 | |||
| 1569 | 2915990346 | |||
| 1570 | 2915994855 | |||
| 1571 | 2916002763 | |||
| 1572 | 2916014479 | |||
| 1573 | 2916017363 | |||
| 1574 | 2916024018 | |||
| 1575 | 2916033220 | |||
| 1576 | 2916036720 | |||
| 1577 | 2916044288 | |||
| 1578 | 2916052226 | |||
| 1579 | 2916055545 | |||
| 1580 | 2916065285 | |||
| 1581 | 2916072084 | |||
| 1582 | 2916080920 | |||
| 1583 | 2920766149 | |||
| 1584 | 2921204855 | |||
| 1585 | 2921212602 | |||
| 1586 | 2921242346 | |||
| 1587 | 2921246571 | |||
| 1588 | 2921255175 | |||
| 1589 | 2921259603 | |||
| 1590 | 2921266966 | |||
| 1591 | 2921287354 | |||
| 1592 | 2921294138 | |||
| 1593 | 2921302602 | |||
| 1594 | 2924145997 | |||
| 1595 | 2924154545 | |||
| 1596 | 2924163062 | |||
| 1597 | 2924170308 | |||
| 1598 | 2924176344 | |||
| 1599 | 2924181399 | |||
| 1600 | 2924189846 | |||
| 1601 | 2924196544 | |||
| 1602 | 2924205828 | |||
| 1603 | 2924211221 | |||
| 1604 | 2924217378 | |||
| 1605 | 2924225027 | |||
| 1606 | 2924231441 | |||
| 1607 | 2936999585 | |||
| 1608 | 2937005985 | |||
| 1609 | 2937013275 | |||
| 1610 | 2937019340 | |||
| 1611 | 2937028915 | |||
| 1612 | 2937033651 | |||
| 1613 | 2937037151 | |||
| 1614 | 2937047512 | |||
| 1615 | 2937052468 | |||
| 1616 | 2937063616 | |||
| 1617 | 2937068092 | |||
| 1618 | 2937072992 | |||
| 1619 | 2937079318 | |||
| 1620 | 2937087871 | |||
| 1621 | 2937094088 | |||
| 1622 | 2937106237 | |||
| 1623 | 2937107998 | |||
| 1624 | 2937115222 | |||
| 1625 | 2937123351 | |||
| 1626 | 2937129112 | |||
| 1627 | 2957381476 | |||
| 1628 | 2957387511 | |||
| 1629 | 2957391795 | |||
| 1630 | 2957396630 | |||
| 1631 | 2957404883 | |||
| 1632 | 2957410920 | |||
| 1633 | 2957420142 | |||
| 1634 | 2957426249 | |||
| 1635 | 2957433926 | |||
| 1636 | 2957441132 | |||
| 1637 | 2957445705 | |||
| 1638 | 2957454639 | |||
| 1639 | 2957464006 | |||
| 1640 | 2957467828 | |||
| 1641 | 2957472447 | |||
| 1642 | 2957480715 | |||
| 1643 | 2957488539 | |||
| 1644 | 2957496654 | |||
| 1645 | 2957502659 | |||
| 1646 | 2957506827 | |||
| 1647 | 2960590096 | |||
| 1648 | 2960597316 | |||
| 1649 | 2960598263 | |||
| 1650 | 2960609660 | |||
| 1651 | 2960615174 | |||
| 1652 | 2960620883 | |||
| 1653 | 2960627587 | |||
| 1654 | 2960635920 | |||
| 1655 | 2960644681 | |||
| 1656 | 2960649029 | |||
| 1657 | 2960659241 | |||
| 1658 | 2960662178 | |||
| 1659 | 2960672717 | |||
| 1660 | 2960676456 | |||
| 1661 | 2960687268 | |||
| 1662 | 2960689918 | |||
| 1663 | 2960698407 | |||
| 1664 | 2964611738 | |||
| 1665 | 2964616928 | |||
| 1666 | 2964624616 | |||
| 1667 | 2964631106 | |||
| 1668 | 2964637556 | |||
| 1669 | 2964646449 | |||
| 1670 | 2964651670 | |||
| 1671 | 2964661622 | |||
| 1672 | 2964669891 | |||
| 1673 | 2964673903 | |||
| 1674 | 2964678476 | |||
| 1675 | 2964686878 | |||
| 1676 | 2964694396 | |||
| 1677 | 2964701579 | |||
| 1678 | 2964710989 | |||
| 1679 | 2964714168 | |||
| 1680 | 2964723453 | |||
| 1681 | 2967665128 | |||
| 1682 | 2967675530 | |||
| 1683 | 2967686167 | |||
| 1684 | 2967690101 | |||
| 1685 | 2967697464 | |||
| 1686 | 2967702835 | |||
| 1687 | 2967709051 | |||
| 1688 | 2967716822 | |||
| 1689 | 2967726371 | |||
| 1690 | 2967732734 | |||
| 1691 | 2967740057 | |||
| 1692 | 2967743298 | |||
| 1693 | 2967753747 | |||
| 1694 | 2967758692 | |||
| 1695 | 2967769276 | |||
| 1696 | 2967770917 | |||
| 1697 | 2967780318 | |||
| 1698 | 2970020397 | |||
| 1699 | 2970030842 | |||
| 1700 | 2970034448 | |||
| 1701 | 2970042539 | |||
| 1702 | 2970048930 | |||
| 1703 | 2970057098 | |||
| 1704 | 2970066184 | |||
| 1705 | 2970070859 | |||
| 1706 | 2970079274 | |||
| 1707 | 2970083688 | |||
| 1708 | 2970090454 | |||
| 1709 | 2970099190 | |||
| 1710 | 2970107442 | |||
| 1711 | 2970111642 | |||
| 1712 | 2970121938 | |||
| 1713 | 2970126719 | |||
| 1714 | 2970133426 | |||
| 1715 | 2970143235 | |||
| 1716 | 2970148090 | |||
| 1717 | 2970156379 | |||
| 1718 | 2970161623 | |||
| 1719 | 2970168176 | |||
| 1720 | 2970174712 | |||
| 1721 | 2970180538 | |||
| 1722 | 2970189331 | |||
| 1723 | 2970195806 | |||
| 1724 | 2977521416 | |||
| 1725 | 2977529295 | |||
| 1726 | 2977534801 | |||
| 1727 | 2977542572 | |||
| 1728 | 2977547763 | |||
| 1729 | 2977556381 | |||
| 1730 | 2977560941 | |||
| 1731 | 2977567910 | |||
| 1732 | 2977575179 | |||
| 1733 | 2977584246 | |||
| 1734 | 643825915 | |||
| 1735 | 648737502 | |||
| 1736 | 8003993789 | |||
| 1737 | 8049294869 | |||
| 1738 | 8054559902 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6b9d-assembly1.cif.gz_A | human atl1 mutant - r77a bound to gdp | 0.8713 | 2 | 28 |
| 5hci-assembly4.cif.gz_F-5 | gpn-loop gtpase npa3 in complex with gdp | 0.853 | 1 | 36 |
| 5hci-assembly2.cif.gz_B-3 | gpn-loop gtpase npa3 in complex with gdp | 0.8515 | 1 | 36 |
| 7oyd-assembly1.cif.gz_v | cryo-em structure of a rabbit 80s ribosome with zebrafish dap1b | 0.7968 | 2 | 24 |
| 1ii0-assembly2.cif.gz_B | crystal structure of the escherichia coli arsenite-translocating atpase | 0.79 | 2 | 36 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PEF9_556_791_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8742 | 1 | 34 | 3.40.50.300 |
| af_Q5BK22_89_283_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8474 | 1 | 24 | 3.40.50.300 |
| af_P47122_2_271_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8381 | 1 | 36 | 3.40.50.300 |
| af_Q07657_23_341_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8296 | 1 | 23 | 3.40.50.300 |
| af_A0A1D6I1M0_330_626_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8221 | 4 | 36 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A426FSQ4-F1-model_v4 | Molybdopterin-guanine dinucleotide biosynthesis protein B | 0.8025 | 2 | 163 |
GO:0005525
GO:0006777 |
| AF-A0A1F4F8S5-F1-model_v4 | Molybdopterin-guanine dinucleotide biosynthesis protein B | 0.7999 | 1 | 164 |
GO:0005525
GO:0006777 |
| AF-A0A238KQS4-F1-model_v4 | Molybdopterin molybdenumtransferase (EC 2.10.1.1) | 0.7964 | 1 | 164 |
GO:0005525
GO:0005829 GO:0006777 GO:0046872 GO:0061599 |
| AF-A0A1F3ZVX0-F1-model_v4 | Molybdopterin-guanine dinucleotide biosynthesis protein B | 0.7951 | 1 | 164 |
GO:0005525
GO:0006777 |
| AF-A0A0E9MI98-F1-model_v4 | Molybdopterin-guanine dinucleotide biosynthesis protein MobB | 0.7951 | 1 | 164 |
GO:0005525
GO:0006777 |