F484110

General Info

Members Datasets Scaffolds Average Seq Length
869 548 1738 168

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100676291|Ga0070689_1006762912
Length 201
Sequence MSRASGCRYRDKGCAQAAGRLNGARPLYNFRMKIIGIAGFSGSGKTTLVEKVIPLLVAEGLRVSLIKHAHHEFDVDQPGKDSYRHRHAGASEVLVSSSKRWALMHELRGAAEPTLEDQLKQLSPCDVVLVEGYKTAPIPKVEVHRRDNTTPLLYPEDEHVVAVATDEALDTTLPQLDIDDAPAVARFIIQHLGLNRARLVR

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
114 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
115 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
118 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
170 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
177 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
185 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
193 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
194 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
195 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
196 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
197 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
198 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
199 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
200 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
201 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
202 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
203 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
204 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
205 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
207 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
209 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
210 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
211 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
212 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
213 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
214 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
215 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
217 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
225 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
226 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
227 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
228 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
229 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
230 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
231 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
232 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
233 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
234 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
235 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
236 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
237 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
238 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
239 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
240 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
241 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
242 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
249 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
250 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
251 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
252 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
253 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
254 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
255 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
256 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
257 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
258 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
259 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
260 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
261 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
262 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
263 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
264 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
265 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
266 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
267 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
268 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
271 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
272 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
273 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
274 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
275 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
276 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
277 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
292 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
293 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
294 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
295 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
296 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
297 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
298 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
299 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
300 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
303 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
304 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
305 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
306 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
307 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
308 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
309 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
310 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
311 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
312 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
313 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
314 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
315 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
316 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
317 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
318 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
320 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
321 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
322 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
323 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
324 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
325 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
326 2509276019 Ensifer aridi TW10 Isolate Nodule
327 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
328 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
329 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
330 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
331 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
332 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
333 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
334 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
335 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
336 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
337 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
338 2516143018 Ensifer sp. BR816 Isolate Nodule
339 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
340 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
341 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
342 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
343 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
344 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
345 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
346 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
347 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
348 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
349 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
350 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
351 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
352 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
353 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
354 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
355 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
356 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
357 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
358 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
359 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
360 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
361 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
362 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
363 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
364 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
365 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
366 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
367 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
368 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
369 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
370 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
371 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
372 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
373 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
374 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
375 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
376 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
377 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
378 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
379 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
380 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
381 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
382 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
383 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
384 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
385 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
386 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
387 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
388 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
389 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
390 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
391 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
392 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
393 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
394 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
395 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
396 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
397 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
398 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
399 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
400 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
401 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
402 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
403 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
404 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
405 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
406 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
407 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
408 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
409 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
410 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
411 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
412 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
413 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
414 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
415 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
416 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
417 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
418 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
419 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
420 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
421 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
422 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
423 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
424 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
425 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
426 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
427 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
428 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
429 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
430 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
431 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
432 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
433 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
434 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
435 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
436 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
437 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
438 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
439 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
440 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
441 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
442 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
443 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
444 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
445 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
446 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
447 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
448 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
449 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
450 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
451 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
452 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
453 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
454 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
455 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
456 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
457 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
458 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
459 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
460 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
461 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
462 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
463 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
464 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
465 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
466 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
467 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
468 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
469 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
470 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
471 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
472 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
473 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
474 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
475 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
476 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
477 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
478 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
479 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
480 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
481 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
482 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
483 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
484 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
485 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
486 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
487 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
488 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
489 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
490 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
491 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
492 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
493 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
494 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
495 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
496 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
497 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
498 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
499 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
500 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
501 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
502 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
503 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
504 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
505 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
506 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
507 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
508 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
509 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
510 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
511 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
512 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
513 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
514 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
515 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
516 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
517 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
518 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
519 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
520 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
521 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
522 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
523 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
524 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
525 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
526 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
527 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
528 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
529 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
530 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
531 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
532 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
533 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
534 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
535 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
536 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
537 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
538 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
539 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
540 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
541 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
542 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
543 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
544 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
545 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
546 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
547 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
548 8054558443 Rhizobium alarense TRM95111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.11
Metatranscriptomes 0
Isolates 25.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 25.89
Rhizoplane 0.12
Rhizosphere 71.46
Stem 0
Stem Tuber 0
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100676291 3300005340 Bacteria 900
2 JGI24742J22300_10070681 3300002244 Bacteria 650
3 Ga0065712_10122077 3300005290 Bacteria 1656
4 Ga0065707_10538935 3300005295 Bacteria 729
5 Ga0070658_10010004 3300005327 Bacteria 7618
6 Ga0070658_10075444 3300005327 Bacteria 2766
7 Ga0070658_11377934 3300005327 Bacteria 612
8 Ga0070676_10794085 3300005328 Bacteria 698
9 Ga0070683_100135633 3300005329 Bacteria 2330
10 Ga0070690_100000148 3300005330 Bacteria 35769
11 Ga0070690_100071630 3300005330 Bacteria 2252
12 Ga0070670_100480948 3300005331 Bacteria 1103
13 Ga0070670_100704208 3300005331 Bacteria 908
14 Ga0070677_10527158 3300005333 Bacteria 644
15 Ga0068869_100000103 3300005334 Bacteria 39927
16 Ga0068869_100063869 3300005334 Bacteria 2707
17 Ga0070680_100000882 3300005336 Bacteria 21272
18 Ga0070682_100008721 3300005337 Bacteria 5719
19 Ga0070682_100931071 3300005337 Bacteria 716
20 Ga0068868_100001076 3300005338 Bacteria 18727
21 Ga0068868_100270401 3300005338 Bacteria 1436
22 Ga0068868_100413471 3300005338 Bacteria 1166
23 Ga0070660_100428494 3300005339 Bacteria 1096
24 Ga0070689_100002361 3300005340 Bacteria 12297
25 Ga0070689_100108737 3300005340 Bacteria 2203
26 Ga0070689_100160901 3300005340 Bacteria 1815
27 Ga0070689_100170739 3300005340 Bacteria 1762
28 Ga0070691_10003035 3300005341 Bacteria 7519
29 Ga0070691_10160365 3300005341 Bacteria 1159
30 Ga0070691_10442088 3300005341 Bacteria 741
31 Ga0070687_100000105 3300005343 Bacteria 28128
32 Ga0070687_100024661 3300005343 Bacteria 2875
33 Ga0070687_100126534 3300005343 Bacteria 1469
34 Ga0070692_10005261 3300005345 Bacteria 5494
35 Ga0070692_10028792 3300005345 Bacteria 2764
36 Ga0070668_100009368 3300005347 Bacteria 7263
37 Ga0070668_100016417 3300005347 Bacteria 5536
38 Ga0070669_100002037 3300005353 Bacteria 14620
39 Ga0070669_100405369 3300005353 Bacteria 1116
40 Ga0070675_100036014 3300005354 Bacteria 4025
41 Ga0070671_100264110 3300005355 Bacteria 1463
42 Ga0070671_100435214 3300005355 Bacteria 1124
43 Ga0070674_100056367 3300005356 Bacteria 2725
44 Ga0070674_100059160 3300005356 Bacteria 2667
45 Ga0070673_100273397 3300005364 Bacteria 1479
46 Ga0070673_100352279 3300005364 Bacteria 1307
47 Ga0070673_100532402 3300005364 Bacteria 1066
48 Ga0070688_100052888 3300005365 Bacteria 2539
49 Ga0070688_100171705 3300005365 Bacteria 1497
50 Ga0070659_100264025 3300005366 Bacteria 1429
51 Ga0070703_10362501 3300005406 Bacteria 622
52 Ga0070714_100198431 3300005435 Bacteria 1835
53 Ga0070714_100384122 3300005435 Bacteria 1324
54 Ga0070714_100412585 3300005435 Bacteria 1278
55 Ga0070713_100403414 3300005436 Bacteria 1277
56 Ga0070713_101182719 3300005436 Bacteria 740
57 Ga0070710_10689498 3300005437 Bacteria 720
58 Ga0070701_10182682 3300005438 Bacteria 1229
59 Ga0070701_10204055 3300005438 Bacteria 1170
60 Ga0070701_10656736 3300005438 Bacteria 701
61 Ga0070705_100001061 3300005440 Bacteria 15312
62 Ga0070705_100005767 3300005440 Bacteria 6052
63 Ga0070705_100075917 3300005440 Bacteria 2048
64 Ga0070705_100133086 3300005440 Bacteria 1625
65 Ga0070705_100212680 3300005440 Bacteria 1334
66 Ga0070705_100368473 3300005440 Bacteria 1053
67 Ga0070700_100001887 3300005441 Bacteria 10592
68 Ga0070700_100009399 3300005441 Bacteria 5364
69 Ga0070694_100000110 3300005444 Bacteria 39928
70 Ga0070694_100002797 3300005444 Bacteria 10358
71 Ga0070694_100013506 3300005444 Bacteria 5100
72 Ga0070694_100365442 3300005444 Bacteria 1122
73 Ga0070694_100583412 3300005444 Bacteria 899
74 Ga0070708_100207175 3300005445 Bacteria 1837
75 Ga0070708_100614047 3300005445 Bacteria 1025
76 Ga0070662_100164412 3300005457 Bacteria 1738
77 Ga0070662_101016463 3300005457 Bacteria 710
78 Ga0070681_10118573 3300005458 Bacteria 2583
79 Ga0070681_10211062 3300005458 Bacteria 1858
80 Ga0070681_10301517 3300005458 Bacteria 1512
81 Ga0070681_11321818 3300005458 Bacteria 644
82 Ga0068867_100000441 3300005459 Bacteria 27580
83 Ga0068867_100001737 3300005459 Bacteria 15180
84 Ga0068867_100305924 3300005459 Bacteria 1312
85 Ga0070706_100830358 3300005467 Bacteria 855
86 Ga0070707_100443939 3300005468 Bacteria 1258
87 Ga0070698_100193154 3300005471 Bacteria 1973
88 Ga0070698_100701983 3300005471 Bacteria 954
89 Ga0070699_100046681 3300005518 Bacteria 3748
90 Ga0070699_100154507 3300005518 Bacteria 2030
91 Ga0070699_100379676 3300005518 Bacteria 1276
92 Ga0070679_100057268 3300005530 Bacteria 3885
93 Ga0070684_100020331 3300005535 Bacteria 5508
94 Ga0070684_100478817 3300005535 Bacteria 1152
95 Ga0070684_101019853 3300005535 Bacteria 777
96 Ga0070697_100203191 3300005536 Bacteria 1684
97 Ga0070697_100223627 3300005536 Bacteria 1604
98 Ga0070697_100476188 3300005536 Bacteria 1090
99 Ga0070697_100480525 3300005536 Bacteria 1085
100 Ga0068853_100064747 3300005539 Bacteria 3171
101 Ga0070672_100130429 3300005543 Bacteria 2065
102 Ga0070672_100149330 3300005543 Bacteria 1932
103 Ga0070686_100000563 3300005544 Bacteria 22161
104 Ga0070686_100054520 3300005544 Bacteria 2557
105 Ga0070695_100000512 3300005545 Bacteria 20355
106 Ga0070695_100064882 3300005545 Bacteria 2376
107 Ga0070695_100189216 3300005545 Bacteria 1463
108 Ga0070695_100206318 3300005545 Bacteria 1408
109 Ga0070695_100228624 3300005545 Bacteria 1344
110 Ga0070696_100009252 3300005546 Bacteria 6596
111 Ga0070696_100015140 3300005546 Bacteria 5179
112 Ga0070696_100040726 3300005546 Bacteria 3208
113 Ga0070696_100076603 3300005546 Bacteria 2362
114 Ga0070696_100083654 3300005546 Bacteria 2264
115 Ga0070696_100288699 3300005546 Bacteria 1252
116 Ga0070693_100000101 3300005547 Bacteria 37995
117 Ga0070693_100014688 3300005547 Bacteria 4019
118 Ga0070665_100563839 3300005548 Bacteria 1151
119 Ga0070704_100000220 3300005549 Bacteria 24002
120 Ga0070704_100001535 3300005549 Bacteria 12465
121 Ga0070704_100012096 3300005549 Bacteria 5322
122 Ga0070704_100017031 3300005549 Bacteria 4609
123 Ga0070704_100104157 3300005549 Bacteria 2145
124 Ga0070704_100660563 3300005549 Bacteria 924
125 Ga0068855_100001986 3300005563 Bacteria 25406
126 Ga0068855_100010909 3300005563 Bacteria 10969
127 Ga0068855_100030675 3300005563 Bacteria 6427
128 Ga0068855_100169283 3300005563 Bacteria 2475
129 Ga0068857_100495085 3300005577 Bacteria 1146
130 Ga0068857_100526291 3300005577 Bacteria 1112
131 Ga0068857_101310592 3300005577 Bacteria 703
132 Ga0068854_100005853 3300005578 Bacteria 7787
133 Ga0068854_100812516 3300005578 Bacteria 816
134 Ga0068856_100009739 3300005614 Bacteria 9335
135 Ga0068856_100037843 3300005614 Bacteria 4734
136 Ga0068856_100251353 3300005614 Bacteria 1783
137 Ga0070702_100000096 3300005615 Bacteria 26117
138 Ga0070702_100375112 3300005615 Bacteria 1010
139 Ga0068852_100001888 3300005616 Bacteria 14274
140 Ga0068852_100205376 3300005616 Bacteria 1866
141 Ga0068852_100250388 3300005616 Bacteria 1697
142 Ga0068859_100004200 3300005617 Bacteria 14703
143 Ga0068859_100179362 3300005617 Bacteria 2201
144 Ga0068859_100599324 3300005617 Bacteria 1195
145 Ga0068864_100541723 3300005618 Bacteria 1124
146 Ga0068866_10000893 3300005718 Bacteria 13164
147 Ga0068866_10227104 3300005718 Bacteria 1130
148 Ga0068861_100000826 3300005719 Bacteria 18701
149 Ga0068861_100003187 3300005719 Bacteria 10851
150 Ga0068851_10093381 3300005834 Bacteria 1587
151 Ga0068870_10058985 3300005840 Bacteria 2056
152 Ga0068863_100904215 3300005841 Bacteria 883
153 Ga0068863_101264015 3300005841 Bacteria 745
154 Ga0068858_100002013 3300005842 Bacteria 20783
155 Ga0068858_100007196 3300005842 Bacteria 10790
156 Ga0068860_100001309 3300005843 Bacteria 27054
157 Ga0068862_100001947 3300005844 Bacteria 18715
158 Ga0068862_100006062 3300005844 Bacteria 10066
159 Ga0068862_100569450 3300005844 Bacteria 1084
160 Ga0081539_10001473 3300005985 Bacteria 39944
161 Ga0075364_10255516 3300006051 Bacteria 1191
162 Ga0070715_10019529 3300006163 Bacteria 2601
163 Ga0070715_10052773 3300006163 Bacteria 1755
164 Ga0070712_100396333 3300006175 Bacteria 1139
165 Ga0070712_100642458 3300006175 Bacteria 901
166 Ga0097621_100000106 3300006237 Bacteria 47435
167 Ga0097621_100006960 3300006237 Bacteria 8053
168 Ga0097621_100012268 3300006237 Bacteria 6341
169 Ga0097621_100050892 3300006237 Bacteria 3369
170 Ga0097621_100287557 3300006237 Bacteria 1448
171 Ga0068871_100002446 3300006358 Bacteria 12683
172 Ga0068871_100008532 3300006358 Bacteria 7365
173 Ga0068871_100017675 3300006358 Bacteria 5401
174 Ga0068871_100182020 3300006358 Bacteria 1806
175 Ga0068871_101188804 3300006358 Bacteria 715
176 Ga0075428_100000134 3300006844 Bacteria 65107
177 Ga0075428_100047461 3300006844 Bacteria 4717
178 Ga0075430_100060701 3300006846 Bacteria 3177
179 Ga0075431_100014959 3300006847 Bacteria 7854
180 Ga0075431_100209478 3300006847 Bacteria 1992
181 Ga0075433_10001519 3300006852 Bacteria 17149
182 Ga0075433_10056858 3300006852 Bacteria 3419
183 Ga0075433_10140793 3300006852 Bacteria 2144
184 Ga0075433_10363736 3300006852 Bacteria 1278
185 Ga0075433_10398836 3300006852 Bacteria 1214
186 Ga0075433_10594228 3300006852 Bacteria 972
187 Ga0075433_10692785 3300006852 Bacteria 893
188 Ga0075433_10808494 3300006852 Bacteria 819
189 Ga0075433_10911110 3300006852 Bacteria 767
190 Ga0075434_100000699 3300006871 Bacteria 26231
191 Ga0075434_100000813 3300006871 Bacteria 24754
192 Ga0075434_100134764 3300006871 Bacteria 2489
193 Ga0075434_100348944 3300006871 Bacteria 1501
194 Ga0075429_100000271 3300006880 Bacteria 36263
195 Ga0075429_100000975 3300006880 Bacteria 22709
196 Ga0068865_100000231 3300006881 Bacteria 31031
197 Ga0068865_100057228 3300006881 Bacteria 2719
198 Ga0068865_100717876 3300006881 Bacteria 856
199 Ga0068865_100775400 3300006881 Bacteria 825
200 Ga0068865_100950084 3300006881 Bacteria 750
201 Ga0075436_100002436 3300006914 Bacteria 12815
202 Ga0075436_100004776 3300006914 Bacteria 9305
203 Ga0075436_100006862 3300006914 Bacteria 7787
204 Ga0075436_100012375 3300006914 Bacteria 5849
205 Ga0075436_100016124 3300006914 Bacteria 5115
206 Ga0075436_100076041 3300006914 Bacteria 2325
207 Ga0075436_100291279 3300006914 Bacteria 1169
208 Ga0097620_100004200 3300006931 Bacteria 14703
209 Ga0097620_100179358 3300006931 Bacteria 2201
210 Ga0097620_100599261 3300006931 Bacteria 1195
211 Ga0079104_1007232 3300006946 Bacteria 4062
212 Ga0079104_1008431 3300006946 Bacteria 3605
213 Ga0075435_100002136 3300007076 Bacteria 13025
214 Ga0075435_100035972 3300007076 Bacteria 3932
215 Ga0075435_100083482 3300007076 Bacteria 2627
216 Ga0075435_100134671 3300007076 Bacteria 2069
217 Ga0075435_100672997 3300007076 Bacteria 899
218 Ga0099794_10201826 3300007265 Bacteria 1018
219 Ga0105240_10002895 3300009093 Bacteria 27079
220 Ga0105240_10061715 3300009093 Bacteria 4670
221 Ga0105240_10071509 3300009093 Bacteria 4290
222 Ga0105240_10161885 3300009093 Bacteria 2657
223 Ga0111539_10008776 3300009094 Bacteria 12816
224 Ga0111539_10305362 3300009094 Bacteria 1852
225 Ga0105245_10000347 3300009098 Bacteria 43236
226 Ga0105245_10042334 3300009098 Bacteria 4063
227 Ga0105245_10489525 3300009098 Bacteria 1244
228 Ga0114129_10005561 3300009147 Bacteria 17827
229 Ga0114129_10474621 3300009147 Bacteria 1637
230 Ga0105243_10000535 3300009148 Bacteria 38636
231 Ga0105243_10004257 3300009148 Bacteria 11335
232 Ga0105243_11054664 3300009148 Bacteria 819
233 Ga0105241_10010941 3300009174 Bacteria 6654
234 Ga0105241_10265525 3300009174 Bacteria 1460
235 Ga0105241_11244082 3300009174 Bacteria 707
236 Ga0105242_10000905 3300009176 Bacteria 23036
237 Ga0105242_10001512 3300009176 Bacteria 18280
238 Ga0105242_10002624 3300009176 Bacteria 14100
239 Ga0105242_10013578 3300009176 Bacteria 6301
240 Ga0105242_10017281 3300009176 Bacteria 5618
241 Ga0105242_10136475 3300009176 Bacteria 2124
242 Ga0105242_10777000 3300009176 Bacteria 946
243 Ga0105242_11123883 3300009176 Bacteria 801
244 Ga0105248_10020172 3300009177 Bacteria 7384
245 Ga0105248_10159204 3300009177 Bacteria 2547
246 Ga0105248_10633277 3300009177 Bacteria 1207
247 Ga0105248_10975333 3300009177 Bacteria 957
248 Ga0105238_10020415 3300009551 Bacteria 6744
249 Ga0105238_10140266 3300009551 Bacteria 2394
250 Ga0105249_10005947 3300009553 Bacteria 10571
251 Ga0105249_10032433 3300009553 Bacteria 4726
252 Ga0105249_10124436 3300009553 Bacteria 2454
253 Ga0105249_12034013 3300009553 Bacteria 647
254 Ga0105239_10110995 3300010375 Bacteria 3040
255 Ga0105246_10394906 3300011119 Bacteria 1147
256 Ga0157370_10001416 3300013104 Bacteria 29771
257 Ga0157370_10147777 3300013104 Bacteria 2188
258 Ga0157370_10207967 3300013104 Bacteria 1814
259 Ga0157369_10047888 3300013105 Bacteria 4640
260 Ga0157369_10223677 3300013105 Bacteria 1969
261 Ga0157374_10087241 3300013296 Bacteria 2970
262 Ga0157374_11017934 3300013296 Bacteria 848
263 Ga0157378_10000447 3300013297 Bacteria 39662
264 Ga0157378_10072444 3300013297 Bacteria 3096
265 Ga0157378_10884520 3300013297 Bacteria 923
266 Ga0163162_10085969 3300013306 Bacteria 3222
267 Ga0163162_10169220 3300013306 Bacteria 2309
268 Ga0163162_10658305 3300013306 Bacteria 1171
269 Ga0163162_10936126 3300013306 Bacteria 978
270 Ga0157372_10011227 3300013307 Bacteria 9528
271 Ga0157372_10016533 3300013307 Bacteria 7917
272 Ga0157375_10390359 3300013308 Bacteria 1559
273 Ga0157375_10474713 3300013308 Bacteria 1416
274 Ga0163163_11692111 3300014325 Bacteria 693
275 Ga0157380_10012418 3300014326 Bacteria 6180
276 Ga0157380_10157007 3300014326 Bacteria 1973
277 Ga0157380_10215074 3300014326 Bacteria 1716
278 Ga0157380_10936208 3300014326 Bacteria 895
279 Ga0157377_10126523 3300014745 Bacteria 1555
280 Ga0157379_10035647 3300014968 Bacteria 4436
281 Ga0157379_10380073 3300014968 Bacteria 1296
282 Ga0157376_10002088 3300014969 Bacteria 13437
283 Ga0163161_11204082 3300017792 Unclassified 655
284 Ga0214544_1000158 3300021320 Bacteria 101943
285 Ga0214542_1001567 3300021321 Bacteria 47020
286 Ga0214543_1000011 3300021327 Bacteria 344093
287 Ga0214543_1000234 3300021327 Bacteria 84243
288 Ga0213876_10203956 3300021384 Bacteria 1051
289 Ga0228711_1000007 3300022739 Bacteria 202413
290 Ga0228710_1000007 3300022740 Bacteria 189104
291 Ga0207653_10010388 3300025885 Bacteria 2903
292 Ga0207692_10033185 3300025898 Bacteria 2488
293 Ga0207642_10018538 3300025899 Bacteria 2674
294 Ga0207642_10555749 3300025899 Bacteria 709
295 Ga0207688_10009633 3300025901 Bacteria 5261
296 Ga0207685_10016491 3300025905 Bacteria 2366
297 Ga0207685_10168466 3300025905 Bacteria 1006
298 Ga0207699_10458149 3300025906 Bacteria 916
299 Ga0207645_10653619 3300025907 Bacteria 714
300 Ga0207643_10034065 3300025908 Bacteria 2852
301 Ga0207705_10055223 3300025909 Bacteria 2863
302 Ga0207705_10067749 3300025909 Bacteria 2584
303 Ga0207684_10733100 3300025910 Bacteria 838
304 Ga0207654_10425853 3300025911 Bacteria 927
305 Ga0207695_10003454 3300025913 Bacteria 22268
306 Ga0207695_10148941 3300025913 Bacteria 2281
307 Ga0207660_10065878 3300025917 Bacteria 2619
308 Ga0207660_11153753 3300025917 Bacteria 631
309 Ga0207662_10000109 3300025918 Bacteria 39758
310 Ga0207662_10051386 3300025918 Bacteria 2452
311 Ga0207652_10030375 3300025921 Bacteria 4525
312 Ga0207646_10301703 3300025922 Bacteria 1447
313 Ga0207646_10368302 3300025922 Bacteria 1298
314 Ga0207681_10005710 3300025923 Bacteria 7636
315 Ga0207694_10146947 3300025924 Bacteria 1898
316 Ga0207650_10690226 3300025925 Bacteria 862
317 Ga0207659_10027967 3300025926 Bacteria 3825
318 Ga0207659_10290999 3300025926 Bacteria 1338
319 Ga0207687_10010136 3300025927 Bacteria 6162
320 Ga0207687_10073432 3300025927 Bacteria 2449
321 Ga0207687_10172205 3300025927 Bacteria 1671
322 Ga0207687_10449317 3300025927 Bacteria 1069
323 Ga0207664_10592560 3300025929 Bacteria 995
324 Ga0207690_10082586 3300025932 Bacteria 2248
325 Ga0207706_10088982 3300025933 Bacteria 2714
326 Ga0207706_10131628 3300025933 Bacteria 2200
327 Ga0207686_10001982 3300025934 Bacteria 11281
328 Ga0207686_10018157 3300025934 Bacteria 3977
329 Ga0207686_10086270 3300025934 Bacteria 2061
330 Ga0207686_10100601 3300025934 Bacteria 1929
331 Ga0207686_10190999 3300025934 Bacteria 1460
332 Ga0207686_10628660 3300025934 Bacteria 847
333 Ga0207709_10002130 3300025935 Bacteria 12715
334 Ga0207709_10003201 3300025935 Bacteria 9840
335 Ga0207709_10313750 3300025935 Bacteria 1171
336 Ga0207670_10009930 3300025936 Bacteria 5455
337 Ga0207670_10121748 3300025936 Bacteria 1898
338 Ga0207670_10222450 3300025936 Bacteria 1446
339 Ga0207670_10426811 3300025936 Bacteria 1065
340 Ga0207670_10452459 3300025936 Bacteria 1035
341 Ga0207670_10573986 3300025936 Bacteria 924
342 Ga0207669_10017503 3300025937 Bacteria 3679
343 Ga0207669_10036799 3300025937 Bacteria 2801
344 Ga0207704_10008864 3300025938 Bacteria 4831
345 Ga0207704_10023598 3300025938 Bacteria 3318
346 Ga0207704_10821733 3300025938 Bacteria 777
347 Ga0207704_10872868 3300025938 Bacteria 755
348 Ga0207665_10882135 3300025939 Bacteria 709
349 Ga0207691_10057987 3300025940 Bacteria 3522
350 Ga0207691_10336608 3300025940 Bacteria 1292
351 Ga0207711_10067898 3300025941 Bacteria 3087
352 Ga0207711_10693143 3300025941 Bacteria 950
353 Ga0207689_10000532 3300025942 Bacteria 36122
354 Ga0207689_10044044 3300025942 Bacteria 3689
355 Ga0207661_10093302 3300025944 Bacteria 2512
356 Ga0207667_10026319 3300025949 Bacteria 6358
357 Ga0207667_10091486 3300025949 Bacteria 3143
358 Ga0207667_10296342 3300025949 Bacteria 1652
359 Ga0207667_10370534 3300025949 Bacteria 1459
360 Ga0207667_10709918 3300025949 Bacteria 1007
361 Ga0207712_10003243 3300025961 Bacteria 10338
362 Ga0207712_10065714 3300025961 Bacteria 2590
363 Ga0207712_10188043 3300025961 Bacteria 1628
364 Ga0207712_11481257 3300025961 Bacteria 608
365 Ga0207668_10015526 3300025972 Bacteria 4734
366 Ga0207668_10152942 3300025972 Bacteria 1788
367 Ga0207640_10136945 3300025981 Bacteria 1779
368 Ga0207677_10007130 3300026023 Bacteria 6154
369 Ga0207677_10191492 3300026023 Bacteria 1618
370 Ga0207677_10736880 3300026023 Bacteria 877
371 Ga0207703_10026056 3300026035 Bacteria 4601
372 Ga0207703_10861590 3300026035 Bacteria 867
373 Ga0207703_11321356 3300026035 Bacteria 693
374 Ga0207639_10115403 3300026041 Bacteria 2196
375 Ga0207639_10183033 3300026041 Bacteria 1784
376 Ga0207639_10794125 3300026041 Bacteria 882
377 Ga0207708_10000712 3300026075 Bacteria 25051
378 Ga0207708_10003441 3300026075 Bacteria 11663
379 Ga0207708_10312524 3300026075 Bacteria 1280
380 Ga0207708_10421411 3300026075 Bacteria 1107
381 Ga0207708_10966896 3300026075 Bacteria 739
382 Ga0207702_10009029 3300026078 Bacteria 8396
383 Ga0207702_10040144 3300026078 Bacteria 3923
384 Ga0207702_10146020 3300026078 Bacteria 2146
385 Ga0207641_11149338 3300026088 Bacteria 775
386 Ga0207648_10000505 3300026089 Bacteria 43495
387 Ga0207648_10188736 3300026089 Bacteria 1826
388 Ga0207648_10283810 3300026089 Bacteria 1481
389 Ga0207676_10707698 3300026095 Bacteria 976
390 Ga0207674_10482920 3300026116 Bacteria 1198
391 Ga0207674_10527796 3300026116 Bacteria 1140
392 Ga0207675_100000625 3300026118 Bacteria 34684
393 Ga0207675_100000760 3300026118 Bacteria 32073
394 Ga0207675_100460148 3300026118 Bacteria 1262
395 Ga0207683_10122736 3300026121 Bacteria 2333
396 Ga0207698_10061806 3300026142 Bacteria 2921
397 Ga0207698_10105045 3300026142 Bacteria 2352
398 Ga0209281_1000128 3300027111 Bacteria 199265
399 Ga0209281_1000483 3300027111 Bacteria 55407
400 Ga0209969_1015731 3300027360 Bacteria 1107
401 Ga0209967_1001411 3300027364 Bacteria 3068
402 Ga0209981_1002546 3300027378 Bacteria 2326
403 Ga0209981_1017810 3300027378 Bacteria 1004
404 Ga0210000_1007602 3300027462 Bacteria 1584
405 Ga0209968_1005587 3300027526 Bacteria 1889
406 Ga0209999_1007649 3300027543 Bacteria 1944
407 Ga0209282_1000034 3300027666 Bacteria 140100
408 Ga0209971_1038064 3300027682 Bacteria 1158
409 Ga0209998_10079843 3300027717 Bacteria 792
410 Ga0207428_10004302 3300027907 Bacteria 13600
411 Ga0207428_10170429 3300027907 Bacteria 1649
412 Ga0207428_10221607 3300027907 Bacteria 1418
413 Ga0268265_10004002 3300028380 Bacteria 10375
414 Ga0268265_10034846 3300028380 Bacteria 3672
415 Ga0268264_10015338 3300028381 Bacteria 6283
416 Ga0268264_10794170 3300028381 Bacteria 945
417 Ga0307515_10000945 3300028794 Bacteria 66458
418 Ga0307408_100160940 3300031548 Bacteria 1783
419 Ga0307408_100347367 3300031548 Bacteria 1258
420 Ga0316579_10002021 3300031691 Bacteria 7595
421 Ga0316578_10029888 3300031728 Bacteria 3095
422 Ga0307405_10664978 3300031731 Bacteria 858
423 Ga0307412_10405676 3300031911 Bacteria 1111
424 Ga0315914_1000010 3300031967 Bacteria 171642
425 Ga0307409_100167378 3300031995 Bacteria 1931
426 Ga0307409_100752514 3300031995 Bacteria 978
427 Ga0307416_100093272 3300032002 Bacteria 2593
428 Ga0307416_100397069 3300032002 Bacteria 1415
429 Ga0307411_10498057 3300032005 Bacteria 1029
430 Ga0307411_10764858 3300032005 Bacteria 847
431 Ga0307411_11853126 3300032005 Bacteria 561
432 Ga0316583_10004918 3300032133 Bacteria 4777
433 Ga0316583_10007067 3300032133 Bacteria 4038
434 Ga0315913_1000005 3300033430 Bacteria 171651
435 Ga0315915_1000012 3300033464 Bacteria 199284
436 Ga0373958_0082813 3300034819 Bacteria 729
437 Ga0373959_0014773 3300034820 Bacteria 1426
438 Ga0373959_0070637 3300034820 Bacteria 789
439 Ga0373938_0057225 3300034957 Bacteria 904
440 Ga0373926_0000860 3300035083 Bacteria 8683
441 Ga0373928_0021740 3300035084 Bacteria 1355
442 Ga0373929_0033902 3300035085 Bacteria 1105
443 Ga0373940_0149405 3300035088 Bacteria 743
444 Ga0373944_0003250 3300035089 Bacteria 4180
445 Ga0373949_0008285 3300035090 Bacteria 2276
446 Ga0373951_0075804 3300035091 Bacteria 863
447 Ga0373923_0173607 3300035111 Bacteria 988
448 Ga0373932_0021715 3300035112 Bacteria 1697
449 Ga0373936_0015541 3300035113 Bacteria 2917
450 Ga0373939_0175761 3300035114 Bacteria 795
451 Ga0373945_0100842 3300035116 Bacteria 1129
452 Ga0373953_0066757 3300035117 Bacteria 1479
453 Ga0373956_0031880 3300035119 Bacteria 2311
454 Ga0373956_0138156 3300035119 Bacteria 1143
455 Ga0373943_0014896 3300035170 Bacteria 3528
456 Ga0373946_0027606 3300035171 Bacteria 2246
457 Ga0373961_0043149 3300035241 Bacteria 1310
458 Ga0373924_0090529 3300035410 Bacteria 1308
459 Ga0373924_0140078 3300035410 Bacteria 1055
460 Ga0373931_0021431 3300035691 Bacteria 3242
461 Ga0373931_0159308 3300035691 Bacteria 1322
462 Ga0373931_0173253 3300035691 Bacteria 1273
463 Ga0373931_0783976 3300035691 Bacteria 634
464 Ga0373935_0003949 3300035692 Bacteria 8659
465 Ga0373927_0009382 3300035695 Bacteria 6564
466 Ga0373927_0095449 3300035695 Bacteria 1933
467 Ga0373947_0009088 3300035725 Bacteria 5710
468 Ga0373937_0012385 3300036401 Bacteria 7500
469 Ga0373937_0193022 3300036401 Bacteria 1914
470 Ga0316582_0044224 3300036647 Bacteria 2798
471 Ga0395900_0398199 3300037418 Bacteria 1342
472 Ga0436365_1397623 3300039437 Bacteria 7292
473 Ga0436360_0549273 3300039438 Bacteria 1716
474 Ga0436362_0387917 3300039453 Bacteria 567
475 Ga0439453_0012544 3300041408 Bacteria 1428
476 Ga0439461_0008132 3300041410 Bacteria 1874
477 Ga0451845_0782002 3300041501 Bacteria 802
478 Ga0439441_000556 3300042001 Bacteria 4136
479 Ga0439432_056806 3300042006 Bacteria 1212
480 Ga0439449_0051120 3300042007 Bacteria 1529
481 Ga0439462_0003827 3300042015 Bacteria 3632
482 Ga0439462_0223826 3300042015 Bacteria 538
483 Ga0439446_0012744 3300042156 Bacteria 2299
484 Ga0439435_0002663 3300042436 Bacteria 3589
485 Ga0439460_0005924 3300042461 Bacteria 3013
486 Ga0450893_0017625 3300042532 Bacteria 1214
487 Ga0451577_0029192 3300042876 Bacteria 4984
488 Ga0451577_1427551 3300042876 Bacteria 613
489 Ga0466966_0042939 3300044684 Bacteria 2900
490 Ga0466966_0195470 3300044684 Bacteria 1225
491 Ga0466964_0347144 3300044706 Bacteria 761
492 Ga0466959_0172851 3300045049 Bacteria 1515
493 Ga0451576_0005592 3300045051 Bacteria 15703
494 Ga0451576_0023317 3300045051 Bacteria 6701
495 Ga0451576_0044258 3300045051 Bacteria 4693
496 Ga0451576_0444608 3300045051 Bacteria 1361
497 Ga0451576_0961944 3300045051 Bacteria 895
498 Ga0466958_0417679 3300045836 Bacteria 867
499 Ga0466967_0043252 3300045976 Bacteria 3899
500 Ga0495592_0056995 3300046454 Bacteria 2885
501 Ga0495603_0014327 3300046455 Bacteria 4794
502 Ga0495590_0198529 3300046457 Bacteria 737
503 Ga0495651_0087495 3300046462 Bacteria 2343
504 Ga0495580_0010043 3300046472 Bacteria 7399
505 Ga0495582_0070394 3300046473 Bacteria 1935
506 Ga0495639_0011028 3300046475 Bacteria 3894
507 Ga0495607_0000252 3300046501 Bacteria 57555
508 Ga0495610_0002342 3300046512 Bacteria 16022
509 Ga0495628_0050060 3300046516 Bacteria 3306
510 Ga0495630_0070696 3300046517 Bacteria 2626
511 Ga0495644_0123118 3300046523 Bacteria 987
512 Ga0495666_0024995 3300046526 Bacteria 2951
513 Ga0495586_0018472 3300046535 Bacteria 3712
514 Ga0495587_0019410 3300046536 Bacteria 4207
515 Ga0495621_0328780 3300046539 Bacteria 638
516 Ga0495645_0021953 3300046543 Bacteria 4616
517 Ga0495645_0645820 3300046543 Bacteria 647
518 Ga0495667_0095135 3300046559 Bacteria 1929
519 Ga0495667_0148633 3300046559 Bacteria 1509
520 Ga0495656_0027754 3300046615 Bacteria 2264
521 Ga0495668_0505675 3300046616 Bacteria 666
522 Ga0495634_0004662 3300046642 Bacteria 10673
523 Ga0495588_0026638 3300046674 Bacteria 2888
524 Ga0495599_0025674 3300046678 Bacteria 3689
525 Ga0495623_0026028 3300046679 Bacteria 3768
526 Ga0495647_0009745 3300046681 Bacteria 3260
527 Ga0495658_0011063 3300046683 Bacteria 4528
528 Ga0495600_0047585 3300046809 Bacteria 2798
529 Ga0495581_0202956 3300047315 Bacteria 1160
530 Ga0495636_0034583 3300047318 Bacteria 2080
531 Ga0495674_0316150 3300047319 Bacteria 1273
532 Ga0495676_0052952 3300047321 Bacteria 3237
533 Ga0495680_0535178 3300047322 Bacteria 791
534 Ga0495675_0481843 3300047444 Bacteria 714
535 Ga0495602_0276733 3300048088 Bacteria 1238
536 Ga0495602_0375412 3300048088 Bacteria 1020
537 Ga0496106_0000050 3300048909 Bacteria 96126
538 Ga0501031_0493777 3300049568 Bacteria 790
539 Ga0501031_0509811 3300049568 Bacteria 776
540 Ga0501033_0143727 3300049570 Bacteria 1724
541 Ga0501033_0195046 3300049570 Bacteria 1448
542 Ga0501036_0001519 3300049572 Bacteria 17901
543 Ga0501036_0081257 3300049572 Bacteria 2739
544 Ga0501036_0646894 3300049572 Bacteria 875
545 Ga0501036_0718779 3300049572 Bacteria 825
546 Ga0501037_0093288 3300049573 Bacteria 2177
547 Ga0501037_0277826 3300049573 Bacteria 1167
548 Ga0501038_0001082 3300049574 Bacteria 24639
549 Ga0501039_0000168 3300049575 Bacteria 45750
550 Ga0501039_0096719 3300049575 Bacteria 2302
551 Ga0501040_0001149 3300049576 Bacteria 16836
552 Ga0501040_0015585 3300049576 Bacteria 5024
553 Ga0501040_0196526 3300049576 Bacteria 1432
554 Ga0501040_0205722 3300049576 Bacteria 1398
555 Ga0501041_0000623 3300049577 Bacteria 18476
556 Ga0501041_0136412 3300049577 Bacteria 1529
557 Ga0501042_0010653 3300049578 Bacteria 6177
558 Ga0501042_0046342 3300049578 Bacteria 3099
559 Ga0501042_0080229 3300049578 Bacteria 2338
560 Ga0501042_0409191 3300049578 Bacteria 983
561 Ga0501043_0137507 3300049579 Bacteria 1914
562 Ga0501046_0000480 3300049580 Bacteria 39915
563 Ga0501046_0241570 3300049580 Bacteria 1332
564 Ga0501048_0000896 3300049582 Bacteria 21988
565 Ga0501048_0618750 3300049582 Bacteria 777
566 Ga0501067_0029549 3300049583 Bacteria 3038
567 Ga0501068_0024852 3300049584 Bacteria 3520
568 Ga0501071_0134164 3300049587 Bacteria 1841
569 Ga0501071_0944765 3300049587 Bacteria 665
570 Ga0501072_0060341 3300049588 Bacteria 2991
571 Ga0501072_0119918 3300049588 Bacteria 2096
572 Ga0501074_0130568 3300049590 Bacteria 1797
573 Ga0501074_0834396 3300049590 Bacteria 649
574 Ga0501075_0000046 3300049591 Bacteria 50813
575 Ga0501075_0066463 3300049591 Bacteria 2721
576 Ga0501076_0000566 3300049592 Bacteria 23610
577 Ga0501077_0004244 3300049593 Bacteria 8660
578 Ga0501077_0104385 3300049593 Bacteria 1796
579 Ga0501079_0000808 3300049741 Bacteria 21315
580 Ga0501081_0001689 3300049743 Bacteria 13675
581 Ga0501035_0004374 3300049822 Bacteria 13419
582 Ga0501045_0000436 3300049824 Bacteria 25558
583 Ga0501045_0019929 3300049824 Bacteria 4787
584 nmdc:mga00v17_256636_c1 3300050491 Bacteria 1134
585 nmdc:mga05p37_1059_c1 3300050507 Bacteria 31441
586 nmdc:mga05p37_2687_c1 3300050507 Bacteria 20683
587 nmdc:mga05p37_454651_c1 3300050507 Bacteria 1481
588 nmdc:mga09592_417012_c1 3300050508 Bacteria 1160
589 nmdc:mga09592_438_c1 3300050508 Bacteria 30676
590 nmdc:mga09592_61_c1 3300050508 Bacteria 60866
591 nmdc:mga09592_622892_c1 3300050508 Bacteria 923
592 nmdc:mga0qj67_112210_c1 3300050509 Bacteria 2201
593 nmdc:mga0qj67_574707_c1 3300050509 Bacteria 903
594 nmdc:mga0qj67_795943_c1 3300050509 Bacteria 749
595 nmdc:mga06r32_11848_c1 3300050510 Bacteria 7853
596 nmdc:mga06r32_332627_c1 3300050510 Bacteria 1504
597 nmdc:mga06r32_914978_c1 3300050510 Bacteria 833
598 nmdc:mga08y16_334659_c1 3300050511 Bacteria 1557
599 nmdc:mga08y16_46313_c1 3300050511 Bacteria 4553
600 nmdc:mga08y16_48826_c1 3300050511 Bacteria 4429
601 nmdc:mga08y16_707660_c1 3300050511 Bacteria 1006
602 nmdc:mga08y16_7845_c1 3300050511 Bacteria 11181
603 nmdc:mga0n895_10713_c1 3300050512 Bacteria 8124
604 nmdc:mga0n895_11009_c1 3300050512 Bacteria 8039
605 nmdc:mga0n895_186096_c1 3300050512 Bacteria 2108
606 nmdc:mga0n895_218696_c1 3300050512 Bacteria 1934
607 nmdc:mga0n895_3867_c1 3300050512 Bacteria 12157
608 nmdc:mga0n895_968802_c1 3300050512 Bacteria 833
609 nmdc:mga0rr50_123773_c1 3300050513 Bacteria 2062
610 nmdc:mga0rr50_16364_c1 3300050513 Bacteria 4924
611 nmdc:mga0rr50_319066_c1 3300050513 Bacteria 1302
612 nmdc:mga0rr50_386804_c1 3300050513 Bacteria 1180
613 nmdc:mga0rr50_569018_c1 3300050513 Bacteria 965
614 nmdc:mga0rr50_90379_c1 3300050513 Bacteria 2383
615 nmdc:mga08x19_127739_c1 3300050514 Bacteria 1708
616 nmdc:mga08x19_200146_c1 3300050514 Bacteria 1369
617 nmdc:mga08x19_375_c1 3300050514 Bacteria 31351
618 nmdc:mga08x19_4952_c1 3300050514 Bacteria 7865
619 nmdc:mga08x19_591298_c1 3300050514 Bacteria 786
620 nmdc:mga08x19_62866_c1 3300050514 Bacteria 2408
621 nmdc:mga0a205_1027619_c1 3300050515 Bacteria 671
622 nmdc:mga0a205_1599_c1 3300050515 Bacteria 19462
623 nmdc:mga0a205_211694_c1 3300050515 Bacteria 1826
624 nmdc:mga0a205_57835_c1 3300050515 Bacteria 3744
625 nmdc:mga0a205_651264_c1 3300050515 Bacteria 905
626 nmdc:mga0a205_742087_c1 3300050515 Bacteria 831
627 nmdc:mga0a205_745504_c1 3300050515 Bacteria 828
628 nmdc:mga0a205_76699_c1 3300050515 Bacteria 3230
629 Ga0495601_0010036 3300053077 Bacteria 5619
630 Ga0495595_0015779 3300053084 Bacteria 3225
631 Ga0495595_0182921 3300053084 Bacteria 1040
632 Ga0495619_0082090 3300053085 Bacteria 2172
633 Ga0500641_0016899 3300053096 Bacteria 2721
634 Ga0500658_0005736 3300053134 Bacteria 4624
635 Ga0500568_0001502 3300053139 Bacteria 14909
636 Ga0501084_0034303 3300054114 Bacteria 4243
637 Ga0501084_0934115 3300054114 Bacteria 729
638 Ga0590071_042212 3300059421 Bacteria 1098
639 Ga0590075_026696 3300059424 Bacteria 1454
640 Ga0501082_0002802 3300060353 Bacteria 15217
641 Ga0466962_0117165 3300061719 Bacteria 1284
642 Ga0530510_0025258 3300061734 Bacteria 4246
643 Ga0530510_0303098 3300061734 Bacteria 1196
644 Ga0530510_0741910 3300061734 Bacteria 749
645 2509107478 2508501122 Bacteria 6292184
646 2509375813 2509276019 Bacteria 6802256
647 2510303345 2510065057 Bacteria 6649661
648 2511501838 2511231052 Bacteria 6974333
649 2512533276 2512047086 Bacteria 6850303
650 2513584697 2513237086 Bacteria 7265287
651 2513603939 2513237089 Bacteria 6553624
652 2513615407 2513237091 Bacteria 6900273
653 2513881195 2513237140 Bacteria 7076289
654 2513905664 2513237143 Bacteria 6664116
655 2513984377 2513237156 Bacteria 6402557
656 2514006164 2513237160 Bacteria 6650282
657 2515608701 2515154107 Bacteria 6795637
658 2516209632 2516143018 Bacteria 6951533
659 2516893133 2516653046 Bacteria 6989037
660 2517569889 2517487022 Bacteria 7227575
661 2524448896 2524023207 Bacteria 6813453
662 2551677973 2551306084 Bacteria 8942552
663 2551686754 2551306085 Bacteria 7347181
664 2551690979 2551306086 Bacteria 6843938
665 2551698954 2551306087 Bacteria 7351905
666 2551713829 2551306089 Bacteria 7162724
667 2551717857 2551306090 Bacteria 7953713
668 2551719337 2551306090 Bacteria 7953713
669 2551727830 2551306091 Bacteria 7086830
670 2551736530 2551306092 Bacteria 6992595
671 2551743891 2551306093 Bacteria 7064773
672 2558868082 2558860100 Bacteria 8458965
673 2585846773 2585427594 Bacteria 6180594
674 2657685865 2657244999 Bacteria 5946535
675 2692315908 2690316117 Bacteria 6800650
676 2753458826 2751185821 Bacteria 6189929
677 2792581857 2791355082 Bacteria 5973319
678 2792620097 2791355091 Bacteria 6135441
679 2792626484 2791355092 Bacteria 6248105
680 2792639414 2791355094 Bacteria 7011481
681 2802719163 2802428858 Bacteria 6636079
682 2802727394 2802428859 Bacteria 6667919
683 2802732176 2802428860 Bacteria 6525526
684 2802739106 2802428861 Bacteria 6534206
685 2802745006 2802428862 Bacteria 6633353
686 2802752281 2802428863 Bacteria 6410669
687 2804752312 2802429268 Bacteria 6094027
688 2838078940 2838074704 Bacteria 6785777
689 2847419027 2847417321 Bacteria 6913799
690 2848994059 2848992105 Bacteria 6810864
691 2850082075 2850079185 Bacteria 6848280
692 2855825934 2855825444 Bacteria 6785811
693 2855841284 2855839649 Bacteria 7135830
694 2855876702 2855872281 Bacteria 6964271
695 2857580398 2857576091 Bacteria 5465855
696 2858802262 2858800743 Bacteria 6603254
697 2896390806 2896384573 Bacteria 7700774
698 2913300911 2913295892 Bacteria 6333755
699 2915985531 2915980308 Bacteria 6624279
700 2915990346 2915986958 Bacteria 6739310
701 2915994855 2915993759 Bacteria 7016183
702 2916002763 2916000859 Bacteria 6865702
703 2916014479 2916007675 Bacteria 6898660
704 2916017363 2916014648 Bacteria 6946486
705 2916024018 2916021584 Bacteria 6854472
706 2916033220 2916028427 Bacteria 6748433
707 2916036720 2916035215 Bacteria 6755766
708 2916044288 2916041962 Bacteria 6820487
709 2916052226 2916048683 Bacteria 6543552
710 2916055545 2916055098 Bacteria 6758838
711 2916065285 2916061851 Bacteria 6737736
712 2916072084 2916068649 Bacteria 6943657
713 2916080920 2916076590 Bacteria 6596108
714 2920766149 2920760137 Bacteria 7427611
715 2921204855 2921201388 Bacteria 6926299
716 2921212602 2921208531 Bacteria 6745326
717 2921242346 2921237296 Bacteria 6876710
718 2921246571 2921244191 Bacteria 6568419
719 2921255175 2921250672 Bacteria 6677771
720 2921259603 2921257292 Bacteria 6808382
721 2921266966 2921263974 Bacteria 6864552
722 2921287354 2921282425 Bacteria 6826397
723 2921294138 2921289301 Bacteria 7316391
724 2921302602 2921296804 Bacteria 7176999
725 2924145997 2924144063 Bacteria 6883928
726 2924154545 2924150972 Bacteria 7169444
727 2924163062 2924158325 Bacteria 7188855
728 2924170308 2924165586 Bacteria 7260590
729 2924176344 2924172951 Bacteria 6749356
730 2924181399 2924179722 Bacteria 6843264
731 2924189846 2924186466 Bacteria 6876637
732 2924196544 2924193448 Bacteria 6955718
733 2924205828 2924200457 Bacteria 6757188
734 2924211221 2924207177 Bacteria 6917007
735 2924217378 2924214083 Bacteria 7080103
736 2924225027 2924221636 Bacteria 7113495
737 2924231441 2924228884 Bacteria 6633132
738 2936999585 2936996657 Bacteria 6298727
739 2937005985 2937002841 Bacteria 6934057
740 2937013275 2937009748 Bacteria 6746052
741 2937019340 2937016420 Bacteria 6782579
742 2937028915 2937023124 Bacteria 6815156
743 2937033651 2937029754 Bacteria 6424026
744 2937037151 2937036028 Bacteria 6846469
745 2937047512 2937042894 Bacteria 6741576
746 2937052468 2937049772 Bacteria 6757901
747 2937063616 2937056579 Bacteria 7107896
748 2937068092 2937063883 Bacteria 7199456
749 2937072992 2937071275 Bacteria 6984483
750 2937079318 2937078374 Bacteria 6610289
751 2937087871 2937084907 Bacteria 6618516
752 2937094088 2937091812 Bacteria 6979387
753 2937106237 2937098957 Bacteria 7249374
754 2937107998 2937106411 Bacteria 6947143
755 2937115222 2937113482 Bacteria 6505872
756 2937123351 2937119839 Bacteria 6597547
757 2937129112 2937126314 Bacteria 6771275
758 2957381476 2957375807 Bacteria 6425588
759 2957387511 2957382221 Bacteria 6737050
760 2957391795 2957388812 Bacteria 6778072
761 2957396630 2957395598 Bacteria 6822399
762 2957404883 2957402308 Bacteria 6741770
763 2957410920 2957408893 Bacteria 6558585
764 2957420142 2957415311 Bacteria 6991633
765 2957426249 2957422303 Bacteria 7172205
766 2957433926 2957430029 Bacteria 7022557
767 2957441132 2957437181 Bacteria 6568994
768 2957445705 2957443900 Bacteria 6869977
769 2957454639 2957450854 Bacteria 6765715
770 2957464006 2957457609 Bacteria 6967680
771 2957467828 2957464669 Bacteria 6568877
772 2957472447 2957471148 Bacteria 6797643
773 2957480715 2957478035 Bacteria 6756658
774 2957488539 2957484790 Bacteria 6703082
775 2957496654 2957491536 Bacteria 6695180
776 2957502659 2957498199 Bacteria 7126688
777 2957506827 2957505466 Bacteria 7253085
778 2960590096 2960584000 Bacteria 6864594
779 2960597316 2960591022 Bacteria 6622873
780 2960598263 2960597568 Bacteria 6550735
781 2960609660 2960603979 Bacteria 6898737
782 2960615174 2960610863 Bacteria 6691244
783 2960620883 2960617483 Bacteria 6727748
784 2960627587 2960624210 Bacteria 6875384
785 2960635920 2960631154 Bacteria 6732508
786 2960644681 2960637947 Bacteria 7296468
787 2960649029 2960645483 Bacteria 7211087
788 2960659241 2960652885 Bacteria 7083688
789 2960662178 2960660292 Bacteria 7041660
790 2960672717 2960667422 Bacteria 6763020
791 2960676456 2960674078 Bacteria 6609048
792 2960687268 2960680706 Bacteria 6624464
793 2960689918 2960687367 Bacteria 6535474
794 2960698407 2960693952 Bacteria 6749742
795 2964611738 2964607997 Bacteria 7101408
796 2964616928 2964615318 Bacteria 6809089
797 2964624616 2964621998 Bacteria 6834995
798 2964631106 2964628898 Bacteria 7083044
799 2964637556 2964636051 Bacteria 7091832
800 2964646449 2964643177 Bacteria 6820887
801 2964651670 2964649959 Bacteria 6675118
802 2964661622 2964656573 Bacteria 7100150
803 2964669891 2964663802 Bacteria 7019362
804 2964673903 2964670856 Bacteria 6851364
805 2964678476 2964678106 Bacteria 6792020
806 2964686878 2964685014 Bacteria 6839111
807 2964694396 2964691889 Bacteria 6802758
808 2964701579 2964698721 Bacteria 6765331
809 2964710989 2964705432 Bacteria 7114648
810 2964714168 2964712639 Bacteria 6695970
811 2964723453 2964719344 Bacteria 7286602
812 2967665128 2967664464 Bacteria 6948836
813 2967675530 2967671571 Bacteria 7021409
814 2967686167 2967678726 Bacteria 7264382
815 2967690101 2967686174 Bacteria 6678622
816 2967697464 2967693043 Bacteria 6804451
817 2967702835 2967699805 Bacteria 6854538
818 2967709051 2967706974 Bacteria 7186053
819 2967716822 2967714385 Bacteria 7000047
820 2967726371 2967721400 Bacteria 7073753
821 2967732734 2967728569 Bacteria 6641507
822 2967740057 2967735183 Bacteria 6827012
823 2967743298 2967742019 Bacteria 6794534
824 2967753747 2967748971 Bacteria 6733771
825 2967758692 2967755722 Bacteria 6814706
826 2967769276 2967762386 Bacteria 6923502
827 2967770917 2967769361 Bacteria 6587838
828 2967780318 2967775926 Bacteria 6738189
829 2970020397 2970019648 Bacteria 7072033
830 2970030842 2970026789 Bacteria 6785236
831 2970034448 2970033650 Bacteria 7118744
832 2970042539 2970040964 Bacteria 6731123
833 2970048930 2970047711 Bacteria 7088379
834 2970057098 2970054988 Bacteria 6611507
835 2970066184 2970061556 Bacteria 7099761
836 2970070859 2970068827 Bacteria 7123112
837 2970079274 2970076120 Bacteria 6697332
838 2970083688 2970082768 Bacteria 6183754
839 2970090454 2970088815 Bacteria 6933825
840 2970099190 2970095765 Bacteria 6936963
841 2970107442 2970102677 Bacteria 6812532
842 2970111642 2970109326 Bacteria 6863976
843 2970121938 2970116247 Bacteria 6501857
844 2970126719 2970122695 Bacteria 6625855
845 2970133426 2970129317 Bacteria 6806560
846 2970143235 2970136068 Bacteria 7207982
847 2970148090 2970143518 Bacteria 6446480
848 2970156379 2970149975 Bacteria 6779706
849 2970161623 2970156795 Bacteria 7168044
850 2970168176 2970164137 Bacteria 6861252
851 2970174712 2970170962 Bacteria 6876229
852 2970180538 2970177841 Bacteria 6768001
853 2970189331 2970184632 Bacteria 7054431
854 2970195806 2970191845 Bacteria 7032787
855 2977521416 2977516862 Bacteria 6940108
856 2977529295 2977523885 Bacteria 6960446
857 2977534801 2977530762 Bacteria 6951399
858 2977542572 2977537788 Bacteria 6929320
859 2977547763 2977544691 Bacteria 6875412
860 2977556381 2977551784 Bacteria 7125765
861 2977560941 2977558990 Bacteria 6863948
862 2977567910 2977565890 Bacteria 6901543
863 2977575179 2977572785 Bacteria 6763888
864 2977584246 2977579622 Bacteria 6772100
865 643825915 643692032 Bacteria 6891900
866 648737502 648276728 Bacteria 6968865
867 8003993789 8003992118 Bacteria 7266902
868 8049294869 8049293176 Bacteria 6128433
869 8054559902 8054558443 Bacteria 5204801
870 Ga0070689_100676291
871 JGI24742J22300_10070681
872 Ga0065712_10122077
873 Ga0065707_10538935
874 Ga0070658_10010004
875 Ga0070658_10075444
876 Ga0070658_11377934
877 Ga0070676_10794085
878 Ga0070683_100135633
879 Ga0070690_100000148
880 Ga0070690_100071630
881 Ga0070670_100480948
882 Ga0070670_100704208
883 Ga0070677_10527158
884 Ga0068869_100000103
885 Ga0068869_100063869
886 Ga0070680_100000882
887 Ga0070682_100008721
888 Ga0070682_100931071
889 Ga0068868_100001076
890 Ga0068868_100270401
891 Ga0068868_100413471
892 Ga0070660_100428494
893 Ga0070689_100002361
894 Ga0070689_100108737
895 Ga0070689_100160901
896 Ga0070689_100170739
897 Ga0070691_10003035
898 Ga0070691_10160365
899 Ga0070691_10442088
900 Ga0070687_100000105
901 Ga0070687_100024661
902 Ga0070687_100126534
903 Ga0070692_10005261
904 Ga0070692_10028792
905 Ga0070668_100009368
906 Ga0070668_100016417
907 Ga0070669_100002037
908 Ga0070669_100405369
909 Ga0070675_100036014
910 Ga0070671_100264110
911 Ga0070671_100435214
912 Ga0070674_100056367
913 Ga0070674_100059160
914 Ga0070673_100273397
915 Ga0070673_100352279
916 Ga0070673_100532402
917 Ga0070688_100052888
918 Ga0070688_100171705
919 Ga0070659_100264025
920 Ga0070703_10362501
921 Ga0070714_100198431
922 Ga0070714_100384122
923 Ga0070714_100412585
924 Ga0070713_100403414
925 Ga0070713_101182719
926 Ga0070710_10689498
927 Ga0070701_10182682
928 Ga0070701_10204055
929 Ga0070701_10656736
930 Ga0070705_100001061
931 Ga0070705_100005767
932 Ga0070705_100075917
933 Ga0070705_100133086
934 Ga0070705_100212680
935 Ga0070705_100368473
936 Ga0070700_100001887
937 Ga0070700_100009399
938 Ga0070694_100000110
939 Ga0070694_100002797
940 Ga0070694_100013506
941 Ga0070694_100365442
942 Ga0070694_100583412
943 Ga0070708_100207175
944 Ga0070708_100614047
945 Ga0070662_100164412
946 Ga0070662_101016463
947 Ga0070681_10118573
948 Ga0070681_10211062
949 Ga0070681_10301517
950 Ga0070681_11321818
951 Ga0068867_100000441
952 Ga0068867_100001737
953 Ga0068867_100305924
954 Ga0070706_100830358
955 Ga0070707_100443939
956 Ga0070698_100193154
957 Ga0070698_100701983
958 Ga0070699_100046681
959 Ga0070699_100154507
960 Ga0070699_100379676
961 Ga0070679_100057268
962 Ga0070684_100020331
963 Ga0070684_100478817
964 Ga0070684_101019853
965 Ga0070697_100203191
966 Ga0070697_100223627
967 Ga0070697_100476188
968 Ga0070697_100480525
969 Ga0068853_100064747
970 Ga0070672_100130429
971 Ga0070672_100149330
972 Ga0070686_100000563
973 Ga0070686_100054520
974 Ga0070695_100000512
975 Ga0070695_100064882
976 Ga0070695_100189216
977 Ga0070695_100206318
978 Ga0070695_100228624
979 Ga0070696_100009252
980 Ga0070696_100015140
981 Ga0070696_100040726
982 Ga0070696_100076603
983 Ga0070696_100083654
984 Ga0070696_100288699
985 Ga0070693_100000101
986 Ga0070693_100014688
987 Ga0070665_100563839
988 Ga0070704_100000220
989 Ga0070704_100001535
990 Ga0070704_100012096
991 Ga0070704_100017031
992 Ga0070704_100104157
993 Ga0070704_100660563
994 Ga0068855_100001986
995 Ga0068855_100010909
996 Ga0068855_100030675
997 Ga0068855_100169283
998 Ga0068857_100495085
999 Ga0068857_100526291
1000 Ga0068857_101310592
1001 Ga0068854_100005853
1002 Ga0068854_100812516
1003 Ga0068856_100009739
1004 Ga0068856_100037843
1005 Ga0068856_100251353
1006 Ga0070702_100000096
1007 Ga0070702_100375112
1008 Ga0068852_100001888
1009 Ga0068852_100205376
1010 Ga0068852_100250388
1011 Ga0068859_100004200
1012 Ga0068859_100179362
1013 Ga0068859_100599324
1014 Ga0068864_100541723
1015 Ga0068866_10000893
1016 Ga0068866_10227104
1017 Ga0068861_100000826
1018 Ga0068861_100003187
1019 Ga0068851_10093381
1020 Ga0068870_10058985
1021 Ga0068863_100904215
1022 Ga0068863_101264015
1023 Ga0068858_100002013
1024 Ga0068858_100007196
1025 Ga0068860_100001309
1026 Ga0068862_100001947
1027 Ga0068862_100006062
1028 Ga0068862_100569450
1029 Ga0081539_10001473
1030 Ga0075364_10255516
1031 Ga0070715_10019529
1032 Ga0070715_10052773
1033 Ga0070712_100396333
1034 Ga0070712_100642458
1035 Ga0097621_100000106
1036 Ga0097621_100006960
1037 Ga0097621_100012268
1038 Ga0097621_100050892
1039 Ga0097621_100287557
1040 Ga0068871_100002446
1041 Ga0068871_100008532
1042 Ga0068871_100017675
1043 Ga0068871_100182020
1044 Ga0068871_101188804
1045 Ga0075428_100000134
1046 Ga0075428_100047461
1047 Ga0075430_100060701
1048 Ga0075431_100014959
1049 Ga0075431_100209478
1050 Ga0075433_10001519
1051 Ga0075433_10056858
1052 Ga0075433_10140793
1053 Ga0075433_10363736
1054 Ga0075433_10398836
1055 Ga0075433_10594228
1056 Ga0075433_10692785
1057 Ga0075433_10808494
1058 Ga0075433_10911110
1059 Ga0075434_100000699
1060 Ga0075434_100000813
1061 Ga0075434_100134764
1062 Ga0075434_100348944
1063 Ga0075429_100000271
1064 Ga0075429_100000975
1065 Ga0068865_100000231
1066 Ga0068865_100057228
1067 Ga0068865_100717876
1068 Ga0068865_100775400
1069 Ga0068865_100950084
1070 Ga0075436_100002436
1071 Ga0075436_100004776
1072 Ga0075436_100006862
1073 Ga0075436_100012375
1074 Ga0075436_100016124
1075 Ga0075436_100076041
1076 Ga0075436_100291279
1077 Ga0097620_100004200
1078 Ga0097620_100179358
1079 Ga0097620_100599261
1080 Ga0079104_1007232
1081 Ga0079104_1008431
1082 Ga0075435_100002136
1083 Ga0075435_100035972
1084 Ga0075435_100083482
1085 Ga0075435_100134671
1086 Ga0075435_100672997
1087 Ga0099794_10201826
1088 Ga0105240_10002895
1089 Ga0105240_10061715
1090 Ga0105240_10071509
1091 Ga0105240_10161885
1092 Ga0111539_10008776
1093 Ga0111539_10305362
1094 Ga0105245_10000347
1095 Ga0105245_10042334
1096 Ga0105245_10489525
1097 Ga0114129_10005561
1098 Ga0114129_10474621
1099 Ga0105243_10000535
1100 Ga0105243_10004257
1101 Ga0105243_11054664
1102 Ga0105241_10010941
1103 Ga0105241_10265525
1104 Ga0105241_11244082
1105 Ga0105242_10000905
1106 Ga0105242_10001512
1107 Ga0105242_10002624
1108 Ga0105242_10013578
1109 Ga0105242_10017281
1110 Ga0105242_10136475
1111 Ga0105242_10777000
1112 Ga0105242_11123883
1113 Ga0105248_10020172
1114 Ga0105248_10159204
1115 Ga0105248_10633277
1116 Ga0105248_10975333
1117 Ga0105238_10020415
1118 Ga0105238_10140266
1119 Ga0105249_10005947
1120 Ga0105249_10032433
1121 Ga0105249_10124436
1122 Ga0105249_12034013
1123 Ga0105239_10110995
1124 Ga0105246_10394906
1125 Ga0157370_10001416
1126 Ga0157370_10147777
1127 Ga0157370_10207967
1128 Ga0157369_10047888
1129 Ga0157369_10223677
1130 Ga0157374_10087241
1131 Ga0157374_11017934
1132 Ga0157378_10000447
1133 Ga0157378_10072444
1134 Ga0157378_10884520
1135 Ga0163162_10085969
1136 Ga0163162_10169220
1137 Ga0163162_10658305
1138 Ga0163162_10936126
1139 Ga0157372_10011227
1140 Ga0157372_10016533
1141 Ga0157375_10390359
1142 Ga0157375_10474713
1143 Ga0163163_11692111
1144 Ga0157380_10012418
1145 Ga0157380_10157007
1146 Ga0157380_10215074
1147 Ga0157380_10936208
1148 Ga0157377_10126523
1149 Ga0157379_10035647
1150 Ga0157379_10380073
1151 Ga0157376_10002088
1152 Ga0163161_11204082
1153 Ga0214544_1000158
1154 Ga0214542_1001567
1155 Ga0214543_1000011
1156 Ga0214543_1000234
1157 Ga0213876_10203956
1158 Ga0228711_1000007
1159 Ga0228710_1000007
1160 Ga0207653_10010388
1161 Ga0207692_10033185
1162 Ga0207642_10018538
1163 Ga0207642_10555749
1164 Ga0207688_10009633
1165 Ga0207685_10016491
1166 Ga0207685_10168466
1167 Ga0207699_10458149
1168 Ga0207645_10653619
1169 Ga0207643_10034065
1170 Ga0207705_10055223
1171 Ga0207705_10067749
1172 Ga0207684_10733100
1173 Ga0207654_10425853
1174 Ga0207695_10003454
1175 Ga0207695_10148941
1176 Ga0207660_10065878
1177 Ga0207660_11153753
1178 Ga0207662_10000109
1179 Ga0207662_10051386
1180 Ga0207652_10030375
1181 Ga0207646_10301703
1182 Ga0207646_10368302
1183 Ga0207681_10005710
1184 Ga0207694_10146947
1185 Ga0207650_10690226
1186 Ga0207659_10027967
1187 Ga0207659_10290999
1188 Ga0207687_10010136
1189 Ga0207687_10073432
1190 Ga0207687_10172205
1191 Ga0207687_10449317
1192 Ga0207664_10592560
1193 Ga0207690_10082586
1194 Ga0207706_10088982
1195 Ga0207706_10131628
1196 Ga0207686_10001982
1197 Ga0207686_10018157
1198 Ga0207686_10086270
1199 Ga0207686_10100601
1200 Ga0207686_10190999
1201 Ga0207686_10628660
1202 Ga0207709_10002130
1203 Ga0207709_10003201
1204 Ga0207709_10313750
1205 Ga0207670_10009930
1206 Ga0207670_10121748
1207 Ga0207670_10222450
1208 Ga0207670_10426811
1209 Ga0207670_10452459
1210 Ga0207670_10573986
1211 Ga0207669_10017503
1212 Ga0207669_10036799
1213 Ga0207704_10008864
1214 Ga0207704_10023598
1215 Ga0207704_10821733
1216 Ga0207704_10872868
1217 Ga0207665_10882135
1218 Ga0207691_10057987
1219 Ga0207691_10336608
1220 Ga0207711_10067898
1221 Ga0207711_10693143
1222 Ga0207689_10000532
1223 Ga0207689_10044044
1224 Ga0207661_10093302
1225 Ga0207667_10026319
1226 Ga0207667_10091486
1227 Ga0207667_10296342
1228 Ga0207667_10370534
1229 Ga0207667_10709918
1230 Ga0207712_10003243
1231 Ga0207712_10065714
1232 Ga0207712_10188043
1233 Ga0207712_11481257
1234 Ga0207668_10015526
1235 Ga0207668_10152942
1236 Ga0207640_10136945
1237 Ga0207677_10007130
1238 Ga0207677_10191492
1239 Ga0207677_10736880
1240 Ga0207703_10026056
1241 Ga0207703_10861590
1242 Ga0207703_11321356
1243 Ga0207639_10115403
1244 Ga0207639_10183033
1245 Ga0207639_10794125
1246 Ga0207708_10000712
1247 Ga0207708_10003441
1248 Ga0207708_10312524
1249 Ga0207708_10421411
1250 Ga0207708_10966896
1251 Ga0207702_10009029
1252 Ga0207702_10040144
1253 Ga0207702_10146020
1254 Ga0207641_11149338
1255 Ga0207648_10000505
1256 Ga0207648_10188736
1257 Ga0207648_10283810
1258 Ga0207676_10707698
1259 Ga0207674_10482920
1260 Ga0207674_10527796
1261 Ga0207675_100000625
1262 Ga0207675_100000760
1263 Ga0207675_100460148
1264 Ga0207683_10122736
1265 Ga0207698_10061806
1266 Ga0207698_10105045
1267 Ga0209281_1000128
1268 Ga0209281_1000483
1269 Ga0209969_1015731
1270 Ga0209967_1001411
1271 Ga0209981_1002546
1272 Ga0209981_1017810
1273 Ga0210000_1007602
1274 Ga0209968_1005587
1275 Ga0209999_1007649
1276 Ga0209282_1000034
1277 Ga0209971_1038064
1278 Ga0209998_10079843
1279 Ga0207428_10004302
1280 Ga0207428_10170429
1281 Ga0207428_10221607
1282 Ga0268265_10004002
1283 Ga0268265_10034846
1284 Ga0268264_10015338
1285 Ga0268264_10794170
1286 Ga0307515_10000945
1287 Ga0307408_100160940
1288 Ga0307408_100347367
1289 Ga0316579_10002021
1290 Ga0316578_10029888
1291 Ga0307405_10664978
1292 Ga0307412_10405676
1293 Ga0315914_1000010
1294 Ga0307409_100167378
1295 Ga0307409_100752514
1296 Ga0307416_100093272
1297 Ga0307416_100397069
1298 Ga0307411_10498057
1299 Ga0307411_10764858
1300 Ga0307411_11853126
1301 Ga0316583_10004918
1302 Ga0316583_10007067
1303 Ga0315913_1000005
1304 Ga0315915_1000012
1305 Ga0373958_0082813
1306 Ga0373959_0014773
1307 Ga0373959_0070637
1308 Ga0373938_0057225
1309 Ga0373926_0000860
1310 Ga0373928_0021740
1311 Ga0373929_0033902
1312 Ga0373940_0149405
1313 Ga0373944_0003250
1314 Ga0373949_0008285
1315 Ga0373951_0075804
1316 Ga0373923_0173607
1317 Ga0373932_0021715
1318 Ga0373936_0015541
1319 Ga0373939_0175761
1320 Ga0373945_0100842
1321 Ga0373953_0066757
1322 Ga0373956_0031880
1323 Ga0373956_0138156
1324 Ga0373943_0014896
1325 Ga0373946_0027606
1326 Ga0373961_0043149
1327 Ga0373924_0090529
1328 Ga0373924_0140078
1329 Ga0373931_0021431
1330 Ga0373931_0159308
1331 Ga0373931_0173253
1332 Ga0373931_0783976
1333 Ga0373935_0003949
1334 Ga0373927_0009382
1335 Ga0373927_0095449
1336 Ga0373947_0009088
1337 Ga0373937_0012385
1338 Ga0373937_0193022
1339 Ga0316582_0044224
1340 Ga0395900_0398199
1341 Ga0436365_1397623
1342 Ga0436360_0549273
1343 Ga0436362_0387917
1344 Ga0439453_0012544
1345 Ga0439461_0008132
1346 Ga0451845_0782002
1347 Ga0439441_000556
1348 Ga0439432_056806
1349 Ga0439449_0051120
1350 Ga0439462_0003827
1351 Ga0439462_0223826
1352 Ga0439446_0012744
1353 Ga0439435_0002663
1354 Ga0439460_0005924
1355 Ga0450893_0017625
1356 Ga0451577_0029192
1357 Ga0451577_1427551
1358 Ga0466966_0042939
1359 Ga0466966_0195470
1360 Ga0466964_0347144
1361 Ga0466959_0172851
1362 Ga0451576_0005592
1363 Ga0451576_0023317
1364 Ga0451576_0044258
1365 Ga0451576_0444608
1366 Ga0451576_0961944
1367 Ga0466958_0417679
1368 Ga0466967_0043252
1369 Ga0495592_0056995
1370 Ga0495603_0014327
1371 Ga0495590_0198529
1372 Ga0495651_0087495
1373 Ga0495580_0010043
1374 Ga0495582_0070394
1375 Ga0495639_0011028
1376 Ga0495607_0000252
1377 Ga0495610_0002342
1378 Ga0495628_0050060
1379 Ga0495630_0070696
1380 Ga0495644_0123118
1381 Ga0495666_0024995
1382 Ga0495586_0018472
1383 Ga0495587_0019410
1384 Ga0495621_0328780
1385 Ga0495645_0021953
1386 Ga0495645_0645820
1387 Ga0495667_0095135
1388 Ga0495667_0148633
1389 Ga0495656_0027754
1390 Ga0495668_0505675
1391 Ga0495634_0004662
1392 Ga0495588_0026638
1393 Ga0495599_0025674
1394 Ga0495623_0026028
1395 Ga0495647_0009745
1396 Ga0495658_0011063
1397 Ga0495600_0047585
1398 Ga0495581_0202956
1399 Ga0495636_0034583
1400 Ga0495674_0316150
1401 Ga0495676_0052952
1402 Ga0495680_0535178
1403 Ga0495675_0481843
1404 Ga0495602_0276733
1405 Ga0495602_0375412
1406 Ga0496106_0000050
1407 Ga0501031_0493777
1408 Ga0501031_0509811
1409 Ga0501033_0143727
1410 Ga0501033_0195046
1411 Ga0501036_0001519
1412 Ga0501036_0081257
1413 Ga0501036_0646894
1414 Ga0501036_0718779
1415 Ga0501037_0093288
1416 Ga0501037_0277826
1417 Ga0501038_0001082
1418 Ga0501039_0000168
1419 Ga0501039_0096719
1420 Ga0501040_0001149
1421 Ga0501040_0015585
1422 Ga0501040_0196526
1423 Ga0501040_0205722
1424 Ga0501041_0000623
1425 Ga0501041_0136412
1426 Ga0501042_0010653
1427 Ga0501042_0046342
1428 Ga0501042_0080229
1429 Ga0501042_0409191
1430 Ga0501043_0137507
1431 Ga0501046_0000480
1432 Ga0501046_0241570
1433 Ga0501048_0000896
1434 Ga0501048_0618750
1435 Ga0501067_0029549
1436 Ga0501068_0024852
1437 Ga0501071_0134164
1438 Ga0501071_0944765
1439 Ga0501072_0060341
1440 Ga0501072_0119918
1441 Ga0501074_0130568
1442 Ga0501074_0834396
1443 Ga0501075_0000046
1444 Ga0501075_0066463
1445 Ga0501076_0000566
1446 Ga0501077_0004244
1447 Ga0501077_0104385
1448 Ga0501079_0000808
1449 Ga0501081_0001689
1450 Ga0501035_0004374
1451 Ga0501045_0000436
1452 Ga0501045_0019929
1453 nmdc:mga00v17_256636_c1
1454 nmdc:mga05p37_1059_c1
1455 nmdc:mga05p37_2687_c1
1456 nmdc:mga05p37_454651_c1
1457 nmdc:mga09592_417012_c1
1458 nmdc:mga09592_438_c1
1459 nmdc:mga09592_61_c1
1460 nmdc:mga09592_622892_c1
1461 nmdc:mga0qj67_112210_c1
1462 nmdc:mga0qj67_574707_c1
1463 nmdc:mga0qj67_795943_c1
1464 nmdc:mga06r32_11848_c1
1465 nmdc:mga06r32_332627_c1
1466 nmdc:mga06r32_914978_c1
1467 nmdc:mga08y16_334659_c1
1468 nmdc:mga08y16_46313_c1
1469 nmdc:mga08y16_48826_c1
1470 nmdc:mga08y16_707660_c1
1471 nmdc:mga08y16_7845_c1
1472 nmdc:mga0n895_10713_c1
1473 nmdc:mga0n895_11009_c1
1474 nmdc:mga0n895_186096_c1
1475 nmdc:mga0n895_218696_c1
1476 nmdc:mga0n895_3867_c1
1477 nmdc:mga0n895_968802_c1
1478 nmdc:mga0rr50_123773_c1
1479 nmdc:mga0rr50_16364_c1
1480 nmdc:mga0rr50_319066_c1
1481 nmdc:mga0rr50_386804_c1
1482 nmdc:mga0rr50_569018_c1
1483 nmdc:mga0rr50_90379_c1
1484 nmdc:mga08x19_127739_c1
1485 nmdc:mga08x19_200146_c1
1486 nmdc:mga08x19_375_c1
1487 nmdc:mga08x19_4952_c1
1488 nmdc:mga08x19_591298_c1
1489 nmdc:mga08x19_62866_c1
1490 nmdc:mga0a205_1027619_c1
1491 nmdc:mga0a205_1599_c1
1492 nmdc:mga0a205_211694_c1
1493 nmdc:mga0a205_57835_c1
1494 nmdc:mga0a205_651264_c1
1495 nmdc:mga0a205_742087_c1
1496 nmdc:mga0a205_745504_c1
1497 nmdc:mga0a205_76699_c1
1498 Ga0495601_0010036
1499 Ga0495595_0015779
1500 Ga0495595_0182921
1501 Ga0495619_0082090
1502 Ga0500641_0016899
1503 Ga0500658_0005736
1504 Ga0500568_0001502
1505 Ga0501084_0034303
1506 Ga0501084_0934115
1507 Ga0590071_042212
1508 Ga0590075_026696
1509 Ga0501082_0002802
1510 Ga0466962_0117165
1511 Ga0530510_0025258
1512 Ga0530510_0303098
1513 Ga0530510_0741910
1514 2509107478
1515 2509375813
1516 2510303345
1517 2511501838
1518 2512533276
1519 2513584697
1520 2513603939
1521 2513615407
1522 2513881195
1523 2513905664
1524 2513984377
1525 2514006164
1526 2515608701
1527 2516209632
1528 2516893133
1529 2517569889
1530 2524448896
1531 2551677973
1532 2551686754
1533 2551690979
1534 2551698954
1535 2551713829
1536 2551717857
1537 2551719337
1538 2551727830
1539 2551736530
1540 2551743891
1541 2558868082
1542 2585846773
1543 2657685865
1544 2692315908
1545 2753458826
1546 2792581857
1547 2792620097
1548 2792626484
1549 2792639414
1550 2802719163
1551 2802727394
1552 2802732176
1553 2802739106
1554 2802745006
1555 2802752281
1556 2804752312
1557 2838078940
1558 2847419027
1559 2848994059
1560 2850082075
1561 2855825934
1562 2855841284
1563 2855876702
1564 2857580398
1565 2858802262
1566 2896390806
1567 2913300911
1568 2915985531
1569 2915990346
1570 2915994855
1571 2916002763
1572 2916014479
1573 2916017363
1574 2916024018
1575 2916033220
1576 2916036720
1577 2916044288
1578 2916052226
1579 2916055545
1580 2916065285
1581 2916072084
1582 2916080920
1583 2920766149
1584 2921204855
1585 2921212602
1586 2921242346
1587 2921246571
1588 2921255175
1589 2921259603
1590 2921266966
1591 2921287354
1592 2921294138
1593 2921302602
1594 2924145997
1595 2924154545
1596 2924163062
1597 2924170308
1598 2924176344
1599 2924181399
1600 2924189846
1601 2924196544
1602 2924205828
1603 2924211221
1604 2924217378
1605 2924225027
1606 2924231441
1607 2936999585
1608 2937005985
1609 2937013275
1610 2937019340
1611 2937028915
1612 2937033651
1613 2937037151
1614 2937047512
1615 2937052468
1616 2937063616
1617 2937068092
1618 2937072992
1619 2937079318
1620 2937087871
1621 2937094088
1622 2937106237
1623 2937107998
1624 2937115222
1625 2937123351
1626 2937129112
1627 2957381476
1628 2957387511
1629 2957391795
1630 2957396630
1631 2957404883
1632 2957410920
1633 2957420142
1634 2957426249
1635 2957433926
1636 2957441132
1637 2957445705
1638 2957454639
1639 2957464006
1640 2957467828
1641 2957472447
1642 2957480715
1643 2957488539
1644 2957496654
1645 2957502659
1646 2957506827
1647 2960590096
1648 2960597316
1649 2960598263
1650 2960609660
1651 2960615174
1652 2960620883
1653 2960627587
1654 2960635920
1655 2960644681
1656 2960649029
1657 2960659241
1658 2960662178
1659 2960672717
1660 2960676456
1661 2960687268
1662 2960689918
1663 2960698407
1664 2964611738
1665 2964616928
1666 2964624616
1667 2964631106
1668 2964637556
1669 2964646449
1670 2964651670
1671 2964661622
1672 2964669891
1673 2964673903
1674 2964678476
1675 2964686878
1676 2964694396
1677 2964701579
1678 2964710989
1679 2964714168
1680 2964723453
1681 2967665128
1682 2967675530
1683 2967686167
1684 2967690101
1685 2967697464
1686 2967702835
1687 2967709051
1688 2967716822
1689 2967726371
1690 2967732734
1691 2967740057
1692 2967743298
1693 2967753747
1694 2967758692
1695 2967769276
1696 2967770917
1697 2967780318
1698 2970020397
1699 2970030842
1700 2970034448
1701 2970042539
1702 2970048930
1703 2970057098
1704 2970066184
1705 2970070859
1706 2970079274
1707 2970083688
1708 2970090454
1709 2970099190
1710 2970107442
1711 2970111642
1712 2970121938
1713 2970126719
1714 2970133426
1715 2970143235
1716 2970148090
1717 2970156379
1718 2970161623
1719 2970168176
1720 2970174712
1721 2970180538
1722 2970189331
1723 2970195806
1724 2977521416
1725 2977529295
1726 2977534801
1727 2977542572
1728 2977547763
1729 2977556381
1730 2977560941
1731 2977567910
1732 2977575179
1733 2977584246
1734 643825915
1735 648737502
1736 8003993789
1737 8049294869
1738 8054559902

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03205

MobB

Molybdopterin guanine dinucleotide synthesis protein B

34

166

0.98

PF03308

MeaB

Methylmalonyl Co-A mutase-associated GTPase MeaB

16

69

0.93

PF02492

cobW

CobW/HypB/UreG, nucleotide-binding domain

33

171

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b9d-assembly1.cif.gz_A human atl1 mutant - r77a bound to gdp 0.8713 2 28
5hci-assembly4.cif.gz_F-5 gpn-loop gtpase npa3 in complex with gdp 0.853 1 36
5hci-assembly2.cif.gz_B-3 gpn-loop gtpase npa3 in complex with gdp 0.8515 1 36
7oyd-assembly1.cif.gz_v cryo-em structure of a rabbit 80s ribosome with zebrafish dap1b 0.7968 2 24
1ii0-assembly2.cif.gz_B crystal structure of the escherichia coli arsenite-translocating atpase 0.79 2 36
ID Description Score Start End Superfamily
af_A0A1D8PEF9_556_791_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8742 1 34 3.40.50.300
af_Q5BK22_89_283_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8474 1 24 3.40.50.300
af_P47122_2_271_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8381 1 36 3.40.50.300
af_Q07657_23_341_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8296 1 23 3.40.50.300
af_A0A1D6I1M0_330_626_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8221 4 36 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A426FSQ4-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B 0.8025 2 163 GO:0005525
GO:0006777
AF-A0A1F4F8S5-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B 0.7999 1 164 GO:0005525
GO:0006777
AF-A0A238KQS4-F1-model_v4 Molybdopterin molybdenumtransferase (EC 2.10.1.1) 0.7964 1 164 GO:0005525
GO:0005829
GO:0006777
GO:0046872
GO:0061599
AF-A0A1F3ZVX0-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B 0.7951 1 164 GO:0005525
GO:0006777
AF-A0A0E9MI98-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein MobB 0.7951 1 164 GO:0005525
GO:0006777

Map