F484117
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 869 | 282 | 868 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10165459|Ga0157370_101654592 |
| Length | 203 |
| Sequence | MTMTKTTAAKALKVRTGTVKRDTTETQIALKLVIDGQGVYKVSTGIRFFDHMLELFTRHGGFDLTLKCTGDLDVDQHHTVEDVGIALGEAFDKKGIMRAGYFVMAMDETLAVAAVDLSGRVAYVVDDKVKVRLVGDFQSELLADFFDGFARGAKANVHVKTMYGRSNHHKIEAIFKAFARALRGACSRDERMREMLPSTKGLL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 2 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 82 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 83 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 84 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 85 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 134 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 138 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 139 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 140 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 143 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 144 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 145 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 146 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 147 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 148 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 149 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 150 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 153 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 158 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 159 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 160 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 161 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 162 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 164 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 165 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 167 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 169 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 175 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 176 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 177 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 178 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 179 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 180 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 181 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 182 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 183 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 184 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 185 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 186 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 187 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 188 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 248 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 249 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 250 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 251 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 257 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 258 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 259 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 278 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 279 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 280 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 281 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.88 |
| Metatranscriptomes | 0 |
| Isolates | 0.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.04 |
| Nodule | 0 |
| Rhizoplane | 3.11 |
| Rhizosphere | 94.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1013739 | 3300003214 | Bacteria | 1109 |
| 2 | rootH2_10009426 | 3300003320 | Bacteria | 39179 |
| 3 | Ga0065712_10479514 | 3300005290 | Bacteria | 664 |
| 4 | Ga0070658_10000121 | 3300005327 | Bacteria | 70439 |
| 5 | Ga0070658_10021582 | 3300005327 | Bacteria | 5160 |
| 6 | Ga0070658_10071707 | 3300005327 | Bacteria | 2837 |
| 7 | Ga0070658_10112053 | 3300005327 | Bacteria | 2261 |
| 8 | Ga0070658_10196354 | 3300005327 | Bacteria | 1702 |
| 9 | Ga0070658_10205977 | 3300005327 | Bacteria | 1661 |
| 10 | Ga0070658_10272828 | 3300005327 | Unclassified | 1439 |
| 11 | Ga0070676_10067377 | 3300005328 | Bacteria | 2140 |
| 12 | Ga0070683_100002041 | 3300005329 | Bacteria | 15901 |
| 13 | Ga0070683_100028772 | 3300005329 | Bacteria | 5025 |
| 14 | Ga0070683_100060569 | 3300005329 | Bacteria | 3518 |
| 15 | Ga0070683_100062351 | 3300005329 | Bacteria | 3467 |
| 16 | Ga0070683_100221096 | 3300005329 | Bacteria | 1800 |
| 17 | Ga0070683_100285059 | 3300005329 | Bacteria | 1571 |
| 18 | Ga0070670_100079127 | 3300005331 | Bacteria | 2825 |
| 19 | Ga0068869_100095013 | 3300005334 | Bacteria | 2248 |
| 20 | Ga0068869_100247235 | 3300005334 | Bacteria | 1423 |
| 21 | Ga0070666_10055265 | 3300005335 | Bacteria | 2680 |
| 22 | Ga0070666_10070170 | 3300005335 | Bacteria | 2383 |
| 23 | Ga0070682_100242035 | 3300005337 | Bacteria | 1295 |
| 24 | Ga0068868_100000066 | 3300005338 | Bacteria | 59945 |
| 25 | Ga0068868_100065060 | 3300005338 | Bacteria | 2896 |
| 26 | Ga0068868_100081115 | 3300005338 | Bacteria | 2600 |
| 27 | Ga0068868_100488108 | 3300005338 | Bacteria | 1077 |
| 28 | Ga0070660_100008313 | 3300005339 | Bacteria | 7255 |
| 29 | Ga0070660_100155643 | 3300005339 | Bacteria | 1839 |
| 30 | Ga0070660_100232314 | 3300005339 | Unclassified | 1501 |
| 31 | Ga0070660_100637198 | 3300005339 | Unclassified | 892 |
| 32 | Ga0070660_100663456 | 3300005339 | Bacteria | 874 |
| 33 | Ga0070661_100019981 | 3300005344 | Bacteria | 4774 |
| 34 | Ga0070661_100050615 | 3300005344 | Bacteria | 3040 |
| 35 | Ga0070661_100066000 | 3300005344 | Bacteria | 2659 |
| 36 | Ga0070661_100153801 | 3300005344 | Bacteria | 1740 |
| 37 | Ga0070661_100701045 | 3300005344 | Unclassified | 825 |
| 38 | Ga0070668_100695790 | 3300005347 | Bacteria | 896 |
| 39 | Ga0070671_100003123 | 3300005355 | Bacteria | 12901 |
| 40 | Ga0070671_100050619 | 3300005355 | Bacteria | 3455 |
| 41 | Ga0070671_100117926 | 3300005355 | Bacteria | 2232 |
| 42 | Ga0070671_100446435 | 3300005355 | Bacteria | 1109 |
| 43 | Ga0070673_100070243 | 3300005364 | Bacteria | 2809 |
| 44 | Ga0070673_100191444 | 3300005364 | Bacteria | 1757 |
| 45 | Ga0070659_100004580 | 3300005366 | Bacteria | 9889 |
| 46 | Ga0070659_100138892 | 3300005366 | Bacteria | 1978 |
| 47 | Ga0070659_100234782 | 3300005366 | Bacteria | 1516 |
| 48 | Ga0070659_100689205 | 3300005366 | Bacteria | 883 |
| 49 | Ga0070667_100046288 | 3300005367 | Bacteria | 3659 |
| 50 | Ga0070667_100246795 | 3300005367 | Bacteria | 1595 |
| 51 | Ga0070709_10166887 | 3300005434 | Unclassified | 1535 |
| 52 | Ga0070709_10356466 | 3300005434 | Bacteria | 1082 |
| 53 | Ga0070709_10501912 | 3300005434 | Unclassified | 922 |
| 54 | Ga0070714_100002654 | 3300005435 | Bacteria | 13178 |
| 55 | Ga0070714_100091602 | 3300005435 | Bacteria | 2664 |
| 56 | Ga0070714_100105232 | 3300005435 | Unclassified | 2491 |
| 57 | Ga0070714_100116911 | 3300005435 | Bacteria | 2368 |
| 58 | Ga0070714_100154671 | 3300005435 | Bacteria | 2069 |
| 59 | Ga0070714_100161553 | 3300005435 | Bacteria | 2027 |
| 60 | Ga0070714_100188384 | 3300005435 | Bacteria | 1881 |
| 61 | Ga0070714_100200420 | 3300005435 | Bacteria | 1825 |
| 62 | Ga0070713_100003005 | 3300005436 | Bacteria | 11079 |
| 63 | Ga0070713_100023543 | 3300005436 | Bacteria | 4780 |
| 64 | Ga0070713_100082409 | 3300005436 | Bacteria | 2747 |
| 65 | Ga0070713_100162511 | 3300005436 | Bacteria | 1994 |
| 66 | Ga0070713_100196366 | 3300005436 | Bacteria | 1820 |
| 67 | Ga0070713_100257582 | 3300005436 | Bacteria | 1593 |
| 68 | Ga0070713_100433308 | 3300005436 | Bacteria | 1232 |
| 69 | Ga0070713_100631919 | 3300005436 | Unclassified | 1019 |
| 70 | Ga0070713_101077027 | 3300005436 | Bacteria | 776 |
| 71 | Ga0070710_10032530 | 3300005437 | Bacteria | 2826 |
| 72 | Ga0070710_10192885 | 3300005437 | Bacteria | 1282 |
| 73 | Ga0070710_10266048 | 3300005437 | Bacteria | 1107 |
| 74 | Ga0070711_100019179 | 3300005439 | Bacteria | 4384 |
| 75 | Ga0070711_100022563 | 3300005439 | Bacteria | 4081 |
| 76 | Ga0070711_100775332 | 3300005439 | Bacteria | 812 |
| 77 | Ga0070663_100053467 | 3300005455 | Bacteria | 2883 |
| 78 | Ga0070663_100130863 | 3300005455 | Bacteria | 1905 |
| 79 | Ga0070663_100182632 | 3300005455 | Bacteria | 1628 |
| 80 | Ga0070663_100321159 | 3300005455 | Bacteria | 1245 |
| 81 | Ga0070663_100479477 | 3300005455 | Bacteria | 1029 |
| 82 | Ga0070663_100498539 | 3300005455 | Bacteria | 1011 |
| 83 | Ga0070678_100600428 | 3300005456 | Bacteria | 983 |
| 84 | Ga0070662_100215752 | 3300005457 | Bacteria | 1529 |
| 85 | Ga0070681_10001050 | 3300005458 | Bacteria | 23493 |
| 86 | Ga0070681_10095557 | 3300005458 | Bacteria | 2920 |
| 87 | Ga0070681_10589316 | 3300005458 | Bacteria | 1026 |
| 88 | Ga0070681_10966872 | 3300005458 | Bacteria | 771 |
| 89 | Ga0068867_100354254 | 3300005459 | Bacteria | 1226 |
| 90 | Ga0070679_100003993 | 3300005530 | Bacteria | 13587 |
| 91 | Ga0070679_100006128 | 3300005530 | Bacteria | 11185 |
| 92 | Ga0070679_100135818 | 3300005530 | Bacteria | 2440 |
| 93 | Ga0070679_100162327 | 3300005530 | Bacteria | 2209 |
| 94 | Ga0070679_100369870 | 3300005530 | Bacteria | 1381 |
| 95 | Ga0070679_100468964 | 3300005530 | Bacteria | 1203 |
| 96 | Ga0070679_100515342 | 3300005530 | Bacteria | 1140 |
| 97 | Ga0070679_100987841 | 3300005530 | Bacteria | 786 |
| 98 | Ga0070679_101067564 | 3300005530 | Bacteria | 752 |
| 99 | Ga0070684_100011551 | 3300005535 | Bacteria | 7035 |
| 100 | Ga0070684_100107048 | 3300005535 | Bacteria | 2504 |
| 101 | Ga0070684_100165684 | 3300005535 | Bacteria | 2006 |
| 102 | Ga0070684_100273521 | 3300005535 | Bacteria | 1547 |
| 103 | Ga0070684_100312272 | 3300005535 | Bacteria | 1443 |
| 104 | Ga0070684_100393724 | 3300005535 | Bacteria | 1277 |
| 105 | Ga0070684_100696362 | 3300005535 | Bacteria | 947 |
| 106 | Ga0068853_100000222 | 3300005539 | Bacteria | 40206 |
| 107 | Ga0068853_100000367 | 3300005539 | Bacteria | 31060 |
| 108 | Ga0068853_100043702 | 3300005539 | Bacteria | 3833 |
| 109 | Ga0068853_100070755 | 3300005539 | Bacteria | 3037 |
| 110 | Ga0068853_100130644 | 3300005539 | Bacteria | 2248 |
| 111 | Ga0068853_100237710 | 3300005539 | Bacteria | 1669 |
| 112 | Ga0068853_100327147 | 3300005539 | Bacteria | 1422 |
| 113 | Ga0068853_100336512 | 3300005539 | Bacteria | 1402 |
| 114 | Ga0068853_100960524 | 3300005539 | Bacteria | 822 |
| 115 | Ga0070665_100005637 | 3300005548 | Bacteria | 12872 |
| 116 | Ga0070665_100041617 | 3300005548 | Bacteria | 4619 |
| 117 | Ga0070665_100158518 | 3300005548 | Bacteria | 2265 |
| 118 | Ga0070665_100181688 | 3300005548 | Bacteria | 2104 |
| 119 | Ga0070665_100403581 | 3300005548 | Bacteria | 1375 |
| 120 | Ga0068855_100000277 | 3300005563 | Bacteria | 63213 |
| 121 | Ga0068855_100002688 | 3300005563 | Bacteria | 21925 |
| 122 | Ga0068855_100003653 | 3300005563 | Bacteria | 18822 |
| 123 | Ga0068855_100010384 | 3300005563 | Bacteria | 11233 |
| 124 | Ga0068855_100035334 | 3300005563 | Bacteria | 5953 |
| 125 | Ga0068855_100060121 | 3300005563 | Bacteria | 4444 |
| 126 | Ga0068855_100092013 | 3300005563 | Bacteria | 3498 |
| 127 | Ga0068855_100169055 | 3300005563 | Bacteria | 2477 |
| 128 | Ga0068855_100181173 | 3300005563 | Bacteria | 2381 |
| 129 | Ga0068855_100218171 | 3300005563 | Bacteria | 2140 |
| 130 | Ga0068855_100278975 | 3300005563 | Bacteria | 1856 |
| 131 | Ga0068855_100301117 | 3300005563 | Bacteria | 1775 |
| 132 | Ga0068855_100468401 | 3300005563 | Bacteria | 1373 |
| 133 | Ga0068855_100584895 | 3300005563 | Bacteria | 1205 |
| 134 | Ga0068855_101193853 | 3300005563 | Bacteria | 791 |
| 135 | Ga0070664_100124085 | 3300005564 | Bacteria | 2263 |
| 136 | Ga0070664_100592049 | 3300005564 | Bacteria | 1028 |
| 137 | Ga0070664_100734426 | 3300005564 | Bacteria | 921 |
| 138 | Ga0068857_100003191 | 3300005577 | Bacteria | 13595 |
| 139 | Ga0068857_100015817 | 3300005577 | Bacteria | 6601 |
| 140 | Ga0068857_100306068 | 3300005577 | Bacteria | 1466 |
| 141 | Ga0068857_100355705 | 3300005577 | Bacteria | 1357 |
| 142 | Ga0068857_101079678 | 3300005577 | Bacteria | 775 |
| 143 | Ga0068854_100000019 | 3300005578 | Bacteria | 134145 |
| 144 | Ga0068854_100034075 | 3300005578 | Bacteria | 3554 |
| 145 | Ga0068854_100044343 | 3300005578 | Bacteria | 3156 |
| 146 | Ga0068856_100003529 | 3300005614 | Bacteria | 15773 |
| 147 | Ga0068856_100033069 | 3300005614 | Bacteria | 5063 |
| 148 | Ga0068856_100050428 | 3300005614 | Bacteria | 4103 |
| 149 | Ga0068856_100057606 | 3300005614 | Bacteria | 3836 |
| 150 | Ga0068856_100085887 | 3300005614 | Bacteria | 3126 |
| 151 | Ga0068856_100227971 | 3300005614 | Bacteria | 1878 |
| 152 | Ga0068856_100413541 | 3300005614 | Bacteria | 1369 |
| 153 | Ga0068856_100509145 | 3300005614 | Bacteria | 1225 |
| 154 | Ga0068856_100709163 | 3300005614 | Bacteria | 1026 |
| 155 | Ga0068852_100000019 | 3300005616 | Bacteria | 129021 |
| 156 | Ga0068852_100000097 | 3300005616 | Bacteria | 59430 |
| 157 | Ga0068852_100001535 | 3300005616 | Bacteria | 15668 |
| 158 | Ga0068852_100097697 | 3300005616 | Bacteria | 2642 |
| 159 | Ga0068852_100103163 | 3300005616 | Bacteria | 2579 |
| 160 | Ga0068852_100113488 | 3300005616 | Bacteria | 2468 |
| 161 | Ga0068852_100161107 | 3300005616 | Bacteria | 2095 |
| 162 | Ga0068852_100168947 | 3300005616 | Bacteria | 2048 |
| 163 | Ga0068859_100120087 | 3300005617 | Bacteria | 2695 |
| 164 | Ga0068864_100000625 | 3300005618 | Bacteria | 29830 |
| 165 | Ga0068864_100012167 | 3300005618 | Bacteria | 7112 |
| 166 | Ga0068864_100092202 | 3300005618 | Bacteria | 2674 |
| 167 | Ga0068851_10016393 | 3300005834 | Bacteria | 3544 |
| 168 | Ga0068851_10041070 | 3300005834 | Bacteria | 2326 |
| 169 | Ga0068851_10051580 | 3300005834 | Bacteria | 2090 |
| 170 | Ga0068851_10058980 | 3300005834 | Bacteria | 1963 |
| 171 | Ga0068851_10167950 | 3300005834 | Bacteria | 1209 |
| 172 | Ga0068851_10306247 | 3300005834 | Unclassified | 915 |
| 173 | Ga0068863_100001753 | 3300005841 | Bacteria | 21524 |
| 174 | Ga0068863_100001814 | 3300005841 | Bacteria | 21208 |
| 175 | Ga0068863_100007046 | 3300005841 | Bacteria | 11016 |
| 176 | Ga0068858_100014586 | 3300005842 | Bacteria | 7404 |
| 177 | Ga0068858_100015914 | 3300005842 | Bacteria | 7067 |
| 178 | Ga0068860_100000689 | 3300005843 | Bacteria | 38878 |
| 179 | Ga0068860_100510378 | 3300005843 | Bacteria | 1201 |
| 180 | Ga0068862_100293795 | 3300005844 | Bacteria | 1493 |
| 181 | Ga0070717_10011247 | 3300006028 | Bacteria | 6789 |
| 182 | Ga0070717_10011904 | 3300006028 | Bacteria | 6620 |
| 183 | Ga0070717_10342393 | 3300006028 | Bacteria | 1335 |
| 184 | Ga0070715_10002310 | 3300006163 | Bacteria | 5819 |
| 185 | Ga0070716_100059060 | 3300006173 | Bacteria | 2210 |
| 186 | Ga0070712_100012762 | 3300006175 | Bacteria | 5347 |
| 187 | Ga0070712_100044876 | 3300006175 | Bacteria | 3049 |
| 188 | Ga0070712_100340838 | 3300006175 | Bacteria | 1224 |
| 189 | Ga0070712_100610888 | 3300006175 | Bacteria | 924 |
| 190 | Ga0097621_100000349 | 3300006237 | Bacteria | 31779 |
| 191 | Ga0097621_100360082 | 3300006237 | Bacteria | 1296 |
| 192 | Ga0097621_100505098 | 3300006237 | Bacteria | 1095 |
| 193 | Ga0068871_100002325 | 3300006358 | Bacteria | 12946 |
| 194 | Ga0068871_100788000 | 3300006358 | Bacteria | 875 |
| 195 | Ga0068865_100136913 | 3300006881 | Bacteria | 1842 |
| 196 | Ga0075436_100648537 | 3300006914 | Bacteria | 780 |
| 197 | Ga0097620_100120081 | 3300006931 | Bacteria | 2695 |
| 198 | Ga0105240_10000372 | 3300009093 | Bacteria | 84325 |
| 199 | Ga0105240_10000496 | 3300009093 | Bacteria | 72575 |
| 200 | Ga0105240_10001875 | 3300009093 | Bacteria | 34957 |
| 201 | Ga0105240_10009346 | 3300009093 | Bacteria | 13895 |
| 202 | Ga0105240_10010838 | 3300009093 | Bacteria | 12767 |
| 203 | Ga0105240_10030875 | 3300009093 | Bacteria | 6960 |
| 204 | Ga0105240_10039085 | 3300009093 | Bacteria | 6080 |
| 205 | Ga0105240_10087131 | 3300009093 | Bacteria | 3824 |
| 206 | Ga0105240_10097071 | 3300009093 | Bacteria | 3591 |
| 207 | Ga0105240_10120373 | 3300009093 | Bacteria | 3161 |
| 208 | Ga0105240_10122860 | 3300009093 | Bacteria | 3124 |
| 209 | Ga0105240_10152229 | 3300009093 | Bacteria | 2754 |
| 210 | Ga0105240_11390657 | 3300009093 | Bacteria | 738 |
| 211 | Ga0105245_10000486 | 3300009098 | Bacteria | 36378 |
| 212 | Ga0105245_10021587 | 3300009098 | Bacteria | 5650 |
| 213 | Ga0105245_10085606 | 3300009098 | Bacteria | 2889 |
| 214 | Ga0105245_10443589 | 3300009098 | Bacteria | 1305 |
| 215 | Ga0105245_10513291 | 3300009098 | Bacteria | 1216 |
| 216 | Ga0105247_10002346 | 3300009101 | Bacteria | 12922 |
| 217 | Ga0105247_10292438 | 3300009101 | Bacteria | 1127 |
| 218 | Ga0114129_11396355 | 3300009147 | Bacteria | 864 |
| 219 | Ga0105241_10000026 | 3300009174 | Bacteria | 132695 |
| 220 | Ga0105241_10000121 | 3300009174 | Bacteria | 57041 |
| 221 | Ga0105241_10002032 | 3300009174 | Bacteria | 15308 |
| 222 | Ga0105241_10213745 | 3300009174 | Bacteria | 1617 |
| 223 | Ga0105241_10232573 | 3300009174 | Unclassified | 1554 |
| 224 | Ga0105242_10298302 | 3300009176 | Unclassified | 1470 |
| 225 | Ga0105248_10000019 | 3300009177 | Bacteria | 285766 |
| 226 | Ga0105248_10007017 | 3300009177 | Bacteria | 12337 |
| 227 | Ga0105248_10016372 | 3300009177 | Bacteria | 8160 |
| 228 | Ga0105248_10022327 | 3300009177 | Bacteria | 7018 |
| 229 | Ga0105248_10029618 | 3300009177 | Bacteria | 6107 |
| 230 | Ga0105248_10042895 | 3300009177 | Bacteria | 5072 |
| 231 | Ga0105248_10094941 | 3300009177 | Bacteria | 3358 |
| 232 | Ga0105248_10477210 | 3300009177 | Bacteria | 1406 |
| 233 | Ga0105248_10578479 | 3300009177 | Bacteria | 1267 |
| 234 | Ga0105248_10765535 | 3300009177 | Bacteria | 1089 |
| 235 | Ga0105248_10796820 | 3300009177 | Bacteria | 1066 |
| 236 | Ga0105237_10000590 | 3300009545 | Bacteria | 50564 |
| 237 | Ga0105237_10006331 | 3300009545 | Bacteria | 13155 |
| 238 | Ga0105237_10063825 | 3300009545 | Bacteria | 3680 |
| 239 | Ga0105237_10137842 | 3300009545 | Bacteria | 2434 |
| 240 | Ga0105237_10212808 | 3300009545 | Bacteria | 1932 |
| 241 | Ga0105237_10248368 | 3300009545 | Bacteria | 1781 |
| 242 | Ga0105237_10575017 | 3300009545 | Bacteria | 1134 |
| 243 | Ga0105237_10627141 | 3300009545 | Bacteria | 1082 |
| 244 | Ga0105237_10812540 | 3300009545 | Bacteria | 942 |
| 245 | Ga0105238_10000197 | 3300009551 | Bacteria | 66637 |
| 246 | Ga0105238_10000509 | 3300009551 | Bacteria | 40868 |
| 247 | Ga0105238_10008072 | 3300009551 | Bacteria | 10529 |
| 248 | Ga0105238_10023794 | 3300009551 | Bacteria | 6244 |
| 249 | Ga0105238_10026652 | 3300009551 | Bacteria | 5892 |
| 250 | Ga0105238_10054460 | 3300009551 | Bacteria | 4017 |
| 251 | Ga0105238_10078759 | 3300009551 | Bacteria | 3286 |
| 252 | Ga0105238_10201945 | 3300009551 | Bacteria | 1963 |
| 253 | Ga0105238_10251055 | 3300009551 | Bacteria | 1747 |
| 254 | Ga0105238_10314767 | 3300009551 | Bacteria | 1550 |
| 255 | Ga0105238_10355224 | 3300009551 | Bacteria | 1455 |
| 256 | Ga0105249_10003449 | 3300009553 | Bacteria | 13698 |
| 257 | Ga0105249_10081598 | 3300009553 | Bacteria | 3006 |
| 258 | Ga0105249_11113285 | 3300009553 | Unclassified | 860 |
| 259 | Ga0105249_11268700 | 3300009553 | Bacteria | 808 |
| 260 | Ga0105239_10001533 | 3300010375 | Bacteria | 30534 |
| 261 | Ga0105239_10003046 | 3300010375 | Bacteria | 20836 |
| 262 | Ga0105239_10105415 | 3300010375 | Bacteria | 3122 |
| 263 | Ga0105239_10246339 | 3300010375 | Bacteria | 2007 |
| 264 | Ga0105239_10857536 | 3300010375 | Bacteria | 1042 |
| 265 | Ga0105246_10001192 | 3300011119 | Bacteria | 15150 |
| 266 | Ga0105246_10119528 | 3300011119 | Bacteria | 1950 |
| 267 | Ga0157373_10225234 | 3300013100 | Bacteria | 1323 |
| 268 | Ga0157370_10000170 | 3300013104 | Bacteria | 80529 |
| 269 | Ga0157370_10010160 | 3300013104 | Bacteria | 9939 |
| 270 | Ga0157370_10012988 | 3300013104 | Bacteria | 8605 |
| 271 | Ga0157370_10013763 | 3300013104 | Bacteria | 8313 |
| 272 | Ga0157370_10046758 | 3300013104 | Unclassified | 4149 |
| 273 | Ga0157370_10165459 | 3300013104 | Bacteria | 2057 |
| 274 | Ga0157370_10171680 | 3300013104 | Bacteria | 2016 |
| 275 | Ga0157370_10752683 | 3300013104 | Bacteria | 888 |
| 276 | Ga0157369_10000085 | 3300013105 | Bacteria | 129025 |
| 277 | Ga0157369_10000430 | 3300013105 | Bacteria | 55736 |
| 278 | Ga0157369_10009218 | 3300013105 | Bacteria | 11289 |
| 279 | Ga0157369_10012659 | 3300013105 | Bacteria | 9566 |
| 280 | Ga0157369_10028989 | 3300013105 | Bacteria | 6121 |
| 281 | Ga0157369_10040085 | 3300013105 | Bacteria | 5115 |
| 282 | Ga0157369_10042189 | 3300013105 | Bacteria | 4977 |
| 283 | Ga0157369_10054976 | 3300013105 | Bacteria | 4298 |
| 284 | Ga0157369_10096566 | 3300013105 | Bacteria | 3153 |
| 285 | Ga0157369_10098891 | 3300013105 | Bacteria | 3110 |
| 286 | Ga0157369_10115794 | 3300013105 | Bacteria | 2847 |
| 287 | Ga0157369_10172157 | 3300013105 | Bacteria | 2281 |
| 288 | Ga0157369_10192237 | 3300013105 | Bacteria | 2144 |
| 289 | Ga0157369_10206790 | 3300013105 | Bacteria | 2058 |
| 290 | Ga0157369_10344813 | 3300013105 | Unclassified | 1547 |
| 291 | Ga0157369_10371511 | 3300013105 | Bacteria | 1484 |
| 292 | Ga0157369_10540699 | 3300013105 | Bacteria | 1204 |
| 293 | Ga0157369_10729791 | 3300013105 | Bacteria | 1020 |
| 294 | Ga0157369_11101743 | 3300013105 | Bacteria | 812 |
| 295 | Ga0157374_10023020 | 3300013296 | Bacteria | 5565 |
| 296 | Ga0157374_10042034 | 3300013296 | Bacteria | 4215 |
| 297 | Ga0157374_10084229 | 3300013296 | Bacteria | 3022 |
| 298 | Ga0157374_10238777 | 3300013296 | Bacteria | 1787 |
| 299 | Ga0157374_10325896 | 3300013296 | Bacteria | 1523 |
| 300 | Ga0157374_10447875 | 3300013296 | Bacteria | 1292 |
| 301 | Ga0157374_10498754 | 3300013296 | Bacteria | 1222 |
| 302 | Ga0157374_10827694 | 3300013296 | Bacteria | 942 |
| 303 | Ga0157378_10023973 | 3300013297 | Bacteria | 5367 |
| 304 | Ga0157378_10131240 | 3300013297 | Bacteria | 2319 |
| 305 | Ga0163162_10027442 | 3300013306 | Bacteria | 5631 |
| 306 | Ga0163162_10158863 | 3300013306 | Bacteria | 2382 |
| 307 | Ga0163162_11275508 | 3300013306 | Bacteria | 834 |
| 308 | Ga0157372_10000217 | 3300013307 | Bacteria | 63667 |
| 309 | Ga0157372_10002601 | 3300013307 | Bacteria | 19543 |
| 310 | Ga0157372_10002611 | 3300013307 | Bacteria | 19494 |
| 311 | Ga0157372_10010870 | 3300013307 | Bacteria | 9688 |
| 312 | Ga0157372_10063864 | 3300013307 | Bacteria | 4130 |
| 313 | Ga0157372_10204729 | 3300013307 | Bacteria | 2286 |
| 314 | Ga0157372_10206180 | 3300013307 | Bacteria | 2278 |
| 315 | Ga0157372_10348925 | 3300013307 | Bacteria | 1724 |
| 316 | Ga0157372_10403380 | 3300013307 | Bacteria | 1593 |
| 317 | Ga0157372_10569693 | 3300013307 | Bacteria | 1320 |
| 318 | Ga0157375_10057497 | 3300013308 | Bacteria | 3845 |
| 319 | Ga0157375_10066677 | 3300013308 | Bacteria | 3595 |
| 320 | Ga0157375_10069334 | 3300013308 | Bacteria | 3532 |
| 321 | Ga0163163_10001161 | 3300014325 | Bacteria | 22403 |
| 322 | Ga0163163_10017757 | 3300014325 | Bacteria | 6641 |
| 323 | Ga0163163_10062243 | 3300014325 | Bacteria | 3697 |
| 324 | Ga0163163_10580801 | 3300014325 | Bacteria | 1184 |
| 325 | Ga0157377_10199620 | 3300014745 | Bacteria | 1269 |
| 326 | Ga0157379_10002312 | 3300014968 | Bacteria | 15882 |
| 327 | Ga0157379_10048162 | 3300014968 | Bacteria | 3804 |
| 328 | Ga0157379_10161237 | 3300014968 | Bacteria | 2024 |
| 329 | Ga0157379_10287290 | 3300014968 | Bacteria | 1497 |
| 330 | Ga0157379_10308107 | 3300014968 | Bacteria | 1444 |
| 331 | Ga0157376_10004372 | 3300014969 | Bacteria | 9831 |
| 332 | Ga0157376_10737860 | 3300014969 | Bacteria | 993 |
| 333 | Ga0157376_11689302 | 3300014969 | Bacteria | 668 |
| 334 | Ga0163161_10044573 | 3300017792 | Bacteria | 3195 |
| 335 | Ga0213872_10002341 | 3300021361 | Bacteria | 11261 |
| 336 | Ga0213872_10034756 | 3300021361 | Bacteria | 2306 |
| 337 | Ga0213872_10051363 | 3300021361 | Bacteria | 1871 |
| 338 | Ga0213872_10054105 | 3300021361 | Bacteria | 1820 |
| 339 | Ga0213875_10000108 | 3300021388 | Bacteria | 94421 |
| 340 | Ga0213875_10219442 | 3300021388 | Bacteria | 896 |
| 341 | Ga0213871_10006004 | 3300021441 | Bacteria | 2545 |
| 342 | Ga0224572_1008454 | 3300024225 | Bacteria | 1903 |
| 343 | Ga0209233_1001442 | 3300025261 | Bacteria | 9385 |
| 344 | Ga0207656_10031201 | 3300025321 | Bacteria | 2206 |
| 345 | Ga0207656_10031615 | 3300025321 | Bacteria | 2194 |
| 346 | Ga0207656_10048760 | 3300025321 | Bacteria | 1824 |
| 347 | Ga0207656_10196195 | 3300025321 | Bacteria | 974 |
| 348 | Ga0207656_10364668 | 3300025321 | Bacteria | 722 |
| 349 | Ga0207692_10438543 | 3300025898 | Bacteria | 820 |
| 350 | Ga0207692_10444087 | 3300025898 | Bacteria | 815 |
| 351 | Ga0207710_10317441 | 3300025900 | Bacteria | 789 |
| 352 | Ga0207680_10030474 | 3300025903 | Bacteria | 3043 |
| 353 | Ga0207680_10204305 | 3300025903 | Bacteria | 1348 |
| 354 | Ga0207647_10078008 | 3300025904 | Bacteria | 1990 |
| 355 | Ga0207647_10125849 | 3300025904 | Bacteria | 1508 |
| 356 | Ga0207699_10125619 | 3300025906 | Bacteria | 1665 |
| 357 | Ga0207699_10680378 | 3300025906 | Bacteria | 752 |
| 358 | Ga0207645_10116005 | 3300025907 | Bacteria | 1736 |
| 359 | Ga0207705_10000021 | 3300025909 | Bacteria | 309436 |
| 360 | Ga0207705_10002125 | 3300025909 | Bacteria | 15376 |
| 361 | Ga0207705_10002923 | 3300025909 | Bacteria | 13059 |
| 362 | Ga0207705_10012875 | 3300025909 | Bacteria | 6038 |
| 363 | Ga0207705_10021055 | 3300025909 | Bacteria | 4651 |
| 364 | Ga0207705_10027435 | 3300025909 | Bacteria | 4060 |
| 365 | Ga0207705_10028574 | 3300025909 | Bacteria | 3976 |
| 366 | Ga0207705_10107321 | 3300025909 | Bacteria | 2060 |
| 367 | Ga0207705_10282735 | 3300025909 | Bacteria | 1270 |
| 368 | Ga0207705_10294604 | 3300025909 | Bacteria | 1243 |
| 369 | Ga0207705_10332471 | 3300025909 | Bacteria | 1169 |
| 370 | Ga0207654_10000054 | 3300025911 | Bacteria | 82347 |
| 371 | Ga0207654_10000281 | 3300025911 | Bacteria | 30979 |
| 372 | Ga0207654_10000808 | 3300025911 | Bacteria | 17242 |
| 373 | Ga0207654_10083730 | 3300025911 | Bacteria | 1926 |
| 374 | Ga0207654_10233283 | 3300025911 | Bacteria | 1226 |
| 375 | Ga0207654_10251596 | 3300025911 | Bacteria | 1185 |
| 376 | Ga0207707_10003864 | 3300025912 | Bacteria | 13285 |
| 377 | Ga0207707_10142923 | 3300025912 | Unclassified | 2092 |
| 378 | Ga0207707_10322003 | 3300025912 | Bacteria | 1335 |
| 379 | Ga0207707_10465465 | 3300025912 | Bacteria | 1081 |
| 380 | Ga0207707_10659207 | 3300025912 | Bacteria | 881 |
| 381 | Ga0207695_10000080 | 3300025913 | Bacteria | 287868 |
| 382 | Ga0207695_10000113 | 3300025913 | Bacteria | 247240 |
| 383 | Ga0207695_10000167 | 3300025913 | Bacteria | 194371 |
| 384 | Ga0207695_10000263 | 3300025913 | Bacteria | 132894 |
| 385 | Ga0207695_10001106 | 3300025913 | Bacteria | 46871 |
| 386 | Ga0207695_10001762 | 3300025913 | Bacteria | 34278 |
| 387 | Ga0207695_10033351 | 3300025913 | Bacteria | 5617 |
| 388 | Ga0207695_10072087 | 3300025913 | Bacteria | 3526 |
| 389 | Ga0207695_10083832 | 3300025913 | Bacteria | 3219 |
| 390 | Ga0207695_10090502 | 3300025913 | Bacteria | 3075 |
| 391 | Ga0207695_10125292 | 3300025913 | Bacteria | 2532 |
| 392 | Ga0207695_10464491 | 3300025913 | Bacteria | 1149 |
| 393 | Ga0207695_10723985 | 3300025913 | Bacteria | 875 |
| 394 | Ga0207671_10000065 | 3300025914 | Bacteria | 166743 |
| 395 | Ga0207671_10000123 | 3300025914 | Bacteria | 119385 |
| 396 | Ga0207671_10000139 | 3300025914 | Bacteria | 111786 |
| 397 | Ga0207671_10086096 | 3300025914 | Bacteria | 2362 |
| 398 | Ga0207671_10218141 | 3300025914 | Bacteria | 1494 |
| 399 | Ga0207693_10002600 | 3300025915 | Bacteria | 15685 |
| 400 | Ga0207693_10059168 | 3300025915 | Bacteria | 3001 |
| 401 | Ga0207693_10405560 | 3300025915 | Bacteria | 1065 |
| 402 | Ga0207663_10016822 | 3300025916 | Bacteria | 4066 |
| 403 | Ga0207663_10023940 | 3300025916 | Bacteria | 3512 |
| 404 | Ga0207663_10519219 | 3300025916 | Bacteria | 927 |
| 405 | Ga0207660_10111242 | 3300025917 | Bacteria | 2061 |
| 406 | Ga0207660_10271414 | 3300025917 | Bacteria | 1344 |
| 407 | Ga0207660_10304040 | 3300025917 | Bacteria | 1270 |
| 408 | Ga0207657_10004623 | 3300025919 | Bacteria | 14538 |
| 409 | Ga0207657_10019482 | 3300025919 | Bacteria | 6442 |
| 410 | Ga0207657_10036579 | 3300025919 | Bacteria | 4393 |
| 411 | Ga0207657_10205754 | 3300025919 | Bacteria | 1581 |
| 412 | Ga0207657_10347439 | 3300025919 | Unclassified | 1170 |
| 413 | Ga0207657_10565120 | 3300025919 | Bacteria | 889 |
| 414 | Ga0207649_10031894 | 3300025920 | Bacteria | 3135 |
| 415 | Ga0207649_10051782 | 3300025920 | Bacteria | 2544 |
| 416 | Ga0207652_10001535 | 3300025921 | Bacteria | 20348 |
| 417 | Ga0207652_10036402 | 3300025921 | Bacteria | 4160 |
| 418 | Ga0207652_10547214 | 3300025921 | Bacteria | 1040 |
| 419 | Ga0207694_10000248 | 3300025924 | Bacteria | 51461 |
| 420 | Ga0207694_10000711 | 3300025924 | Bacteria | 29920 |
| 421 | Ga0207694_10048093 | 3300025924 | Bacteria | 3300 |
| 422 | Ga0207694_10062538 | 3300025924 | Bacteria | 2898 |
| 423 | Ga0207694_10078380 | 3300025924 | Bacteria | 2590 |
| 424 | Ga0207694_10139468 | 3300025924 | Bacteria | 1949 |
| 425 | Ga0207694_10273841 | 3300025924 | Bacteria | 1385 |
| 426 | Ga0207694_10522820 | 3300025924 | Bacteria | 994 |
| 427 | Ga0207650_10003582 | 3300025925 | Bacteria | 10655 |
| 428 | Ga0207650_10213491 | 3300025925 | Bacteria | 1550 |
| 429 | Ga0207687_10000978 | 3300025927 | Bacteria | 19404 |
| 430 | Ga0207687_10002372 | 3300025927 | Bacteria | 12792 |
| 431 | Ga0207687_10130110 | 3300025927 | Bacteria | 1896 |
| 432 | Ga0207687_10350078 | 3300025927 | Bacteria | 1203 |
| 433 | Ga0207700_10003745 | 3300025928 | Bacteria | 8878 |
| 434 | Ga0207700_10021300 | 3300025928 | Bacteria | 4424 |
| 435 | Ga0207700_10058092 | 3300025928 | Bacteria | 2921 |
| 436 | Ga0207700_10062682 | 3300025928 | Bacteria | 2824 |
| 437 | Ga0207700_10393013 | 3300025928 | Bacteria | 1214 |
| 438 | Ga0207700_10394546 | 3300025928 | Bacteria | 1212 |
| 439 | Ga0207700_10452458 | 3300025928 | Bacteria | 1132 |
| 440 | Ga0207700_10552917 | 3300025928 | Unclassified | 1022 |
| 441 | Ga0207700_10678905 | 3300025928 | Bacteria | 919 |
| 442 | Ga0207700_11068310 | 3300025928 | Bacteria | 722 |
| 443 | Ga0207664_10017916 | 3300025929 | Bacteria | 5203 |
| 444 | Ga0207664_10071842 | 3300025929 | Unclassified | 2789 |
| 445 | Ga0207664_10105160 | 3300025929 | Bacteria | 2339 |
| 446 | Ga0207664_10128766 | 3300025929 | Bacteria | 2128 |
| 447 | Ga0207664_10205846 | 3300025929 | Bacteria | 1700 |
| 448 | Ga0207664_10234262 | 3300025929 | Bacteria | 1597 |
| 449 | Ga0207664_10420967 | 3300025929 | Bacteria | 1190 |
| 450 | Ga0207664_10527307 | 3300025929 | Bacteria | 1059 |
| 451 | Ga0207644_10017923 | 3300025931 | Bacteria | 4788 |
| 452 | Ga0207644_10266848 | 3300025931 | Bacteria | 1370 |
| 453 | Ga0207690_10050737 | 3300025932 | Bacteria | 2771 |
| 454 | Ga0207690_10175486 | 3300025932 | Bacteria | 1609 |
| 455 | Ga0207706_10243219 | 3300025933 | Bacteria | 1573 |
| 456 | Ga0207686_10373242 | 3300025934 | Bacteria | 1080 |
| 457 | Ga0207665_10022539 | 3300025939 | Bacteria | 4144 |
| 458 | Ga0207665_10044340 | 3300025939 | Bacteria | 2976 |
| 459 | Ga0207665_10052779 | 3300025939 | Bacteria | 2739 |
| 460 | Ga0207691_10039961 | 3300025940 | Bacteria | 4338 |
| 461 | Ga0207711_10000014 | 3300025941 | Bacteria | 506753 |
| 462 | Ga0207711_10004781 | 3300025941 | Bacteria | 11494 |
| 463 | Ga0207711_10033255 | 3300025941 | Bacteria | 4362 |
| 464 | Ga0207711_10044398 | 3300025941 | Bacteria | 3794 |
| 465 | Ga0207711_10065518 | 3300025941 | Bacteria | 3141 |
| 466 | Ga0207711_10093223 | 3300025941 | Bacteria | 2652 |
| 467 | Ga0207689_11050014 | 3300025942 | Unclassified | 687 |
| 468 | Ga0207661_10001283 | 3300025944 | Bacteria | 16799 |
| 469 | Ga0207661_10055710 | 3300025944 | Bacteria | 3172 |
| 470 | Ga0207661_10077968 | 3300025944 | Bacteria | 2726 |
| 471 | Ga0207661_10078225 | 3300025944 | Bacteria | 2722 |
| 472 | Ga0207661_10104793 | 3300025944 | Bacteria | 2382 |
| 473 | Ga0207661_10179079 | 3300025944 | Bacteria | 1850 |
| 474 | Ga0207661_10475948 | 3300025944 | Bacteria | 1140 |
| 475 | Ga0207679_10137102 | 3300025945 | Bacteria | 1972 |
| 476 | Ga0207679_10616612 | 3300025945 | Bacteria | 979 |
| 477 | Ga0207667_10000468 | 3300025949 | Bacteria | 53974 |
| 478 | Ga0207667_10006194 | 3300025949 | Bacteria | 14522 |
| 479 | Ga0207667_10007633 | 3300025949 | Bacteria | 12958 |
| 480 | Ga0207667_10009516 | 3300025949 | Bacteria | 11434 |
| 481 | Ga0207667_10012818 | 3300025949 | Bacteria | 9632 |
| 482 | Ga0207667_10030921 | 3300025949 | Bacteria | 5786 |
| 483 | Ga0207667_10035816 | 3300025949 | Bacteria | 5323 |
| 484 | Ga0207667_10098554 | 3300025949 | Bacteria | 3016 |
| 485 | Ga0207667_10176714 | 3300025949 | Bacteria | 2193 |
| 486 | Ga0207667_10198277 | 3300025949 | Bacteria | 2059 |
| 487 | Ga0207667_10243021 | 3300025949 | Bacteria | 1842 |
| 488 | Ga0207667_10249710 | 3300025949 | Bacteria | 1815 |
| 489 | Ga0207667_10294967 | 3300025949 | Bacteria | 1656 |
| 490 | Ga0207667_10321631 | 3300025949 | Bacteria | 1580 |
| 491 | Ga0207667_10373279 | 3300025949 | Bacteria | 1453 |
| 492 | Ga0207667_10979643 | 3300025949 | Bacteria | 834 |
| 493 | Ga0207712_10043097 | 3300025961 | Bacteria | 3111 |
| 494 | Ga0207640_10000028 | 3300025981 | Bacteria | 135727 |
| 495 | Ga0207640_10024137 | 3300025981 | Bacteria | 3664 |
| 496 | Ga0207640_10034716 | 3300025981 | Bacteria | 3150 |
| 497 | Ga0207640_10092985 | 3300025981 | Bacteria | 2094 |
| 498 | Ga0207640_10286155 | 3300025981 | Bacteria | 1297 |
| 499 | Ga0207640_10677227 | 3300025981 | Bacteria | 882 |
| 500 | Ga0207658_10003428 | 3300025986 | Bacteria | 11222 |
| 501 | Ga0207677_10000143 | 3300026023 | Bacteria | 58337 |
| 502 | Ga0207677_10154976 | 3300026023 | Bacteria | 1773 |
| 503 | Ga0207677_10192193 | 3300026023 | Bacteria | 1615 |
| 504 | Ga0207677_10322859 | 3300026023 | Bacteria | 1283 |
| 505 | Ga0207703_10004820 | 3300026035 | Bacteria | 10980 |
| 506 | Ga0207703_10123186 | 3300026035 | Bacteria | 2228 |
| 507 | Ga0207639_10000088 | 3300026041 | Bacteria | 78742 |
| 508 | Ga0207639_10000371 | 3300026041 | Bacteria | 31074 |
| 509 | Ga0207639_10014115 | 3300026041 | Bacteria | 5610 |
| 510 | Ga0207639_10016992 | 3300026041 | Bacteria | 5155 |
| 511 | Ga0207639_10054301 | 3300026041 | Bacteria | 3061 |
| 512 | Ga0207639_10129182 | 3300026041 | Bacteria | 2089 |
| 513 | Ga0207639_10154385 | 3300026041 | Bacteria | 1927 |
| 514 | Ga0207639_10211214 | 3300026041 | Bacteria | 1671 |
| 515 | Ga0207639_10520451 | 3300026041 | Bacteria | 1089 |
| 516 | Ga0207639_10748403 | 3300026041 | Bacteria | 909 |
| 517 | Ga0207678_10006398 | 3300026067 | Bacteria | 10461 |
| 518 | Ga0207678_10229059 | 3300026067 | Bacteria | 1591 |
| 519 | Ga0207678_10336767 | 3300026067 | Bacteria | 1300 |
| 520 | Ga0207678_10500580 | 3300026067 | Bacteria | 1059 |
| 521 | Ga0207678_10575718 | 3300026067 | Bacteria | 986 |
| 522 | Ga0207702_10001334 | 3300026078 | Bacteria | 24682 |
| 523 | Ga0207702_10005816 | 3300026078 | Bacteria | 10726 |
| 524 | Ga0207702_10017932 | 3300026078 | Bacteria | 5856 |
| 525 | Ga0207702_10034912 | 3300026078 | Bacteria | 4205 |
| 526 | Ga0207702_10070171 | 3300026078 | Bacteria | 3013 |
| 527 | Ga0207702_10306913 | 3300026078 | Bacteria | 1507 |
| 528 | Ga0207702_10888883 | 3300026078 | Bacteria | 883 |
| 529 | Ga0207702_10989030 | 3300026078 | Bacteria | 834 |
| 530 | Ga0207702_11043759 | 3300026078 | Bacteria | 811 |
| 531 | Ga0207641_10005346 | 3300026088 | Bacteria | 10965 |
| 532 | Ga0207641_10021590 | 3300026088 | Bacteria | 5290 |
| 533 | Ga0207641_10037049 | 3300026088 | Bacteria | 4072 |
| 534 | Ga0207641_10306612 | 3300026088 | Bacteria | 1501 |
| 535 | Ga0207676_10055374 | 3300026095 | Bacteria | 3113 |
| 536 | Ga0207676_10159038 | 3300026095 | Bacteria | 1955 |
| 537 | Ga0207676_10508123 | 3300026095 | Bacteria | 1145 |
| 538 | Ga0207674_10000669 | 3300026116 | Bacteria | 44573 |
| 539 | Ga0207674_10142769 | 3300026116 | Bacteria | 2353 |
| 540 | Ga0207674_10148285 | 3300026116 | Bacteria | 2303 |
| 541 | Ga0207674_10201213 | 3300026116 | Bacteria | 1941 |
| 542 | Ga0207674_10293248 | 3300026116 | Bacteria | 1575 |
| 543 | Ga0207674_10294723 | 3300026116 | Bacteria | 1571 |
| 544 | Ga0207674_10305491 | 3300026116 | Bacteria | 1540 |
| 545 | Ga0207683_10028240 | 3300026121 | Bacteria | 4851 |
| 546 | Ga0207683_10262222 | 3300026121 | Bacteria | 1578 |
| 547 | Ga0207698_10000003 | 3300026142 | Bacteria | 321303 |
| 548 | Ga0207698_10000708 | 3300026142 | Bacteria | 19330 |
| 549 | Ga0207698_10003525 | 3300026142 | Bacteria | 9436 |
| 550 | Ga0207698_10031875 | 3300026142 | Bacteria | 3811 |
| 551 | Ga0207698_10036682 | 3300026142 | Bacteria | 3601 |
| 552 | Ga0207698_10059852 | 3300026142 | Unclassified | 2959 |
| 553 | Ga0207698_10215710 | 3300026142 | Bacteria | 1730 |
| 554 | Ga0207698_10464681 | 3300026142 | Bacteria | 1224 |
| 555 | Ga0265356_1004445 | 3300028017 | Bacteria | 1714 |
| 556 | Ga0268266_10005265 | 3300028379 | Bacteria | 12146 |
| 557 | Ga0268266_10006399 | 3300028379 | Bacteria | 10792 |
| 558 | Ga0268266_10008807 | 3300028379 | Bacteria | 8937 |
| 559 | Ga0268266_10078240 | 3300028379 | Bacteria | 2877 |
| 560 | Ga0268266_10188892 | 3300028379 | Bacteria | 1880 |
| 561 | Ga0268265_10562240 | 3300028380 | Bacteria | 1084 |
| 562 | Ga0268264_10000598 | 3300028381 | Bacteria | 43640 |
| 563 | Ga0265319_1044472 | 3300028563 | Bacteria | 1488 |
| 564 | Ga0265334_10130983 | 3300028573 | Bacteria | 892 |
| 565 | Ga0265318_10011054 | 3300028577 | Bacteria | 3903 |
| 566 | Ga0265318_10076123 | 3300028577 | Bacteria | 1242 |
| 567 | Ga0265336_10001048 | 3300028666 | Bacteria | 13512 |
| 568 | Ga0265336_10005708 | 3300028666 | Bacteria | 4561 |
| 569 | Ga0265338_10004495 | 3300028800 | Bacteria | 18805 |
| 570 | Ga0265338_10005157 | 3300028800 | Bacteria | 17175 |
| 571 | Ga0265338_10009284 | 3300028800 | Bacteria | 11764 |
| 572 | Ga0265338_10017734 | 3300028800 | Bacteria | 7656 |
| 573 | Ga0265338_10040619 | 3300028800 | Bacteria | 4367 |
| 574 | Ga0265338_10099138 | 3300028800 | Bacteria | 2381 |
| 575 | Ga0265338_10259829 | 3300028800 | Bacteria | 1277 |
| 576 | Ga0265338_10268771 | 3300028800 | Bacteria | 1250 |
| 577 | Ga0265338_10527691 | 3300028800 | Bacteria | 829 |
| 578 | Ga0265338_10610317 | 3300028800 | Bacteria | 759 |
| 579 | Ga0265324_10009104 | 3300029957 | Bacteria | 3896 |
| 580 | Ga0265324_10026321 | 3300029957 | Bacteria | 2059 |
| 581 | Ga0265330_10000273 | 3300031235 | Bacteria | 38107 |
| 582 | Ga0265330_10001219 | 3300031235 | Bacteria | 15180 |
| 583 | Ga0265330_10011435 | 3300031235 | Bacteria | 4163 |
| 584 | Ga0265330_10030656 | 3300031235 | Bacteria | 2413 |
| 585 | Ga0265330_10072643 | 3300031235 | Bacteria | 1488 |
| 586 | Ga0265330_10120309 | 3300031235 | Bacteria | 1119 |
| 587 | Ga0265330_10126058 | 3300031235 | Bacteria | 1090 |
| 588 | Ga0265332_10054533 | 3300031238 | Unclassified | 1715 |
| 589 | Ga0265332_10280342 | 3300031238 | Bacteria | 689 |
| 590 | Ga0265328_10001272 | 3300031239 | Bacteria | 11639 |
| 591 | Ga0265328_10005053 | 3300031239 | Bacteria | 5684 |
| 592 | Ga0265328_10011186 | 3300031239 | Bacteria | 3591 |
| 593 | Ga0265320_10003664 | 3300031240 | Bacteria | 10255 |
| 594 | Ga0265325_10000266 | 3300031241 | Bacteria | 37071 |
| 595 | Ga0265325_10000695 | 3300031241 | Bacteria | 24506 |
| 596 | Ga0265325_10005858 | 3300031241 | Bacteria | 7531 |
| 597 | Ga0265325_10087985 | 3300031241 | Bacteria | 1535 |
| 598 | Ga0265325_10098913 | 3300031241 | Bacteria | 1430 |
| 599 | Ga0265329_10011153 | 3300031242 | Bacteria | 3272 |
| 600 | Ga0265329_10011996 | 3300031242 | Bacteria | 3132 |
| 601 | Ga0265340_10001072 | 3300031247 | Bacteria | 15563 |
| 602 | Ga0265340_10012505 | 3300031247 | Bacteria | 4481 |
| 603 | Ga0265340_10015610 | 3300031247 | Bacteria | 3945 |
| 604 | Ga0265340_10096350 | 3300031247 | Bacteria | 1378 |
| 605 | Ga0265340_10171805 | 3300031247 | Bacteria | 982 |
| 606 | Ga0265339_10000114 | 3300031249 | Bacteria | 65609 |
| 607 | Ga0265339_10000124 | 3300031249 | Bacteria | 64124 |
| 608 | Ga0265339_10000194 | 3300031249 | Bacteria | 50375 |
| 609 | Ga0265339_10003213 | 3300031249 | Bacteria | 11471 |
| 610 | Ga0265339_10009288 | 3300031249 | Bacteria | 6193 |
| 611 | Ga0265339_10021882 | 3300031249 | Bacteria | 3711 |
| 612 | Ga0265339_10028825 | 3300031249 | Bacteria | 3154 |
| 613 | Ga0265339_10165558 | 3300031249 | Bacteria | 1110 |
| 614 | Ga0265331_10073017 | 3300031250 | Bacteria | 1602 |
| 615 | Ga0265331_10111778 | 3300031250 | Bacteria | 1253 |
| 616 | Ga0265327_10267568 | 3300031251 | Bacteria | 758 |
| 617 | Ga0265316_10000352 | 3300031344 | Bacteria | 51670 |
| 618 | Ga0265316_10000712 | 3300031344 | Bacteria | 36687 |
| 619 | Ga0265316_10003105 | 3300031344 | Bacteria | 16919 |
| 620 | Ga0265316_10006699 | 3300031344 | Bacteria | 10976 |
| 621 | Ga0265316_10008382 | 3300031344 | Bacteria | 9600 |
| 622 | Ga0265316_10018630 | 3300031344 | Bacteria | 5963 |
| 623 | Ga0265316_10022409 | 3300031344 | Bacteria | 5325 |
| 624 | Ga0265316_10129073 | 3300031344 | Bacteria | 1905 |
| 625 | Ga0265316_10136596 | 3300031344 | Bacteria | 1844 |
| 626 | Ga0265316_10177577 | 3300031344 | Bacteria | 1586 |
| 627 | Ga0265313_10002216 | 3300031595 | Bacteria | 17122 |
| 628 | Ga0265313_10004714 | 3300031595 | Bacteria | 10288 |
| 629 | Ga0265313_10046248 | 3300031595 | Bacteria | 2113 |
| 630 | Ga0265313_10068916 | 3300031595 | Bacteria | 1633 |
| 631 | Ga0265313_10137519 | 3300031595 | Bacteria | 1053 |
| 632 | Ga0265313_10187633 | 3300031595 | Bacteria | 866 |
| 633 | Ga0265313_10227340 | 3300031595 | Bacteria | 767 |
| 634 | Ga0265314_10000504 | 3300031711 | Bacteria | 50376 |
| 635 | Ga0265314_10002987 | 3300031711 | Bacteria | 16745 |
| 636 | Ga0265314_10034859 | 3300031711 | Bacteria | 3672 |
| 637 | Ga0265314_10117019 | 3300031711 | Bacteria | 1685 |
| 638 | Ga0265342_10000225 | 3300031712 | Bacteria | 63822 |
| 639 | Ga0265342_10001536 | 3300031712 | Bacteria | 21355 |
| 640 | Ga0265342_10002164 | 3300031712 | Bacteria | 17314 |
| 641 | Ga0265342_10002441 | 3300031712 | Bacteria | 16049 |
| 642 | Ga0265342_10014061 | 3300031712 | Bacteria | 5326 |
| 643 | Ga0265342_10027916 | 3300031712 | Bacteria | 3520 |
| 644 | Ga0265342_10029908 | 3300031712 | Bacteria | 3379 |
| 645 | Ga0265342_10045350 | 3300031712 | Bacteria | 2646 |
| 646 | Ga0265342_10069670 | 3300031712 | Bacteria | 2053 |
| 647 | Ga0265342_10136398 | 3300031712 | Bacteria | 1371 |
| 648 | Ga0265342_10188592 | 3300031712 | Bacteria | 1126 |
| 649 | Ga0265342_10332508 | 3300031712 | Bacteria | 794 |
| 650 | Ga0316583_10095825 | 3300032133 | Bacteria | 1035 |
| 651 | Ga0307510_10010774 | 3300033180 | Bacteria | 10874 |
| 652 | Ga0307510_10212472 | 3300033180 | Bacteria | 1455 |
| 653 | Ga0307510_10223248 | 3300033180 | Bacteria | 1393 |
| 654 | Ga0316215_1003489 | 3300033544 | Bacteria | 1498 |
| 655 | Ga0373926_0000675 | 3300035083 | Bacteria | 9381 |
| 656 | Ga0373954_0036836 | 3300035118 | Bacteria | 2272 |
| 657 | Ga0373954_0294562 | 3300035118 | Bacteria | 800 |
| 658 | Ga0373956_0061195 | 3300035119 | Bacteria | 1705 |
| 659 | Ga0373956_0153569 | 3300035119 | Unclassified | 1083 |
| 660 | Ga0373943_0001291 | 3300035170 | Bacteria | 11240 |
| 661 | Ga0373946_0000821 | 3300035171 | Bacteria | 10594 |
| 662 | Ga0373955_0149693 | 3300035172 | Bacteria | 1373 |
| 663 | Ga0373924_0000243 | 3300035410 | Bacteria | 16627 |
| 664 | Ga0373924_0093250 | 3300035410 | Bacteria | 1290 |
| 665 | Ga0373935_0012297 | 3300035692 | Bacteria | 5149 |
| 666 | Ga0373935_0829003 | 3300035692 | Bacteria | 683 |
| 667 | Ga0373927_0004411 | 3300035695 | Bacteria | 9864 |
| 668 | Ga0373947_0112424 | 3300035725 | Unclassified | 1722 |
| 669 | Ga0373937_0007405 | 3300036401 | Bacteria | 9499 |
| 670 | Ga0373937_0065583 | 3300036401 | Bacteria | 3343 |
| 671 | Ga0373925_0060693 | 3300037068 | Unclassified | 2839 |
| 672 | Ga0395900_0025848 | 3300037418 | Bacteria | 6011 |
| 673 | Ga0395900_0389492 | 3300037418 | Bacteria | 1360 |
| 674 | Ga0395898_0027814 | 3300037466 | Bacteria | 5670 |
| 675 | Ga0395898_0117975 | 3300037466 | Bacteria | 2542 |
| 676 | Ga0395898_0546082 | 3300037466 | Bacteria | 1101 |
| 677 | Ga0436364_0115933 | 3300037853 | Bacteria | 94405 |
| 678 | Ga0436364_0147107 | 3300037853 | Unclassified | 2317 |
| 679 | Ga0436364_0354157 | 3300037853 | Bacteria | 1857 |
| 680 | Ga0395901_0310997 | 3300038443 | Bacteria | 1632 |
| 681 | Ga0395901_0513053 | 3300038443 | Bacteria | 1219 |
| 682 | Ga0436365_0590507 | 3300039437 | Bacteria | 1029 |
| 683 | Ga0436360_1067871 | 3300039438 | Archaea | 894 |
| 684 | Ga0436360_1280163 | 3300039438 | Bacteria | 848 |
| 685 | Ga0436361_0318263 | 3300039447 | Bacteria | 10520 |
| 686 | Ga0436361_0387230 | 3300039447 | Bacteria | 1246 |
| 687 | Ga0436361_0497072 | 3300039447 | Bacteria | 714 |
| 688 | Ga0436361_0500168 | 3300039447 | Bacteria | 41610 |
| 689 | Ga0436361_0732319 | 3300039447 | Bacteria | 1755 |
| 690 | Ga0436361_1103679 | 3300039447 | Bacteria | 1360 |
| 691 | Ga0436363_0331024 | 3300039450 | Unclassified | 1311 |
| 692 | Ga0466966_0149285 | 3300044684 | Bacteria | 1426 |
| 693 | Ga0466961_0055286 | 3300044693 | Bacteria | 2531 |
| 694 | Ga0466963_0000494 | 3300044694 | Bacteria | 18341 |
| 695 | Ga0466963_0107210 | 3300044694 | Bacteria | 1916 |
| 696 | Ga0466970_0244720 | 3300044765 | Bacteria | 1004 |
| 697 | Ga0466957_0026837 | 3300044842 | Bacteria | 3419 |
| 698 | Ga0466959_0382284 | 3300045049 | Bacteria | 958 |
| 699 | Ga0451576_0873383 | 3300045051 | Bacteria | 944 |
| 700 | Ga0466967_0001401 | 3300045976 | Bacteria | 13938 |
| 701 | Ga0466967_0046813 | 3300045976 | Bacteria | 3768 |
| 702 | Ga0466967_0111253 | 3300045976 | Bacteria | 2517 |
| 703 | Ga0495617_026479 | 3300046452 | Bacteria | 1953 |
| 704 | Ga0495603_0039419 | 3300046455 | Bacteria | 2830 |
| 705 | Ga0495629_0029674 | 3300046459 | Bacteria | 3878 |
| 706 | Ga0495629_0049585 | 3300046459 | Bacteria | 2942 |
| 707 | Ga0495629_0060065 | 3300046459 | Bacteria | 2657 |
| 708 | Ga0495629_0137756 | 3300046459 | Bacteria | 1699 |
| 709 | Ga0495638_0445383 | 3300046460 | Bacteria | 662 |
| 710 | Ga0495651_0053044 | 3300046462 | Bacteria | 3123 |
| 711 | Ga0495653_0010749 | 3300046463 | Bacteria | 7495 |
| 712 | Ga0495650_0000038 | 3300046471 | Bacteria | 377530 |
| 713 | Ga0495580_0120910 | 3300046472 | Bacteria | 1818 |
| 714 | Ga0495580_0156212 | 3300046472 | Unclassified | 1579 |
| 715 | Ga0495580_0326733 | 3300046472 | Bacteria | 1042 |
| 716 | Ga0495580_0497340 | 3300046472 | Bacteria | 814 |
| 717 | Ga0495582_0001853 | 3300046473 | Bacteria | 11921 |
| 718 | Ga0495582_0095987 | 3300046473 | Bacteria | 1657 |
| 719 | Ga0495639_0004538 | 3300046475 | Bacteria | 5952 |
| 720 | Ga0495662_0005660 | 3300046476 | Bacteria | 6246 |
| 721 | Ga0495664_0001348 | 3300046477 | Bacteria | 12929 |
| 722 | Ga0495664_0057856 | 3300046477 | Bacteria | 2306 |
| 723 | Ga0495585_0085882 | 3300046492 | Bacteria | 1700 |
| 724 | Ga0495594_0000388 | 3300046499 | Bacteria | 22139 |
| 725 | Ga0495594_0001190 | 3300046499 | Bacteria | 13614 |
| 726 | Ga0495594_0004431 | 3300046499 | Bacteria | 7222 |
| 727 | Ga0495583_0033822 | 3300046506 | Bacteria | 2455 |
| 728 | Ga0495606_0044975 | 3300046507 | Bacteria | 2931 |
| 729 | Ga0495606_0067569 | 3300046507 | Bacteria | 2263 |
| 730 | Ga0495630_0270870 | 3300046517 | Bacteria | 1297 |
| 731 | Ga0495644_0000048 | 3300046523 | Bacteria | 57696 |
| 732 | Ga0495666_0001196 | 3300046526 | Bacteria | 12524 |
| 733 | Ga0495642_0019216 | 3300046528 | Bacteria | 2678 |
| 734 | Ga0495652_0006640 | 3300046529 | Bacteria | 10742 |
| 735 | Ga0495652_0043862 | 3300046529 | Bacteria | 3853 |
| 736 | Ga0495665_0001828 | 3300046531 | Bacteria | 11486 |
| 737 | Ga0495665_0243362 | 3300046531 | Bacteria | 927 |
| 738 | Ga0495640_0004801 | 3300046533 | Bacteria | 10760 |
| 739 | Ga0495640_0112414 | 3300046533 | Bacteria | 1778 |
| 740 | Ga0495586_0019711 | 3300046535 | Bacteria | 3591 |
| 741 | Ga0495586_0197397 | 3300046535 | Unclassified | 1140 |
| 742 | Ga0495587_0093692 | 3300046536 | Bacteria | 1734 |
| 743 | Ga0495609_0011141 | 3300046538 | Bacteria | 4292 |
| 744 | Ga0495609_0080699 | 3300046538 | Bacteria | 1422 |
| 745 | Ga0495645_0053835 | 3300046543 | Unclassified | 2924 |
| 746 | Ga0495645_0213338 | 3300046543 | Archaea | 1302 |
| 747 | Ga0495633_0051416 | 3300046558 | Bacteria | 1942 |
| 748 | Ga0495667_0150787 | 3300046559 | Bacteria | 1497 |
| 749 | Ga0495668_0128921 | 3300046616 | Bacteria | 1385 |
| 750 | Ga0495634_0006225 | 3300046642 | Bacteria | 9093 |
| 751 | Ga0495611_0005877 | 3300046648 | Bacteria | 5236 |
| 752 | Ga0495625_0000985 | 3300046660 | Bacteria | 37750 |
| 753 | Ga0495625_0007833 | 3300046660 | Bacteria | 9208 |
| 754 | Ga0495625_0026175 | 3300046660 | Bacteria | 4411 |
| 755 | Ga0495625_0034121 | 3300046660 | Bacteria | 3757 |
| 756 | Ga0495625_0089152 | 3300046660 | Bacteria | 2136 |
| 757 | Ga0495625_0381016 | 3300046660 | Bacteria | 885 |
| 758 | Ga0495625_0434634 | 3300046660 | Bacteria | 814 |
| 759 | Ga0495635_0002836 | 3300046663 | Bacteria | 11904 |
| 760 | Ga0495659_0114237 | 3300046664 | Bacteria | 1057 |
| 761 | Ga0495661_0026784 | 3300046665 | Bacteria | 3708 |
| 762 | Ga0495657_0277857 | 3300046675 | Bacteria | 1003 |
| 763 | Ga0495599_0242663 | 3300046678 | Bacteria | 1098 |
| 764 | Ga0495599_0548749 | 3300046678 | Bacteria | 677 |
| 765 | Ga0495623_0008357 | 3300046679 | Bacteria | 6733 |
| 766 | Ga0495623_0410809 | 3300046679 | Bacteria | 727 |
| 767 | Ga0495646_0013211 | 3300046680 | Bacteria | 5247 |
| 768 | Ga0495646_0023225 | 3300046680 | Bacteria | 3904 |
| 769 | Ga0495646_0222729 | 3300046680 | Bacteria | 1019 |
| 770 | Ga0495669_0004252 | 3300046684 | Bacteria | 5901 |
| 771 | Ga0495669_0370251 | 3300046684 | Unclassified | 693 |
| 772 | Ga0495613_0003966 | 3300046689 | Bacteria | 11081 |
| 773 | Ga0495613_0018773 | 3300046689 | Bacteria | 5152 |
| 774 | Ga0495613_0038534 | 3300046689 | Unclassified | 3543 |
| 775 | Ga0495613_0109799 | 3300046689 | Bacteria | 1988 |
| 776 | Ga0495624_0007524 | 3300046690 | Bacteria | 7641 |
| 777 | Ga0495624_0174027 | 3300046690 | Bacteria | 1313 |
| 778 | Ga0495671_0095768 | 3300046692 | Bacteria | 1452 |
| 779 | Ga0495649_0012107 | 3300046694 | Bacteria | 5035 |
| 780 | Ga0495600_0012858 | 3300046809 | Bacteria | 5243 |
| 781 | Ga0495600_0172644 | 3300046809 | Unclassified | 1395 |
| 782 | Ga0495581_0001976 | 3300047315 | Bacteria | 11495 |
| 783 | Ga0495604_0002834 | 3300047317 | Bacteria | 13912 |
| 784 | Ga0495674_0014334 | 3300047319 | Bacteria | 7423 |
| 785 | Ga0495672_0021506 | 3300047320 | Bacteria | 4206 |
| 786 | Ga0495672_0063127 | 3300047320 | Bacteria | 2127 |
| 787 | Ga0495676_0008961 | 3300047321 | Bacteria | 9134 |
| 788 | Ga0495683_0174509 | 3300047323 | Bacteria | 986 |
| 789 | Ga0495675_0012974 | 3300047444 | Bacteria | 5253 |
| 790 | Ga0495673_0231467 | 3300047469 | Bacteria | 680 |
| 791 | Ga0495684_0099043 | 3300047471 | Bacteria | 2204 |
| 792 | Ga0495686_0000178 | 3300047472 | Bacteria | 121468 |
| 793 | Ga0495686_0001621 | 3300047472 | Bacteria | 23566 |
| 794 | Ga0495686_0008419 | 3300047472 | Bacteria | 7568 |
| 795 | Ga0495686_0047439 | 3300047472 | Bacteria | 2712 |
| 796 | Ga0495686_0085891 | 3300047472 | Bacteria | 1915 |
| 797 | Ga0495602_0081301 | 3300048088 | Archaea | 2725 |
| 798 | Ga0495602_0236738 | 3300048088 | Bacteria | 1368 |
| 799 | Ga0495614_0000972 | 3300048089 | Bacteria | 12208 |
| 800 | Ga0496100_0314419 | 3300048903 | Bacteria | 1175 |
| 801 | Ga0496100_0725168 | 3300048903 | Bacteria | 776 |
| 802 | Ga0496102_0344146 | 3300048905 | Bacteria | 1404 |
| 803 | Ga0496102_0851610 | 3300048905 | Bacteria | 834 |
| 804 | Ga0496104_0000053 | 3300048907 | Bacteria | 135895 |
| 805 | Ga0496104_0056645 | 3300048907 | Bacteria | 3708 |
| 806 | Ga0496104_0071299 | 3300048907 | Unclassified | 3303 |
| 807 | Ga0496104_0438058 | 3300048907 | Bacteria | 1219 |
| 808 | Ga0496104_0659933 | 3300048907 | Bacteria | 955 |
| 809 | Ga0496104_0726557 | 3300048907 | Bacteria | 900 |
| 810 | Ga0496104_0798050 | 3300048907 | Bacteria | 850 |
| 811 | Ga0496105_0001615 | 3300048908 | Bacteria | 15999 |
| 812 | Ga0496105_0057832 | 3300048908 | Bacteria | 3201 |
| 813 | Ga0496106_0042478 | 3300048909 | Bacteria | 3410 |
| 814 | Ga0496108_0134232 | 3300048911 | Bacteria | 2128 |
| 815 | Ga0496109_0316949 | 3300048912 | Bacteria | 1471 |
| 816 | Ga0496111_0044511 | 3300048914 | Bacteria | 3191 |
| 817 | Ga0496111_0158175 | 3300048914 | Bacteria | 1682 |
| 818 | Ga0496111_0303736 | 3300048914 | Bacteria | 1183 |
| 819 | Ga0496112_0021005 | 3300048915 | Bacteria | 6201 |
| 820 | Ga0496112_0150505 | 3300048915 | Bacteria | 2294 |
| 821 | Ga0496112_0467738 | 3300048915 | Bacteria | 1198 |
| 822 | Ga0496113_0084737 | 3300048916 | Bacteria | 2434 |
| 823 | Ga0496115_0085005 | 3300048918 | Bacteria | 2580 |
| 824 | Ga0496115_0091617 | 3300048918 | Bacteria | 2484 |
| 825 | Ga0496115_0273258 | 3300048918 | Bacteria | 1388 |
| 826 | Ga0496115_0373480 | 3300048918 | Unclassified | 1160 |
| 827 | Ga0496121_0365824 | 3300048924 | Bacteria | 956 |
| 828 | Ga0496126_0000100 | 3300048929 | Bacteria | 203706 |
| 829 | Ga0496126_0000154 | 3300048929 | Bacteria | 159983 |
| 830 | Ga0496126_0078490 | 3300048929 | Bacteria | 2925 |
| 831 | Ga0501032_0001912 | 3300049569 | Bacteria | 16446 |
| 832 | Ga0501033_0028282 | 3300049570 | Bacteria | 4213 |
| 833 | Ga0501033_0115308 | 3300049570 | Bacteria | 1952 |
| 834 | Ga0501033_0637612 | 3300049570 | Bacteria | 729 |
| 835 | Ga0501034_0148520 | 3300049571 | Bacteria | 2320 |
| 836 | Ga0501036_0076344 | 3300049572 | Bacteria | 2834 |
| 837 | Ga0501037_0391740 | 3300049573 | Bacteria | 954 |
| 838 | Ga0501037_0492477 | 3300049573 | Bacteria | 832 |
| 839 | Ga0501038_0048143 | 3300049574 | Bacteria | 3690 |
| 840 | Ga0501038_0085946 | 3300049574 | Bacteria | 2644 |
| 841 | Ga0501043_0003983 | 3300049579 | Bacteria | 12094 |
| 842 | Ga0501046_0000056 | 3300049580 | Bacteria | 129342 |
| 843 | Ga0501047_0008947 | 3300049581 | Bacteria | 9454 |
| 844 | Ga0501047_0066914 | 3300049581 | Bacteria | 3463 |
| 845 | Ga0501073_0110559 | 3300049589 | Bacteria | 1906 |
| 846 | Ga0501073_0110594 | 3300049589 | Bacteria | 1906 |
| 847 | Ga0501074_0196241 | 3300049590 | Bacteria | 1439 |
| 848 | Ga0501080_0188110 | 3300049742 | Bacteria | 1898 |
| 849 | Ga0501083_0147296 | 3300049744 | Bacteria | 1541 |
| 850 | Ga0501035_0044540 | 3300049822 | Bacteria | 3995 |
| 851 | Ga0501035_0377603 | 3300049822 | Bacteria | 1182 |
| 852 | Ga0501035_0469538 | 3300049822 | Bacteria | 1039 |
| 853 | Ga0501044_0027240 | 3300049823 | Bacteria | 6042 |
| 854 | Ga0501044_0095095 | 3300049823 | Bacteria | 3003 |
| 855 | Ga0501044_0417372 | 3300049823 | Bacteria | 1252 |
| 856 | Ga0501044_0690521 | 3300049823 | Bacteria | 907 |
| 857 | nmdc:mga06r32_320162_c1 | 3300050510 | Bacteria | 1536 |
| 858 | Ga0495601_0167705 | 3300053077 | Bacteria | 1435 |
| 859 | Ga0495619_0140913 | 3300053085 | Unclassified | 1660 |
| 860 | Ga0500643_109394 | 3300053087 | Bacteria | 747 |
| 861 | Ga0500651_0000005 | 3300053093 | Bacteria | 384761 |
| 862 | Ga0500595_000004 | 3300053119 | Bacteria | 410922 |
| 863 | Ga0500595_007997 | 3300053119 | Bacteria | 4343 |
| 864 | Ga0500595_058334 | 3300053119 | Bacteria | 1173 |
| 865 | Ga0500595_079031 | 3300053119 | Bacteria | 965 |
| 866 | Ga0500661_003309 | 3300055283 | Bacteria | 3030 |
| 867 | Ga0501082_0213946 | 3300060353 | Bacteria | 1677 |
| 868 | Ga0530510_0265842 | 3300061734 | Bacteria | 1280 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005616 | Ga0068852_100161107 | Ga0068852_1001611073 | 186 |
| 2 | 3300028800 | Ga0265338_10040619 | Ga0265338_100406193 | 187 |
| 3 | 3300048907 | Ga0496104_0798050 | Ga0496104_0798050_85_687 | 188 |
| 4 | 3300013105 | Ga0157369_10040085 | Ga0157369_100400855 | 189 |
| 5 | 3300049822 | Ga0501035_0469538 | Ga0501035_0469538_251_823 | 190 |
| 6 | 3300050510 | nmdc:mga06r32_320162_c1 | nmdc:mga06r32_320162_c1_693_1265 | 190 |
| 7 | 3300009093 | Ga0105240_10000372 | Ga0105240_1000037262 | 191 |
| 8 | 3300009093 | Ga0105240_10000496 | Ga0105240_1000049655 | 191 |
| 9 | 3300009093 | Ga0105240_10087131 | Ga0105240_100871314 | 191 |
| 10 | 3300009098 | Ga0105245_10000486 | Ga0105245_1000048629 | 191 |
| 11 | 3300009101 | Ga0105247_10002346 | Ga0105247_1000234610 | 191 |
| 12 | 3300009101 | Ga0105247_10292438 | Ga0105247_102924382 | 191 |
| 13 | 3300009174 | Ga0105241_10000121 | Ga0105241_1000012115 | 191 |
| 14 | 3300009174 | Ga0105241_10002032 | Ga0105241_100020325 | 191 |
| 15 | 3300009177 | Ga0105248_10007017 | Ga0105248_1000701710 | 191 |
| 16 | 3300009177 | Ga0105248_10029618 | Ga0105248_100296183 | 191 |
| 17 | 3300009545 | Ga0105237_10006331 | Ga0105237_100063319 | 191 |
| 18 | 3300009551 | Ga0105238_10000509 | Ga0105238_1000050928 | 191 |
| 19 | 3300009551 | Ga0105238_10201945 | Ga0105238_102019453 | 191 |
| 20 | 3300009553 | Ga0105249_10081598 | Ga0105249_100815982 | 191 |
| 21 | 3300010375 | Ga0105239_10003046 | Ga0105239_1000304617 | 191 |
| 22 | 3300011119 | Ga0105246_10001192 | Ga0105246_1000119214 | 191 |
| 23 | 3300013100 | Ga0157373_10225234 | Ga0157373_102252342 | 191 |
| 24 | 3300013104 | Ga0157370_10000170 | Ga0157370_1000017077 | 191 |
| 25 | 3300013105 | Ga0157369_10000085 | Ga0157369_1000008577 | 191 |
| 26 | 3300013105 | Ga0157369_10009218 | Ga0157369_100092186 | 191 |
| 27 | 3300013105 | Ga0157369_10206790 | Ga0157369_102067902 | 191 |
| 28 | 3300013105 | Ga0157369_10344813 | Ga0157369_103448132 | 191 |
| 29 | 3300013296 | Ga0157374_10023020 | Ga0157374_100230202 | 191 |
| 30 | 3300013296 | Ga0157374_10084229 | Ga0157374_100842292 | 191 |
| 31 | 3300013306 | Ga0163162_10158863 | Ga0163162_101588632 | 191 |
| 32 | 3300013306 | Ga0163162_11275508 | Ga0163162_112755081 | 191 |
| 33 | 3300013307 | Ga0157372_10000217 | Ga0157372_1000021746 | 191 |
| 34 | 3300013307 | Ga0157372_10002601 | Ga0157372_1000260114 | 191 |
| 35 | 3300013307 | Ga0157372_10010870 | Ga0157372_100108709 | 191 |
| 36 | 3300013308 | Ga0157375_10057497 | Ga0157375_100574973 | 191 |
| 37 | 3300014325 | Ga0163163_10001161 | Ga0163163_1000116110 | 191 |
| 38 | 3300014745 | Ga0157377_10199620 | Ga0157377_101996202 | 191 |
| 39 | 3300014968 | Ga0157379_10002312 | Ga0157379_100023129 | 191 |
| 40 | 3300014969 | Ga0157376_10004372 | Ga0157376_100043728 | 191 |
| 41 | 3300025929 | Ga0207664_10234262 | Ga0207664_102342622 | 191 |
| 42 | 3300045976 | Ga0466967_0111253 | Ga0466967_0111253_1158_1772 | 191 |
| 43 | 3300046616 | Ga0495668_0128921 | Ga0495668_0128921_578_1153 | 191 |
| 44 | 3300044684 | Ga0466966_0149285 | Ga0466966_0149285_391_1020 | 193 |
| 45 | 3300005439 | Ga0070711_100775332 | Ga0070711_1007753322 | 194 |
| 46 | 3300005290 | Ga0065712_10479514 | Ga0065712_104795141 | 195 |
| 47 | 3300005329 | Ga0070683_100285059 | Ga0070683_1002850592 | 195 |
| 48 | 3300005334 | Ga0068869_100247235 | Ga0068869_1002472352 | 195 |
| 49 | 3300005338 | Ga0068868_100065060 | Ga0068868_1000650604 | 195 |
| 50 | 3300005364 | Ga0070673_100191444 | Ga0070673_1001914442 | 195 |
| 51 | 3300005434 | Ga0070709_10166887 | Ga0070709_101668872 | 195 |
| 52 | 3300005434 | Ga0070709_10501912 | Ga0070709_105019122 | 195 |
| 53 | 3300005435 | Ga0070714_100091602 | Ga0070714_1000916022 | 195 |
| 54 | 3300005435 | Ga0070714_100105232 | Ga0070714_1001052323 | 195 |
| 55 | 3300005435 | Ga0070714_100154671 | Ga0070714_1001546713 | 195 |
| 56 | 3300005435 | Ga0070714_100188384 | Ga0070714_1001883843 | 195 |
| 57 | 3300005436 | Ga0070713_100003005 | Ga0070713_10000300510 | 195 |
| 58 | 3300005436 | Ga0070713_100023543 | Ga0070713_1000235435 | 195 |
| 59 | 3300005436 | Ga0070713_100082409 | Ga0070713_1000824092 | 195 |
| 60 | 3300005436 | Ga0070713_100162511 | Ga0070713_1001625112 | 195 |
| 61 | 3300005436 | Ga0070713_100196366 | Ga0070713_1001963662 | 195 |
| 62 | 3300005436 | Ga0070713_100257582 | Ga0070713_1002575822 | 195 |
| 63 | 3300005436 | Ga0070713_101077027 | Ga0070713_1010770271 | 195 |
| 64 | 3300005437 | Ga0070710_10032530 | Ga0070710_100325302 | 195 |
| 65 | 3300005439 | Ga0070711_100019179 | Ga0070711_1000191793 | 195 |
| 66 | 3300005439 | Ga0070711_100022563 | Ga0070711_1000225634 | 195 |
| 67 | 3300005458 | Ga0070681_10589316 | Ga0070681_105893162 | 195 |
| 68 | 3300005530 | Ga0070679_100468964 | Ga0070679_1004689642 | 195 |
| 69 | 3300005530 | Ga0070679_101067564 | Ga0070679_1010675641 | 195 |
| 70 | 3300005535 | Ga0070684_100312272 | Ga0070684_1003122722 | 195 |
| 71 | 3300005535 | Ga0070684_100696362 | Ga0070684_1006963621 | 195 |
| 72 | 3300005539 | Ga0068853_100043702 | Ga0068853_1000437024 | 195 |
| 73 | 3300005539 | Ga0068853_100336512 | Ga0068853_1003365121 | 195 |
| 74 | 3300005539 | Ga0068853_100960524 | Ga0068853_1009605242 | 195 |
| 75 | 3300005564 | Ga0070664_100124085 | Ga0070664_1001240851 | 195 |
| 76 | 3300005614 | Ga0068856_100057606 | Ga0068856_1000576062 | 195 |
| 77 | 3300005616 | Ga0068852_100097697 | Ga0068852_1000976972 | 195 |
| 78 | 3300005618 | Ga0068864_100092202 | Ga0068864_1000922022 | 195 |
| 79 | 3300005841 | Ga0068863_100007046 | Ga0068863_1000070463 | 195 |
| 80 | 3300006028 | Ga0070717_10011247 | Ga0070717_100112477 | 195 |
| 81 | 3300006028 | Ga0070717_10342393 | Ga0070717_103423932 | 195 |
| 82 | 3300006163 | Ga0070715_10002310 | Ga0070715_100023106 | 195 |
| 83 | 3300006173 | Ga0070716_100059060 | Ga0070716_1000590603 | 195 |
| 84 | 3300006175 | Ga0070712_100012762 | Ga0070712_1000127624 | 195 |
| 85 | 3300006175 | Ga0070712_100044876 | Ga0070712_1000448762 | 195 |
| 86 | 3300006175 | Ga0070712_100340838 | Ga0070712_1003408382 | 195 |
| 87 | 3300006175 | Ga0070712_100610888 | Ga0070712_1006108882 | 195 |
| 88 | 3300006914 | Ga0075436_100648537 | Ga0075436_1006485372 | 195 |
| 89 | 3300009093 | Ga0105240_10030875 | Ga0105240_100308757 | 195 |
| 90 | 3300009093 | Ga0105240_10122860 | Ga0105240_101228604 | 195 |
| 91 | 3300009098 | Ga0105245_10021587 | Ga0105245_100215874 | 195 |
| 92 | 3300009174 | Ga0105241_10213745 | Ga0105241_102137452 | 195 |
| 93 | 3300009176 | Ga0105242_10298302 | Ga0105242_102983022 | 195 |
| 94 | 3300009177 | Ga0105248_10477210 | Ga0105248_104772101 | 195 |
| 95 | 3300009177 | Ga0105248_10765535 | Ga0105248_107655352 | 195 |
| 96 | 3300009545 | Ga0105237_10212808 | Ga0105237_102128082 | 195 |
| 97 | 3300009545 | Ga0105237_10627141 | Ga0105237_106271412 | 195 |
| 98 | 3300009551 | Ga0105238_10054460 | Ga0105238_100544601 | 195 |
| 99 | 3300010375 | Ga0105239_10246339 | Ga0105239_102463393 | 195 |
| 100 | 3300010375 | Ga0105239_10857536 | Ga0105239_108575361 | 195 |
| 101 | 3300013105 | Ga0157369_10096566 | Ga0157369_100965664 | 195 |
| 102 | 3300013105 | Ga0157369_10540699 | Ga0157369_105406992 | 195 |
| 103 | 3300013296 | Ga0157374_10238777 | Ga0157374_102387772 | 195 |
| 104 | 3300013296 | Ga0157374_10447875 | Ga0157374_104478752 | 195 |
| 105 | 3300013297 | Ga0157378_10131240 | Ga0157378_101312403 | 195 |
| 106 | 3300013307 | Ga0157372_10204729 | Ga0157372_102047294 | 195 |
| 107 | 3300013307 | Ga0157372_10206180 | Ga0157372_102061802 | 195 |
| 108 | 3300014325 | Ga0163163_10017757 | Ga0163163_100177572 | 195 |
| 109 | 3300014325 | Ga0163163_10580801 | Ga0163163_105808012 | 195 |
| 110 | 3300021388 | Ga0213875_10000108 | Ga0213875_1000010869 | 195 |
| 111 | 3300021388 | Ga0213875_10219442 | Ga0213875_102194421 | 195 |
| 112 | 3300025898 | Ga0207692_10438543 | Ga0207692_104385432 | 195 |
| 113 | 3300025898 | Ga0207692_10444087 | Ga0207692_104440872 | 195 |
| 114 | 3300025900 | Ga0207710_10317441 | Ga0207710_103174411 | 195 |
| 115 | 3300025906 | Ga0207699_10125619 | Ga0207699_101256192 | 195 |
| 116 | 3300025911 | Ga0207654_10083730 | Ga0207654_100837303 | 195 |
| 117 | 3300025912 | Ga0207707_10142923 | Ga0207707_101429232 | 195 |
| 118 | 3300025912 | Ga0207707_10322003 | Ga0207707_103220032 | 195 |
| 119 | 3300025913 | Ga0207695_10125292 | Ga0207695_101252923 | 195 |
| 120 | 3300025915 | Ga0207693_10002600 | Ga0207693_1000260015 | 195 |
| 121 | 3300025915 | Ga0207693_10059168 | Ga0207693_100591684 | 195 |
| 122 | 3300025915 | Ga0207693_10405560 | Ga0207693_104055602 | 195 |
| 123 | 3300025916 | Ga0207663_10016822 | Ga0207663_100168224 | 195 |
| 124 | 3300025916 | Ga0207663_10023940 | Ga0207663_100239403 | 195 |
| 125 | 3300025916 | Ga0207663_10519219 | Ga0207663_105192192 | 195 |
| 126 | 3300025917 | Ga0207660_10304040 | Ga0207660_103040402 | 195 |
| 127 | 3300025927 | Ga0207687_10002372 | Ga0207687_1000237213 | 195 |
| 128 | 3300025928 | Ga0207700_10003745 | Ga0207700_100037458 | 195 |
| 129 | 3300025928 | Ga0207700_10021300 | Ga0207700_100213003 | 195 |
| 130 | 3300025928 | Ga0207700_10062682 | Ga0207700_100626823 | 195 |
| 131 | 3300025928 | Ga0207700_10393013 | Ga0207700_103930131 | 195 |
| 132 | 3300025928 | Ga0207700_10452458 | Ga0207700_104524582 | 195 |
| 133 | 3300025928 | Ga0207700_10552917 | Ga0207700_105529172 | 195 |
| 134 | 3300025928 | Ga0207700_10678905 | Ga0207700_106789052 | 195 |
| 135 | 3300025929 | Ga0207664_10071842 | Ga0207664_100718424 | 195 |
| 136 | 3300025929 | Ga0207664_10205846 | Ga0207664_102058462 | 195 |
| 137 | 3300025929 | Ga0207664_10420967 | Ga0207664_104209672 | 195 |
| 138 | 3300025929 | Ga0207664_10527307 | Ga0207664_105273072 | 195 |
| 139 | 3300025939 | Ga0207665_10022539 | Ga0207665_100225395 | 195 |
| 140 | 3300025939 | Ga0207665_10044340 | Ga0207665_100443403 | 195 |
| 141 | 3300025939 | Ga0207665_10052779 | Ga0207665_100527793 | 195 |
| 142 | 3300025942 | Ga0207689_11050014 | Ga0207689_110500141 | 195 |
| 143 | 3300025944 | Ga0207661_10179079 | Ga0207661_101790792 | 195 |
| 144 | 3300025945 | Ga0207679_10137102 | Ga0207679_101371023 | 195 |
| 145 | 3300025949 | Ga0207667_10198277 | Ga0207667_101982772 | 195 |
| 146 | 3300025949 | Ga0207667_10321631 | Ga0207667_103216312 | 195 |
| 147 | 3300025981 | Ga0207640_10286155 | Ga0207640_102861552 | 195 |
| 148 | 3300026023 | Ga0207677_10192193 | Ga0207677_101921932 | 195 |
| 149 | 3300026041 | Ga0207639_10129182 | Ga0207639_101291822 | 195 |
| 150 | 3300026041 | Ga0207639_10748403 | Ga0207639_107484032 | 195 |
| 151 | 3300026078 | Ga0207702_10017932 | Ga0207702_100179325 | 195 |
| 152 | 3300026088 | Ga0207641_10021590 | Ga0207641_100215904 | 195 |
| 153 | 3300026088 | Ga0207641_10306612 | Ga0207641_103066122 | 195 |
| 154 | 3300026095 | Ga0207676_10159038 | Ga0207676_101590382 | 195 |
| 155 | 3300026116 | Ga0207674_10201213 | Ga0207674_102012132 | 195 |
| 156 | 3300026116 | Ga0207674_10305491 | Ga0207674_103054912 | 195 |
| 157 | 3300026121 | Ga0207683_10262222 | Ga0207683_102622222 | 195 |
| 158 | 3300026142 | Ga0207698_10059852 | Ga0207698_100598523 | 195 |
| 159 | 3300031595 | Ga0265313_10137519 | Ga0265313_101375192 | 195 |
| 160 | 3300035083 | Ga0373926_0000675 | Ga0373926_0000675_7445_8032 | 195 |
| 161 | 3300035118 | Ga0373954_0294562 | Ga0373954_0294562_33_620 | 195 |
| 162 | 3300035119 | Ga0373956_0061195 | Ga0373956_0061195_712_1299 | 195 |
| 163 | 3300035119 | Ga0373956_0153569 | Ga0373956_0153569_103_690 | 195 |
| 164 | 3300035170 | Ga0373943_0001291 | Ga0373943_0001291_8573_9160 | 195 |
| 165 | 3300035171 | Ga0373946_0000821 | Ga0373946_0000821_8880_9467 | 195 |
| 166 | 3300035410 | Ga0373924_0000243 | Ga0373924_0000243_9575_10162 | 195 |
| 167 | 3300035692 | Ga0373935_0012297 | Ga0373935_0012297_769_1356 | 195 |
| 168 | 3300035692 | Ga0373935_0829003 | Ga0373935_0829003_82_669 | 195 |
| 169 | 3300035695 | Ga0373927_0004411 | Ga0373927_0004411_8170_8757 | 195 |
| 170 | 3300035725 | Ga0373947_0112424 | Ga0373947_0112424_755_1342 | 195 |
| 171 | 3300036401 | Ga0373937_0065583 | Ga0373937_0065583_1289_1876 | 195 |
| 172 | 3300037068 | Ga0373925_0060693 | Ga0373925_0060693_483_1070 | 195 |
| 173 | 3300037853 | Ga0436364_0115933 | Ga0436364_0115933_14104_14691 | 195 |
| 174 | 3300037853 | Ga0436364_0147107 | Ga0436364_0147107_571_1158 | 195 |
| 175 | 3300037853 | Ga0436364_0354157 | Ga0436364_0354157_1233_1820 | 195 |
| 176 | 3300045051 | Ga0451576_0873383 | Ga0451576_0873383_256_843 | 195 |
| 177 | 3300046472 | Ga0495580_0156212 | Ga0495580_0156212_213_800 | 195 |
| 178 | 3300046472 | Ga0495580_0326733 | Ga0495580_0326733_193_780 | 195 |
| 179 | 3300046531 | Ga0495665_0243362 | Ga0495665_0243362_265_852 | 195 |
| 180 | 3300046678 | Ga0495599_0548749 | Ga0495599_0548749_79_666 | 195 |
| 181 | 3300046679 | Ga0495623_0008357 | Ga0495623_0008357_3952_4539 | 195 |
| 182 | 3300046684 | Ga0495669_0370251 | Ga0495669_0370251_29_616 | 195 |
| 183 | 3300048903 | Ga0496100_0314419 | Ga0496100_0314419_237_824 | 195 |
| 184 | 3300048905 | Ga0496102_0344146 | Ga0496102_0344146_113_700 | 195 |
| 185 | 3300048905 | Ga0496102_0851610 | Ga0496102_0851610_114_701 | 195 |
| 186 | 3300048907 | Ga0496104_0056645 | Ga0496104_0056645_1862_2449 | 195 |
| 187 | 3300048907 | Ga0496104_0071299 | Ga0496104_0071299_2301_2888 | 195 |
| 188 | 3300048907 | Ga0496104_0659933 | Ga0496104_0659933_257_844 | 195 |
| 189 | 3300048908 | Ga0496105_0001615 | Ga0496105_0001615_6945_7532 | 195 |
| 190 | 3300048909 | Ga0496106_0042478 | Ga0496106_0042478_2589_3176 | 195 |
| 191 | 3300048911 | Ga0496108_0134232 | Ga0496108_0134232_1270_1857 | 195 |
| 192 | 3300048912 | Ga0496109_0316949 | Ga0496109_0316949_486_1073 | 195 |
| 193 | 3300048914 | Ga0496111_0044511 | Ga0496111_0044511_254_841 | 195 |
| 194 | 3300048914 | Ga0496111_0158175 | Ga0496111_0158175_804_1391 | 195 |
| 195 | 3300048915 | Ga0496112_0021005 | Ga0496112_0021005_351_938 | 195 |
| 196 | 3300048915 | Ga0496112_0150505 | Ga0496112_0150505_472_1059 | 195 |
| 197 | 3300048915 | Ga0496112_0467738 | Ga0496112_0467738_102_689 | 195 |
| 198 | 3300048916 | Ga0496113_0084737 | Ga0496113_0084737_426_1013 | 195 |
| 199 | 3300048918 | Ga0496115_0273258 | Ga0496115_0273258_97_684 | 195 |
| 200 | 3300048929 | Ga0496126_0078490 | Ga0496126_0078490_2288_2875 | 195 |
| 201 | 3300049744 | Ga0501083_0147296 | Ga0501083_0147296_334_921 | 195 |
| 202 | 3300053077 | Ga0495601_0167705 | Ga0495601_0167705_777_1364 | 195 |
| 203 | 3300005530 | Ga0070679_100135818 | Ga0070679_1001358182 | 196 |
| 204 | 3300005530 | Ga0070679_100162327 | Ga0070679_1001623272 | 196 |
| 205 | 3300005530 | Ga0070679_100515342 | Ga0070679_1005153422 | 196 |
| 206 | 3300005563 | Ga0068855_100003653 | Ga0068855_10000365315 | 196 |
| 207 | 3300009093 | Ga0105240_10039085 | Ga0105240_100390855 | 196 |
| 208 | 3300013104 | Ga0157370_10165459 | Ga0157370_101654592 | 196 |
| 209 | 3300013105 | Ga0157369_10172157 | Ga0157369_101721573 | 196 |
| 210 | 3300013296 | Ga0157374_10325896 | Ga0157374_103258962 | 196 |
| 211 | 3300013307 | Ga0157372_10569693 | Ga0157372_105696932 | 196 |
| 212 | 3300021361 | Ga0213872_10034756 | Ga0213872_100347563 | 196 |
| 213 | 3300025909 | Ga0207705_10294604 | Ga0207705_102946042 | 196 |
| 214 | 3300025913 | Ga0207695_10083832 | Ga0207695_100838322 | 196 |
| 215 | 3300025917 | Ga0207660_10111242 | Ga0207660_101112422 | 196 |
| 216 | 3300025921 | Ga0207652_10547214 | Ga0207652_105472141 | 196 |
| 217 | 3300025949 | Ga0207667_10007633 | Ga0207667_1000763310 | 196 |
| 218 | 3300037418 | Ga0395900_0025848 | Ga0395900_0025848_2866_3459 | 196 |
| 219 | 3300037466 | Ga0395898_0117975 | Ga0395898_0117975_1106_1699 | 196 |
| 220 | 3300039437 | Ga0436365_0590507 | Ga0436365_0590507_339_929 | 196 |
| 221 | 3300003320 | rootH2_10009426 | rootH2_100094268 | 197 |
| 222 | 3300005339 | Ga0070660_100663456 | Ga0070660_1006634561 | 197 |
| 223 | 3300005435 | Ga0070714_100161553 | Ga0070714_1001615533 | 197 |
| 224 | 3300005455 | Ga0070663_100479477 | Ga0070663_1004794772 | 197 |
| 225 | 3300005535 | Ga0070684_100011551 | Ga0070684_1000115515 | 197 |
| 226 | 3300005577 | Ga0068857_101079678 | Ga0068857_1010796782 | 197 |
| 227 | 3300009177 | Ga0105248_10000019 | Ga0105248_1000001915 | 197 |
| 228 | 3300009553 | Ga0105249_11113285 | Ga0105249_111132852 | 197 |
| 229 | 3300014968 | Ga0157379_10308107 | Ga0157379_103081072 | 197 |
| 230 | 3300025909 | Ga0207705_10107321 | Ga0207705_101073212 | 197 |
| 231 | 3300025913 | Ga0207695_10464491 | Ga0207695_104644911 | 197 |
| 232 | 3300025919 | Ga0207657_10565120 | Ga0207657_105651201 | 197 |
| 233 | 3300025941 | Ga0207711_10000014 | Ga0207711_10000014429 | 197 |
| 234 | 3300026067 | Ga0207678_10500580 | Ga0207678_105005802 | 197 |
| 235 | 3300039447 | Ga0436361_1103679 | Ga0436361_1103679_454_1086 | 197 |
| 236 | 3300039450 | Ga0436363_0331024 | Ga0436363_0331024_373_969 | 197 |
| 237 | 3300044694 | Ga0466963_0000494 | Ga0466963_0000494_12544_13140 | 197 |
| 238 | 3300045976 | Ga0466967_0001401 | Ga0466967_0001401_7243_7839 | 197 |
| 239 | 3300053119 | Ga0500595_058334 | Ga0500595_058334_491_1087 | 197 |
| 240 | 3300053119 | Ga0500595_079031 | Ga0500595_079031_283_879 | 197 |
| 241 | 3300061734 | Ga0530510_0265842 | Ga0530510_0265842_51_644 | 197 |
| 242 | 3300005563 | Ga0068855_100181173 | Ga0068855_1001811733 | 198 |
| 243 | 3300009551 | Ga0105238_10251055 | Ga0105238_102510552 | 198 |
| 244 | 3300009553 | Ga0105249_11268700 | Ga0105249_112687002 | 198 |
| 245 | 3300014969 | Ga0157376_11689302 | Ga0157376_116893021 | 198 |
| 246 | 3300025906 | Ga0207699_10680378 | Ga0207699_106803782 | 198 |
| 247 | 3300025909 | Ga0207705_10028574 | Ga0207705_100285744 | 198 |
| 248 | 3300028800 | Ga0265338_10610317 | Ga0265338_106103171 | 198 |
| 249 | 3300031344 | Ga0265316_10177577 | Ga0265316_101775772 | 198 |
| 250 | 3300047472 | Ga0495686_0008419 | Ga0495686_0008419_2547_3143 | 198 |
| 251 | 3300049570 | Ga0501033_0637612 | Ga0501033_0637612_10_606 | 198 |
| 252 | 3300005327 | Ga0070658_10272828 | Ga0070658_102728281 | 199 |
| 253 | 3300005366 | Ga0070659_100004580 | Ga0070659_1000045809 | 199 |
| 254 | 3300005435 | Ga0070714_100116911 | Ga0070714_1001169112 | 199 |
| 255 | 3300005539 | Ga0068853_100000367 | Ga0068853_10000036724 | 199 |
| 256 | 3300005563 | Ga0068855_100092013 | Ga0068855_1000920132 | 199 |
| 257 | 3300005563 | Ga0068855_100278975 | Ga0068855_1002789752 | 199 |
| 258 | 3300005578 | Ga0068854_100000019 | Ga0068854_10000001996 | 199 |
| 259 | 3300005614 | Ga0068856_100227971 | Ga0068856_1002279713 | 199 |
| 260 | 3300009093 | Ga0105240_10010838 | Ga0105240_100108386 | 199 |
| 261 | 3300009177 | Ga0105248_10022327 | Ga0105248_100223278 | 199 |
| 262 | 3300013104 | Ga0157370_10012988 | Ga0157370_100129882 | 199 |
| 263 | 3300013104 | Ga0157370_10046758 | Ga0157370_100467582 | 199 |
| 264 | 3300013105 | Ga0157369_10729791 | Ga0157369_107297912 | 199 |
| 265 | 3300013307 | Ga0157372_10348925 | Ga0157372_103489252 | 199 |
| 266 | 3300025913 | Ga0207695_10033351 | Ga0207695_100333516 | 199 |
| 267 | 3300025919 | Ga0207657_10019482 | Ga0207657_100194822 | 199 |
| 268 | 3300025929 | Ga0207664_10128766 | Ga0207664_101287663 | 199 |
| 269 | 3300025932 | Ga0207690_10050737 | Ga0207690_100507372 | 199 |
| 270 | 3300025941 | Ga0207711_10033255 | Ga0207711_100332553 | 199 |
| 271 | 3300025949 | Ga0207667_10030921 | Ga0207667_100309215 | 199 |
| 272 | 3300025949 | Ga0207667_10249710 | Ga0207667_102497102 | 199 |
| 273 | 3300025981 | Ga0207640_10000028 | Ga0207640_1000002820 | 199 |
| 274 | 3300026041 | Ga0207639_10000371 | Ga0207639_1000037111 | 199 |
| 275 | 3300026078 | Ga0207702_10306913 | Ga0207702_103069132 | 199 |
| 276 | 3300037466 | Ga0395898_0027814 | Ga0395898_0027814_4523_5125 | 199 |
| 277 | 3300037466 | Ga0395898_0546082 | Ga0395898_0546082_191_793 | 199 |
| 278 | 3300038443 | Ga0395901_0310997 | Ga0395901_0310997_575_1177 | 199 |
| 279 | 3300045049 | Ga0466959_0382284 | Ga0466959_0382284_167_766 | 199 |
| 280 | 3300046472 | Ga0495580_0497340 | Ga0495580_0497340_109_708 | 199 |
| 281 | 3300046543 | Ga0495645_0213338 | Ga0495645_0213338_236_835 | 199 |
| 282 | 3300047472 | Ga0495686_0001621 | Ga0495686_0001621_18856_19461 | 199 |
| 283 | 3300005337 | Ga0070682_100242035 | Ga0070682_1002420351 | 200 |
| 284 | 3300005548 | Ga0070665_100403581 | Ga0070665_1004035812 | 200 |
| 285 | 3300005842 | Ga0068858_100015914 | Ga0068858_1000159149 | 200 |
| 286 | 3300009177 | Ga0105248_10016372 | Ga0105248_100163727 | 200 |
| 287 | 3300009545 | Ga0105237_10063825 | Ga0105237_100638254 | 200 |
| 288 | 3300009551 | Ga0105238_10026652 | Ga0105238_100266525 | 200 |
| 289 | 3300009551 | Ga0105238_10355224 | Ga0105238_103552242 | 200 |
| 290 | 3300025924 | Ga0207694_10048093 | Ga0207694_100480932 | 200 |
| 291 | 3300025941 | Ga0207711_10044398 | Ga0207711_100443986 | 200 |
| 292 | 3300026035 | Ga0207703_10123186 | Ga0207703_101231863 | 200 |
| 293 | 3300028800 | Ga0265338_10004495 | Ga0265338_100044959 | 200 |
| 294 | 3300031249 | Ga0265339_10021882 | Ga0265339_100218824 | 200 |
| 295 | 3300031711 | Ga0265314_10034859 | Ga0265314_100348594 | 200 |
| 296 | 3300031712 | Ga0265342_10027916 | Ga0265342_100279165 | 200 |
| 297 | 3300033180 | Ga0307510_10010774 | Ga0307510_100107748 | 200 |
| 298 | 3300047472 | Ga0495686_0085891 | Ga0495686_0085891_279_881 | 200 |
| 299 | 3300053087 | Ga0500643_109394 | Ga0500643_109394_66_680 | 200 |
| 300 | iso_pu_bacteria | 2884215851 | 2884217798 | 200 |
| 301 | 3300005434 | Ga0070709_10356466 | Ga0070709_103564662 | 201 |
| 302 | 3300005435 | Ga0070714_100002654 | Ga0070714_1000026548 | 201 |
| 303 | 3300005435 | Ga0070714_100200420 | Ga0070714_1002004202 | 201 |
| 304 | 3300005563 | Ga0068855_100010384 | Ga0068855_10001038411 | 201 |
| 305 | 3300005614 | Ga0068856_100709163 | Ga0068856_1007091632 | 201 |
| 306 | 3300009093 | Ga0105240_10009346 | Ga0105240_100093465 | 201 |
| 307 | 3300009147 | Ga0114129_11396355 | Ga0114129_113963551 | 201 |
| 308 | 3300009177 | Ga0105248_10094941 | Ga0105248_100949413 | 201 |
| 309 | 3300009553 | Ga0105249_10003449 | Ga0105249_100034493 | 201 |
| 310 | 3300013105 | Ga0157369_10371511 | Ga0157369_103715112 | 201 |
| 311 | 3300013306 | Ga0163162_10027442 | Ga0163162_100274426 | 201 |
| 312 | 3300014968 | Ga0157379_10048162 | Ga0157379_100481624 | 201 |
| 313 | 3300014968 | Ga0157379_10287290 | Ga0157379_102872902 | 201 |
| 314 | 3300021361 | Ga0213872_10002341 | Ga0213872_100023413 | 201 |
| 315 | 3300021361 | Ga0213872_10051363 | Ga0213872_100513633 | 201 |
| 316 | 3300021361 | Ga0213872_10054105 | Ga0213872_100541052 | 201 |
| 317 | 3300024225 | Ga0224572_1008454 | Ga0224572_10084543 | 201 |
| 318 | 3300025911 | Ga0207654_10233283 | Ga0207654_102332832 | 201 |
| 319 | 3300025913 | Ga0207695_10000263 | Ga0207695_1000026317 | 201 |
| 320 | 3300025913 | Ga0207695_10723985 | Ga0207695_107239852 | 201 |
| 321 | 3300025914 | Ga0207671_10218141 | Ga0207671_102181411 | 201 |
| 322 | 3300025928 | Ga0207700_11068310 | Ga0207700_110683101 | 201 |
| 323 | 3300025929 | Ga0207664_10017916 | Ga0207664_100179163 | 201 |
| 324 | 3300025929 | Ga0207664_10105160 | Ga0207664_101051603 | 201 |
| 325 | 3300025941 | Ga0207711_10065518 | Ga0207711_100655182 | 201 |
| 326 | 3300025949 | Ga0207667_10243021 | Ga0207667_102430212 | 201 |
| 327 | 3300025961 | Ga0207712_10043097 | Ga0207712_100430973 | 201 |
| 328 | 3300026078 | Ga0207702_10070171 | Ga0207702_100701711 | 201 |
| 329 | 3300033180 | Ga0307510_10212472 | Ga0307510_102124722 | 201 |
| 330 | 3300033180 | Ga0307510_10223248 | Ga0307510_102232481 | 201 |
| 331 | 3300039438 | Ga0436360_1067871 | Ga0436360_1067871_123_728 | 201 |
| 332 | 3300039438 | Ga0436360_1280163 | Ga0436360_1280163_22_648 | 201 |
| 333 | 3300039447 | Ga0436361_0318263 | Ga0436361_0318263_3747_4367 | 201 |
| 334 | 3300039447 | Ga0436361_0387230 | Ga0436361_0387230_206_814 | 201 |
| 335 | 3300039447 | Ga0436361_0497072 | Ga0436361_0497072_57_674 | 201 |
| 336 | 3300039447 | Ga0436361_0500168 | Ga0436361_0500168_1214_1825 | 201 |
| 337 | 3300039447 | Ga0436361_0732319 | Ga0436361_0732319_854_1459 | 201 |
| 338 | 3300044765 | Ga0466970_0244720 | Ga0466970_0244720_315_932 | 201 |
| 339 | 3300045976 | Ga0466967_0046813 | Ga0466967_0046813_379_996 | 201 |
| 340 | 3300046459 | Ga0495629_0029674 | Ga0495629_0029674_2757_3362 | 201 |
| 341 | 3300046459 | Ga0495629_0049585 | Ga0495629_0049585_238_843 | 201 |
| 342 | 3300046460 | Ga0495638_0445383 | Ga0495638_0445383_38_643 | 201 |
| 343 | 3300046462 | Ga0495651_0053044 | Ga0495651_0053044_909_1514 | 201 |
| 344 | 3300046463 | Ga0495653_0010749 | Ga0495653_0010749_2408_3013 | 201 |
| 345 | 3300046473 | Ga0495582_0001853 | Ga0495582_0001853_2290_2895 | 201 |
| 346 | 3300046473 | Ga0495582_0095987 | Ga0495582_0095987_694_1299 | 201 |
| 347 | 3300046475 | Ga0495639_0004538 | Ga0495639_0004538_1420_2025 | 201 |
| 348 | 3300046476 | Ga0495662_0005660 | Ga0495662_0005660_714_1319 | 201 |
| 349 | 3300046477 | Ga0495664_0001348 | Ga0495664_0001348_8660_9265 | 201 |
| 350 | 3300046477 | Ga0495664_0057856 | Ga0495664_0057856_1552_2157 | 201 |
| 351 | 3300046499 | Ga0495594_0000388 | Ga0495594_0000388_1148_1753 | 201 |
| 352 | 3300046499 | Ga0495594_0004431 | Ga0495594_0004431_1071_1676 | 201 |
| 353 | 3300046506 | Ga0495583_0033822 | Ga0495583_0033822_817_1422 | 201 |
| 354 | 3300046517 | Ga0495630_0270870 | Ga0495630_0270870_221_826 | 201 |
| 355 | 3300046526 | Ga0495666_0001196 | Ga0495666_0001196_861_1466 | 201 |
| 356 | 3300046529 | Ga0495652_0006640 | Ga0495652_0006640_9047_9652 | 201 |
| 357 | 3300046531 | Ga0495665_0001828 | Ga0495665_0001828_9607_10212 | 201 |
| 358 | 3300046533 | Ga0495640_0004801 | Ga0495640_0004801_8603_9208 | 201 |
| 359 | 3300046533 | Ga0495640_0112414 | Ga0495640_0112414_243_848 | 201 |
| 360 | 3300046535 | Ga0495586_0019711 | Ga0495586_0019711_2891_3496 | 201 |
| 361 | 3300046536 | Ga0495587_0093692 | Ga0495587_0093692_443_1048 | 201 |
| 362 | 3300046559 | Ga0495667_0150787 | Ga0495667_0150787_298_903 | 201 |
| 363 | 3300046642 | Ga0495634_0006225 | Ga0495634_0006225_4027_4632 | 201 |
| 364 | 3300046660 | Ga0495625_0007833 | Ga0495625_0007833_7699_8304 | 201 |
| 365 | 3300046660 | Ga0495625_0026175 | Ga0495625_0026175_2642_3247 | 201 |
| 366 | 3300046663 | Ga0495635_0002836 | Ga0495635_0002836_3728_4333 | 201 |
| 367 | 3300046665 | Ga0495661_0026784 | Ga0495661_0026784_2959_3564 | 201 |
| 368 | 3300046675 | Ga0495657_0277857 | Ga0495657_0277857_182_787 | 201 |
| 369 | 3300046678 | Ga0495599_0242663 | Ga0495599_0242663_112_717 | 201 |
| 370 | 3300046680 | Ga0495646_0013211 | Ga0495646_0013211_1524_2129 | 201 |
| 371 | 3300046680 | Ga0495646_0023225 | Ga0495646_0023225_271_876 | 201 |
| 372 | 3300046680 | Ga0495646_0222729 | Ga0495646_0222729_330_935 | 201 |
| 373 | 3300046689 | Ga0495613_0003966 | Ga0495613_0003966_5046_5651 | 201 |
| 374 | 3300046689 | Ga0495613_0018773 | Ga0495613_0018773_3065_3670 | 201 |
| 375 | 3300046690 | Ga0495624_0007524 | Ga0495624_0007524_2555_3160 | 201 |
| 376 | 3300046692 | Ga0495671_0095768 | Ga0495671_0095768_719_1324 | 201 |
| 377 | 3300046809 | Ga0495600_0012858 | Ga0495600_0012858_1525_2130 | 201 |
| 378 | 3300047315 | Ga0495581_0001976 | Ga0495581_0001976_7386_7991 | 201 |
| 379 | 3300047317 | Ga0495604_0002834 | Ga0495604_0002834_11697_12302 | 201 |
| 380 | 3300047319 | Ga0495674_0014334 | Ga0495674_0014334_3154_3759 | 201 |
| 381 | 3300047320 | Ga0495672_0021506 | Ga0495672_0021506_406_1011 | 201 |
| 382 | 3300047320 | Ga0495672_0063127 | Ga0495672_0063127_247_852 | 201 |
| 383 | 3300047321 | Ga0495676_0008961 | Ga0495676_0008961_3708_4313 | 201 |
| 384 | 3300047444 | Ga0495675_0012974 | Ga0495675_0012974_1868_2473 | 201 |
| 385 | 3300047469 | Ga0495673_0231467 | Ga0495673_0231467_54_659 | 201 |
| 386 | 3300047471 | Ga0495684_0099043 | Ga0495684_0099043_1035_1640 | 201 |
| 387 | 3300048089 | Ga0495614_0000972 | Ga0495614_0000972_5097_5702 | 201 |
| 388 | 3300048918 | Ga0496115_0085005 | Ga0496115_0085005_196_807 | 201 |
| 389 | 3300048924 | Ga0496121_0365824 | Ga0496121_0365824_324_929 | 201 |
| 390 | 3300048929 | Ga0496126_0000154 | Ga0496126_0000154_113120_113725 | 201 |
| 391 | 3300053093 | Ga0500651_0000005 | Ga0500651_0000005_175084_175689 | 201 |
| 392 | 3300053119 | Ga0500595_000004 | Ga0500595_000004_240926_241531 | 201 |
| 393 | 3300053119 | Ga0500595_007997 | Ga0500595_007997_657_1262 | 201 |
| 394 | 3300055283 | Ga0500661_003309 | Ga0500661_003309_1098_1703 | 201 |
| 395 | 3300005327 | Ga0070658_10000121 | Ga0070658_100001218 | 202 |
| 396 | 3300005327 | Ga0070658_10021582 | Ga0070658_100215825 | 202 |
| 397 | 3300005327 | Ga0070658_10071707 | Ga0070658_100717072 | 202 |
| 398 | 3300005327 | Ga0070658_10112053 | Ga0070658_101120532 | 202 |
| 399 | 3300005329 | Ga0070683_100028772 | Ga0070683_1000287726 | 202 |
| 400 | 3300005331 | Ga0070670_100079127 | Ga0070670_1000791273 | 202 |
| 401 | 3300005338 | Ga0068868_100488108 | Ga0068868_1004881082 | 202 |
| 402 | 3300005339 | Ga0070660_100155643 | Ga0070660_1001556433 | 202 |
| 403 | 3300005355 | Ga0070671_100003123 | Ga0070671_1000031232 | 202 |
| 404 | 3300005366 | Ga0070659_100689205 | Ga0070659_1006892051 | 202 |
| 405 | 3300005455 | Ga0070663_100053467 | Ga0070663_1000534672 | 202 |
| 406 | 3300005455 | Ga0070663_100130863 | Ga0070663_1001308632 | 202 |
| 407 | 3300005455 | Ga0070663_100182632 | Ga0070663_1001826321 | 202 |
| 408 | 3300005530 | Ga0070679_100003993 | Ga0070679_10000399311 | 202 |
| 409 | 3300005548 | Ga0070665_100158518 | Ga0070665_1001585182 | 202 |
| 410 | 3300005563 | Ga0068855_100035334 | Ga0068855_1000353343 | 202 |
| 411 | 3300005563 | Ga0068855_100218171 | Ga0068855_1002181712 | 202 |
| 412 | 3300005563 | Ga0068855_100468401 | Ga0068855_1004684012 | 202 |
| 413 | 3300005563 | Ga0068855_100584895 | Ga0068855_1005848952 | 202 |
| 414 | 3300005563 | Ga0068855_101193853 | Ga0068855_1011938531 | 202 |
| 415 | 3300005577 | Ga0068857_100015817 | Ga0068857_1000158173 | 202 |
| 416 | 3300005578 | Ga0068854_100044343 | Ga0068854_1000443433 | 202 |
| 417 | 3300005618 | Ga0068864_100012167 | Ga0068864_1000121672 | 202 |
| 418 | 3300005841 | Ga0068863_100001814 | Ga0068863_10000181411 | 202 |
| 419 | 3300009093 | Ga0105240_11390657 | Ga0105240_113906571 | 202 |
| 420 | 3300009177 | Ga0105248_10042895 | Ga0105248_100428955 | 202 |
| 421 | 3300009545 | Ga0105237_10812540 | Ga0105237_108125402 | 202 |
| 422 | 3300013104 | Ga0157370_10013763 | Ga0157370_100137632 | 202 |
| 423 | 3300013104 | Ga0157370_10171680 | Ga0157370_101716803 | 202 |
| 424 | 3300013104 | Ga0157370_10752683 | Ga0157370_107526832 | 202 |
| 425 | 3300013105 | Ga0157369_10028989 | Ga0157369_100289892 | 202 |
| 426 | 3300013105 | Ga0157369_10115794 | Ga0157369_101157943 | 202 |
| 427 | 3300013296 | Ga0157374_10042034 | Ga0157374_100420344 | 202 |
| 428 | 3300014325 | Ga0163163_10062243 | Ga0163163_100622434 | 202 |
| 429 | 3300025903 | Ga0207680_10204305 | Ga0207680_102043052 | 202 |
| 430 | 3300025909 | Ga0207705_10000021 | Ga0207705_10000021234 | 202 |
| 431 | 3300025909 | Ga0207705_10002125 | Ga0207705_100021252 | 202 |
| 432 | 3300025909 | Ga0207705_10002923 | Ga0207705_1000292313 | 202 |
| 433 | 3300025909 | Ga0207705_10027435 | Ga0207705_100274352 | 202 |
| 434 | 3300025909 | Ga0207705_10332471 | Ga0207705_103324711 | 202 |
| 435 | 3300025912 | Ga0207707_10465465 | Ga0207707_104654653 | 202 |
| 436 | 3300025919 | Ga0207657_10036579 | Ga0207657_100365794 | 202 |
| 437 | 3300025921 | Ga0207652_10036402 | Ga0207652_100364025 | 202 |
| 438 | 3300025925 | Ga0207650_10213491 | Ga0207650_102134912 | 202 |
| 439 | 3300025931 | Ga0207644_10017923 | Ga0207644_100179234 | 202 |
| 440 | 3300025941 | Ga0207711_10093223 | Ga0207711_100932233 | 202 |
| 441 | 3300025944 | Ga0207661_10078225 | Ga0207661_100782251 | 202 |
| 442 | 3300025949 | Ga0207667_10012818 | Ga0207667_100128182 | 202 |
| 443 | 3300025949 | Ga0207667_10098554 | Ga0207667_100985542 | 202 |
| 444 | 3300025949 | Ga0207667_10979643 | Ga0207667_109796431 | 202 |
| 445 | 3300025981 | Ga0207640_10034716 | Ga0207640_100347162 | 202 |
| 446 | 3300026041 | Ga0207639_10054301 | Ga0207639_100543012 | 202 |
| 447 | 3300026067 | Ga0207678_10006398 | Ga0207678_100063983 | 202 |
| 448 | 3300026067 | Ga0207678_10229059 | Ga0207678_102290592 | 202 |
| 449 | 3300026067 | Ga0207678_10575718 | Ga0207678_105757182 | 202 |
| 450 | 3300026078 | Ga0207702_10888883 | Ga0207702_108888832 | 202 |
| 451 | 3300026088 | Ga0207641_10037049 | Ga0207641_100370494 | 202 |
| 452 | 3300026095 | Ga0207676_10508123 | Ga0207676_105081233 | 202 |
| 453 | 3300026116 | Ga0207674_10142769 | Ga0207674_101427691 | 202 |
| 454 | 3300028379 | Ga0268266_10078240 | Ga0268266_100782402 | 202 |
| 455 | 3300028379 | Ga0268266_10188892 | Ga0268266_101888922 | 202 |
| 456 | 3300028577 | Ga0265318_10076123 | Ga0265318_100761232 | 202 |
| 457 | 3300028666 | Ga0265336_10001048 | Ga0265336_100010488 | 202 |
| 458 | 3300031235 | Ga0265330_10072643 | Ga0265330_100726432 | 202 |
| 459 | 3300031235 | Ga0265330_10126058 | Ga0265330_101260582 | 202 |
| 460 | 3300031241 | Ga0265325_10098913 | Ga0265325_100989132 | 202 |
| 461 | 3300031247 | Ga0265340_10096350 | Ga0265340_100963502 | 202 |
| 462 | 3300031249 | Ga0265339_10003213 | Ga0265339_100032133 | 202 |
| 463 | 3300031344 | Ga0265316_10129073 | Ga0265316_101290732 | 202 |
| 464 | 3300031595 | Ga0265313_10068916 | Ga0265313_100689162 | 202 |
| 465 | 3300031711 | Ga0265314_10117019 | Ga0265314_101170192 | 202 |
| 466 | 3300031712 | Ga0265342_10014061 | Ga0265342_100140613 | 202 |
| 467 | 3300035410 | Ga0373924_0093250 | Ga0373924_0093250_89_709 | 202 |
| 468 | 3300046507 | Ga0495606_0044975 | Ga0495606_0044975_202_810 | 202 |
| 469 | 3300046538 | Ga0495609_0080699 | Ga0495609_0080699_655_1263 | 202 |
| 470 | 3300046660 | Ga0495625_0381016 | Ga0495625_0381016_71_679 | 202 |
| 471 | 3300046660 | Ga0495625_0434634 | Ga0495625_0434634_176_784 | 202 |
| 472 | 3300046664 | Ga0495659_0114237 | Ga0495659_0114237_312_920 | 202 |
| 473 | 3300047323 | Ga0495683_0174509 | Ga0495683_0174509_364_972 | 202 |
| 474 | 3300049573 | Ga0501037_0492477 | Ga0501037_0492477_96_704 | 202 |
| 475 | 3300049574 | Ga0501038_0085946 | Ga0501038_0085946_242_850 | 202 |
| 476 | 3300049581 | Ga0501047_0066914 | Ga0501047_0066914_2253_2861 | 202 |
| 477 | 3300049589 | Ga0501073_0110559 | Ga0501073_0110559_83_691 | 202 |
| 478 | 3300049590 | Ga0501074_0196241 | Ga0501074_0196241_127_735 | 202 |
| 479 | 3300049742 | Ga0501080_0188110 | Ga0501080_0188110_1237_1845 | 202 |
| 480 | 3300005339 | Ga0070660_100232314 | Ga0070660_1002323143 | 203 |
| 481 | 3300005344 | Ga0070661_100050615 | Ga0070661_1000506154 | 203 |
| 482 | 3300005366 | Ga0070659_100138892 | Ga0070659_1001388922 | 203 |
| 483 | 3300005437 | Ga0070710_10192885 | Ga0070710_101928852 | 203 |
| 484 | 3300005530 | Ga0070679_100987841 | Ga0070679_1009878411 | 203 |
| 485 | 3300005539 | Ga0068853_100237710 | Ga0068853_1002377102 | 203 |
| 486 | 3300005563 | Ga0068855_100169055 | Ga0068855_1001690553 | 203 |
| 487 | 3300005834 | Ga0068851_10306247 | Ga0068851_103062472 | 203 |
| 488 | 3300009551 | Ga0105238_10078759 | Ga0105238_100787594 | 203 |
| 489 | 3300013105 | Ga0157369_10012659 | Ga0157369_100126595 | 203 |
| 490 | 3300013307 | Ga0157372_10403380 | Ga0157372_104033802 | 203 |
| 491 | 3300014968 | Ga0157379_10161237 | Ga0157379_101612373 | 203 |
| 492 | 3300014969 | Ga0157376_10737860 | Ga0157376_107378602 | 203 |
| 493 | 3300021441 | Ga0213871_10006004 | Ga0213871_100060042 | 203 |
| 494 | 3300025321 | Ga0207656_10196195 | Ga0207656_101961951 | 203 |
| 495 | 3300025909 | Ga0207705_10021055 | Ga0207705_100210552 | 203 |
| 496 | 3300025919 | Ga0207657_10205754 | Ga0207657_102057542 | 203 |
| 497 | 3300025920 | Ga0207649_10031894 | Ga0207649_100318943 | 203 |
| 498 | 3300026041 | Ga0207639_10520451 | Ga0207639_105204512 | 203 |
| 499 | 3300031247 | Ga0265340_10171805 | Ga0265340_101718052 | 203 |
| 500 | 3300031344 | Ga0265316_10018630 | Ga0265316_100186302 | 203 |
| 501 | 3300031712 | Ga0265342_10188592 | Ga0265342_101885922 | 203 |
| 502 | 3300048088 | Ga0495602_0081301 | Ga0495602_0081301_382_1002 | 203 |
| 503 | 3300005327 | Ga0070658_10205977 | Ga0070658_102059772 | 204 |
| 504 | 3300005338 | Ga0068868_100081115 | Ga0068868_1000811154 | 204 |
| 505 | 3300005344 | Ga0070661_100153801 | Ga0070661_1001538012 | 204 |
| 506 | 3300005455 | Ga0070663_100498539 | Ga0070663_1004985392 | 204 |
| 507 | 3300005616 | Ga0068852_100103163 | Ga0068852_1001031631 | 204 |
| 508 | 3300005834 | Ga0068851_10016393 | Ga0068851_100163932 | 204 |
| 509 | 3300009093 | Ga0105240_10120373 | Ga0105240_101203733 | 204 |
| 510 | 3300009098 | Ga0105245_10085606 | Ga0105245_100856063 | 204 |
| 511 | 3300009098 | Ga0105245_10513291 | Ga0105245_105132912 | 204 |
| 512 | 3300009545 | Ga0105237_10248368 | Ga0105237_102483682 | 204 |
| 513 | 3300009551 | Ga0105238_10023794 | Ga0105238_100237942 | 204 |
| 514 | 3300010375 | Ga0105239_10105415 | Ga0105239_101054153 | 204 |
| 515 | 3300013105 | Ga0157369_10192237 | Ga0157369_101922373 | 204 |
| 516 | 3300013296 | Ga0157374_10498754 | Ga0157374_104987541 | 204 |
| 517 | 3300013297 | Ga0157378_10023973 | Ga0157378_100239736 | 204 |
| 518 | 3300013308 | Ga0157375_10066677 | Ga0157375_100666772 | 204 |
| 519 | 3300025321 | Ga0207656_10048760 | Ga0207656_100487602 | 204 |
| 520 | 3300025913 | Ga0207695_10072087 | Ga0207695_100720874 | 204 |
| 521 | 3300025914 | Ga0207671_10086096 | Ga0207671_100860962 | 204 |
| 522 | 3300025924 | Ga0207694_10273841 | Ga0207694_102738412 | 204 |
| 523 | 3300025927 | Ga0207687_10130110 | Ga0207687_101301102 | 204 |
| 524 | 3300026023 | Ga0207677_10322859 | Ga0207677_103228592 | 204 |
| 525 | 3300026041 | Ga0207639_10014115 | Ga0207639_100141152 | 204 |
| 526 | 3300026041 | Ga0207639_10016992 | Ga0207639_100169922 | 204 |
| 527 | 3300026142 | Ga0207698_10215710 | Ga0207698_102157103 | 204 |
| 528 | 3300031235 | Ga0265330_10011435 | Ga0265330_100114355 | 204 |
| 529 | 3300031235 | Ga0265330_10120309 | Ga0265330_101203092 | 204 |
| 530 | 3300031242 | Ga0265329_10011996 | Ga0265329_100119962 | 204 |
| 531 | 3300031344 | Ga0265316_10000352 | Ga0265316_1000035236 | 204 |
| 532 | 3300031712 | Ga0265342_10002441 | Ga0265342_100024418 | 204 |
| 533 | 3300031712 | Ga0265342_10332508 | Ga0265342_103325082 | 204 |
| 534 | 3300044694 | Ga0466963_0107210 | Ga0466963_0107210_880_1509 | 204 |
| 535 | 3300044842 | Ga0466957_0026837 | Ga0466957_0026837_1469_2089 | 204 |
| 536 | 3300046452 | Ga0495617_026479 | Ga0495617_026479_536_1156 | 204 |
| 537 | 3300046455 | Ga0495603_0039419 | Ga0495603_0039419_1171_1791 | 204 |
| 538 | 3300046459 | Ga0495629_0137756 | Ga0495629_0137756_601_1230 | 204 |
| 539 | 3300046492 | Ga0495585_0085882 | Ga0495585_0085882_912_1532 | 204 |
| 540 | 3300046499 | Ga0495594_0001190 | Ga0495594_0001190_4229_4849 | 204 |
| 541 | 3300046523 | Ga0495644_0000048 | Ga0495644_0000048_34106_34726 | 204 |
| 542 | 3300046528 | Ga0495642_0019216 | Ga0495642_0019216_2000_2620 | 204 |
| 543 | 3300046538 | Ga0495609_0011141 | Ga0495609_0011141_1119_1739 | 204 |
| 544 | 3300046558 | Ga0495633_0051416 | Ga0495633_0051416_351_971 | 204 |
| 545 | 3300046648 | Ga0495611_0005877 | Ga0495611_0005877_4194_4814 | 204 |
| 546 | 3300046660 | Ga0495625_0034121 | Ga0495625_0034121_2234_2854 | 204 |
| 547 | 3300046679 | Ga0495623_0410809 | Ga0495623_0410809_53_682 | 204 |
| 548 | 3300046684 | Ga0495669_0004252 | Ga0495669_0004252_3687_4307 | 204 |
| 549 | 3300046689 | Ga0495613_0109799 | Ga0495613_0109799_878_1507 | 204 |
| 550 | 3300048903 | Ga0496100_0725168 | Ga0496100_0725168_114_743 | 204 |
| 551 | 3300048908 | Ga0496105_0057832 | Ga0496105_0057832_1627_2256 | 204 |
| 552 | 3300048914 | Ga0496111_0303736 | Ga0496111_0303736_468_1097 | 204 |
| 553 | 3300048918 | Ga0496115_0091617 | Ga0496115_0091617_1553_2182 | 204 |
| 554 | 3300048918 | Ga0496115_0373480 | Ga0496115_0373480_96_725 | 204 |
| 555 | 3300049569 | Ga0501032_0001912 | Ga0501032_0001912_6908_7528 | 204 |
| 556 | 3300049570 | Ga0501033_0028282 | Ga0501033_0028282_2381_3001 | 204 |
| 557 | 3300049571 | Ga0501034_0148520 | Ga0501034_0148520_831_1451 | 204 |
| 558 | 3300049572 | Ga0501036_0076344 | Ga0501036_0076344_1396_2016 | 204 |
| 559 | 3300049573 | Ga0501037_0391740 | Ga0501037_0391740_66_686 | 204 |
| 560 | 3300049574 | Ga0501038_0048143 | Ga0501038_0048143_2333_2953 | 204 |
| 561 | 3300049579 | Ga0501043_0003983 | Ga0501043_0003983_9383_10003 | 204 |
| 562 | 3300049580 | Ga0501046_0000056 | Ga0501046_0000056_47108_47728 | 204 |
| 563 | 3300049581 | Ga0501047_0008947 | Ga0501047_0008947_4589_5209 | 204 |
| 564 | 3300049589 | Ga0501073_0110594 | Ga0501073_0110594_1212_1832 | 204 |
| 565 | 3300049822 | Ga0501035_0044540 | Ga0501035_0044540_2717_3337 | 204 |
| 566 | 3300049823 | Ga0501044_0027240 | Ga0501044_0027240_659_1279 | 204 |
| 567 | 3300005614 | Ga0068856_100050428 | Ga0068856_1000504284 | 205 |
| 568 | 3300005834 | Ga0068851_10058980 | Ga0068851_100589804 | 205 |
| 569 | 3300013105 | Ga0157369_10054976 | Ga0157369_100549764 | 205 |
| 570 | 3300025321 | Ga0207656_10364668 | Ga0207656_103646682 | 205 |
| 571 | 3300026078 | Ga0207702_10989030 | Ga0207702_109890302 | 205 |
| 572 | 3300028800 | Ga0265338_10268771 | Ga0265338_102687712 | 205 |
| 573 | 3300031239 | Ga0265328_10011186 | Ga0265328_100111865 | 205 |
| 574 | 3300031249 | Ga0265339_10000194 | Ga0265339_1000019417 | 205 |
| 575 | 3300031344 | Ga0265316_10022409 | Ga0265316_100224094 | 205 |
| 576 | 3300031712 | Ga0265342_10001536 | Ga0265342_100015365 | 205 |
| 577 | 3300033544 | Ga0316215_1003489 | Ga0316215_10034892 | 205 |
| 578 | 3300005458 | Ga0070681_10966872 | Ga0070681_109668721 | 206 |
| 579 | 3300025912 | Ga0207707_10659207 | Ga0207707_106592072 | 206 |
| 580 | 3300028800 | Ga0265338_10259829 | Ga0265338_102598292 | 206 |
| 581 | 3300031235 | Ga0265330_10000273 | Ga0265330_1000027325 | 206 |
| 582 | 3300031235 | Ga0265330_10030656 | Ga0265330_100306563 | 206 |
| 583 | 3300031241 | Ga0265325_10000266 | Ga0265325_1000026623 | 206 |
| 584 | 3300031241 | Ga0265325_10005858 | Ga0265325_100058588 | 206 |
| 585 | 3300031247 | Ga0265340_10012505 | Ga0265340_100125055 | 206 |
| 586 | 3300031247 | Ga0265340_10015610 | Ga0265340_100156104 | 206 |
| 587 | 3300031249 | Ga0265339_10009288 | Ga0265339_100092881 | 206 |
| 588 | 3300031249 | Ga0265339_10028825 | Ga0265339_100288253 | 206 |
| 589 | 3300031344 | Ga0265316_10003105 | Ga0265316_100031053 | 206 |
| 590 | 3300031344 | Ga0265316_10008382 | Ga0265316_100083825 | 206 |
| 591 | 3300031595 | Ga0265313_10002216 | Ga0265313_1000221616 | 206 |
| 592 | 3300031595 | Ga0265313_10187633 | Ga0265313_101876332 | 206 |
| 593 | 3300031712 | Ga0265342_10000225 | Ga0265342_1000022533 | 206 |
| 594 | 3300031712 | Ga0265342_10069670 | Ga0265342_100696702 | 206 |
| 595 | 3300046471 | Ga0495650_0000038 | Ga0495650_0000038_183824_184450 | 206 |
| 596 | 3300046660 | Ga0495625_0089152 | Ga0495625_0089152_201_827 | 206 |
| 597 | 3300046694 | Ga0495649_0012107 | Ga0495649_0012107_2979_3641 | 206 |
| 598 | 3300005436 | Ga0070713_100631919 | Ga0070713_1006319192 | 207 |
| 599 | 3300037418 | Ga0395900_0389492 | Ga0395900_0389492_392_1027 | 207 |
| 600 | 3300044693 | Ga0466961_0055286 | Ga0466961_0055286_538_1164 | 207 |
| 601 | 3300046507 | Ga0495606_0067569 | Ga0495606_0067569_1209_1871 | 207 |
| 602 | 3300005328 | Ga0070676_10067377 | Ga0070676_100673773 | 208 |
| 603 | 3300005335 | Ga0070666_10070170 | Ga0070666_100701704 | 208 |
| 604 | 3300005344 | Ga0070661_100701045 | Ga0070661_1007010451 | 208 |
| 605 | 3300005355 | Ga0070671_100446435 | Ga0070671_1004464352 | 208 |
| 606 | 3300005364 | Ga0070673_100070243 | Ga0070673_1000702433 | 208 |
| 607 | 3300005367 | Ga0070667_100246795 | Ga0070667_1002467952 | 208 |
| 608 | 3300005436 | Ga0070713_100433308 | Ga0070713_1004333082 | 208 |
| 609 | 3300005456 | Ga0070678_100600428 | Ga0070678_1006004282 | 208 |
| 610 | 3300005457 | Ga0070662_100215752 | Ga0070662_1002157522 | 208 |
| 611 | 3300005459 | Ga0068867_100354254 | Ga0068867_1003542542 | 208 |
| 612 | 3300005539 | Ga0068853_100327147 | Ga0068853_1003271472 | 208 |
| 613 | 3300005548 | Ga0070665_100181688 | Ga0070665_1001816882 | 208 |
| 614 | 3300005564 | Ga0070664_100592049 | Ga0070664_1005920492 | 208 |
| 615 | 3300005577 | Ga0068857_100355705 | Ga0068857_1003557052 | 208 |
| 616 | 3300005614 | Ga0068856_100085887 | Ga0068856_1000858873 | 208 |
| 617 | 3300005616 | Ga0068852_100113488 | Ga0068852_1001134882 | 208 |
| 618 | 3300005834 | Ga0068851_10167950 | Ga0068851_101679502 | 208 |
| 619 | 3300005843 | Ga0068860_100510378 | Ga0068860_1005103782 | 208 |
| 620 | 3300006237 | Ga0097621_100505098 | Ga0097621_1005050982 | 208 |
| 621 | 3300006881 | Ga0068865_100136913 | Ga0068865_1001369132 | 208 |
| 622 | 3300009098 | Ga0105245_10443589 | Ga0105245_104435892 | 208 |
| 623 | 3300009174 | Ga0105241_10232573 | Ga0105241_102325732 | 208 |
| 624 | 3300009177 | Ga0105248_10796820 | Ga0105248_107968202 | 208 |
| 625 | 3300009545 | Ga0105237_10137842 | Ga0105237_101378422 | 208 |
| 626 | 3300011119 | Ga0105246_10119528 | Ga0105246_101195282 | 208 |
| 627 | 3300013105 | Ga0157369_11101743 | Ga0157369_111017432 | 208 |
| 628 | 3300013308 | Ga0157375_10069334 | Ga0157375_100693343 | 208 |
| 629 | 3300017792 | Ga0163161_10044573 | Ga0163161_100445732 | 208 |
| 630 | 3300025904 | Ga0207647_10078008 | Ga0207647_100780083 | 208 |
| 631 | 3300025907 | Ga0207645_10116005 | Ga0207645_101160052 | 208 |
| 632 | 3300025927 | Ga0207687_10350078 | Ga0207687_103500782 | 208 |
| 633 | 3300025928 | Ga0207700_10394546 | Ga0207700_103945462 | 208 |
| 634 | 3300025933 | Ga0207706_10243219 | Ga0207706_102432192 | 208 |
| 635 | 3300025934 | Ga0207686_10373242 | Ga0207686_103732422 | 208 |
| 636 | 3300025940 | Ga0207691_10039961 | Ga0207691_100399614 | 208 |
| 637 | 3300025944 | Ga0207661_10475948 | Ga0207661_104759482 | 208 |
| 638 | 3300025949 | Ga0207667_10373279 | Ga0207667_103732792 | 208 |
| 639 | 3300025981 | Ga0207640_10677227 | Ga0207640_106772272 | 208 |
| 640 | 3300026023 | Ga0207677_10154976 | Ga0207677_101549763 | 208 |
| 641 | 3300026116 | Ga0207674_10294723 | Ga0207674_102947232 | 208 |
| 642 | 3300026121 | Ga0207683_10028240 | Ga0207683_100282402 | 208 |
| 643 | 3300026142 | Ga0207698_10036682 | Ga0207698_100366822 | 208 |
| 644 | 3300028017 | Ga0265356_1004445 | Ga0265356_10044453 | 208 |
| 645 | 3300046459 | Ga0495629_0060065 | Ga0495629_0060065_1679_2323 | 208 |
| 646 | 3300046472 | Ga0495580_0120910 | Ga0495580_0120910_858_1502 | 208 |
| 647 | 3300046529 | Ga0495652_0043862 | Ga0495652_0043862_2592_3236 | 208 |
| 648 | 3300046535 | Ga0495586_0197397 | Ga0495586_0197397_134_778 | 208 |
| 649 | 3300046543 | Ga0495645_0053835 | Ga0495645_0053835_313_957 | 208 |
| 650 | 3300046689 | Ga0495613_0038534 | Ga0495613_0038534_1922_2566 | 208 |
| 651 | 3300046690 | Ga0495624_0174027 | Ga0495624_0174027_520_1164 | 208 |
| 652 | 3300046809 | Ga0495600_0172644 | Ga0495600_0172644_464_1108 | 208 |
| 653 | 3300048088 | Ga0495602_0236738 | Ga0495602_0236738_539_1183 | 208 |
| 654 | 3300048907 | Ga0496104_0438058 | Ga0496104_0438058_484_1128 | 208 |
| 655 | 3300053085 | Ga0495619_0140913 | Ga0495619_0140913_687_1331 | 208 |
| 656 | 3300005329 | Ga0070683_100060569 | Ga0070683_1000605695 | 209 |
| 657 | 3300005535 | Ga0070684_100165684 | Ga0070684_1001656842 | 209 |
| 658 | 3300005563 | Ga0068855_100002688 | Ga0068855_10000268814 | 209 |
| 659 | 3300005563 | Ga0068855_100060121 | Ga0068855_1000601215 | 209 |
| 660 | 3300005616 | Ga0068852_100000019 | Ga0068852_10000001978 | 209 |
| 661 | 3300009093 | Ga0105240_10152229 | Ga0105240_101522292 | 209 |
| 662 | 3300009551 | Ga0105238_10314767 | Ga0105238_103147672 | 209 |
| 663 | 3300025913 | Ga0207695_10000167 | Ga0207695_10000167110 | 209 |
| 664 | 3300025913 | Ga0207695_10090502 | Ga0207695_100905022 | 209 |
| 665 | 3300025924 | Ga0207694_10139468 | Ga0207694_101394683 | 209 |
| 666 | 3300025924 | Ga0207694_10522820 | Ga0207694_105228202 | 209 |
| 667 | 3300025944 | Ga0207661_10077968 | Ga0207661_100779684 | 209 |
| 668 | 3300025949 | Ga0207667_10009516 | Ga0207667_100095168 | 209 |
| 669 | 3300025949 | Ga0207667_10035816 | Ga0207667_100358163 | 209 |
| 670 | 3300026142 | Ga0207698_10000003 | Ga0207698_10000003237 | 209 |
| 671 | 3300028800 | Ga0265338_10099138 | Ga0265338_100991382 | 209 |
| 672 | 3300028800 | Ga0265338_10527691 | Ga0265338_105276912 | 209 |
| 673 | 3300031238 | Ga0265332_10054533 | Ga0265332_100545332 | 209 |
| 674 | 3300031238 | Ga0265332_10280342 | Ga0265332_102803421 | 209 |
| 675 | 3300031241 | Ga0265325_10087985 | Ga0265325_100879852 | 209 |
| 676 | 3300031249 | Ga0265339_10165558 | Ga0265339_101655582 | 209 |
| 677 | 3300031344 | Ga0265316_10136596 | Ga0265316_101365961 | 209 |
| 678 | 3300031595 | Ga0265313_10046248 | Ga0265313_100462483 | 209 |
| 679 | 3300031595 | Ga0265313_10227340 | Ga0265313_102273401 | 209 |
| 680 | 3300031712 | Ga0265342_10136398 | Ga0265342_101363982 | 209 |
| 681 | 3300005339 | Ga0070660_100008313 | Ga0070660_1000083134 | 210 |
| 682 | 3300005366 | Ga0070659_100234782 | Ga0070659_1002347822 | 210 |
| 683 | 3300005437 | Ga0070710_10266048 | Ga0070710_102660481 | 210 |
| 684 | 3300005458 | Ga0070681_10001050 | Ga0070681_1000105019 | 210 |
| 685 | 3300005530 | Ga0070679_100006128 | Ga0070679_1000061288 | 210 |
| 686 | 3300005539 | Ga0068853_100130644 | Ga0068853_1001306443 | 210 |
| 687 | 3300005548 | Ga0070665_100041617 | Ga0070665_1000416173 | 210 |
| 688 | 3300005577 | Ga0068857_100306068 | Ga0068857_1003060682 | 210 |
| 689 | 3300005614 | Ga0068856_100509145 | Ga0068856_1005091452 | 210 |
| 690 | 3300005616 | Ga0068852_100001535 | Ga0068852_1000015357 | 210 |
| 691 | 3300009093 | Ga0105240_10001875 | Ga0105240_1000187517 | 210 |
| 692 | 3300009545 | Ga0105237_10575017 | Ga0105237_105750172 | 210 |
| 693 | 3300009551 | Ga0105238_10008072 | Ga0105238_100080723 | 210 |
| 694 | 3300013104 | Ga0157370_10010160 | Ga0157370_100101604 | 210 |
| 695 | 3300013105 | Ga0157369_10042189 | Ga0157369_100421896 | 210 |
| 696 | 3300013296 | Ga0157374_10827694 | Ga0157374_108276942 | 210 |
| 697 | 3300013307 | Ga0157372_10002611 | Ga0157372_100026114 | 210 |
| 698 | 3300013307 | Ga0157372_10063864 | Ga0157372_100638646 | 210 |
| 699 | 3300025909 | Ga0207705_10012875 | Ga0207705_100128752 | 210 |
| 700 | 3300025912 | Ga0207707_10003864 | Ga0207707_1000386410 | 210 |
| 701 | 3300025913 | Ga0207695_10001762 | Ga0207695_1000176220 | 210 |
| 702 | 3300025919 | Ga0207657_10004623 | Ga0207657_100046232 | 210 |
| 703 | 3300025921 | Ga0207652_10001535 | Ga0207652_1000153518 | 210 |
| 704 | 3300025924 | Ga0207694_10062538 | Ga0207694_100625383 | 210 |
| 705 | 3300025928 | Ga0207700_10058092 | Ga0207700_100580923 | 210 |
| 706 | 3300025932 | Ga0207690_10175486 | Ga0207690_101754862 | 210 |
| 707 | 3300025949 | Ga0207667_10000468 | Ga0207667_100004683 | 210 |
| 708 | 3300025949 | Ga0207667_10176714 | Ga0207667_101767142 | 210 |
| 709 | 3300026041 | Ga0207639_10211214 | Ga0207639_102112142 | 210 |
| 710 | 3300026078 | Ga0207702_10034912 | Ga0207702_100349125 | 210 |
| 711 | 3300026078 | Ga0207702_11043759 | Ga0207702_110437592 | 210 |
| 712 | 3300026116 | Ga0207674_10293248 | Ga0207674_102932482 | 210 |
| 713 | 3300026142 | Ga0207698_10003525 | Ga0207698_100035257 | 210 |
| 714 | 3300028379 | Ga0268266_10005265 | Ga0268266_100052658 | 210 |
| 715 | 3300028379 | Ga0268266_10006399 | Ga0268266_100063997 | 210 |
| 716 | 3300028573 | Ga0265334_10130983 | Ga0265334_101309832 | 210 |
| 717 | 3300028577 | Ga0265318_10011054 | Ga0265318_100110543 | 210 |
| 718 | 3300028666 | Ga0265336_10005708 | Ga0265336_100057082 | 210 |
| 719 | 3300028800 | Ga0265338_10005157 | Ga0265338_1000515714 | 210 |
| 720 | 3300028800 | Ga0265338_10009284 | Ga0265338_100092847 | 210 |
| 721 | 3300029957 | Ga0265324_10026321 | Ga0265324_100263211 | 210 |
| 722 | 3300031235 | Ga0265330_10001219 | Ga0265330_100012197 | 210 |
| 723 | 3300031239 | Ga0265328_10001272 | Ga0265328_100012723 | 210 |
| 724 | 3300031240 | Ga0265320_10003664 | Ga0265320_100036647 | 210 |
| 725 | 3300031241 | Ga0265325_10000695 | Ga0265325_1000069512 | 210 |
| 726 | 3300031242 | Ga0265329_10011153 | Ga0265329_100111533 | 210 |
| 727 | 3300031247 | Ga0265340_10001072 | Ga0265340_100010729 | 210 |
| 728 | 3300031249 | Ga0265339_10000114 | Ga0265339_1000011457 | 210 |
| 729 | 3300031250 | Ga0265331_10073017 | Ga0265331_100730173 | 210 |
| 730 | 3300031344 | Ga0265316_10000712 | Ga0265316_1000071225 | 210 |
| 731 | 3300031595 | Ga0265313_10004714 | Ga0265313_100047149 | 210 |
| 732 | 3300031711 | Ga0265314_10000504 | Ga0265314_1000050412 | 210 |
| 733 | 3300031712 | Ga0265342_10002164 | Ga0265342_1000216415 | 210 |
| 734 | 3300038443 | Ga0395901_0513053 | Ga0395901_0513053_405_1040 | 210 |
| 735 | 3300046660 | Ga0495625_0000985 | Ga0495625_0000985_25987_26637 | 210 |
| 736 | 3300049570 | Ga0501033_0115308 | Ga0501033_0115308_1009_1659 | 210 |
| 737 | 3300049822 | Ga0501035_0377603 | Ga0501035_0377603_208_858 | 210 |
| 738 | 3300049823 | Ga0501044_0095095 | Ga0501044_0095095_184_834 | 210 |
| 739 | 3300049823 | Ga0501044_0417372 | Ga0501044_0417372_552_1202 | 210 |
| 740 | 3300005458 | Ga0070681_10095557 | Ga0070681_100955573 | 211 |
| 741 | 3300005530 | Ga0070679_100369870 | Ga0070679_1003698702 | 211 |
| 742 | 3300009177 | Ga0105248_10578479 | Ga0105248_105784792 | 211 |
| 743 | 3300025911 | Ga0207654_10000054 | Ga0207654_1000005459 | 211 |
| 744 | 3300025917 | Ga0207660_10271414 | Ga0207660_102714142 | 211 |
| 745 | 3300048907 | Ga0496104_0726557 | Ga0496104_0726557_75_728 | 211 |
| 746 | 3300028800 | Ga0265338_10017734 | Ga0265338_100177345 | 212 |
| 747 | 3300029957 | Ga0265324_10009104 | Ga0265324_100091045 | 212 |
| 748 | 3300031239 | Ga0265328_10005053 | Ga0265328_100050535 | 212 |
| 749 | 3300031249 | Ga0265339_10000124 | Ga0265339_1000012417 | 212 |
| 750 | 3300031251 | Ga0265327_10267568 | Ga0265327_102675681 | 212 |
| 751 | 3300031344 | Ga0265316_10006699 | Ga0265316_100066999 | 212 |
| 752 | 3300031711 | Ga0265314_10002987 | Ga0265314_100029879 | 212 |
| 753 | 3300031712 | Ga0265342_10045350 | Ga0265342_100453504 | 212 |
| 754 | 3300032133 | Ga0316583_10095825 | Ga0316583_100958251 | 212 |
| 755 | 3300049823 | Ga0501044_0690521 | Ga0501044_0690521_186_833 | 212 |
| 756 | 3300005347 | Ga0070668_100695790 | Ga0070668_1006957901 | 213 |
| 757 | 3300006028 | Ga0070717_10011904 | Ga0070717_100119046 | 213 |
| 758 | 3300026142 | Ga0207698_10464681 | Ga0207698_104646812 | 213 |
| 759 | 3300028563 | Ga0265319_1044472 | Ga0265319_10444722 | 213 |
| 760 | 3300031250 | Ga0265331_10111778 | Ga0265331_101117782 | 213 |
| 761 | 3300035118 | Ga0373954_0036836 | Ga0373954_0036836_354_1034 | 213 |
| 762 | 3300035172 | Ga0373955_0149693 | Ga0373955_0149693_604_1284 | 213 |
| 763 | 3300036401 | Ga0373937_0007405 | Ga0373937_0007405_4375_5055 | 213 |
| 764 | 3300005327 | Ga0070658_10196354 | Ga0070658_101963543 | 214 |
| 765 | 3300005329 | Ga0070683_100002041 | Ga0070683_10000204110 | 214 |
| 766 | 3300005329 | Ga0070683_100062351 | Ga0070683_1000623513 | 214 |
| 767 | 3300005329 | Ga0070683_100221096 | Ga0070683_1002210962 | 214 |
| 768 | 3300005334 | Ga0068869_100095013 | Ga0068869_1000950132 | 214 |
| 769 | 3300005335 | Ga0070666_10055265 | Ga0070666_100552653 | 214 |
| 770 | 3300005338 | Ga0068868_100000066 | Ga0068868_10000006628 | 214 |
| 771 | 3300005339 | Ga0070660_100637198 | Ga0070660_1006371981 | 214 |
| 772 | 3300005344 | Ga0070661_100019981 | Ga0070661_1000199813 | 214 |
| 773 | 3300005344 | Ga0070661_100066000 | Ga0070661_1000660002 | 214 |
| 774 | 3300005355 | Ga0070671_100050619 | Ga0070671_1000506194 | 214 |
| 775 | 3300005367 | Ga0070667_100046288 | Ga0070667_1000462882 | 214 |
| 776 | 3300005455 | Ga0070663_100321159 | Ga0070663_1003211592 | 214 |
| 777 | 3300005535 | Ga0070684_100107048 | Ga0070684_1001070482 | 214 |
| 778 | 3300005535 | Ga0070684_100273521 | Ga0070684_1002735212 | 214 |
| 779 | 3300005535 | Ga0070684_100393724 | Ga0070684_1003937241 | 214 |
| 780 | 3300005539 | Ga0068853_100000222 | Ga0068853_10000022225 | 214 |
| 781 | 3300005539 | Ga0068853_100070755 | Ga0068853_1000707552 | 214 |
| 782 | 3300005563 | Ga0068855_100000277 | Ga0068855_10000027728 | 214 |
| 783 | 3300005563 | Ga0068855_100301117 | Ga0068855_1003011172 | 214 |
| 784 | 3300005564 | Ga0070664_100734426 | Ga0070664_1007344262 | 214 |
| 785 | 3300005577 | Ga0068857_100003191 | Ga0068857_1000031914 | 214 |
| 786 | 3300005578 | Ga0068854_100034075 | Ga0068854_1000340754 | 214 |
| 787 | 3300005614 | Ga0068856_100003529 | Ga0068856_1000035296 | 214 |
| 788 | 3300005614 | Ga0068856_100033069 | Ga0068856_1000330694 | 214 |
| 789 | 3300005614 | Ga0068856_100413541 | Ga0068856_1004135412 | 214 |
| 790 | 3300005616 | Ga0068852_100000097 | Ga0068852_10000009729 | 214 |
| 791 | 3300005616 | Ga0068852_100168947 | Ga0068852_1001689472 | 214 |
| 792 | 3300005618 | Ga0068864_100000625 | Ga0068864_1000006251 | 214 |
| 793 | 3300005834 | Ga0068851_10041070 | Ga0068851_100410703 | 214 |
| 794 | 3300005834 | Ga0068851_10051580 | Ga0068851_100515802 | 214 |
| 795 | 3300005841 | Ga0068863_100001753 | Ga0068863_10000175312 | 214 |
| 796 | 3300005842 | Ga0068858_100014586 | Ga0068858_1000145863 | 214 |
| 797 | 3300005843 | Ga0068860_100000689 | Ga0068860_10000068912 | 214 |
| 798 | 3300005844 | Ga0068862_100293795 | Ga0068862_1002937952 | 214 |
| 799 | 3300006237 | Ga0097621_100000349 | Ga0097621_10000034918 | 214 |
| 800 | 3300006358 | Ga0068871_100002325 | Ga0068871_10000232512 | 214 |
| 801 | 3300009093 | Ga0105240_10097071 | Ga0105240_100970715 | 214 |
| 802 | 3300009174 | Ga0105241_10000026 | Ga0105241_1000002626 | 214 |
| 803 | 3300009545 | Ga0105237_10000590 | Ga0105237_1000059010 | 214 |
| 804 | 3300009551 | Ga0105238_10000197 | Ga0105238_1000019727 | 214 |
| 805 | 3300010375 | Ga0105239_10001533 | Ga0105239_1000153323 | 214 |
| 806 | 3300013105 | Ga0157369_10000430 | Ga0157369_1000043027 | 214 |
| 807 | 3300025321 | Ga0207656_10031201 | Ga0207656_100312013 | 214 |
| 808 | 3300025321 | Ga0207656_10031615 | Ga0207656_100316152 | 214 |
| 809 | 3300025903 | Ga0207680_10030474 | Ga0207680_100304742 | 214 |
| 810 | 3300025904 | Ga0207647_10125849 | Ga0207647_101258492 | 214 |
| 811 | 3300025909 | Ga0207705_10282735 | Ga0207705_102827352 | 214 |
| 812 | 3300025911 | Ga0207654_10000281 | Ga0207654_1000028110 | 214 |
| 813 | 3300025911 | Ga0207654_10000808 | Ga0207654_100008084 | 214 |
| 814 | 3300025913 | Ga0207695_10000113 | Ga0207695_10000113156 | 214 |
| 815 | 3300025913 | Ga0207695_10001106 | Ga0207695_1000110637 | 214 |
| 816 | 3300025914 | Ga0207671_10000065 | Ga0207671_1000006572 | 214 |
| 817 | 3300025914 | Ga0207671_10000123 | Ga0207671_1000012386 | 214 |
| 818 | 3300025914 | Ga0207671_10000139 | Ga0207671_1000013961 | 214 |
| 819 | 3300025919 | Ga0207657_10347439 | Ga0207657_103474393 | 214 |
| 820 | 3300025920 | Ga0207649_10051782 | Ga0207649_100517824 | 214 |
| 821 | 3300025924 | Ga0207694_10000248 | Ga0207694_1000024827 | 214 |
| 822 | 3300025924 | Ga0207694_10000711 | Ga0207694_100007115 | 214 |
| 823 | 3300025925 | Ga0207650_10003582 | Ga0207650_100035829 | 214 |
| 824 | 3300025927 | Ga0207687_10000978 | Ga0207687_1000097815 | 214 |
| 825 | 3300025931 | Ga0207644_10266848 | Ga0207644_102668482 | 214 |
| 826 | 3300025944 | Ga0207661_10001283 | Ga0207661_100012836 | 214 |
| 827 | 3300025944 | Ga0207661_10055710 | Ga0207661_100557102 | 214 |
| 828 | 3300025944 | Ga0207661_10104793 | Ga0207661_101047932 | 214 |
| 829 | 3300025945 | Ga0207679_10616612 | Ga0207679_106166122 | 214 |
| 830 | 3300025949 | Ga0207667_10006194 | Ga0207667_1000619414 | 214 |
| 831 | 3300025949 | Ga0207667_10294967 | Ga0207667_102949672 | 214 |
| 832 | 3300025981 | Ga0207640_10024137 | Ga0207640_100241373 | 214 |
| 833 | 3300025981 | Ga0207640_10092985 | Ga0207640_100929853 | 214 |
| 834 | 3300025986 | Ga0207658_10003428 | Ga0207658_1000342812 | 214 |
| 835 | 3300026023 | Ga0207677_10000143 | Ga0207677_1000014322 | 214 |
| 836 | 3300026035 | Ga0207703_10004820 | Ga0207703_1000482012 | 214 |
| 837 | 3300026041 | Ga0207639_10000088 | Ga0207639_1000008818 | 214 |
| 838 | 3300026041 | Ga0207639_10154385 | Ga0207639_101543851 | 214 |
| 839 | 3300026067 | Ga0207678_10336767 | Ga0207678_103367672 | 214 |
| 840 | 3300026078 | Ga0207702_10001334 | Ga0207702_100013342 | 214 |
| 841 | 3300026078 | Ga0207702_10005816 | Ga0207702_100058163 | 214 |
| 842 | 3300026088 | Ga0207641_10005346 | Ga0207641_100053469 | 214 |
| 843 | 3300026095 | Ga0207676_10055374 | Ga0207676_100553743 | 214 |
| 844 | 3300026116 | Ga0207674_10000669 | Ga0207674_1000066911 | 214 |
| 845 | 3300026116 | Ga0207674_10148285 | Ga0207674_101482853 | 214 |
| 846 | 3300026142 | Ga0207698_10000708 | Ga0207698_100007082 | 214 |
| 847 | 3300026142 | Ga0207698_10031875 | Ga0207698_100318753 | 214 |
| 848 | 3300028380 | Ga0268265_10562240 | Ga0268265_105622402 | 214 |
| 849 | 3300028381 | Ga0268264_10000598 | Ga0268264_1000059819 | 214 |
| 850 | 3300005355 | Ga0070671_100117926 | Ga0070671_1001179262 | 215 |
| 851 | 3300005548 | Ga0070665_100005637 | Ga0070665_10000563712 | 215 |
| 852 | 3300005617 | Ga0068859_100120087 | Ga0068859_1001200873 | 215 |
| 853 | 3300006237 | Ga0097621_100360082 | Ga0097621_1003600821 | 215 |
| 854 | 3300006358 | Ga0068871_100788000 | Ga0068871_1007880002 | 215 |
| 855 | 3300006931 | Ga0097620_100120081 | Ga0097620_1001200813 | 215 |
| 856 | 3300025911 | Ga0207654_10251596 | Ga0207654_102515962 | 215 |
| 857 | 3300025913 | Ga0207695_10000080 | Ga0207695_10000080198 | 215 |
| 858 | 3300025924 | Ga0207694_10078380 | Ga0207694_100783802 | 215 |
| 859 | 3300025941 | Ga0207711_10004781 | Ga0207711_1000478110 | 215 |
| 860 | 3300028379 | Ga0268266_10008807 | Ga0268266_100088078 | 215 |
| 861 | 3300031712 | Ga0265342_10029908 | Ga0265342_100299082 | 216 |
| 862 | 3300060353 | Ga0501082_0213946 | Ga0501082_0213946_437_1129 | 217 |
| 863 | 3300013105 | Ga0157369_10098891 | Ga0157369_100988912 | 220 |
| 864 | 3300047472 | Ga0495686_0000178 | Ga0495686_0000178_48986_49663 | 220 |
| 865 | 3300047472 | Ga0495686_0047439 | Ga0495686_0047439_1172_1885 | 220 |
| 866 | 3300003214 | JGI25165J46597_1013739 | JGI25165J46597_10137392 | 229 |
| 867 | 3300025261 | Ga0209233_1001442 | Ga0209233_10014424 | 229 |
| 868 | 3300048907 | Ga0496104_0000053 | Ga0496104_0000053_125499_126197 | 229 |
| 869 | 3300048929 | Ga0496126_0000100 | Ga0496126_0000100_78964_79653 | 229 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4mu0-assembly1.cif.gz_A | the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4-triazole at 1.3 a resolution | 0.9463 | 34 | 217 |
| 7oj5-assembly1.cif.gz_A | cryo-em structure of medicago truncatula hisn5 protein | 0.9437 | 36 | 217 |
| 2f1d-assembly1.cif.gz_D | x-ray structure of imidazoleglycerol-phosphate dehydratase | 0.9435 | 36 | 217 |
| 4mu3-assembly1.cif.gz_A | the form a structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution | 0.9416 | 34 | 218 |
| 4mu0-assembly1.cif.gz_A | the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4-triazole at 1.3 a resolution | 0.9364 | 34 | 217 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1rhyA02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9662 | 124 | 214 | 3.30.230.40 |
| 4qnkD01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9607 | 34 | 121 | 3.30.230.40 |
| 1rhyA02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9561 | 124 | 214 | 3.30.230.40 |
| 2f1dA02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9531 | 124 | 217 | 3.30.230.40 |
| 2f1dA02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9434 | 124 | 217 | 3.30.230.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A850D107-F1-model_v4 | deleted | 1 | 35 | 95 |
|
| AF-A0A7X6NPR2-F1-model_v4 | deleted | 0.9949 | 36 | 114 |
|
| AF-A0A522GSK4-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase | 0.9937 | 37 | 111 |
GO:0000105
GO:0004424 |
| AF-A0A7V8WEL3-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase | 0.9936 | 37 | 100 |
GO:0000105
GO:0004424 |
| AF-A0A257PNR5-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase | 0.9928 | 35 | 114 |
GO:0000105
GO:0004424 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar