F484117

General Info

Members Datasets Scaffolds Average Seq Length
869 282 868 206

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10165459|Ga0157370_101654592
Length 203
Sequence MTMTKTTAAKALKVRTGTVKRDTTETQIALKLVIDGQGVYKVSTGIRFFDHMLELFTRHGGFDLTLKCTGDLDVDQHHTVEDVGIALGEAFDKKGIMRAGYFVMAMDETLAVAAVDLSGRVAYVVDDKVKVRLVGDFQSELLADFFDGFARGAKANVHVKTMYGRSNHHKIEAIFKAFARALRGACSRDERMREMLPSTKGLL

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
84 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
138 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
139 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
140 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
143 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
144 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
145 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
146 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
147 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
148 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
149 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
160 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
178 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
203 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
206 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
207 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
208 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
209 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
219 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
220 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
223 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
224 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
225 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
226 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
227 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
231 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
232 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
233 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
234 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
269 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
272 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
277 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
278 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
279 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
280 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.88
Metatranscriptomes 0
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.04
Nodule 0
Rhizoplane 3.11
Rhizosphere 94.02
Stem 0
Stem Tuber 0
Unclassified 1.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1013739 3300003214 Bacteria 1109
2 rootH2_10009426 3300003320 Bacteria 39179
3 Ga0065712_10479514 3300005290 Bacteria 664
4 Ga0070658_10000121 3300005327 Bacteria 70439
5 Ga0070658_10021582 3300005327 Bacteria 5160
6 Ga0070658_10071707 3300005327 Bacteria 2837
7 Ga0070658_10112053 3300005327 Bacteria 2261
8 Ga0070658_10196354 3300005327 Bacteria 1702
9 Ga0070658_10205977 3300005327 Bacteria 1661
10 Ga0070658_10272828 3300005327 Unclassified 1439
11 Ga0070676_10067377 3300005328 Bacteria 2140
12 Ga0070683_100002041 3300005329 Bacteria 15901
13 Ga0070683_100028772 3300005329 Bacteria 5025
14 Ga0070683_100060569 3300005329 Bacteria 3518
15 Ga0070683_100062351 3300005329 Bacteria 3467
16 Ga0070683_100221096 3300005329 Bacteria 1800
17 Ga0070683_100285059 3300005329 Bacteria 1571
18 Ga0070670_100079127 3300005331 Bacteria 2825
19 Ga0068869_100095013 3300005334 Bacteria 2248
20 Ga0068869_100247235 3300005334 Bacteria 1423
21 Ga0070666_10055265 3300005335 Bacteria 2680
22 Ga0070666_10070170 3300005335 Bacteria 2383
23 Ga0070682_100242035 3300005337 Bacteria 1295
24 Ga0068868_100000066 3300005338 Bacteria 59945
25 Ga0068868_100065060 3300005338 Bacteria 2896
26 Ga0068868_100081115 3300005338 Bacteria 2600
27 Ga0068868_100488108 3300005338 Bacteria 1077
28 Ga0070660_100008313 3300005339 Bacteria 7255
29 Ga0070660_100155643 3300005339 Bacteria 1839
30 Ga0070660_100232314 3300005339 Unclassified 1501
31 Ga0070660_100637198 3300005339 Unclassified 892
32 Ga0070660_100663456 3300005339 Bacteria 874
33 Ga0070661_100019981 3300005344 Bacteria 4774
34 Ga0070661_100050615 3300005344 Bacteria 3040
35 Ga0070661_100066000 3300005344 Bacteria 2659
36 Ga0070661_100153801 3300005344 Bacteria 1740
37 Ga0070661_100701045 3300005344 Unclassified 825
38 Ga0070668_100695790 3300005347 Bacteria 896
39 Ga0070671_100003123 3300005355 Bacteria 12901
40 Ga0070671_100050619 3300005355 Bacteria 3455
41 Ga0070671_100117926 3300005355 Bacteria 2232
42 Ga0070671_100446435 3300005355 Bacteria 1109
43 Ga0070673_100070243 3300005364 Bacteria 2809
44 Ga0070673_100191444 3300005364 Bacteria 1757
45 Ga0070659_100004580 3300005366 Bacteria 9889
46 Ga0070659_100138892 3300005366 Bacteria 1978
47 Ga0070659_100234782 3300005366 Bacteria 1516
48 Ga0070659_100689205 3300005366 Bacteria 883
49 Ga0070667_100046288 3300005367 Bacteria 3659
50 Ga0070667_100246795 3300005367 Bacteria 1595
51 Ga0070709_10166887 3300005434 Unclassified 1535
52 Ga0070709_10356466 3300005434 Bacteria 1082
53 Ga0070709_10501912 3300005434 Unclassified 922
54 Ga0070714_100002654 3300005435 Bacteria 13178
55 Ga0070714_100091602 3300005435 Bacteria 2664
56 Ga0070714_100105232 3300005435 Unclassified 2491
57 Ga0070714_100116911 3300005435 Bacteria 2368
58 Ga0070714_100154671 3300005435 Bacteria 2069
59 Ga0070714_100161553 3300005435 Bacteria 2027
60 Ga0070714_100188384 3300005435 Bacteria 1881
61 Ga0070714_100200420 3300005435 Bacteria 1825
62 Ga0070713_100003005 3300005436 Bacteria 11079
63 Ga0070713_100023543 3300005436 Bacteria 4780
64 Ga0070713_100082409 3300005436 Bacteria 2747
65 Ga0070713_100162511 3300005436 Bacteria 1994
66 Ga0070713_100196366 3300005436 Bacteria 1820
67 Ga0070713_100257582 3300005436 Bacteria 1593
68 Ga0070713_100433308 3300005436 Bacteria 1232
69 Ga0070713_100631919 3300005436 Unclassified 1019
70 Ga0070713_101077027 3300005436 Bacteria 776
71 Ga0070710_10032530 3300005437 Bacteria 2826
72 Ga0070710_10192885 3300005437 Bacteria 1282
73 Ga0070710_10266048 3300005437 Bacteria 1107
74 Ga0070711_100019179 3300005439 Bacteria 4384
75 Ga0070711_100022563 3300005439 Bacteria 4081
76 Ga0070711_100775332 3300005439 Bacteria 812
77 Ga0070663_100053467 3300005455 Bacteria 2883
78 Ga0070663_100130863 3300005455 Bacteria 1905
79 Ga0070663_100182632 3300005455 Bacteria 1628
80 Ga0070663_100321159 3300005455 Bacteria 1245
81 Ga0070663_100479477 3300005455 Bacteria 1029
82 Ga0070663_100498539 3300005455 Bacteria 1011
83 Ga0070678_100600428 3300005456 Bacteria 983
84 Ga0070662_100215752 3300005457 Bacteria 1529
85 Ga0070681_10001050 3300005458 Bacteria 23493
86 Ga0070681_10095557 3300005458 Bacteria 2920
87 Ga0070681_10589316 3300005458 Bacteria 1026
88 Ga0070681_10966872 3300005458 Bacteria 771
89 Ga0068867_100354254 3300005459 Bacteria 1226
90 Ga0070679_100003993 3300005530 Bacteria 13587
91 Ga0070679_100006128 3300005530 Bacteria 11185
92 Ga0070679_100135818 3300005530 Bacteria 2440
93 Ga0070679_100162327 3300005530 Bacteria 2209
94 Ga0070679_100369870 3300005530 Bacteria 1381
95 Ga0070679_100468964 3300005530 Bacteria 1203
96 Ga0070679_100515342 3300005530 Bacteria 1140
97 Ga0070679_100987841 3300005530 Bacteria 786
98 Ga0070679_101067564 3300005530 Bacteria 752
99 Ga0070684_100011551 3300005535 Bacteria 7035
100 Ga0070684_100107048 3300005535 Bacteria 2504
101 Ga0070684_100165684 3300005535 Bacteria 2006
102 Ga0070684_100273521 3300005535 Bacteria 1547
103 Ga0070684_100312272 3300005535 Bacteria 1443
104 Ga0070684_100393724 3300005535 Bacteria 1277
105 Ga0070684_100696362 3300005535 Bacteria 947
106 Ga0068853_100000222 3300005539 Bacteria 40206
107 Ga0068853_100000367 3300005539 Bacteria 31060
108 Ga0068853_100043702 3300005539 Bacteria 3833
109 Ga0068853_100070755 3300005539 Bacteria 3037
110 Ga0068853_100130644 3300005539 Bacteria 2248
111 Ga0068853_100237710 3300005539 Bacteria 1669
112 Ga0068853_100327147 3300005539 Bacteria 1422
113 Ga0068853_100336512 3300005539 Bacteria 1402
114 Ga0068853_100960524 3300005539 Bacteria 822
115 Ga0070665_100005637 3300005548 Bacteria 12872
116 Ga0070665_100041617 3300005548 Bacteria 4619
117 Ga0070665_100158518 3300005548 Bacteria 2265
118 Ga0070665_100181688 3300005548 Bacteria 2104
119 Ga0070665_100403581 3300005548 Bacteria 1375
120 Ga0068855_100000277 3300005563 Bacteria 63213
121 Ga0068855_100002688 3300005563 Bacteria 21925
122 Ga0068855_100003653 3300005563 Bacteria 18822
123 Ga0068855_100010384 3300005563 Bacteria 11233
124 Ga0068855_100035334 3300005563 Bacteria 5953
125 Ga0068855_100060121 3300005563 Bacteria 4444
126 Ga0068855_100092013 3300005563 Bacteria 3498
127 Ga0068855_100169055 3300005563 Bacteria 2477
128 Ga0068855_100181173 3300005563 Bacteria 2381
129 Ga0068855_100218171 3300005563 Bacteria 2140
130 Ga0068855_100278975 3300005563 Bacteria 1856
131 Ga0068855_100301117 3300005563 Bacteria 1775
132 Ga0068855_100468401 3300005563 Bacteria 1373
133 Ga0068855_100584895 3300005563 Bacteria 1205
134 Ga0068855_101193853 3300005563 Bacteria 791
135 Ga0070664_100124085 3300005564 Bacteria 2263
136 Ga0070664_100592049 3300005564 Bacteria 1028
137 Ga0070664_100734426 3300005564 Bacteria 921
138 Ga0068857_100003191 3300005577 Bacteria 13595
139 Ga0068857_100015817 3300005577 Bacteria 6601
140 Ga0068857_100306068 3300005577 Bacteria 1466
141 Ga0068857_100355705 3300005577 Bacteria 1357
142 Ga0068857_101079678 3300005577 Bacteria 775
143 Ga0068854_100000019 3300005578 Bacteria 134145
144 Ga0068854_100034075 3300005578 Bacteria 3554
145 Ga0068854_100044343 3300005578 Bacteria 3156
146 Ga0068856_100003529 3300005614 Bacteria 15773
147 Ga0068856_100033069 3300005614 Bacteria 5063
148 Ga0068856_100050428 3300005614 Bacteria 4103
149 Ga0068856_100057606 3300005614 Bacteria 3836
150 Ga0068856_100085887 3300005614 Bacteria 3126
151 Ga0068856_100227971 3300005614 Bacteria 1878
152 Ga0068856_100413541 3300005614 Bacteria 1369
153 Ga0068856_100509145 3300005614 Bacteria 1225
154 Ga0068856_100709163 3300005614 Bacteria 1026
155 Ga0068852_100000019 3300005616 Bacteria 129021
156 Ga0068852_100000097 3300005616 Bacteria 59430
157 Ga0068852_100001535 3300005616 Bacteria 15668
158 Ga0068852_100097697 3300005616 Bacteria 2642
159 Ga0068852_100103163 3300005616 Bacteria 2579
160 Ga0068852_100113488 3300005616 Bacteria 2468
161 Ga0068852_100161107 3300005616 Bacteria 2095
162 Ga0068852_100168947 3300005616 Bacteria 2048
163 Ga0068859_100120087 3300005617 Bacteria 2695
164 Ga0068864_100000625 3300005618 Bacteria 29830
165 Ga0068864_100012167 3300005618 Bacteria 7112
166 Ga0068864_100092202 3300005618 Bacteria 2674
167 Ga0068851_10016393 3300005834 Bacteria 3544
168 Ga0068851_10041070 3300005834 Bacteria 2326
169 Ga0068851_10051580 3300005834 Bacteria 2090
170 Ga0068851_10058980 3300005834 Bacteria 1963
171 Ga0068851_10167950 3300005834 Bacteria 1209
172 Ga0068851_10306247 3300005834 Unclassified 915
173 Ga0068863_100001753 3300005841 Bacteria 21524
174 Ga0068863_100001814 3300005841 Bacteria 21208
175 Ga0068863_100007046 3300005841 Bacteria 11016
176 Ga0068858_100014586 3300005842 Bacteria 7404
177 Ga0068858_100015914 3300005842 Bacteria 7067
178 Ga0068860_100000689 3300005843 Bacteria 38878
179 Ga0068860_100510378 3300005843 Bacteria 1201
180 Ga0068862_100293795 3300005844 Bacteria 1493
181 Ga0070717_10011247 3300006028 Bacteria 6789
182 Ga0070717_10011904 3300006028 Bacteria 6620
183 Ga0070717_10342393 3300006028 Bacteria 1335
184 Ga0070715_10002310 3300006163 Bacteria 5819
185 Ga0070716_100059060 3300006173 Bacteria 2210
186 Ga0070712_100012762 3300006175 Bacteria 5347
187 Ga0070712_100044876 3300006175 Bacteria 3049
188 Ga0070712_100340838 3300006175 Bacteria 1224
189 Ga0070712_100610888 3300006175 Bacteria 924
190 Ga0097621_100000349 3300006237 Bacteria 31779
191 Ga0097621_100360082 3300006237 Bacteria 1296
192 Ga0097621_100505098 3300006237 Bacteria 1095
193 Ga0068871_100002325 3300006358 Bacteria 12946
194 Ga0068871_100788000 3300006358 Bacteria 875
195 Ga0068865_100136913 3300006881 Bacteria 1842
196 Ga0075436_100648537 3300006914 Bacteria 780
197 Ga0097620_100120081 3300006931 Bacteria 2695
198 Ga0105240_10000372 3300009093 Bacteria 84325
199 Ga0105240_10000496 3300009093 Bacteria 72575
200 Ga0105240_10001875 3300009093 Bacteria 34957
201 Ga0105240_10009346 3300009093 Bacteria 13895
202 Ga0105240_10010838 3300009093 Bacteria 12767
203 Ga0105240_10030875 3300009093 Bacteria 6960
204 Ga0105240_10039085 3300009093 Bacteria 6080
205 Ga0105240_10087131 3300009093 Bacteria 3824
206 Ga0105240_10097071 3300009093 Bacteria 3591
207 Ga0105240_10120373 3300009093 Bacteria 3161
208 Ga0105240_10122860 3300009093 Bacteria 3124
209 Ga0105240_10152229 3300009093 Bacteria 2754
210 Ga0105240_11390657 3300009093 Bacteria 738
211 Ga0105245_10000486 3300009098 Bacteria 36378
212 Ga0105245_10021587 3300009098 Bacteria 5650
213 Ga0105245_10085606 3300009098 Bacteria 2889
214 Ga0105245_10443589 3300009098 Bacteria 1305
215 Ga0105245_10513291 3300009098 Bacteria 1216
216 Ga0105247_10002346 3300009101 Bacteria 12922
217 Ga0105247_10292438 3300009101 Bacteria 1127
218 Ga0114129_11396355 3300009147 Bacteria 864
219 Ga0105241_10000026 3300009174 Bacteria 132695
220 Ga0105241_10000121 3300009174 Bacteria 57041
221 Ga0105241_10002032 3300009174 Bacteria 15308
222 Ga0105241_10213745 3300009174 Bacteria 1617
223 Ga0105241_10232573 3300009174 Unclassified 1554
224 Ga0105242_10298302 3300009176 Unclassified 1470
225 Ga0105248_10000019 3300009177 Bacteria 285766
226 Ga0105248_10007017 3300009177 Bacteria 12337
227 Ga0105248_10016372 3300009177 Bacteria 8160
228 Ga0105248_10022327 3300009177 Bacteria 7018
229 Ga0105248_10029618 3300009177 Bacteria 6107
230 Ga0105248_10042895 3300009177 Bacteria 5072
231 Ga0105248_10094941 3300009177 Bacteria 3358
232 Ga0105248_10477210 3300009177 Bacteria 1406
233 Ga0105248_10578479 3300009177 Bacteria 1267
234 Ga0105248_10765535 3300009177 Bacteria 1089
235 Ga0105248_10796820 3300009177 Bacteria 1066
236 Ga0105237_10000590 3300009545 Bacteria 50564
237 Ga0105237_10006331 3300009545 Bacteria 13155
238 Ga0105237_10063825 3300009545 Bacteria 3680
239 Ga0105237_10137842 3300009545 Bacteria 2434
240 Ga0105237_10212808 3300009545 Bacteria 1932
241 Ga0105237_10248368 3300009545 Bacteria 1781
242 Ga0105237_10575017 3300009545 Bacteria 1134
243 Ga0105237_10627141 3300009545 Bacteria 1082
244 Ga0105237_10812540 3300009545 Bacteria 942
245 Ga0105238_10000197 3300009551 Bacteria 66637
246 Ga0105238_10000509 3300009551 Bacteria 40868
247 Ga0105238_10008072 3300009551 Bacteria 10529
248 Ga0105238_10023794 3300009551 Bacteria 6244
249 Ga0105238_10026652 3300009551 Bacteria 5892
250 Ga0105238_10054460 3300009551 Bacteria 4017
251 Ga0105238_10078759 3300009551 Bacteria 3286
252 Ga0105238_10201945 3300009551 Bacteria 1963
253 Ga0105238_10251055 3300009551 Bacteria 1747
254 Ga0105238_10314767 3300009551 Bacteria 1550
255 Ga0105238_10355224 3300009551 Bacteria 1455
256 Ga0105249_10003449 3300009553 Bacteria 13698
257 Ga0105249_10081598 3300009553 Bacteria 3006
258 Ga0105249_11113285 3300009553 Unclassified 860
259 Ga0105249_11268700 3300009553 Bacteria 808
260 Ga0105239_10001533 3300010375 Bacteria 30534
261 Ga0105239_10003046 3300010375 Bacteria 20836
262 Ga0105239_10105415 3300010375 Bacteria 3122
263 Ga0105239_10246339 3300010375 Bacteria 2007
264 Ga0105239_10857536 3300010375 Bacteria 1042
265 Ga0105246_10001192 3300011119 Bacteria 15150
266 Ga0105246_10119528 3300011119 Bacteria 1950
267 Ga0157373_10225234 3300013100 Bacteria 1323
268 Ga0157370_10000170 3300013104 Bacteria 80529
269 Ga0157370_10010160 3300013104 Bacteria 9939
270 Ga0157370_10012988 3300013104 Bacteria 8605
271 Ga0157370_10013763 3300013104 Bacteria 8313
272 Ga0157370_10046758 3300013104 Unclassified 4149
273 Ga0157370_10165459 3300013104 Bacteria 2057
274 Ga0157370_10171680 3300013104 Bacteria 2016
275 Ga0157370_10752683 3300013104 Bacteria 888
276 Ga0157369_10000085 3300013105 Bacteria 129025
277 Ga0157369_10000430 3300013105 Bacteria 55736
278 Ga0157369_10009218 3300013105 Bacteria 11289
279 Ga0157369_10012659 3300013105 Bacteria 9566
280 Ga0157369_10028989 3300013105 Bacteria 6121
281 Ga0157369_10040085 3300013105 Bacteria 5115
282 Ga0157369_10042189 3300013105 Bacteria 4977
283 Ga0157369_10054976 3300013105 Bacteria 4298
284 Ga0157369_10096566 3300013105 Bacteria 3153
285 Ga0157369_10098891 3300013105 Bacteria 3110
286 Ga0157369_10115794 3300013105 Bacteria 2847
287 Ga0157369_10172157 3300013105 Bacteria 2281
288 Ga0157369_10192237 3300013105 Bacteria 2144
289 Ga0157369_10206790 3300013105 Bacteria 2058
290 Ga0157369_10344813 3300013105 Unclassified 1547
291 Ga0157369_10371511 3300013105 Bacteria 1484
292 Ga0157369_10540699 3300013105 Bacteria 1204
293 Ga0157369_10729791 3300013105 Bacteria 1020
294 Ga0157369_11101743 3300013105 Bacteria 812
295 Ga0157374_10023020 3300013296 Bacteria 5565
296 Ga0157374_10042034 3300013296 Bacteria 4215
297 Ga0157374_10084229 3300013296 Bacteria 3022
298 Ga0157374_10238777 3300013296 Bacteria 1787
299 Ga0157374_10325896 3300013296 Bacteria 1523
300 Ga0157374_10447875 3300013296 Bacteria 1292
301 Ga0157374_10498754 3300013296 Bacteria 1222
302 Ga0157374_10827694 3300013296 Bacteria 942
303 Ga0157378_10023973 3300013297 Bacteria 5367
304 Ga0157378_10131240 3300013297 Bacteria 2319
305 Ga0163162_10027442 3300013306 Bacteria 5631
306 Ga0163162_10158863 3300013306 Bacteria 2382
307 Ga0163162_11275508 3300013306 Bacteria 834
308 Ga0157372_10000217 3300013307 Bacteria 63667
309 Ga0157372_10002601 3300013307 Bacteria 19543
310 Ga0157372_10002611 3300013307 Bacteria 19494
311 Ga0157372_10010870 3300013307 Bacteria 9688
312 Ga0157372_10063864 3300013307 Bacteria 4130
313 Ga0157372_10204729 3300013307 Bacteria 2286
314 Ga0157372_10206180 3300013307 Bacteria 2278
315 Ga0157372_10348925 3300013307 Bacteria 1724
316 Ga0157372_10403380 3300013307 Bacteria 1593
317 Ga0157372_10569693 3300013307 Bacteria 1320
318 Ga0157375_10057497 3300013308 Bacteria 3845
319 Ga0157375_10066677 3300013308 Bacteria 3595
320 Ga0157375_10069334 3300013308 Bacteria 3532
321 Ga0163163_10001161 3300014325 Bacteria 22403
322 Ga0163163_10017757 3300014325 Bacteria 6641
323 Ga0163163_10062243 3300014325 Bacteria 3697
324 Ga0163163_10580801 3300014325 Bacteria 1184
325 Ga0157377_10199620 3300014745 Bacteria 1269
326 Ga0157379_10002312 3300014968 Bacteria 15882
327 Ga0157379_10048162 3300014968 Bacteria 3804
328 Ga0157379_10161237 3300014968 Bacteria 2024
329 Ga0157379_10287290 3300014968 Bacteria 1497
330 Ga0157379_10308107 3300014968 Bacteria 1444
331 Ga0157376_10004372 3300014969 Bacteria 9831
332 Ga0157376_10737860 3300014969 Bacteria 993
333 Ga0157376_11689302 3300014969 Bacteria 668
334 Ga0163161_10044573 3300017792 Bacteria 3195
335 Ga0213872_10002341 3300021361 Bacteria 11261
336 Ga0213872_10034756 3300021361 Bacteria 2306
337 Ga0213872_10051363 3300021361 Bacteria 1871
338 Ga0213872_10054105 3300021361 Bacteria 1820
339 Ga0213875_10000108 3300021388 Bacteria 94421
340 Ga0213875_10219442 3300021388 Bacteria 896
341 Ga0213871_10006004 3300021441 Bacteria 2545
342 Ga0224572_1008454 3300024225 Bacteria 1903
343 Ga0209233_1001442 3300025261 Bacteria 9385
344 Ga0207656_10031201 3300025321 Bacteria 2206
345 Ga0207656_10031615 3300025321 Bacteria 2194
346 Ga0207656_10048760 3300025321 Bacteria 1824
347 Ga0207656_10196195 3300025321 Bacteria 974
348 Ga0207656_10364668 3300025321 Bacteria 722
349 Ga0207692_10438543 3300025898 Bacteria 820
350 Ga0207692_10444087 3300025898 Bacteria 815
351 Ga0207710_10317441 3300025900 Bacteria 789
352 Ga0207680_10030474 3300025903 Bacteria 3043
353 Ga0207680_10204305 3300025903 Bacteria 1348
354 Ga0207647_10078008 3300025904 Bacteria 1990
355 Ga0207647_10125849 3300025904 Bacteria 1508
356 Ga0207699_10125619 3300025906 Bacteria 1665
357 Ga0207699_10680378 3300025906 Bacteria 752
358 Ga0207645_10116005 3300025907 Bacteria 1736
359 Ga0207705_10000021 3300025909 Bacteria 309436
360 Ga0207705_10002125 3300025909 Bacteria 15376
361 Ga0207705_10002923 3300025909 Bacteria 13059
362 Ga0207705_10012875 3300025909 Bacteria 6038
363 Ga0207705_10021055 3300025909 Bacteria 4651
364 Ga0207705_10027435 3300025909 Bacteria 4060
365 Ga0207705_10028574 3300025909 Bacteria 3976
366 Ga0207705_10107321 3300025909 Bacteria 2060
367 Ga0207705_10282735 3300025909 Bacteria 1270
368 Ga0207705_10294604 3300025909 Bacteria 1243
369 Ga0207705_10332471 3300025909 Bacteria 1169
370 Ga0207654_10000054 3300025911 Bacteria 82347
371 Ga0207654_10000281 3300025911 Bacteria 30979
372 Ga0207654_10000808 3300025911 Bacteria 17242
373 Ga0207654_10083730 3300025911 Bacteria 1926
374 Ga0207654_10233283 3300025911 Bacteria 1226
375 Ga0207654_10251596 3300025911 Bacteria 1185
376 Ga0207707_10003864 3300025912 Bacteria 13285
377 Ga0207707_10142923 3300025912 Unclassified 2092
378 Ga0207707_10322003 3300025912 Bacteria 1335
379 Ga0207707_10465465 3300025912 Bacteria 1081
380 Ga0207707_10659207 3300025912 Bacteria 881
381 Ga0207695_10000080 3300025913 Bacteria 287868
382 Ga0207695_10000113 3300025913 Bacteria 247240
383 Ga0207695_10000167 3300025913 Bacteria 194371
384 Ga0207695_10000263 3300025913 Bacteria 132894
385 Ga0207695_10001106 3300025913 Bacteria 46871
386 Ga0207695_10001762 3300025913 Bacteria 34278
387 Ga0207695_10033351 3300025913 Bacteria 5617
388 Ga0207695_10072087 3300025913 Bacteria 3526
389 Ga0207695_10083832 3300025913 Bacteria 3219
390 Ga0207695_10090502 3300025913 Bacteria 3075
391 Ga0207695_10125292 3300025913 Bacteria 2532
392 Ga0207695_10464491 3300025913 Bacteria 1149
393 Ga0207695_10723985 3300025913 Bacteria 875
394 Ga0207671_10000065 3300025914 Bacteria 166743
395 Ga0207671_10000123 3300025914 Bacteria 119385
396 Ga0207671_10000139 3300025914 Bacteria 111786
397 Ga0207671_10086096 3300025914 Bacteria 2362
398 Ga0207671_10218141 3300025914 Bacteria 1494
399 Ga0207693_10002600 3300025915 Bacteria 15685
400 Ga0207693_10059168 3300025915 Bacteria 3001
401 Ga0207693_10405560 3300025915 Bacteria 1065
402 Ga0207663_10016822 3300025916 Bacteria 4066
403 Ga0207663_10023940 3300025916 Bacteria 3512
404 Ga0207663_10519219 3300025916 Bacteria 927
405 Ga0207660_10111242 3300025917 Bacteria 2061
406 Ga0207660_10271414 3300025917 Bacteria 1344
407 Ga0207660_10304040 3300025917 Bacteria 1270
408 Ga0207657_10004623 3300025919 Bacteria 14538
409 Ga0207657_10019482 3300025919 Bacteria 6442
410 Ga0207657_10036579 3300025919 Bacteria 4393
411 Ga0207657_10205754 3300025919 Bacteria 1581
412 Ga0207657_10347439 3300025919 Unclassified 1170
413 Ga0207657_10565120 3300025919 Bacteria 889
414 Ga0207649_10031894 3300025920 Bacteria 3135
415 Ga0207649_10051782 3300025920 Bacteria 2544
416 Ga0207652_10001535 3300025921 Bacteria 20348
417 Ga0207652_10036402 3300025921 Bacteria 4160
418 Ga0207652_10547214 3300025921 Bacteria 1040
419 Ga0207694_10000248 3300025924 Bacteria 51461
420 Ga0207694_10000711 3300025924 Bacteria 29920
421 Ga0207694_10048093 3300025924 Bacteria 3300
422 Ga0207694_10062538 3300025924 Bacteria 2898
423 Ga0207694_10078380 3300025924 Bacteria 2590
424 Ga0207694_10139468 3300025924 Bacteria 1949
425 Ga0207694_10273841 3300025924 Bacteria 1385
426 Ga0207694_10522820 3300025924 Bacteria 994
427 Ga0207650_10003582 3300025925 Bacteria 10655
428 Ga0207650_10213491 3300025925 Bacteria 1550
429 Ga0207687_10000978 3300025927 Bacteria 19404
430 Ga0207687_10002372 3300025927 Bacteria 12792
431 Ga0207687_10130110 3300025927 Bacteria 1896
432 Ga0207687_10350078 3300025927 Bacteria 1203
433 Ga0207700_10003745 3300025928 Bacteria 8878
434 Ga0207700_10021300 3300025928 Bacteria 4424
435 Ga0207700_10058092 3300025928 Bacteria 2921
436 Ga0207700_10062682 3300025928 Bacteria 2824
437 Ga0207700_10393013 3300025928 Bacteria 1214
438 Ga0207700_10394546 3300025928 Bacteria 1212
439 Ga0207700_10452458 3300025928 Bacteria 1132
440 Ga0207700_10552917 3300025928 Unclassified 1022
441 Ga0207700_10678905 3300025928 Bacteria 919
442 Ga0207700_11068310 3300025928 Bacteria 722
443 Ga0207664_10017916 3300025929 Bacteria 5203
444 Ga0207664_10071842 3300025929 Unclassified 2789
445 Ga0207664_10105160 3300025929 Bacteria 2339
446 Ga0207664_10128766 3300025929 Bacteria 2128
447 Ga0207664_10205846 3300025929 Bacteria 1700
448 Ga0207664_10234262 3300025929 Bacteria 1597
449 Ga0207664_10420967 3300025929 Bacteria 1190
450 Ga0207664_10527307 3300025929 Bacteria 1059
451 Ga0207644_10017923 3300025931 Bacteria 4788
452 Ga0207644_10266848 3300025931 Bacteria 1370
453 Ga0207690_10050737 3300025932 Bacteria 2771
454 Ga0207690_10175486 3300025932 Bacteria 1609
455 Ga0207706_10243219 3300025933 Bacteria 1573
456 Ga0207686_10373242 3300025934 Bacteria 1080
457 Ga0207665_10022539 3300025939 Bacteria 4144
458 Ga0207665_10044340 3300025939 Bacteria 2976
459 Ga0207665_10052779 3300025939 Bacteria 2739
460 Ga0207691_10039961 3300025940 Bacteria 4338
461 Ga0207711_10000014 3300025941 Bacteria 506753
462 Ga0207711_10004781 3300025941 Bacteria 11494
463 Ga0207711_10033255 3300025941 Bacteria 4362
464 Ga0207711_10044398 3300025941 Bacteria 3794
465 Ga0207711_10065518 3300025941 Bacteria 3141
466 Ga0207711_10093223 3300025941 Bacteria 2652
467 Ga0207689_11050014 3300025942 Unclassified 687
468 Ga0207661_10001283 3300025944 Bacteria 16799
469 Ga0207661_10055710 3300025944 Bacteria 3172
470 Ga0207661_10077968 3300025944 Bacteria 2726
471 Ga0207661_10078225 3300025944 Bacteria 2722
472 Ga0207661_10104793 3300025944 Bacteria 2382
473 Ga0207661_10179079 3300025944 Bacteria 1850
474 Ga0207661_10475948 3300025944 Bacteria 1140
475 Ga0207679_10137102 3300025945 Bacteria 1972
476 Ga0207679_10616612 3300025945 Bacteria 979
477 Ga0207667_10000468 3300025949 Bacteria 53974
478 Ga0207667_10006194 3300025949 Bacteria 14522
479 Ga0207667_10007633 3300025949 Bacteria 12958
480 Ga0207667_10009516 3300025949 Bacteria 11434
481 Ga0207667_10012818 3300025949 Bacteria 9632
482 Ga0207667_10030921 3300025949 Bacteria 5786
483 Ga0207667_10035816 3300025949 Bacteria 5323
484 Ga0207667_10098554 3300025949 Bacteria 3016
485 Ga0207667_10176714 3300025949 Bacteria 2193
486 Ga0207667_10198277 3300025949 Bacteria 2059
487 Ga0207667_10243021 3300025949 Bacteria 1842
488 Ga0207667_10249710 3300025949 Bacteria 1815
489 Ga0207667_10294967 3300025949 Bacteria 1656
490 Ga0207667_10321631 3300025949 Bacteria 1580
491 Ga0207667_10373279 3300025949 Bacteria 1453
492 Ga0207667_10979643 3300025949 Bacteria 834
493 Ga0207712_10043097 3300025961 Bacteria 3111
494 Ga0207640_10000028 3300025981 Bacteria 135727
495 Ga0207640_10024137 3300025981 Bacteria 3664
496 Ga0207640_10034716 3300025981 Bacteria 3150
497 Ga0207640_10092985 3300025981 Bacteria 2094
498 Ga0207640_10286155 3300025981 Bacteria 1297
499 Ga0207640_10677227 3300025981 Bacteria 882
500 Ga0207658_10003428 3300025986 Bacteria 11222
501 Ga0207677_10000143 3300026023 Bacteria 58337
502 Ga0207677_10154976 3300026023 Bacteria 1773
503 Ga0207677_10192193 3300026023 Bacteria 1615
504 Ga0207677_10322859 3300026023 Bacteria 1283
505 Ga0207703_10004820 3300026035 Bacteria 10980
506 Ga0207703_10123186 3300026035 Bacteria 2228
507 Ga0207639_10000088 3300026041 Bacteria 78742
508 Ga0207639_10000371 3300026041 Bacteria 31074
509 Ga0207639_10014115 3300026041 Bacteria 5610
510 Ga0207639_10016992 3300026041 Bacteria 5155
511 Ga0207639_10054301 3300026041 Bacteria 3061
512 Ga0207639_10129182 3300026041 Bacteria 2089
513 Ga0207639_10154385 3300026041 Bacteria 1927
514 Ga0207639_10211214 3300026041 Bacteria 1671
515 Ga0207639_10520451 3300026041 Bacteria 1089
516 Ga0207639_10748403 3300026041 Bacteria 909
517 Ga0207678_10006398 3300026067 Bacteria 10461
518 Ga0207678_10229059 3300026067 Bacteria 1591
519 Ga0207678_10336767 3300026067 Bacteria 1300
520 Ga0207678_10500580 3300026067 Bacteria 1059
521 Ga0207678_10575718 3300026067 Bacteria 986
522 Ga0207702_10001334 3300026078 Bacteria 24682
523 Ga0207702_10005816 3300026078 Bacteria 10726
524 Ga0207702_10017932 3300026078 Bacteria 5856
525 Ga0207702_10034912 3300026078 Bacteria 4205
526 Ga0207702_10070171 3300026078 Bacteria 3013
527 Ga0207702_10306913 3300026078 Bacteria 1507
528 Ga0207702_10888883 3300026078 Bacteria 883
529 Ga0207702_10989030 3300026078 Bacteria 834
530 Ga0207702_11043759 3300026078 Bacteria 811
531 Ga0207641_10005346 3300026088 Bacteria 10965
532 Ga0207641_10021590 3300026088 Bacteria 5290
533 Ga0207641_10037049 3300026088 Bacteria 4072
534 Ga0207641_10306612 3300026088 Bacteria 1501
535 Ga0207676_10055374 3300026095 Bacteria 3113
536 Ga0207676_10159038 3300026095 Bacteria 1955
537 Ga0207676_10508123 3300026095 Bacteria 1145
538 Ga0207674_10000669 3300026116 Bacteria 44573
539 Ga0207674_10142769 3300026116 Bacteria 2353
540 Ga0207674_10148285 3300026116 Bacteria 2303
541 Ga0207674_10201213 3300026116 Bacteria 1941
542 Ga0207674_10293248 3300026116 Bacteria 1575
543 Ga0207674_10294723 3300026116 Bacteria 1571
544 Ga0207674_10305491 3300026116 Bacteria 1540
545 Ga0207683_10028240 3300026121 Bacteria 4851
546 Ga0207683_10262222 3300026121 Bacteria 1578
547 Ga0207698_10000003 3300026142 Bacteria 321303
548 Ga0207698_10000708 3300026142 Bacteria 19330
549 Ga0207698_10003525 3300026142 Bacteria 9436
550 Ga0207698_10031875 3300026142 Bacteria 3811
551 Ga0207698_10036682 3300026142 Bacteria 3601
552 Ga0207698_10059852 3300026142 Unclassified 2959
553 Ga0207698_10215710 3300026142 Bacteria 1730
554 Ga0207698_10464681 3300026142 Bacteria 1224
555 Ga0265356_1004445 3300028017 Bacteria 1714
556 Ga0268266_10005265 3300028379 Bacteria 12146
557 Ga0268266_10006399 3300028379 Bacteria 10792
558 Ga0268266_10008807 3300028379 Bacteria 8937
559 Ga0268266_10078240 3300028379 Bacteria 2877
560 Ga0268266_10188892 3300028379 Bacteria 1880
561 Ga0268265_10562240 3300028380 Bacteria 1084
562 Ga0268264_10000598 3300028381 Bacteria 43640
563 Ga0265319_1044472 3300028563 Bacteria 1488
564 Ga0265334_10130983 3300028573 Bacteria 892
565 Ga0265318_10011054 3300028577 Bacteria 3903
566 Ga0265318_10076123 3300028577 Bacteria 1242
567 Ga0265336_10001048 3300028666 Bacteria 13512
568 Ga0265336_10005708 3300028666 Bacteria 4561
569 Ga0265338_10004495 3300028800 Bacteria 18805
570 Ga0265338_10005157 3300028800 Bacteria 17175
571 Ga0265338_10009284 3300028800 Bacteria 11764
572 Ga0265338_10017734 3300028800 Bacteria 7656
573 Ga0265338_10040619 3300028800 Bacteria 4367
574 Ga0265338_10099138 3300028800 Bacteria 2381
575 Ga0265338_10259829 3300028800 Bacteria 1277
576 Ga0265338_10268771 3300028800 Bacteria 1250
577 Ga0265338_10527691 3300028800 Bacteria 829
578 Ga0265338_10610317 3300028800 Bacteria 759
579 Ga0265324_10009104 3300029957 Bacteria 3896
580 Ga0265324_10026321 3300029957 Bacteria 2059
581 Ga0265330_10000273 3300031235 Bacteria 38107
582 Ga0265330_10001219 3300031235 Bacteria 15180
583 Ga0265330_10011435 3300031235 Bacteria 4163
584 Ga0265330_10030656 3300031235 Bacteria 2413
585 Ga0265330_10072643 3300031235 Bacteria 1488
586 Ga0265330_10120309 3300031235 Bacteria 1119
587 Ga0265330_10126058 3300031235 Bacteria 1090
588 Ga0265332_10054533 3300031238 Unclassified 1715
589 Ga0265332_10280342 3300031238 Bacteria 689
590 Ga0265328_10001272 3300031239 Bacteria 11639
591 Ga0265328_10005053 3300031239 Bacteria 5684
592 Ga0265328_10011186 3300031239 Bacteria 3591
593 Ga0265320_10003664 3300031240 Bacteria 10255
594 Ga0265325_10000266 3300031241 Bacteria 37071
595 Ga0265325_10000695 3300031241 Bacteria 24506
596 Ga0265325_10005858 3300031241 Bacteria 7531
597 Ga0265325_10087985 3300031241 Bacteria 1535
598 Ga0265325_10098913 3300031241 Bacteria 1430
599 Ga0265329_10011153 3300031242 Bacteria 3272
600 Ga0265329_10011996 3300031242 Bacteria 3132
601 Ga0265340_10001072 3300031247 Bacteria 15563
602 Ga0265340_10012505 3300031247 Bacteria 4481
603 Ga0265340_10015610 3300031247 Bacteria 3945
604 Ga0265340_10096350 3300031247 Bacteria 1378
605 Ga0265340_10171805 3300031247 Bacteria 982
606 Ga0265339_10000114 3300031249 Bacteria 65609
607 Ga0265339_10000124 3300031249 Bacteria 64124
608 Ga0265339_10000194 3300031249 Bacteria 50375
609 Ga0265339_10003213 3300031249 Bacteria 11471
610 Ga0265339_10009288 3300031249 Bacteria 6193
611 Ga0265339_10021882 3300031249 Bacteria 3711
612 Ga0265339_10028825 3300031249 Bacteria 3154
613 Ga0265339_10165558 3300031249 Bacteria 1110
614 Ga0265331_10073017 3300031250 Bacteria 1602
615 Ga0265331_10111778 3300031250 Bacteria 1253
616 Ga0265327_10267568 3300031251 Bacteria 758
617 Ga0265316_10000352 3300031344 Bacteria 51670
618 Ga0265316_10000712 3300031344 Bacteria 36687
619 Ga0265316_10003105 3300031344 Bacteria 16919
620 Ga0265316_10006699 3300031344 Bacteria 10976
621 Ga0265316_10008382 3300031344 Bacteria 9600
622 Ga0265316_10018630 3300031344 Bacteria 5963
623 Ga0265316_10022409 3300031344 Bacteria 5325
624 Ga0265316_10129073 3300031344 Bacteria 1905
625 Ga0265316_10136596 3300031344 Bacteria 1844
626 Ga0265316_10177577 3300031344 Bacteria 1586
627 Ga0265313_10002216 3300031595 Bacteria 17122
628 Ga0265313_10004714 3300031595 Bacteria 10288
629 Ga0265313_10046248 3300031595 Bacteria 2113
630 Ga0265313_10068916 3300031595 Bacteria 1633
631 Ga0265313_10137519 3300031595 Bacteria 1053
632 Ga0265313_10187633 3300031595 Bacteria 866
633 Ga0265313_10227340 3300031595 Bacteria 767
634 Ga0265314_10000504 3300031711 Bacteria 50376
635 Ga0265314_10002987 3300031711 Bacteria 16745
636 Ga0265314_10034859 3300031711 Bacteria 3672
637 Ga0265314_10117019 3300031711 Bacteria 1685
638 Ga0265342_10000225 3300031712 Bacteria 63822
639 Ga0265342_10001536 3300031712 Bacteria 21355
640 Ga0265342_10002164 3300031712 Bacteria 17314
641 Ga0265342_10002441 3300031712 Bacteria 16049
642 Ga0265342_10014061 3300031712 Bacteria 5326
643 Ga0265342_10027916 3300031712 Bacteria 3520
644 Ga0265342_10029908 3300031712 Bacteria 3379
645 Ga0265342_10045350 3300031712 Bacteria 2646
646 Ga0265342_10069670 3300031712 Bacteria 2053
647 Ga0265342_10136398 3300031712 Bacteria 1371
648 Ga0265342_10188592 3300031712 Bacteria 1126
649 Ga0265342_10332508 3300031712 Bacteria 794
650 Ga0316583_10095825 3300032133 Bacteria 1035
651 Ga0307510_10010774 3300033180 Bacteria 10874
652 Ga0307510_10212472 3300033180 Bacteria 1455
653 Ga0307510_10223248 3300033180 Bacteria 1393
654 Ga0316215_1003489 3300033544 Bacteria 1498
655 Ga0373926_0000675 3300035083 Bacteria 9381
656 Ga0373954_0036836 3300035118 Bacteria 2272
657 Ga0373954_0294562 3300035118 Bacteria 800
658 Ga0373956_0061195 3300035119 Bacteria 1705
659 Ga0373956_0153569 3300035119 Unclassified 1083
660 Ga0373943_0001291 3300035170 Bacteria 11240
661 Ga0373946_0000821 3300035171 Bacteria 10594
662 Ga0373955_0149693 3300035172 Bacteria 1373
663 Ga0373924_0000243 3300035410 Bacteria 16627
664 Ga0373924_0093250 3300035410 Bacteria 1290
665 Ga0373935_0012297 3300035692 Bacteria 5149
666 Ga0373935_0829003 3300035692 Bacteria 683
667 Ga0373927_0004411 3300035695 Bacteria 9864
668 Ga0373947_0112424 3300035725 Unclassified 1722
669 Ga0373937_0007405 3300036401 Bacteria 9499
670 Ga0373937_0065583 3300036401 Bacteria 3343
671 Ga0373925_0060693 3300037068 Unclassified 2839
672 Ga0395900_0025848 3300037418 Bacteria 6011
673 Ga0395900_0389492 3300037418 Bacteria 1360
674 Ga0395898_0027814 3300037466 Bacteria 5670
675 Ga0395898_0117975 3300037466 Bacteria 2542
676 Ga0395898_0546082 3300037466 Bacteria 1101
677 Ga0436364_0115933 3300037853 Bacteria 94405
678 Ga0436364_0147107 3300037853 Unclassified 2317
679 Ga0436364_0354157 3300037853 Bacteria 1857
680 Ga0395901_0310997 3300038443 Bacteria 1632
681 Ga0395901_0513053 3300038443 Bacteria 1219
682 Ga0436365_0590507 3300039437 Bacteria 1029
683 Ga0436360_1067871 3300039438 Archaea 894
684 Ga0436360_1280163 3300039438 Bacteria 848
685 Ga0436361_0318263 3300039447 Bacteria 10520
686 Ga0436361_0387230 3300039447 Bacteria 1246
687 Ga0436361_0497072 3300039447 Bacteria 714
688 Ga0436361_0500168 3300039447 Bacteria 41610
689 Ga0436361_0732319 3300039447 Bacteria 1755
690 Ga0436361_1103679 3300039447 Bacteria 1360
691 Ga0436363_0331024 3300039450 Unclassified 1311
692 Ga0466966_0149285 3300044684 Bacteria 1426
693 Ga0466961_0055286 3300044693 Bacteria 2531
694 Ga0466963_0000494 3300044694 Bacteria 18341
695 Ga0466963_0107210 3300044694 Bacteria 1916
696 Ga0466970_0244720 3300044765 Bacteria 1004
697 Ga0466957_0026837 3300044842 Bacteria 3419
698 Ga0466959_0382284 3300045049 Bacteria 958
699 Ga0451576_0873383 3300045051 Bacteria 944
700 Ga0466967_0001401 3300045976 Bacteria 13938
701 Ga0466967_0046813 3300045976 Bacteria 3768
702 Ga0466967_0111253 3300045976 Bacteria 2517
703 Ga0495617_026479 3300046452 Bacteria 1953
704 Ga0495603_0039419 3300046455 Bacteria 2830
705 Ga0495629_0029674 3300046459 Bacteria 3878
706 Ga0495629_0049585 3300046459 Bacteria 2942
707 Ga0495629_0060065 3300046459 Bacteria 2657
708 Ga0495629_0137756 3300046459 Bacteria 1699
709 Ga0495638_0445383 3300046460 Bacteria 662
710 Ga0495651_0053044 3300046462 Bacteria 3123
711 Ga0495653_0010749 3300046463 Bacteria 7495
712 Ga0495650_0000038 3300046471 Bacteria 377530
713 Ga0495580_0120910 3300046472 Bacteria 1818
714 Ga0495580_0156212 3300046472 Unclassified 1579
715 Ga0495580_0326733 3300046472 Bacteria 1042
716 Ga0495580_0497340 3300046472 Bacteria 814
717 Ga0495582_0001853 3300046473 Bacteria 11921
718 Ga0495582_0095987 3300046473 Bacteria 1657
719 Ga0495639_0004538 3300046475 Bacteria 5952
720 Ga0495662_0005660 3300046476 Bacteria 6246
721 Ga0495664_0001348 3300046477 Bacteria 12929
722 Ga0495664_0057856 3300046477 Bacteria 2306
723 Ga0495585_0085882 3300046492 Bacteria 1700
724 Ga0495594_0000388 3300046499 Bacteria 22139
725 Ga0495594_0001190 3300046499 Bacteria 13614
726 Ga0495594_0004431 3300046499 Bacteria 7222
727 Ga0495583_0033822 3300046506 Bacteria 2455
728 Ga0495606_0044975 3300046507 Bacteria 2931
729 Ga0495606_0067569 3300046507 Bacteria 2263
730 Ga0495630_0270870 3300046517 Bacteria 1297
731 Ga0495644_0000048 3300046523 Bacteria 57696
732 Ga0495666_0001196 3300046526 Bacteria 12524
733 Ga0495642_0019216 3300046528 Bacteria 2678
734 Ga0495652_0006640 3300046529 Bacteria 10742
735 Ga0495652_0043862 3300046529 Bacteria 3853
736 Ga0495665_0001828 3300046531 Bacteria 11486
737 Ga0495665_0243362 3300046531 Bacteria 927
738 Ga0495640_0004801 3300046533 Bacteria 10760
739 Ga0495640_0112414 3300046533 Bacteria 1778
740 Ga0495586_0019711 3300046535 Bacteria 3591
741 Ga0495586_0197397 3300046535 Unclassified 1140
742 Ga0495587_0093692 3300046536 Bacteria 1734
743 Ga0495609_0011141 3300046538 Bacteria 4292
744 Ga0495609_0080699 3300046538 Bacteria 1422
745 Ga0495645_0053835 3300046543 Unclassified 2924
746 Ga0495645_0213338 3300046543 Archaea 1302
747 Ga0495633_0051416 3300046558 Bacteria 1942
748 Ga0495667_0150787 3300046559 Bacteria 1497
749 Ga0495668_0128921 3300046616 Bacteria 1385
750 Ga0495634_0006225 3300046642 Bacteria 9093
751 Ga0495611_0005877 3300046648 Bacteria 5236
752 Ga0495625_0000985 3300046660 Bacteria 37750
753 Ga0495625_0007833 3300046660 Bacteria 9208
754 Ga0495625_0026175 3300046660 Bacteria 4411
755 Ga0495625_0034121 3300046660 Bacteria 3757
756 Ga0495625_0089152 3300046660 Bacteria 2136
757 Ga0495625_0381016 3300046660 Bacteria 885
758 Ga0495625_0434634 3300046660 Bacteria 814
759 Ga0495635_0002836 3300046663 Bacteria 11904
760 Ga0495659_0114237 3300046664 Bacteria 1057
761 Ga0495661_0026784 3300046665 Bacteria 3708
762 Ga0495657_0277857 3300046675 Bacteria 1003
763 Ga0495599_0242663 3300046678 Bacteria 1098
764 Ga0495599_0548749 3300046678 Bacteria 677
765 Ga0495623_0008357 3300046679 Bacteria 6733
766 Ga0495623_0410809 3300046679 Bacteria 727
767 Ga0495646_0013211 3300046680 Bacteria 5247
768 Ga0495646_0023225 3300046680 Bacteria 3904
769 Ga0495646_0222729 3300046680 Bacteria 1019
770 Ga0495669_0004252 3300046684 Bacteria 5901
771 Ga0495669_0370251 3300046684 Unclassified 693
772 Ga0495613_0003966 3300046689 Bacteria 11081
773 Ga0495613_0018773 3300046689 Bacteria 5152
774 Ga0495613_0038534 3300046689 Unclassified 3543
775 Ga0495613_0109799 3300046689 Bacteria 1988
776 Ga0495624_0007524 3300046690 Bacteria 7641
777 Ga0495624_0174027 3300046690 Bacteria 1313
778 Ga0495671_0095768 3300046692 Bacteria 1452
779 Ga0495649_0012107 3300046694 Bacteria 5035
780 Ga0495600_0012858 3300046809 Bacteria 5243
781 Ga0495600_0172644 3300046809 Unclassified 1395
782 Ga0495581_0001976 3300047315 Bacteria 11495
783 Ga0495604_0002834 3300047317 Bacteria 13912
784 Ga0495674_0014334 3300047319 Bacteria 7423
785 Ga0495672_0021506 3300047320 Bacteria 4206
786 Ga0495672_0063127 3300047320 Bacteria 2127
787 Ga0495676_0008961 3300047321 Bacteria 9134
788 Ga0495683_0174509 3300047323 Bacteria 986
789 Ga0495675_0012974 3300047444 Bacteria 5253
790 Ga0495673_0231467 3300047469 Bacteria 680
791 Ga0495684_0099043 3300047471 Bacteria 2204
792 Ga0495686_0000178 3300047472 Bacteria 121468
793 Ga0495686_0001621 3300047472 Bacteria 23566
794 Ga0495686_0008419 3300047472 Bacteria 7568
795 Ga0495686_0047439 3300047472 Bacteria 2712
796 Ga0495686_0085891 3300047472 Bacteria 1915
797 Ga0495602_0081301 3300048088 Archaea 2725
798 Ga0495602_0236738 3300048088 Bacteria 1368
799 Ga0495614_0000972 3300048089 Bacteria 12208
800 Ga0496100_0314419 3300048903 Bacteria 1175
801 Ga0496100_0725168 3300048903 Bacteria 776
802 Ga0496102_0344146 3300048905 Bacteria 1404
803 Ga0496102_0851610 3300048905 Bacteria 834
804 Ga0496104_0000053 3300048907 Bacteria 135895
805 Ga0496104_0056645 3300048907 Bacteria 3708
806 Ga0496104_0071299 3300048907 Unclassified 3303
807 Ga0496104_0438058 3300048907 Bacteria 1219
808 Ga0496104_0659933 3300048907 Bacteria 955
809 Ga0496104_0726557 3300048907 Bacteria 900
810 Ga0496104_0798050 3300048907 Bacteria 850
811 Ga0496105_0001615 3300048908 Bacteria 15999
812 Ga0496105_0057832 3300048908 Bacteria 3201
813 Ga0496106_0042478 3300048909 Bacteria 3410
814 Ga0496108_0134232 3300048911 Bacteria 2128
815 Ga0496109_0316949 3300048912 Bacteria 1471
816 Ga0496111_0044511 3300048914 Bacteria 3191
817 Ga0496111_0158175 3300048914 Bacteria 1682
818 Ga0496111_0303736 3300048914 Bacteria 1183
819 Ga0496112_0021005 3300048915 Bacteria 6201
820 Ga0496112_0150505 3300048915 Bacteria 2294
821 Ga0496112_0467738 3300048915 Bacteria 1198
822 Ga0496113_0084737 3300048916 Bacteria 2434
823 Ga0496115_0085005 3300048918 Bacteria 2580
824 Ga0496115_0091617 3300048918 Bacteria 2484
825 Ga0496115_0273258 3300048918 Bacteria 1388
826 Ga0496115_0373480 3300048918 Unclassified 1160
827 Ga0496121_0365824 3300048924 Bacteria 956
828 Ga0496126_0000100 3300048929 Bacteria 203706
829 Ga0496126_0000154 3300048929 Bacteria 159983
830 Ga0496126_0078490 3300048929 Bacteria 2925
831 Ga0501032_0001912 3300049569 Bacteria 16446
832 Ga0501033_0028282 3300049570 Bacteria 4213
833 Ga0501033_0115308 3300049570 Bacteria 1952
834 Ga0501033_0637612 3300049570 Bacteria 729
835 Ga0501034_0148520 3300049571 Bacteria 2320
836 Ga0501036_0076344 3300049572 Bacteria 2834
837 Ga0501037_0391740 3300049573 Bacteria 954
838 Ga0501037_0492477 3300049573 Bacteria 832
839 Ga0501038_0048143 3300049574 Bacteria 3690
840 Ga0501038_0085946 3300049574 Bacteria 2644
841 Ga0501043_0003983 3300049579 Bacteria 12094
842 Ga0501046_0000056 3300049580 Bacteria 129342
843 Ga0501047_0008947 3300049581 Bacteria 9454
844 Ga0501047_0066914 3300049581 Bacteria 3463
845 Ga0501073_0110559 3300049589 Bacteria 1906
846 Ga0501073_0110594 3300049589 Bacteria 1906
847 Ga0501074_0196241 3300049590 Bacteria 1439
848 Ga0501080_0188110 3300049742 Bacteria 1898
849 Ga0501083_0147296 3300049744 Bacteria 1541
850 Ga0501035_0044540 3300049822 Bacteria 3995
851 Ga0501035_0377603 3300049822 Bacteria 1182
852 Ga0501035_0469538 3300049822 Bacteria 1039
853 Ga0501044_0027240 3300049823 Bacteria 6042
854 Ga0501044_0095095 3300049823 Bacteria 3003
855 Ga0501044_0417372 3300049823 Bacteria 1252
856 Ga0501044_0690521 3300049823 Bacteria 907
857 nmdc:mga06r32_320162_c1 3300050510 Bacteria 1536
858 Ga0495601_0167705 3300053077 Bacteria 1435
859 Ga0495619_0140913 3300053085 Unclassified 1660
860 Ga0500643_109394 3300053087 Bacteria 747
861 Ga0500651_0000005 3300053093 Bacteria 384761
862 Ga0500595_000004 3300053119 Bacteria 410922
863 Ga0500595_007997 3300053119 Bacteria 4343
864 Ga0500595_058334 3300053119 Bacteria 1173
865 Ga0500595_079031 3300053119 Bacteria 965
866 Ga0500661_003309 3300055283 Bacteria 3030
867 Ga0501082_0213946 3300060353 Bacteria 1677
868 Ga0530510_0265842 3300061734 Bacteria 1280

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005616 Ga0068852_100161107 Ga0068852_1001611073 186
2 3300028800 Ga0265338_10040619 Ga0265338_100406193 187
3 3300048907 Ga0496104_0798050 Ga0496104_0798050_85_687 188
4 3300013105 Ga0157369_10040085 Ga0157369_100400855 189
5 3300049822 Ga0501035_0469538 Ga0501035_0469538_251_823 190
6 3300050510 nmdc:mga06r32_320162_c1 nmdc:mga06r32_320162_c1_693_1265 190
7 3300009093 Ga0105240_10000372 Ga0105240_1000037262 191
8 3300009093 Ga0105240_10000496 Ga0105240_1000049655 191
9 3300009093 Ga0105240_10087131 Ga0105240_100871314 191
10 3300009098 Ga0105245_10000486 Ga0105245_1000048629 191
11 3300009101 Ga0105247_10002346 Ga0105247_1000234610 191
12 3300009101 Ga0105247_10292438 Ga0105247_102924382 191
13 3300009174 Ga0105241_10000121 Ga0105241_1000012115 191
14 3300009174 Ga0105241_10002032 Ga0105241_100020325 191
15 3300009177 Ga0105248_10007017 Ga0105248_1000701710 191
16 3300009177 Ga0105248_10029618 Ga0105248_100296183 191
17 3300009545 Ga0105237_10006331 Ga0105237_100063319 191
18 3300009551 Ga0105238_10000509 Ga0105238_1000050928 191
19 3300009551 Ga0105238_10201945 Ga0105238_102019453 191
20 3300009553 Ga0105249_10081598 Ga0105249_100815982 191
21 3300010375 Ga0105239_10003046 Ga0105239_1000304617 191
22 3300011119 Ga0105246_10001192 Ga0105246_1000119214 191
23 3300013100 Ga0157373_10225234 Ga0157373_102252342 191
24 3300013104 Ga0157370_10000170 Ga0157370_1000017077 191
25 3300013105 Ga0157369_10000085 Ga0157369_1000008577 191
26 3300013105 Ga0157369_10009218 Ga0157369_100092186 191
27 3300013105 Ga0157369_10206790 Ga0157369_102067902 191
28 3300013105 Ga0157369_10344813 Ga0157369_103448132 191
29 3300013296 Ga0157374_10023020 Ga0157374_100230202 191
30 3300013296 Ga0157374_10084229 Ga0157374_100842292 191
31 3300013306 Ga0163162_10158863 Ga0163162_101588632 191
32 3300013306 Ga0163162_11275508 Ga0163162_112755081 191
33 3300013307 Ga0157372_10000217 Ga0157372_1000021746 191
34 3300013307 Ga0157372_10002601 Ga0157372_1000260114 191
35 3300013307 Ga0157372_10010870 Ga0157372_100108709 191
36 3300013308 Ga0157375_10057497 Ga0157375_100574973 191
37 3300014325 Ga0163163_10001161 Ga0163163_1000116110 191
38 3300014745 Ga0157377_10199620 Ga0157377_101996202 191
39 3300014968 Ga0157379_10002312 Ga0157379_100023129 191
40 3300014969 Ga0157376_10004372 Ga0157376_100043728 191
41 3300025929 Ga0207664_10234262 Ga0207664_102342622 191
42 3300045976 Ga0466967_0111253 Ga0466967_0111253_1158_1772 191
43 3300046616 Ga0495668_0128921 Ga0495668_0128921_578_1153 191
44 3300044684 Ga0466966_0149285 Ga0466966_0149285_391_1020 193
45 3300005439 Ga0070711_100775332 Ga0070711_1007753322 194
46 3300005290 Ga0065712_10479514 Ga0065712_104795141 195
47 3300005329 Ga0070683_100285059 Ga0070683_1002850592 195
48 3300005334 Ga0068869_100247235 Ga0068869_1002472352 195
49 3300005338 Ga0068868_100065060 Ga0068868_1000650604 195
50 3300005364 Ga0070673_100191444 Ga0070673_1001914442 195
51 3300005434 Ga0070709_10166887 Ga0070709_101668872 195
52 3300005434 Ga0070709_10501912 Ga0070709_105019122 195
53 3300005435 Ga0070714_100091602 Ga0070714_1000916022 195
54 3300005435 Ga0070714_100105232 Ga0070714_1001052323 195
55 3300005435 Ga0070714_100154671 Ga0070714_1001546713 195
56 3300005435 Ga0070714_100188384 Ga0070714_1001883843 195
57 3300005436 Ga0070713_100003005 Ga0070713_10000300510 195
58 3300005436 Ga0070713_100023543 Ga0070713_1000235435 195
59 3300005436 Ga0070713_100082409 Ga0070713_1000824092 195
60 3300005436 Ga0070713_100162511 Ga0070713_1001625112 195
61 3300005436 Ga0070713_100196366 Ga0070713_1001963662 195
62 3300005436 Ga0070713_100257582 Ga0070713_1002575822 195
63 3300005436 Ga0070713_101077027 Ga0070713_1010770271 195
64 3300005437 Ga0070710_10032530 Ga0070710_100325302 195
65 3300005439 Ga0070711_100019179 Ga0070711_1000191793 195
66 3300005439 Ga0070711_100022563 Ga0070711_1000225634 195
67 3300005458 Ga0070681_10589316 Ga0070681_105893162 195
68 3300005530 Ga0070679_100468964 Ga0070679_1004689642 195
69 3300005530 Ga0070679_101067564 Ga0070679_1010675641 195
70 3300005535 Ga0070684_100312272 Ga0070684_1003122722 195
71 3300005535 Ga0070684_100696362 Ga0070684_1006963621 195
72 3300005539 Ga0068853_100043702 Ga0068853_1000437024 195
73 3300005539 Ga0068853_100336512 Ga0068853_1003365121 195
74 3300005539 Ga0068853_100960524 Ga0068853_1009605242 195
75 3300005564 Ga0070664_100124085 Ga0070664_1001240851 195
76 3300005614 Ga0068856_100057606 Ga0068856_1000576062 195
77 3300005616 Ga0068852_100097697 Ga0068852_1000976972 195
78 3300005618 Ga0068864_100092202 Ga0068864_1000922022 195
79 3300005841 Ga0068863_100007046 Ga0068863_1000070463 195
80 3300006028 Ga0070717_10011247 Ga0070717_100112477 195
81 3300006028 Ga0070717_10342393 Ga0070717_103423932 195
82 3300006163 Ga0070715_10002310 Ga0070715_100023106 195
83 3300006173 Ga0070716_100059060 Ga0070716_1000590603 195
84 3300006175 Ga0070712_100012762 Ga0070712_1000127624 195
85 3300006175 Ga0070712_100044876 Ga0070712_1000448762 195
86 3300006175 Ga0070712_100340838 Ga0070712_1003408382 195
87 3300006175 Ga0070712_100610888 Ga0070712_1006108882 195
88 3300006914 Ga0075436_100648537 Ga0075436_1006485372 195
89 3300009093 Ga0105240_10030875 Ga0105240_100308757 195
90 3300009093 Ga0105240_10122860 Ga0105240_101228604 195
91 3300009098 Ga0105245_10021587 Ga0105245_100215874 195
92 3300009174 Ga0105241_10213745 Ga0105241_102137452 195
93 3300009176 Ga0105242_10298302 Ga0105242_102983022 195
94 3300009177 Ga0105248_10477210 Ga0105248_104772101 195
95 3300009177 Ga0105248_10765535 Ga0105248_107655352 195
96 3300009545 Ga0105237_10212808 Ga0105237_102128082 195
97 3300009545 Ga0105237_10627141 Ga0105237_106271412 195
98 3300009551 Ga0105238_10054460 Ga0105238_100544601 195
99 3300010375 Ga0105239_10246339 Ga0105239_102463393 195
100 3300010375 Ga0105239_10857536 Ga0105239_108575361 195
101 3300013105 Ga0157369_10096566 Ga0157369_100965664 195
102 3300013105 Ga0157369_10540699 Ga0157369_105406992 195
103 3300013296 Ga0157374_10238777 Ga0157374_102387772 195
104 3300013296 Ga0157374_10447875 Ga0157374_104478752 195
105 3300013297 Ga0157378_10131240 Ga0157378_101312403 195
106 3300013307 Ga0157372_10204729 Ga0157372_102047294 195
107 3300013307 Ga0157372_10206180 Ga0157372_102061802 195
108 3300014325 Ga0163163_10017757 Ga0163163_100177572 195
109 3300014325 Ga0163163_10580801 Ga0163163_105808012 195
110 3300021388 Ga0213875_10000108 Ga0213875_1000010869 195
111 3300021388 Ga0213875_10219442 Ga0213875_102194421 195
112 3300025898 Ga0207692_10438543 Ga0207692_104385432 195
113 3300025898 Ga0207692_10444087 Ga0207692_104440872 195
114 3300025900 Ga0207710_10317441 Ga0207710_103174411 195
115 3300025906 Ga0207699_10125619 Ga0207699_101256192 195
116 3300025911 Ga0207654_10083730 Ga0207654_100837303 195
117 3300025912 Ga0207707_10142923 Ga0207707_101429232 195
118 3300025912 Ga0207707_10322003 Ga0207707_103220032 195
119 3300025913 Ga0207695_10125292 Ga0207695_101252923 195
120 3300025915 Ga0207693_10002600 Ga0207693_1000260015 195
121 3300025915 Ga0207693_10059168 Ga0207693_100591684 195
122 3300025915 Ga0207693_10405560 Ga0207693_104055602 195
123 3300025916 Ga0207663_10016822 Ga0207663_100168224 195
124 3300025916 Ga0207663_10023940 Ga0207663_100239403 195
125 3300025916 Ga0207663_10519219 Ga0207663_105192192 195
126 3300025917 Ga0207660_10304040 Ga0207660_103040402 195
127 3300025927 Ga0207687_10002372 Ga0207687_1000237213 195
128 3300025928 Ga0207700_10003745 Ga0207700_100037458 195
129 3300025928 Ga0207700_10021300 Ga0207700_100213003 195
130 3300025928 Ga0207700_10062682 Ga0207700_100626823 195
131 3300025928 Ga0207700_10393013 Ga0207700_103930131 195
132 3300025928 Ga0207700_10452458 Ga0207700_104524582 195
133 3300025928 Ga0207700_10552917 Ga0207700_105529172 195
134 3300025928 Ga0207700_10678905 Ga0207700_106789052 195
135 3300025929 Ga0207664_10071842 Ga0207664_100718424 195
136 3300025929 Ga0207664_10205846 Ga0207664_102058462 195
137 3300025929 Ga0207664_10420967 Ga0207664_104209672 195
138 3300025929 Ga0207664_10527307 Ga0207664_105273072 195
139 3300025939 Ga0207665_10022539 Ga0207665_100225395 195
140 3300025939 Ga0207665_10044340 Ga0207665_100443403 195
141 3300025939 Ga0207665_10052779 Ga0207665_100527793 195
142 3300025942 Ga0207689_11050014 Ga0207689_110500141 195
143 3300025944 Ga0207661_10179079 Ga0207661_101790792 195
144 3300025945 Ga0207679_10137102 Ga0207679_101371023 195
145 3300025949 Ga0207667_10198277 Ga0207667_101982772 195
146 3300025949 Ga0207667_10321631 Ga0207667_103216312 195
147 3300025981 Ga0207640_10286155 Ga0207640_102861552 195
148 3300026023 Ga0207677_10192193 Ga0207677_101921932 195
149 3300026041 Ga0207639_10129182 Ga0207639_101291822 195
150 3300026041 Ga0207639_10748403 Ga0207639_107484032 195
151 3300026078 Ga0207702_10017932 Ga0207702_100179325 195
152 3300026088 Ga0207641_10021590 Ga0207641_100215904 195
153 3300026088 Ga0207641_10306612 Ga0207641_103066122 195
154 3300026095 Ga0207676_10159038 Ga0207676_101590382 195
155 3300026116 Ga0207674_10201213 Ga0207674_102012132 195
156 3300026116 Ga0207674_10305491 Ga0207674_103054912 195
157 3300026121 Ga0207683_10262222 Ga0207683_102622222 195
158 3300026142 Ga0207698_10059852 Ga0207698_100598523 195
159 3300031595 Ga0265313_10137519 Ga0265313_101375192 195
160 3300035083 Ga0373926_0000675 Ga0373926_0000675_7445_8032 195
161 3300035118 Ga0373954_0294562 Ga0373954_0294562_33_620 195
162 3300035119 Ga0373956_0061195 Ga0373956_0061195_712_1299 195
163 3300035119 Ga0373956_0153569 Ga0373956_0153569_103_690 195
164 3300035170 Ga0373943_0001291 Ga0373943_0001291_8573_9160 195
165 3300035171 Ga0373946_0000821 Ga0373946_0000821_8880_9467 195
166 3300035410 Ga0373924_0000243 Ga0373924_0000243_9575_10162 195
167 3300035692 Ga0373935_0012297 Ga0373935_0012297_769_1356 195
168 3300035692 Ga0373935_0829003 Ga0373935_0829003_82_669 195
169 3300035695 Ga0373927_0004411 Ga0373927_0004411_8170_8757 195
170 3300035725 Ga0373947_0112424 Ga0373947_0112424_755_1342 195
171 3300036401 Ga0373937_0065583 Ga0373937_0065583_1289_1876 195
172 3300037068 Ga0373925_0060693 Ga0373925_0060693_483_1070 195
173 3300037853 Ga0436364_0115933 Ga0436364_0115933_14104_14691 195
174 3300037853 Ga0436364_0147107 Ga0436364_0147107_571_1158 195
175 3300037853 Ga0436364_0354157 Ga0436364_0354157_1233_1820 195
176 3300045051 Ga0451576_0873383 Ga0451576_0873383_256_843 195
177 3300046472 Ga0495580_0156212 Ga0495580_0156212_213_800 195
178 3300046472 Ga0495580_0326733 Ga0495580_0326733_193_780 195
179 3300046531 Ga0495665_0243362 Ga0495665_0243362_265_852 195
180 3300046678 Ga0495599_0548749 Ga0495599_0548749_79_666 195
181 3300046679 Ga0495623_0008357 Ga0495623_0008357_3952_4539 195
182 3300046684 Ga0495669_0370251 Ga0495669_0370251_29_616 195
183 3300048903 Ga0496100_0314419 Ga0496100_0314419_237_824 195
184 3300048905 Ga0496102_0344146 Ga0496102_0344146_113_700 195
185 3300048905 Ga0496102_0851610 Ga0496102_0851610_114_701 195
186 3300048907 Ga0496104_0056645 Ga0496104_0056645_1862_2449 195
187 3300048907 Ga0496104_0071299 Ga0496104_0071299_2301_2888 195
188 3300048907 Ga0496104_0659933 Ga0496104_0659933_257_844 195
189 3300048908 Ga0496105_0001615 Ga0496105_0001615_6945_7532 195
190 3300048909 Ga0496106_0042478 Ga0496106_0042478_2589_3176 195
191 3300048911 Ga0496108_0134232 Ga0496108_0134232_1270_1857 195
192 3300048912 Ga0496109_0316949 Ga0496109_0316949_486_1073 195
193 3300048914 Ga0496111_0044511 Ga0496111_0044511_254_841 195
194 3300048914 Ga0496111_0158175 Ga0496111_0158175_804_1391 195
195 3300048915 Ga0496112_0021005 Ga0496112_0021005_351_938 195
196 3300048915 Ga0496112_0150505 Ga0496112_0150505_472_1059 195
197 3300048915 Ga0496112_0467738 Ga0496112_0467738_102_689 195
198 3300048916 Ga0496113_0084737 Ga0496113_0084737_426_1013 195
199 3300048918 Ga0496115_0273258 Ga0496115_0273258_97_684 195
200 3300048929 Ga0496126_0078490 Ga0496126_0078490_2288_2875 195
201 3300049744 Ga0501083_0147296 Ga0501083_0147296_334_921 195
202 3300053077 Ga0495601_0167705 Ga0495601_0167705_777_1364 195
203 3300005530 Ga0070679_100135818 Ga0070679_1001358182 196
204 3300005530 Ga0070679_100162327 Ga0070679_1001623272 196
205 3300005530 Ga0070679_100515342 Ga0070679_1005153422 196
206 3300005563 Ga0068855_100003653 Ga0068855_10000365315 196
207 3300009093 Ga0105240_10039085 Ga0105240_100390855 196
208 3300013104 Ga0157370_10165459 Ga0157370_101654592 196
209 3300013105 Ga0157369_10172157 Ga0157369_101721573 196
210 3300013296 Ga0157374_10325896 Ga0157374_103258962 196
211 3300013307 Ga0157372_10569693 Ga0157372_105696932 196
212 3300021361 Ga0213872_10034756 Ga0213872_100347563 196
213 3300025909 Ga0207705_10294604 Ga0207705_102946042 196
214 3300025913 Ga0207695_10083832 Ga0207695_100838322 196
215 3300025917 Ga0207660_10111242 Ga0207660_101112422 196
216 3300025921 Ga0207652_10547214 Ga0207652_105472141 196
217 3300025949 Ga0207667_10007633 Ga0207667_1000763310 196
218 3300037418 Ga0395900_0025848 Ga0395900_0025848_2866_3459 196
219 3300037466 Ga0395898_0117975 Ga0395898_0117975_1106_1699 196
220 3300039437 Ga0436365_0590507 Ga0436365_0590507_339_929 196
221 3300003320 rootH2_10009426 rootH2_100094268 197
222 3300005339 Ga0070660_100663456 Ga0070660_1006634561 197
223 3300005435 Ga0070714_100161553 Ga0070714_1001615533 197
224 3300005455 Ga0070663_100479477 Ga0070663_1004794772 197
225 3300005535 Ga0070684_100011551 Ga0070684_1000115515 197
226 3300005577 Ga0068857_101079678 Ga0068857_1010796782 197
227 3300009177 Ga0105248_10000019 Ga0105248_1000001915 197
228 3300009553 Ga0105249_11113285 Ga0105249_111132852 197
229 3300014968 Ga0157379_10308107 Ga0157379_103081072 197
230 3300025909 Ga0207705_10107321 Ga0207705_101073212 197
231 3300025913 Ga0207695_10464491 Ga0207695_104644911 197
232 3300025919 Ga0207657_10565120 Ga0207657_105651201 197
233 3300025941 Ga0207711_10000014 Ga0207711_10000014429 197
234 3300026067 Ga0207678_10500580 Ga0207678_105005802 197
235 3300039447 Ga0436361_1103679 Ga0436361_1103679_454_1086 197
236 3300039450 Ga0436363_0331024 Ga0436363_0331024_373_969 197
237 3300044694 Ga0466963_0000494 Ga0466963_0000494_12544_13140 197
238 3300045976 Ga0466967_0001401 Ga0466967_0001401_7243_7839 197
239 3300053119 Ga0500595_058334 Ga0500595_058334_491_1087 197
240 3300053119 Ga0500595_079031 Ga0500595_079031_283_879 197
241 3300061734 Ga0530510_0265842 Ga0530510_0265842_51_644 197
242 3300005563 Ga0068855_100181173 Ga0068855_1001811733 198
243 3300009551 Ga0105238_10251055 Ga0105238_102510552 198
244 3300009553 Ga0105249_11268700 Ga0105249_112687002 198
245 3300014969 Ga0157376_11689302 Ga0157376_116893021 198
246 3300025906 Ga0207699_10680378 Ga0207699_106803782 198
247 3300025909 Ga0207705_10028574 Ga0207705_100285744 198
248 3300028800 Ga0265338_10610317 Ga0265338_106103171 198
249 3300031344 Ga0265316_10177577 Ga0265316_101775772 198
250 3300047472 Ga0495686_0008419 Ga0495686_0008419_2547_3143 198
251 3300049570 Ga0501033_0637612 Ga0501033_0637612_10_606 198
252 3300005327 Ga0070658_10272828 Ga0070658_102728281 199
253 3300005366 Ga0070659_100004580 Ga0070659_1000045809 199
254 3300005435 Ga0070714_100116911 Ga0070714_1001169112 199
255 3300005539 Ga0068853_100000367 Ga0068853_10000036724 199
256 3300005563 Ga0068855_100092013 Ga0068855_1000920132 199
257 3300005563 Ga0068855_100278975 Ga0068855_1002789752 199
258 3300005578 Ga0068854_100000019 Ga0068854_10000001996 199
259 3300005614 Ga0068856_100227971 Ga0068856_1002279713 199
260 3300009093 Ga0105240_10010838 Ga0105240_100108386 199
261 3300009177 Ga0105248_10022327 Ga0105248_100223278 199
262 3300013104 Ga0157370_10012988 Ga0157370_100129882 199
263 3300013104 Ga0157370_10046758 Ga0157370_100467582 199
264 3300013105 Ga0157369_10729791 Ga0157369_107297912 199
265 3300013307 Ga0157372_10348925 Ga0157372_103489252 199
266 3300025913 Ga0207695_10033351 Ga0207695_100333516 199
267 3300025919 Ga0207657_10019482 Ga0207657_100194822 199
268 3300025929 Ga0207664_10128766 Ga0207664_101287663 199
269 3300025932 Ga0207690_10050737 Ga0207690_100507372 199
270 3300025941 Ga0207711_10033255 Ga0207711_100332553 199
271 3300025949 Ga0207667_10030921 Ga0207667_100309215 199
272 3300025949 Ga0207667_10249710 Ga0207667_102497102 199
273 3300025981 Ga0207640_10000028 Ga0207640_1000002820 199
274 3300026041 Ga0207639_10000371 Ga0207639_1000037111 199
275 3300026078 Ga0207702_10306913 Ga0207702_103069132 199
276 3300037466 Ga0395898_0027814 Ga0395898_0027814_4523_5125 199
277 3300037466 Ga0395898_0546082 Ga0395898_0546082_191_793 199
278 3300038443 Ga0395901_0310997 Ga0395901_0310997_575_1177 199
279 3300045049 Ga0466959_0382284 Ga0466959_0382284_167_766 199
280 3300046472 Ga0495580_0497340 Ga0495580_0497340_109_708 199
281 3300046543 Ga0495645_0213338 Ga0495645_0213338_236_835 199
282 3300047472 Ga0495686_0001621 Ga0495686_0001621_18856_19461 199
283 3300005337 Ga0070682_100242035 Ga0070682_1002420351 200
284 3300005548 Ga0070665_100403581 Ga0070665_1004035812 200
285 3300005842 Ga0068858_100015914 Ga0068858_1000159149 200
286 3300009177 Ga0105248_10016372 Ga0105248_100163727 200
287 3300009545 Ga0105237_10063825 Ga0105237_100638254 200
288 3300009551 Ga0105238_10026652 Ga0105238_100266525 200
289 3300009551 Ga0105238_10355224 Ga0105238_103552242 200
290 3300025924 Ga0207694_10048093 Ga0207694_100480932 200
291 3300025941 Ga0207711_10044398 Ga0207711_100443986 200
292 3300026035 Ga0207703_10123186 Ga0207703_101231863 200
293 3300028800 Ga0265338_10004495 Ga0265338_100044959 200
294 3300031249 Ga0265339_10021882 Ga0265339_100218824 200
295 3300031711 Ga0265314_10034859 Ga0265314_100348594 200
296 3300031712 Ga0265342_10027916 Ga0265342_100279165 200
297 3300033180 Ga0307510_10010774 Ga0307510_100107748 200
298 3300047472 Ga0495686_0085891 Ga0495686_0085891_279_881 200
299 3300053087 Ga0500643_109394 Ga0500643_109394_66_680 200
300 iso_pu_bacteria 2884215851 2884217798 200
301 3300005434 Ga0070709_10356466 Ga0070709_103564662 201
302 3300005435 Ga0070714_100002654 Ga0070714_1000026548 201
303 3300005435 Ga0070714_100200420 Ga0070714_1002004202 201
304 3300005563 Ga0068855_100010384 Ga0068855_10001038411 201
305 3300005614 Ga0068856_100709163 Ga0068856_1007091632 201
306 3300009093 Ga0105240_10009346 Ga0105240_100093465 201
307 3300009147 Ga0114129_11396355 Ga0114129_113963551 201
308 3300009177 Ga0105248_10094941 Ga0105248_100949413 201
309 3300009553 Ga0105249_10003449 Ga0105249_100034493 201
310 3300013105 Ga0157369_10371511 Ga0157369_103715112 201
311 3300013306 Ga0163162_10027442 Ga0163162_100274426 201
312 3300014968 Ga0157379_10048162 Ga0157379_100481624 201
313 3300014968 Ga0157379_10287290 Ga0157379_102872902 201
314 3300021361 Ga0213872_10002341 Ga0213872_100023413 201
315 3300021361 Ga0213872_10051363 Ga0213872_100513633 201
316 3300021361 Ga0213872_10054105 Ga0213872_100541052 201
317 3300024225 Ga0224572_1008454 Ga0224572_10084543 201
318 3300025911 Ga0207654_10233283 Ga0207654_102332832 201
319 3300025913 Ga0207695_10000263 Ga0207695_1000026317 201
320 3300025913 Ga0207695_10723985 Ga0207695_107239852 201
321 3300025914 Ga0207671_10218141 Ga0207671_102181411 201
322 3300025928 Ga0207700_11068310 Ga0207700_110683101 201
323 3300025929 Ga0207664_10017916 Ga0207664_100179163 201
324 3300025929 Ga0207664_10105160 Ga0207664_101051603 201
325 3300025941 Ga0207711_10065518 Ga0207711_100655182 201
326 3300025949 Ga0207667_10243021 Ga0207667_102430212 201
327 3300025961 Ga0207712_10043097 Ga0207712_100430973 201
328 3300026078 Ga0207702_10070171 Ga0207702_100701711 201
329 3300033180 Ga0307510_10212472 Ga0307510_102124722 201
330 3300033180 Ga0307510_10223248 Ga0307510_102232481 201
331 3300039438 Ga0436360_1067871 Ga0436360_1067871_123_728 201
332 3300039438 Ga0436360_1280163 Ga0436360_1280163_22_648 201
333 3300039447 Ga0436361_0318263 Ga0436361_0318263_3747_4367 201
334 3300039447 Ga0436361_0387230 Ga0436361_0387230_206_814 201
335 3300039447 Ga0436361_0497072 Ga0436361_0497072_57_674 201
336 3300039447 Ga0436361_0500168 Ga0436361_0500168_1214_1825 201
337 3300039447 Ga0436361_0732319 Ga0436361_0732319_854_1459 201
338 3300044765 Ga0466970_0244720 Ga0466970_0244720_315_932 201
339 3300045976 Ga0466967_0046813 Ga0466967_0046813_379_996 201
340 3300046459 Ga0495629_0029674 Ga0495629_0029674_2757_3362 201
341 3300046459 Ga0495629_0049585 Ga0495629_0049585_238_843 201
342 3300046460 Ga0495638_0445383 Ga0495638_0445383_38_643 201
343 3300046462 Ga0495651_0053044 Ga0495651_0053044_909_1514 201
344 3300046463 Ga0495653_0010749 Ga0495653_0010749_2408_3013 201
345 3300046473 Ga0495582_0001853 Ga0495582_0001853_2290_2895 201
346 3300046473 Ga0495582_0095987 Ga0495582_0095987_694_1299 201
347 3300046475 Ga0495639_0004538 Ga0495639_0004538_1420_2025 201
348 3300046476 Ga0495662_0005660 Ga0495662_0005660_714_1319 201
349 3300046477 Ga0495664_0001348 Ga0495664_0001348_8660_9265 201
350 3300046477 Ga0495664_0057856 Ga0495664_0057856_1552_2157 201
351 3300046499 Ga0495594_0000388 Ga0495594_0000388_1148_1753 201
352 3300046499 Ga0495594_0004431 Ga0495594_0004431_1071_1676 201
353 3300046506 Ga0495583_0033822 Ga0495583_0033822_817_1422 201
354 3300046517 Ga0495630_0270870 Ga0495630_0270870_221_826 201
355 3300046526 Ga0495666_0001196 Ga0495666_0001196_861_1466 201
356 3300046529 Ga0495652_0006640 Ga0495652_0006640_9047_9652 201
357 3300046531 Ga0495665_0001828 Ga0495665_0001828_9607_10212 201
358 3300046533 Ga0495640_0004801 Ga0495640_0004801_8603_9208 201
359 3300046533 Ga0495640_0112414 Ga0495640_0112414_243_848 201
360 3300046535 Ga0495586_0019711 Ga0495586_0019711_2891_3496 201
361 3300046536 Ga0495587_0093692 Ga0495587_0093692_443_1048 201
362 3300046559 Ga0495667_0150787 Ga0495667_0150787_298_903 201
363 3300046642 Ga0495634_0006225 Ga0495634_0006225_4027_4632 201
364 3300046660 Ga0495625_0007833 Ga0495625_0007833_7699_8304 201
365 3300046660 Ga0495625_0026175 Ga0495625_0026175_2642_3247 201
366 3300046663 Ga0495635_0002836 Ga0495635_0002836_3728_4333 201
367 3300046665 Ga0495661_0026784 Ga0495661_0026784_2959_3564 201
368 3300046675 Ga0495657_0277857 Ga0495657_0277857_182_787 201
369 3300046678 Ga0495599_0242663 Ga0495599_0242663_112_717 201
370 3300046680 Ga0495646_0013211 Ga0495646_0013211_1524_2129 201
371 3300046680 Ga0495646_0023225 Ga0495646_0023225_271_876 201
372 3300046680 Ga0495646_0222729 Ga0495646_0222729_330_935 201
373 3300046689 Ga0495613_0003966 Ga0495613_0003966_5046_5651 201
374 3300046689 Ga0495613_0018773 Ga0495613_0018773_3065_3670 201
375 3300046690 Ga0495624_0007524 Ga0495624_0007524_2555_3160 201
376 3300046692 Ga0495671_0095768 Ga0495671_0095768_719_1324 201
377 3300046809 Ga0495600_0012858 Ga0495600_0012858_1525_2130 201
378 3300047315 Ga0495581_0001976 Ga0495581_0001976_7386_7991 201
379 3300047317 Ga0495604_0002834 Ga0495604_0002834_11697_12302 201
380 3300047319 Ga0495674_0014334 Ga0495674_0014334_3154_3759 201
381 3300047320 Ga0495672_0021506 Ga0495672_0021506_406_1011 201
382 3300047320 Ga0495672_0063127 Ga0495672_0063127_247_852 201
383 3300047321 Ga0495676_0008961 Ga0495676_0008961_3708_4313 201
384 3300047444 Ga0495675_0012974 Ga0495675_0012974_1868_2473 201
385 3300047469 Ga0495673_0231467 Ga0495673_0231467_54_659 201
386 3300047471 Ga0495684_0099043 Ga0495684_0099043_1035_1640 201
387 3300048089 Ga0495614_0000972 Ga0495614_0000972_5097_5702 201
388 3300048918 Ga0496115_0085005 Ga0496115_0085005_196_807 201
389 3300048924 Ga0496121_0365824 Ga0496121_0365824_324_929 201
390 3300048929 Ga0496126_0000154 Ga0496126_0000154_113120_113725 201
391 3300053093 Ga0500651_0000005 Ga0500651_0000005_175084_175689 201
392 3300053119 Ga0500595_000004 Ga0500595_000004_240926_241531 201
393 3300053119 Ga0500595_007997 Ga0500595_007997_657_1262 201
394 3300055283 Ga0500661_003309 Ga0500661_003309_1098_1703 201
395 3300005327 Ga0070658_10000121 Ga0070658_100001218 202
396 3300005327 Ga0070658_10021582 Ga0070658_100215825 202
397 3300005327 Ga0070658_10071707 Ga0070658_100717072 202
398 3300005327 Ga0070658_10112053 Ga0070658_101120532 202
399 3300005329 Ga0070683_100028772 Ga0070683_1000287726 202
400 3300005331 Ga0070670_100079127 Ga0070670_1000791273 202
401 3300005338 Ga0068868_100488108 Ga0068868_1004881082 202
402 3300005339 Ga0070660_100155643 Ga0070660_1001556433 202
403 3300005355 Ga0070671_100003123 Ga0070671_1000031232 202
404 3300005366 Ga0070659_100689205 Ga0070659_1006892051 202
405 3300005455 Ga0070663_100053467 Ga0070663_1000534672 202
406 3300005455 Ga0070663_100130863 Ga0070663_1001308632 202
407 3300005455 Ga0070663_100182632 Ga0070663_1001826321 202
408 3300005530 Ga0070679_100003993 Ga0070679_10000399311 202
409 3300005548 Ga0070665_100158518 Ga0070665_1001585182 202
410 3300005563 Ga0068855_100035334 Ga0068855_1000353343 202
411 3300005563 Ga0068855_100218171 Ga0068855_1002181712 202
412 3300005563 Ga0068855_100468401 Ga0068855_1004684012 202
413 3300005563 Ga0068855_100584895 Ga0068855_1005848952 202
414 3300005563 Ga0068855_101193853 Ga0068855_1011938531 202
415 3300005577 Ga0068857_100015817 Ga0068857_1000158173 202
416 3300005578 Ga0068854_100044343 Ga0068854_1000443433 202
417 3300005618 Ga0068864_100012167 Ga0068864_1000121672 202
418 3300005841 Ga0068863_100001814 Ga0068863_10000181411 202
419 3300009093 Ga0105240_11390657 Ga0105240_113906571 202
420 3300009177 Ga0105248_10042895 Ga0105248_100428955 202
421 3300009545 Ga0105237_10812540 Ga0105237_108125402 202
422 3300013104 Ga0157370_10013763 Ga0157370_100137632 202
423 3300013104 Ga0157370_10171680 Ga0157370_101716803 202
424 3300013104 Ga0157370_10752683 Ga0157370_107526832 202
425 3300013105 Ga0157369_10028989 Ga0157369_100289892 202
426 3300013105 Ga0157369_10115794 Ga0157369_101157943 202
427 3300013296 Ga0157374_10042034 Ga0157374_100420344 202
428 3300014325 Ga0163163_10062243 Ga0163163_100622434 202
429 3300025903 Ga0207680_10204305 Ga0207680_102043052 202
430 3300025909 Ga0207705_10000021 Ga0207705_10000021234 202
431 3300025909 Ga0207705_10002125 Ga0207705_100021252 202
432 3300025909 Ga0207705_10002923 Ga0207705_1000292313 202
433 3300025909 Ga0207705_10027435 Ga0207705_100274352 202
434 3300025909 Ga0207705_10332471 Ga0207705_103324711 202
435 3300025912 Ga0207707_10465465 Ga0207707_104654653 202
436 3300025919 Ga0207657_10036579 Ga0207657_100365794 202
437 3300025921 Ga0207652_10036402 Ga0207652_100364025 202
438 3300025925 Ga0207650_10213491 Ga0207650_102134912 202
439 3300025931 Ga0207644_10017923 Ga0207644_100179234 202
440 3300025941 Ga0207711_10093223 Ga0207711_100932233 202
441 3300025944 Ga0207661_10078225 Ga0207661_100782251 202
442 3300025949 Ga0207667_10012818 Ga0207667_100128182 202
443 3300025949 Ga0207667_10098554 Ga0207667_100985542 202
444 3300025949 Ga0207667_10979643 Ga0207667_109796431 202
445 3300025981 Ga0207640_10034716 Ga0207640_100347162 202
446 3300026041 Ga0207639_10054301 Ga0207639_100543012 202
447 3300026067 Ga0207678_10006398 Ga0207678_100063983 202
448 3300026067 Ga0207678_10229059 Ga0207678_102290592 202
449 3300026067 Ga0207678_10575718 Ga0207678_105757182 202
450 3300026078 Ga0207702_10888883 Ga0207702_108888832 202
451 3300026088 Ga0207641_10037049 Ga0207641_100370494 202
452 3300026095 Ga0207676_10508123 Ga0207676_105081233 202
453 3300026116 Ga0207674_10142769 Ga0207674_101427691 202
454 3300028379 Ga0268266_10078240 Ga0268266_100782402 202
455 3300028379 Ga0268266_10188892 Ga0268266_101888922 202
456 3300028577 Ga0265318_10076123 Ga0265318_100761232 202
457 3300028666 Ga0265336_10001048 Ga0265336_100010488 202
458 3300031235 Ga0265330_10072643 Ga0265330_100726432 202
459 3300031235 Ga0265330_10126058 Ga0265330_101260582 202
460 3300031241 Ga0265325_10098913 Ga0265325_100989132 202
461 3300031247 Ga0265340_10096350 Ga0265340_100963502 202
462 3300031249 Ga0265339_10003213 Ga0265339_100032133 202
463 3300031344 Ga0265316_10129073 Ga0265316_101290732 202
464 3300031595 Ga0265313_10068916 Ga0265313_100689162 202
465 3300031711 Ga0265314_10117019 Ga0265314_101170192 202
466 3300031712 Ga0265342_10014061 Ga0265342_100140613 202
467 3300035410 Ga0373924_0093250 Ga0373924_0093250_89_709 202
468 3300046507 Ga0495606_0044975 Ga0495606_0044975_202_810 202
469 3300046538 Ga0495609_0080699 Ga0495609_0080699_655_1263 202
470 3300046660 Ga0495625_0381016 Ga0495625_0381016_71_679 202
471 3300046660 Ga0495625_0434634 Ga0495625_0434634_176_784 202
472 3300046664 Ga0495659_0114237 Ga0495659_0114237_312_920 202
473 3300047323 Ga0495683_0174509 Ga0495683_0174509_364_972 202
474 3300049573 Ga0501037_0492477 Ga0501037_0492477_96_704 202
475 3300049574 Ga0501038_0085946 Ga0501038_0085946_242_850 202
476 3300049581 Ga0501047_0066914 Ga0501047_0066914_2253_2861 202
477 3300049589 Ga0501073_0110559 Ga0501073_0110559_83_691 202
478 3300049590 Ga0501074_0196241 Ga0501074_0196241_127_735 202
479 3300049742 Ga0501080_0188110 Ga0501080_0188110_1237_1845 202
480 3300005339 Ga0070660_100232314 Ga0070660_1002323143 203
481 3300005344 Ga0070661_100050615 Ga0070661_1000506154 203
482 3300005366 Ga0070659_100138892 Ga0070659_1001388922 203
483 3300005437 Ga0070710_10192885 Ga0070710_101928852 203
484 3300005530 Ga0070679_100987841 Ga0070679_1009878411 203
485 3300005539 Ga0068853_100237710 Ga0068853_1002377102 203
486 3300005563 Ga0068855_100169055 Ga0068855_1001690553 203
487 3300005834 Ga0068851_10306247 Ga0068851_103062472 203
488 3300009551 Ga0105238_10078759 Ga0105238_100787594 203
489 3300013105 Ga0157369_10012659 Ga0157369_100126595 203
490 3300013307 Ga0157372_10403380 Ga0157372_104033802 203
491 3300014968 Ga0157379_10161237 Ga0157379_101612373 203
492 3300014969 Ga0157376_10737860 Ga0157376_107378602 203
493 3300021441 Ga0213871_10006004 Ga0213871_100060042 203
494 3300025321 Ga0207656_10196195 Ga0207656_101961951 203
495 3300025909 Ga0207705_10021055 Ga0207705_100210552 203
496 3300025919 Ga0207657_10205754 Ga0207657_102057542 203
497 3300025920 Ga0207649_10031894 Ga0207649_100318943 203
498 3300026041 Ga0207639_10520451 Ga0207639_105204512 203
499 3300031247 Ga0265340_10171805 Ga0265340_101718052 203
500 3300031344 Ga0265316_10018630 Ga0265316_100186302 203
501 3300031712 Ga0265342_10188592 Ga0265342_101885922 203
502 3300048088 Ga0495602_0081301 Ga0495602_0081301_382_1002 203
503 3300005327 Ga0070658_10205977 Ga0070658_102059772 204
504 3300005338 Ga0068868_100081115 Ga0068868_1000811154 204
505 3300005344 Ga0070661_100153801 Ga0070661_1001538012 204
506 3300005455 Ga0070663_100498539 Ga0070663_1004985392 204
507 3300005616 Ga0068852_100103163 Ga0068852_1001031631 204
508 3300005834 Ga0068851_10016393 Ga0068851_100163932 204
509 3300009093 Ga0105240_10120373 Ga0105240_101203733 204
510 3300009098 Ga0105245_10085606 Ga0105245_100856063 204
511 3300009098 Ga0105245_10513291 Ga0105245_105132912 204
512 3300009545 Ga0105237_10248368 Ga0105237_102483682 204
513 3300009551 Ga0105238_10023794 Ga0105238_100237942 204
514 3300010375 Ga0105239_10105415 Ga0105239_101054153 204
515 3300013105 Ga0157369_10192237 Ga0157369_101922373 204
516 3300013296 Ga0157374_10498754 Ga0157374_104987541 204
517 3300013297 Ga0157378_10023973 Ga0157378_100239736 204
518 3300013308 Ga0157375_10066677 Ga0157375_100666772 204
519 3300025321 Ga0207656_10048760 Ga0207656_100487602 204
520 3300025913 Ga0207695_10072087 Ga0207695_100720874 204
521 3300025914 Ga0207671_10086096 Ga0207671_100860962 204
522 3300025924 Ga0207694_10273841 Ga0207694_102738412 204
523 3300025927 Ga0207687_10130110 Ga0207687_101301102 204
524 3300026023 Ga0207677_10322859 Ga0207677_103228592 204
525 3300026041 Ga0207639_10014115 Ga0207639_100141152 204
526 3300026041 Ga0207639_10016992 Ga0207639_100169922 204
527 3300026142 Ga0207698_10215710 Ga0207698_102157103 204
528 3300031235 Ga0265330_10011435 Ga0265330_100114355 204
529 3300031235 Ga0265330_10120309 Ga0265330_101203092 204
530 3300031242 Ga0265329_10011996 Ga0265329_100119962 204
531 3300031344 Ga0265316_10000352 Ga0265316_1000035236 204
532 3300031712 Ga0265342_10002441 Ga0265342_100024418 204
533 3300031712 Ga0265342_10332508 Ga0265342_103325082 204
534 3300044694 Ga0466963_0107210 Ga0466963_0107210_880_1509 204
535 3300044842 Ga0466957_0026837 Ga0466957_0026837_1469_2089 204
536 3300046452 Ga0495617_026479 Ga0495617_026479_536_1156 204
537 3300046455 Ga0495603_0039419 Ga0495603_0039419_1171_1791 204
538 3300046459 Ga0495629_0137756 Ga0495629_0137756_601_1230 204
539 3300046492 Ga0495585_0085882 Ga0495585_0085882_912_1532 204
540 3300046499 Ga0495594_0001190 Ga0495594_0001190_4229_4849 204
541 3300046523 Ga0495644_0000048 Ga0495644_0000048_34106_34726 204
542 3300046528 Ga0495642_0019216 Ga0495642_0019216_2000_2620 204
543 3300046538 Ga0495609_0011141 Ga0495609_0011141_1119_1739 204
544 3300046558 Ga0495633_0051416 Ga0495633_0051416_351_971 204
545 3300046648 Ga0495611_0005877 Ga0495611_0005877_4194_4814 204
546 3300046660 Ga0495625_0034121 Ga0495625_0034121_2234_2854 204
547 3300046679 Ga0495623_0410809 Ga0495623_0410809_53_682 204
548 3300046684 Ga0495669_0004252 Ga0495669_0004252_3687_4307 204
549 3300046689 Ga0495613_0109799 Ga0495613_0109799_878_1507 204
550 3300048903 Ga0496100_0725168 Ga0496100_0725168_114_743 204
551 3300048908 Ga0496105_0057832 Ga0496105_0057832_1627_2256 204
552 3300048914 Ga0496111_0303736 Ga0496111_0303736_468_1097 204
553 3300048918 Ga0496115_0091617 Ga0496115_0091617_1553_2182 204
554 3300048918 Ga0496115_0373480 Ga0496115_0373480_96_725 204
555 3300049569 Ga0501032_0001912 Ga0501032_0001912_6908_7528 204
556 3300049570 Ga0501033_0028282 Ga0501033_0028282_2381_3001 204
557 3300049571 Ga0501034_0148520 Ga0501034_0148520_831_1451 204
558 3300049572 Ga0501036_0076344 Ga0501036_0076344_1396_2016 204
559 3300049573 Ga0501037_0391740 Ga0501037_0391740_66_686 204
560 3300049574 Ga0501038_0048143 Ga0501038_0048143_2333_2953 204
561 3300049579 Ga0501043_0003983 Ga0501043_0003983_9383_10003 204
562 3300049580 Ga0501046_0000056 Ga0501046_0000056_47108_47728 204
563 3300049581 Ga0501047_0008947 Ga0501047_0008947_4589_5209 204
564 3300049589 Ga0501073_0110594 Ga0501073_0110594_1212_1832 204
565 3300049822 Ga0501035_0044540 Ga0501035_0044540_2717_3337 204
566 3300049823 Ga0501044_0027240 Ga0501044_0027240_659_1279 204
567 3300005614 Ga0068856_100050428 Ga0068856_1000504284 205
568 3300005834 Ga0068851_10058980 Ga0068851_100589804 205
569 3300013105 Ga0157369_10054976 Ga0157369_100549764 205
570 3300025321 Ga0207656_10364668 Ga0207656_103646682 205
571 3300026078 Ga0207702_10989030 Ga0207702_109890302 205
572 3300028800 Ga0265338_10268771 Ga0265338_102687712 205
573 3300031239 Ga0265328_10011186 Ga0265328_100111865 205
574 3300031249 Ga0265339_10000194 Ga0265339_1000019417 205
575 3300031344 Ga0265316_10022409 Ga0265316_100224094 205
576 3300031712 Ga0265342_10001536 Ga0265342_100015365 205
577 3300033544 Ga0316215_1003489 Ga0316215_10034892 205
578 3300005458 Ga0070681_10966872 Ga0070681_109668721 206
579 3300025912 Ga0207707_10659207 Ga0207707_106592072 206
580 3300028800 Ga0265338_10259829 Ga0265338_102598292 206
581 3300031235 Ga0265330_10000273 Ga0265330_1000027325 206
582 3300031235 Ga0265330_10030656 Ga0265330_100306563 206
583 3300031241 Ga0265325_10000266 Ga0265325_1000026623 206
584 3300031241 Ga0265325_10005858 Ga0265325_100058588 206
585 3300031247 Ga0265340_10012505 Ga0265340_100125055 206
586 3300031247 Ga0265340_10015610 Ga0265340_100156104 206
587 3300031249 Ga0265339_10009288 Ga0265339_100092881 206
588 3300031249 Ga0265339_10028825 Ga0265339_100288253 206
589 3300031344 Ga0265316_10003105 Ga0265316_100031053 206
590 3300031344 Ga0265316_10008382 Ga0265316_100083825 206
591 3300031595 Ga0265313_10002216 Ga0265313_1000221616 206
592 3300031595 Ga0265313_10187633 Ga0265313_101876332 206
593 3300031712 Ga0265342_10000225 Ga0265342_1000022533 206
594 3300031712 Ga0265342_10069670 Ga0265342_100696702 206
595 3300046471 Ga0495650_0000038 Ga0495650_0000038_183824_184450 206
596 3300046660 Ga0495625_0089152 Ga0495625_0089152_201_827 206
597 3300046694 Ga0495649_0012107 Ga0495649_0012107_2979_3641 206
598 3300005436 Ga0070713_100631919 Ga0070713_1006319192 207
599 3300037418 Ga0395900_0389492 Ga0395900_0389492_392_1027 207
600 3300044693 Ga0466961_0055286 Ga0466961_0055286_538_1164 207
601 3300046507 Ga0495606_0067569 Ga0495606_0067569_1209_1871 207
602 3300005328 Ga0070676_10067377 Ga0070676_100673773 208
603 3300005335 Ga0070666_10070170 Ga0070666_100701704 208
604 3300005344 Ga0070661_100701045 Ga0070661_1007010451 208
605 3300005355 Ga0070671_100446435 Ga0070671_1004464352 208
606 3300005364 Ga0070673_100070243 Ga0070673_1000702433 208
607 3300005367 Ga0070667_100246795 Ga0070667_1002467952 208
608 3300005436 Ga0070713_100433308 Ga0070713_1004333082 208
609 3300005456 Ga0070678_100600428 Ga0070678_1006004282 208
610 3300005457 Ga0070662_100215752 Ga0070662_1002157522 208
611 3300005459 Ga0068867_100354254 Ga0068867_1003542542 208
612 3300005539 Ga0068853_100327147 Ga0068853_1003271472 208
613 3300005548 Ga0070665_100181688 Ga0070665_1001816882 208
614 3300005564 Ga0070664_100592049 Ga0070664_1005920492 208
615 3300005577 Ga0068857_100355705 Ga0068857_1003557052 208
616 3300005614 Ga0068856_100085887 Ga0068856_1000858873 208
617 3300005616 Ga0068852_100113488 Ga0068852_1001134882 208
618 3300005834 Ga0068851_10167950 Ga0068851_101679502 208
619 3300005843 Ga0068860_100510378 Ga0068860_1005103782 208
620 3300006237 Ga0097621_100505098 Ga0097621_1005050982 208
621 3300006881 Ga0068865_100136913 Ga0068865_1001369132 208
622 3300009098 Ga0105245_10443589 Ga0105245_104435892 208
623 3300009174 Ga0105241_10232573 Ga0105241_102325732 208
624 3300009177 Ga0105248_10796820 Ga0105248_107968202 208
625 3300009545 Ga0105237_10137842 Ga0105237_101378422 208
626 3300011119 Ga0105246_10119528 Ga0105246_101195282 208
627 3300013105 Ga0157369_11101743 Ga0157369_111017432 208
628 3300013308 Ga0157375_10069334 Ga0157375_100693343 208
629 3300017792 Ga0163161_10044573 Ga0163161_100445732 208
630 3300025904 Ga0207647_10078008 Ga0207647_100780083 208
631 3300025907 Ga0207645_10116005 Ga0207645_101160052 208
632 3300025927 Ga0207687_10350078 Ga0207687_103500782 208
633 3300025928 Ga0207700_10394546 Ga0207700_103945462 208
634 3300025933 Ga0207706_10243219 Ga0207706_102432192 208
635 3300025934 Ga0207686_10373242 Ga0207686_103732422 208
636 3300025940 Ga0207691_10039961 Ga0207691_100399614 208
637 3300025944 Ga0207661_10475948 Ga0207661_104759482 208
638 3300025949 Ga0207667_10373279 Ga0207667_103732792 208
639 3300025981 Ga0207640_10677227 Ga0207640_106772272 208
640 3300026023 Ga0207677_10154976 Ga0207677_101549763 208
641 3300026116 Ga0207674_10294723 Ga0207674_102947232 208
642 3300026121 Ga0207683_10028240 Ga0207683_100282402 208
643 3300026142 Ga0207698_10036682 Ga0207698_100366822 208
644 3300028017 Ga0265356_1004445 Ga0265356_10044453 208
645 3300046459 Ga0495629_0060065 Ga0495629_0060065_1679_2323 208
646 3300046472 Ga0495580_0120910 Ga0495580_0120910_858_1502 208
647 3300046529 Ga0495652_0043862 Ga0495652_0043862_2592_3236 208
648 3300046535 Ga0495586_0197397 Ga0495586_0197397_134_778 208
649 3300046543 Ga0495645_0053835 Ga0495645_0053835_313_957 208
650 3300046689 Ga0495613_0038534 Ga0495613_0038534_1922_2566 208
651 3300046690 Ga0495624_0174027 Ga0495624_0174027_520_1164 208
652 3300046809 Ga0495600_0172644 Ga0495600_0172644_464_1108 208
653 3300048088 Ga0495602_0236738 Ga0495602_0236738_539_1183 208
654 3300048907 Ga0496104_0438058 Ga0496104_0438058_484_1128 208
655 3300053085 Ga0495619_0140913 Ga0495619_0140913_687_1331 208
656 3300005329 Ga0070683_100060569 Ga0070683_1000605695 209
657 3300005535 Ga0070684_100165684 Ga0070684_1001656842 209
658 3300005563 Ga0068855_100002688 Ga0068855_10000268814 209
659 3300005563 Ga0068855_100060121 Ga0068855_1000601215 209
660 3300005616 Ga0068852_100000019 Ga0068852_10000001978 209
661 3300009093 Ga0105240_10152229 Ga0105240_101522292 209
662 3300009551 Ga0105238_10314767 Ga0105238_103147672 209
663 3300025913 Ga0207695_10000167 Ga0207695_10000167110 209
664 3300025913 Ga0207695_10090502 Ga0207695_100905022 209
665 3300025924 Ga0207694_10139468 Ga0207694_101394683 209
666 3300025924 Ga0207694_10522820 Ga0207694_105228202 209
667 3300025944 Ga0207661_10077968 Ga0207661_100779684 209
668 3300025949 Ga0207667_10009516 Ga0207667_100095168 209
669 3300025949 Ga0207667_10035816 Ga0207667_100358163 209
670 3300026142 Ga0207698_10000003 Ga0207698_10000003237 209
671 3300028800 Ga0265338_10099138 Ga0265338_100991382 209
672 3300028800 Ga0265338_10527691 Ga0265338_105276912 209
673 3300031238 Ga0265332_10054533 Ga0265332_100545332 209
674 3300031238 Ga0265332_10280342 Ga0265332_102803421 209
675 3300031241 Ga0265325_10087985 Ga0265325_100879852 209
676 3300031249 Ga0265339_10165558 Ga0265339_101655582 209
677 3300031344 Ga0265316_10136596 Ga0265316_101365961 209
678 3300031595 Ga0265313_10046248 Ga0265313_100462483 209
679 3300031595 Ga0265313_10227340 Ga0265313_102273401 209
680 3300031712 Ga0265342_10136398 Ga0265342_101363982 209
681 3300005339 Ga0070660_100008313 Ga0070660_1000083134 210
682 3300005366 Ga0070659_100234782 Ga0070659_1002347822 210
683 3300005437 Ga0070710_10266048 Ga0070710_102660481 210
684 3300005458 Ga0070681_10001050 Ga0070681_1000105019 210
685 3300005530 Ga0070679_100006128 Ga0070679_1000061288 210
686 3300005539 Ga0068853_100130644 Ga0068853_1001306443 210
687 3300005548 Ga0070665_100041617 Ga0070665_1000416173 210
688 3300005577 Ga0068857_100306068 Ga0068857_1003060682 210
689 3300005614 Ga0068856_100509145 Ga0068856_1005091452 210
690 3300005616 Ga0068852_100001535 Ga0068852_1000015357 210
691 3300009093 Ga0105240_10001875 Ga0105240_1000187517 210
692 3300009545 Ga0105237_10575017 Ga0105237_105750172 210
693 3300009551 Ga0105238_10008072 Ga0105238_100080723 210
694 3300013104 Ga0157370_10010160 Ga0157370_100101604 210
695 3300013105 Ga0157369_10042189 Ga0157369_100421896 210
696 3300013296 Ga0157374_10827694 Ga0157374_108276942 210
697 3300013307 Ga0157372_10002611 Ga0157372_100026114 210
698 3300013307 Ga0157372_10063864 Ga0157372_100638646 210
699 3300025909 Ga0207705_10012875 Ga0207705_100128752 210
700 3300025912 Ga0207707_10003864 Ga0207707_1000386410 210
701 3300025913 Ga0207695_10001762 Ga0207695_1000176220 210
702 3300025919 Ga0207657_10004623 Ga0207657_100046232 210
703 3300025921 Ga0207652_10001535 Ga0207652_1000153518 210
704 3300025924 Ga0207694_10062538 Ga0207694_100625383 210
705 3300025928 Ga0207700_10058092 Ga0207700_100580923 210
706 3300025932 Ga0207690_10175486 Ga0207690_101754862 210
707 3300025949 Ga0207667_10000468 Ga0207667_100004683 210
708 3300025949 Ga0207667_10176714 Ga0207667_101767142 210
709 3300026041 Ga0207639_10211214 Ga0207639_102112142 210
710 3300026078 Ga0207702_10034912 Ga0207702_100349125 210
711 3300026078 Ga0207702_11043759 Ga0207702_110437592 210
712 3300026116 Ga0207674_10293248 Ga0207674_102932482 210
713 3300026142 Ga0207698_10003525 Ga0207698_100035257 210
714 3300028379 Ga0268266_10005265 Ga0268266_100052658 210
715 3300028379 Ga0268266_10006399 Ga0268266_100063997 210
716 3300028573 Ga0265334_10130983 Ga0265334_101309832 210
717 3300028577 Ga0265318_10011054 Ga0265318_100110543 210
718 3300028666 Ga0265336_10005708 Ga0265336_100057082 210
719 3300028800 Ga0265338_10005157 Ga0265338_1000515714 210
720 3300028800 Ga0265338_10009284 Ga0265338_100092847 210
721 3300029957 Ga0265324_10026321 Ga0265324_100263211 210
722 3300031235 Ga0265330_10001219 Ga0265330_100012197 210
723 3300031239 Ga0265328_10001272 Ga0265328_100012723 210
724 3300031240 Ga0265320_10003664 Ga0265320_100036647 210
725 3300031241 Ga0265325_10000695 Ga0265325_1000069512 210
726 3300031242 Ga0265329_10011153 Ga0265329_100111533 210
727 3300031247 Ga0265340_10001072 Ga0265340_100010729 210
728 3300031249 Ga0265339_10000114 Ga0265339_1000011457 210
729 3300031250 Ga0265331_10073017 Ga0265331_100730173 210
730 3300031344 Ga0265316_10000712 Ga0265316_1000071225 210
731 3300031595 Ga0265313_10004714 Ga0265313_100047149 210
732 3300031711 Ga0265314_10000504 Ga0265314_1000050412 210
733 3300031712 Ga0265342_10002164 Ga0265342_1000216415 210
734 3300038443 Ga0395901_0513053 Ga0395901_0513053_405_1040 210
735 3300046660 Ga0495625_0000985 Ga0495625_0000985_25987_26637 210
736 3300049570 Ga0501033_0115308 Ga0501033_0115308_1009_1659 210
737 3300049822 Ga0501035_0377603 Ga0501035_0377603_208_858 210
738 3300049823 Ga0501044_0095095 Ga0501044_0095095_184_834 210
739 3300049823 Ga0501044_0417372 Ga0501044_0417372_552_1202 210
740 3300005458 Ga0070681_10095557 Ga0070681_100955573 211
741 3300005530 Ga0070679_100369870 Ga0070679_1003698702 211
742 3300009177 Ga0105248_10578479 Ga0105248_105784792 211
743 3300025911 Ga0207654_10000054 Ga0207654_1000005459 211
744 3300025917 Ga0207660_10271414 Ga0207660_102714142 211
745 3300048907 Ga0496104_0726557 Ga0496104_0726557_75_728 211
746 3300028800 Ga0265338_10017734 Ga0265338_100177345 212
747 3300029957 Ga0265324_10009104 Ga0265324_100091045 212
748 3300031239 Ga0265328_10005053 Ga0265328_100050535 212
749 3300031249 Ga0265339_10000124 Ga0265339_1000012417 212
750 3300031251 Ga0265327_10267568 Ga0265327_102675681 212
751 3300031344 Ga0265316_10006699 Ga0265316_100066999 212
752 3300031711 Ga0265314_10002987 Ga0265314_100029879 212
753 3300031712 Ga0265342_10045350 Ga0265342_100453504 212
754 3300032133 Ga0316583_10095825 Ga0316583_100958251 212
755 3300049823 Ga0501044_0690521 Ga0501044_0690521_186_833 212
756 3300005347 Ga0070668_100695790 Ga0070668_1006957901 213
757 3300006028 Ga0070717_10011904 Ga0070717_100119046 213
758 3300026142 Ga0207698_10464681 Ga0207698_104646812 213
759 3300028563 Ga0265319_1044472 Ga0265319_10444722 213
760 3300031250 Ga0265331_10111778 Ga0265331_101117782 213
761 3300035118 Ga0373954_0036836 Ga0373954_0036836_354_1034 213
762 3300035172 Ga0373955_0149693 Ga0373955_0149693_604_1284 213
763 3300036401 Ga0373937_0007405 Ga0373937_0007405_4375_5055 213
764 3300005327 Ga0070658_10196354 Ga0070658_101963543 214
765 3300005329 Ga0070683_100002041 Ga0070683_10000204110 214
766 3300005329 Ga0070683_100062351 Ga0070683_1000623513 214
767 3300005329 Ga0070683_100221096 Ga0070683_1002210962 214
768 3300005334 Ga0068869_100095013 Ga0068869_1000950132 214
769 3300005335 Ga0070666_10055265 Ga0070666_100552653 214
770 3300005338 Ga0068868_100000066 Ga0068868_10000006628 214
771 3300005339 Ga0070660_100637198 Ga0070660_1006371981 214
772 3300005344 Ga0070661_100019981 Ga0070661_1000199813 214
773 3300005344 Ga0070661_100066000 Ga0070661_1000660002 214
774 3300005355 Ga0070671_100050619 Ga0070671_1000506194 214
775 3300005367 Ga0070667_100046288 Ga0070667_1000462882 214
776 3300005455 Ga0070663_100321159 Ga0070663_1003211592 214
777 3300005535 Ga0070684_100107048 Ga0070684_1001070482 214
778 3300005535 Ga0070684_100273521 Ga0070684_1002735212 214
779 3300005535 Ga0070684_100393724 Ga0070684_1003937241 214
780 3300005539 Ga0068853_100000222 Ga0068853_10000022225 214
781 3300005539 Ga0068853_100070755 Ga0068853_1000707552 214
782 3300005563 Ga0068855_100000277 Ga0068855_10000027728 214
783 3300005563 Ga0068855_100301117 Ga0068855_1003011172 214
784 3300005564 Ga0070664_100734426 Ga0070664_1007344262 214
785 3300005577 Ga0068857_100003191 Ga0068857_1000031914 214
786 3300005578 Ga0068854_100034075 Ga0068854_1000340754 214
787 3300005614 Ga0068856_100003529 Ga0068856_1000035296 214
788 3300005614 Ga0068856_100033069 Ga0068856_1000330694 214
789 3300005614 Ga0068856_100413541 Ga0068856_1004135412 214
790 3300005616 Ga0068852_100000097 Ga0068852_10000009729 214
791 3300005616 Ga0068852_100168947 Ga0068852_1001689472 214
792 3300005618 Ga0068864_100000625 Ga0068864_1000006251 214
793 3300005834 Ga0068851_10041070 Ga0068851_100410703 214
794 3300005834 Ga0068851_10051580 Ga0068851_100515802 214
795 3300005841 Ga0068863_100001753 Ga0068863_10000175312 214
796 3300005842 Ga0068858_100014586 Ga0068858_1000145863 214
797 3300005843 Ga0068860_100000689 Ga0068860_10000068912 214
798 3300005844 Ga0068862_100293795 Ga0068862_1002937952 214
799 3300006237 Ga0097621_100000349 Ga0097621_10000034918 214
800 3300006358 Ga0068871_100002325 Ga0068871_10000232512 214
801 3300009093 Ga0105240_10097071 Ga0105240_100970715 214
802 3300009174 Ga0105241_10000026 Ga0105241_1000002626 214
803 3300009545 Ga0105237_10000590 Ga0105237_1000059010 214
804 3300009551 Ga0105238_10000197 Ga0105238_1000019727 214
805 3300010375 Ga0105239_10001533 Ga0105239_1000153323 214
806 3300013105 Ga0157369_10000430 Ga0157369_1000043027 214
807 3300025321 Ga0207656_10031201 Ga0207656_100312013 214
808 3300025321 Ga0207656_10031615 Ga0207656_100316152 214
809 3300025903 Ga0207680_10030474 Ga0207680_100304742 214
810 3300025904 Ga0207647_10125849 Ga0207647_101258492 214
811 3300025909 Ga0207705_10282735 Ga0207705_102827352 214
812 3300025911 Ga0207654_10000281 Ga0207654_1000028110 214
813 3300025911 Ga0207654_10000808 Ga0207654_100008084 214
814 3300025913 Ga0207695_10000113 Ga0207695_10000113156 214
815 3300025913 Ga0207695_10001106 Ga0207695_1000110637 214
816 3300025914 Ga0207671_10000065 Ga0207671_1000006572 214
817 3300025914 Ga0207671_10000123 Ga0207671_1000012386 214
818 3300025914 Ga0207671_10000139 Ga0207671_1000013961 214
819 3300025919 Ga0207657_10347439 Ga0207657_103474393 214
820 3300025920 Ga0207649_10051782 Ga0207649_100517824 214
821 3300025924 Ga0207694_10000248 Ga0207694_1000024827 214
822 3300025924 Ga0207694_10000711 Ga0207694_100007115 214
823 3300025925 Ga0207650_10003582 Ga0207650_100035829 214
824 3300025927 Ga0207687_10000978 Ga0207687_1000097815 214
825 3300025931 Ga0207644_10266848 Ga0207644_102668482 214
826 3300025944 Ga0207661_10001283 Ga0207661_100012836 214
827 3300025944 Ga0207661_10055710 Ga0207661_100557102 214
828 3300025944 Ga0207661_10104793 Ga0207661_101047932 214
829 3300025945 Ga0207679_10616612 Ga0207679_106166122 214
830 3300025949 Ga0207667_10006194 Ga0207667_1000619414 214
831 3300025949 Ga0207667_10294967 Ga0207667_102949672 214
832 3300025981 Ga0207640_10024137 Ga0207640_100241373 214
833 3300025981 Ga0207640_10092985 Ga0207640_100929853 214
834 3300025986 Ga0207658_10003428 Ga0207658_1000342812 214
835 3300026023 Ga0207677_10000143 Ga0207677_1000014322 214
836 3300026035 Ga0207703_10004820 Ga0207703_1000482012 214
837 3300026041 Ga0207639_10000088 Ga0207639_1000008818 214
838 3300026041 Ga0207639_10154385 Ga0207639_101543851 214
839 3300026067 Ga0207678_10336767 Ga0207678_103367672 214
840 3300026078 Ga0207702_10001334 Ga0207702_100013342 214
841 3300026078 Ga0207702_10005816 Ga0207702_100058163 214
842 3300026088 Ga0207641_10005346 Ga0207641_100053469 214
843 3300026095 Ga0207676_10055374 Ga0207676_100553743 214
844 3300026116 Ga0207674_10000669 Ga0207674_1000066911 214
845 3300026116 Ga0207674_10148285 Ga0207674_101482853 214
846 3300026142 Ga0207698_10000708 Ga0207698_100007082 214
847 3300026142 Ga0207698_10031875 Ga0207698_100318753 214
848 3300028380 Ga0268265_10562240 Ga0268265_105622402 214
849 3300028381 Ga0268264_10000598 Ga0268264_1000059819 214
850 3300005355 Ga0070671_100117926 Ga0070671_1001179262 215
851 3300005548 Ga0070665_100005637 Ga0070665_10000563712 215
852 3300005617 Ga0068859_100120087 Ga0068859_1001200873 215
853 3300006237 Ga0097621_100360082 Ga0097621_1003600821 215
854 3300006358 Ga0068871_100788000 Ga0068871_1007880002 215
855 3300006931 Ga0097620_100120081 Ga0097620_1001200813 215
856 3300025911 Ga0207654_10251596 Ga0207654_102515962 215
857 3300025913 Ga0207695_10000080 Ga0207695_10000080198 215
858 3300025924 Ga0207694_10078380 Ga0207694_100783802 215
859 3300025941 Ga0207711_10004781 Ga0207711_1000478110 215
860 3300028379 Ga0268266_10008807 Ga0268266_100088078 215
861 3300031712 Ga0265342_10029908 Ga0265342_100299082 216
862 3300060353 Ga0501082_0213946 Ga0501082_0213946_437_1129 217
863 3300013105 Ga0157369_10098891 Ga0157369_100988912 220
864 3300047472 Ga0495686_0000178 Ga0495686_0000178_48986_49663 220
865 3300047472 Ga0495686_0047439 Ga0495686_0047439_1172_1885 220
866 3300003214 JGI25165J46597_1013739 JGI25165J46597_10137392 229
867 3300025261 Ga0209233_1001442 Ga0209233_10014424 229
868 3300048907 Ga0496104_0000053 Ga0496104_0000053_125499_126197 229
869 3300048929 Ga0496126_0000100 Ga0496126_0000100_78964_79653 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00475

IGPD

Imidazoleglycerol-phosphate dehydratase

44

182

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mu0-assembly1.cif.gz_A the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4-triazole at 1.3 a resolution 0.9463 34 217
7oj5-assembly1.cif.gz_A cryo-em structure of medicago truncatula hisn5 protein 0.9437 36 217
2f1d-assembly1.cif.gz_D x-ray structure of imidazoleglycerol-phosphate dehydratase 0.9435 36 217
4mu3-assembly1.cif.gz_A the form a structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution 0.9416 34 218
4mu0-assembly1.cif.gz_A the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4-triazole at 1.3 a resolution 0.9364 34 217
ID Description Score Start End Superfamily
1rhyA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9662 124 214 3.30.230.40
4qnkD01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9607 34 121 3.30.230.40
1rhyA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9561 124 214 3.30.230.40
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9531 124 217 3.30.230.40
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9434 124 217 3.30.230.40
ID Description Score Start End GO Terms
AF-A0A850D107-F1-model_v4 deleted 1 35 95
AF-A0A7X6NPR2-F1-model_v4 deleted 0.9949 36 114
AF-A0A522GSK4-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9937 37 111 GO:0000105
GO:0004424
AF-A0A7V8WEL3-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9936 37 100 GO:0000105
GO:0004424
AF-A0A257PNR5-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9928 35 114 GO:0000105
GO:0004424

Feature Viewer

pLDDT pTM Quality
83.4 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map