F484119

General Info

Members Datasets Scaffolds Average Seq Length
869 326 1738 115

Family's Representative Sequence

Representative Sequence 3300025901|Ga0207688_10031142|Ga0207688_100311422
Length 132
Sequence MGETTSSATAAAARADGARFDPSCVFCKIVAGQIPSRKAFEDDELIVFHDIAPWAPVHVLLVPKAHIASHADVTDADSALLGRMLALAPKLMRDLGVTNGFRTVINTGRDGGQEVAHLHVHVMGGPRPWARG

Samples

Sample ID Description Type Environment
1 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
101 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
102 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
103 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
119 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
122 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
184 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
192 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
193 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
194 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
195 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
196 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
199 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
200 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
201 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
202 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
210 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
211 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
212 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
213 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
220 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
225 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
226 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
227 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
228 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
229 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
230 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
231 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
232 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
233 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
234 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
235 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
236 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
237 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
238 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
239 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
240 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
241 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
244 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
245 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
246 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
247 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
248 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
251 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
252 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
253 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
254 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
255 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
256 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
257 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
258 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
259 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
260 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
263 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
264 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
265 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
266 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
267 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
268 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
269 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
270 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
271 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
272 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
273 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
274 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
275 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
276 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
277 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
278 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
279 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
280 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
281 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
282 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
283 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
284 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
285 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
286 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
287 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
288 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
289 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
290 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
291 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
295 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
296 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
305 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
306 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
307 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
308 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
309 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
310 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
311 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
312 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
313 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
314 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
315 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
316 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
317 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
318 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
319 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
320 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
321 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
322 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
323 2643221660 Methylibium sp. Root1272 Isolate Unclassified
324 2831864461 Roseateles noduli HZ7 Isolate Nodule
325 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
326 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.12
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.93
Nodule 0.35
Rhizoplane 1.38
Rhizosphere 84.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207688_10031142 3300025901 Bacteria 2943
2 rootH1_10042584 3300003316 Bacteria 1609
3 rootH2_10005996 3300003320 Bacteria 2723
4 rootL2_10000300 3300003322 Bacteria 57400
5 rootH1_10006628 3300003323 Bacteria 3787
6 rootH1_10102547 3300003323 Bacteria 1571
7 Ga0055526_1000414 3300003771 Bacteria 34422
8 Ga0055524_1003149 3300003775 Bacteria 8126
9 Ga0055524_1006310 3300003775 Bacteria 5155
10 Ga0055530_10023684 3300003791 Bacteria 1758
11 Ga0055540_1008994 3300003792 Bacteria 3517
12 Ga0055531_10006730 3300003794 Bacteria 6433
13 Ga0055531_10015923 3300003794 Bacteria 3277
14 Ga0055543_1003646 3300004625 Bacteria 4442
15 Ga0065165_1000177 3300005262 Bacteria 113446
16 Ga0065712_10089833 3300005290 Bacteria 2451
17 Ga0065715_10189229 3300005293 Bacteria 1425
18 Ga0065707_10401843 3300005295 Bacteria 849
19 Ga0070658_10655752 3300005327 Bacteria 911
20 Ga0070658_10982660 3300005327 Bacteria 734
21 Ga0070676_10056576 3300005328 Bacteria 2318
22 Ga0070676_10077465 3300005328 Bacteria 2009
23 Ga0070676_10097211 3300005328 Bacteria 1813
24 Ga0070676_10157832 3300005328 Bacteria 1457
25 Ga0070676_10169876 3300005328 Bacteria 1409
26 Ga0070676_10242391 3300005328 Bacteria 1199
27 Ga0070676_10396006 3300005328 Bacteria 960
28 Ga0070683_100937722 3300005329 Bacteria 831
29 Ga0070690_100020420 3300005330 Bacteria 4035
30 Ga0070690_100282481 3300005330 Bacteria 1184
31 Ga0070670_100001787 3300005331 Bacteria 17505
32 Ga0070670_100004549 3300005331 Bacteria 11629
33 Ga0070670_100096015 3300005331 Bacteria 2550
34 Ga0070670_102269641 3300005331 Bacteria 500
35 Ga0070677_10019535 3300005333 Bacteria 2455
36 Ga0070677_10021218 3300005333 Bacteria 2380
37 Ga0070677_10034831 3300005333 Bacteria 1947
38 Ga0070677_10035303 3300005333 Bacteria 1937
39 Ga0070677_10057427 3300005333 Bacteria 1595
40 Ga0070677_10067530 3300005333 Bacteria 1494
41 Ga0070677_10082720 3300005333 Bacteria 1377
42 Ga0068869_100090154 3300005334 Bacteria 2304
43 Ga0068869_100254584 3300005334 Bacteria 1403
44 Ga0068869_100520378 3300005334 Bacteria 996
45 Ga0068869_100784857 3300005334 Bacteria 818
46 Ga0070666_10006757 3300005335 Bacteria 7065
47 Ga0070666_10125512 3300005335 Bacteria 1781
48 Ga0070666_10172011 3300005335 Bacteria 1517
49 Ga0070666_10254780 3300005335 Bacteria 1243
50 Ga0070666_11172574 3300005335 Bacteria 572
51 Ga0070682_100770342 3300005337 Bacteria 779
52 Ga0070682_101471806 3300005337 Bacteria 585
53 Ga0068868_100000966 3300005338 Bacteria 19576
54 Ga0068868_100057566 3300005338 Bacteria 3071
55 Ga0068868_100900218 3300005338 Bacteria 804
56 Ga0070660_101711672 3300005339 Bacteria 536
57 Ga0070689_101691667 3300005340 Bacteria 576
58 Ga0070687_100041173 3300005343 Bacteria 2333
59 Ga0070687_100545901 3300005343 Bacteria 788
60 Ga0070661_100655004 3300005344 Bacteria 853
61 Ga0070661_100899812 3300005344 Bacteria 730
62 Ga0070661_101048422 3300005344 Bacteria 678
63 Ga0070661_101052009 3300005344 Bacteria 677
64 Ga0070692_10156390 3300005345 Bacteria 1302
65 Ga0070668_100036969 3300005347 Bacteria 3727
66 Ga0070668_100068511 3300005347 Bacteria 2758
67 Ga0070668_100173369 3300005347 Bacteria 1757
68 Ga0070668_101427346 3300005347 Bacteria 631
69 Ga0070669_100002645 3300005353 Bacteria 12924
70 Ga0070669_100005844 3300005353 Bacteria 8872
71 Ga0070669_100545998 3300005353 Bacteria 966
72 Ga0070669_100663035 3300005353 Bacteria 878
73 Ga0070669_100950294 3300005353 Bacteria 736
74 Ga0070675_100008036 3300005354 Bacteria 8179
75 Ga0070675_100023867 3300005354 Bacteria 4895
76 Ga0070675_100080667 3300005354 Bacteria 2712
77 Ga0070675_100113048 3300005354 Bacteria 2299
78 Ga0070675_100280683 3300005354 Bacteria 1463
79 Ga0070675_100401053 3300005354 Bacteria 1223
80 Ga0070675_100574867 3300005354 Bacteria 1020
81 Ga0070675_100992024 3300005354 Bacteria 771
82 Ga0070671_100011057 3300005355 Bacteria 7245
83 Ga0070671_100033755 3300005355 Bacteria 4234
84 Ga0070671_100060500 3300005355 Bacteria 3153
85 Ga0070671_100086706 3300005355 Bacteria 2620
86 Ga0070671_100207302 3300005355 Bacteria 1662
87 Ga0070671_100208222 3300005355 Bacteria 1658
88 Ga0070671_101529847 3300005355 Bacteria 591
89 Ga0070674_100002485 3300005356 Bacteria 10209
90 Ga0070674_100004974 3300005356 Bacteria 7619
91 Ga0070674_100102944 3300005356 Bacteria 2083
92 Ga0070674_100328581 3300005356 Bacteria 1228
93 Ga0070674_100538909 3300005356 Bacteria 977
94 Ga0070674_101522411 3300005356 Bacteria 602
95 Ga0070673_100050040 3300005364 Bacteria 3265
96 Ga0070673_100099910 3300005364 Bacteria 2387
97 Ga0070673_100110202 3300005364 Bacteria 2282
98 Ga0070673_100118826 3300005364 Bacteria 2201
99 Ga0070673_100216515 3300005364 Bacteria 1656
100 Ga0070673_100244226 3300005364 Bacteria 1562
101 Ga0070673_100262754 3300005364 Bacteria 1508
102 Ga0070688_100917710 3300005365 Bacteria 692
103 Ga0070688_101061042 3300005365 Bacteria 646
104 Ga0070688_101161690 3300005365 Bacteria 619
105 Ga0070659_100571255 3300005366 Bacteria 969
106 Ga0070667_100016643 3300005367 Bacteria 6086
107 Ga0070667_100021277 3300005367 Bacteria 5388
108 Ga0070667_100023158 3300005367 Bacteria 5151
109 Ga0070667_100108445 3300005367 Bacteria 2406
110 Ga0070667_100459072 3300005367 Bacteria 1165
111 Ga0070701_10425311 3300005438 Bacteria 847
112 Ga0070701_11026543 3300005438 Bacteria 577
113 Ga0070700_100129428 3300005441 Bacteria 1701
114 Ga0070700_100239757 3300005441 Bacteria 1295
115 Ga0070700_100373625 3300005441 Bacteria 1064
116 Ga0070663_100053248 3300005455 Bacteria 2889
117 Ga0070663_100155356 3300005455 Bacteria 1757
118 Ga0070663_100158128 3300005455 Bacteria 1743
119 Ga0070663_100276145 3300005455 Bacteria 1337
120 Ga0070663_100503933 3300005455 Bacteria 1006
121 Ga0070663_101226741 3300005455 Bacteria 660
122 Ga0070678_100006239 3300005456 Bacteria 6975
123 Ga0070678_100013205 3300005456 Bacteria 5169
124 Ga0070678_100077866 3300005456 Bacteria 2502
125 Ga0070678_100139409 3300005456 Bacteria 1938
126 Ga0070678_100149221 3300005456 Bacteria 1881
127 Ga0070678_100315241 3300005456 Bacteria 1334
128 Ga0070678_100644762 3300005456 Bacteria 949
129 Ga0070678_100854067 3300005456 Bacteria 830
130 Ga0070678_101754248 3300005456 Bacteria 585
131 Ga0070662_100017313 3300005457 Bacteria 4857
132 Ga0070662_100148518 3300005457 Bacteria 1822
133 Ga0070662_100930474 3300005457 Bacteria 742
134 Ga0070662_101261260 3300005457 Bacteria 636
135 Ga0070681_10176293 3300005458 Bacteria 2060
136 Ga0068867_100000081 3300005459 Bacteria 59361
137 Ga0068867_100001379 3300005459 Bacteria 16789
138 Ga0068867_100002071 3300005459 Bacteria 14068
139 Ga0068867_100005640 3300005459 Bacteria 8872
140 Ga0068867_100036861 3300005459 Bacteria 3552
141 Ga0068867_100095371 3300005459 Bacteria 2263
142 Ga0068867_100386107 3300005459 Bacteria 1177
143 Ga0070685_11365074 3300005466 Bacteria 543
144 Ga0070707_101628618 3300005468 Bacteria 612
145 Ga0070698_100182583 3300005471 Bacteria 2036
146 Ga0070679_100108254 3300005530 Bacteria 2765
147 Ga0070679_100351676 3300005530 Bacteria 1421
148 Ga0070684_100031515 3300005535 Bacteria 4514
149 Ga0070684_100441279 3300005535 Bacteria 1202
150 Ga0068853_100339802 3300005539 Bacteria 1395
151 Ga0068853_100349786 3300005539 Bacteria 1374
152 Ga0068853_100701222 3300005539 Bacteria 966
153 Ga0070672_100002675 3300005543 Bacteria 11393
154 Ga0070672_100007718 3300005543 Bacteria 7327
155 Ga0070672_100016975 3300005543 Bacteria 5226
156 Ga0070672_100036721 3300005543 Bacteria 3734
157 Ga0070672_100092834 3300005543 Bacteria 2437
158 Ga0070672_100149059 3300005543 Bacteria 1934
159 Ga0070672_100214937 3300005543 Bacteria 1611
160 Ga0070672_100418586 3300005543 Bacteria 1150
161 Ga0070672_101223181 3300005543 Bacteria 669
162 Ga0070672_101655886 3300005543 Bacteria 574
163 Ga0070672_101701795 3300005543 Bacteria 566
164 Ga0070686_100243514 3300005544 Bacteria 1310
165 Ga0070665_100905789 3300005548 Bacteria 894
166 Ga0070665_102111455 3300005548 Bacteria 568
167 Ga0070665_102509977 3300005548 Bacteria 517
168 Ga0070664_100204112 3300005564 Bacteria 1765
169 Ga0070664_100310215 3300005564 Bacteria 1427
170 Ga0070664_100357144 3300005564 Bacteria 1330
171 Ga0070664_100861591 3300005564 Bacteria 848
172 Ga0070664_100904666 3300005564 Bacteria 827
173 Ga0070664_101008604 3300005564 Bacteria 782
174 Ga0070664_101213416 3300005564 Bacteria 712
175 Ga0070664_101422802 3300005564 Bacteria 656
176 Ga0070664_101844679 3300005564 Bacteria 573
177 Ga0068857_100042432 3300005577 Bacteria 4036
178 Ga0068857_100593438 3300005577 Bacteria 1047
179 Ga0068857_101213316 3300005577 Bacteria 731
180 Ga0068854_100149364 3300005578 Bacteria 1800
181 Ga0068854_100344134 3300005578 Bacteria 1218
182 Ga0068854_100391608 3300005578 Bacteria 1147
183 Ga0068854_101526736 3300005578 Bacteria 607
184 Ga0068856_102256930 3300005614 Bacteria 553
185 Ga0070702_100582819 3300005615 Bacteria 836
186 Ga0070702_100943430 3300005615 Bacteria 679
187 Ga0070702_101063810 3300005615 Bacteria 644
188 Ga0068852_100005075 3300005616 Bacteria 9367
189 Ga0068852_100141798 3300005616 Bacteria 2225
190 Ga0068852_100175965 3300005616 Bacteria 2009
191 Ga0068852_100236513 3300005616 Bacteria 1744
192 Ga0068852_100467849 3300005616 Bacteria 1251
193 Ga0068852_100521452 3300005616 Bacteria 1186
194 Ga0068852_102229897 3300005616 Bacteria 569
195 Ga0068852_102667666 3300005616 Bacteria 519
196 Ga0068859_100019167 3300005617 Bacteria 6872
197 Ga0068859_100303608 3300005617 Bacteria 1690
198 Ga0068859_100825868 3300005617 Bacteria 1013
199 Ga0068859_101245626 3300005617 Bacteria 819
200 Ga0068859_101504309 3300005617 Bacteria 743
201 Ga0068864_100002065 3300005618 Bacteria 16597
202 Ga0068864_100013594 3300005618 Bacteria 6748
203 Ga0068864_100087903 3300005618 Bacteria 2737
204 Ga0068864_100178614 3300005618 Bacteria 1939
205 Ga0068864_100209955 3300005618 Bacteria 1792
206 Ga0068864_101314593 3300005618 Bacteria 723
207 Ga0068866_10003257 3300005718 Bacteria 6683
208 Ga0068866_10016475 3300005718 Bacteria 3304
209 Ga0068866_10551714 3300005718 Bacteria 771
210 Ga0068866_10571549 3300005718 Bacteria 759
211 Ga0068866_10918464 3300005718 Bacteria 617
212 Ga0068861_100236372 3300005719 Bacteria 1552
213 Ga0068861_100720802 3300005719 Bacteria 929
214 Ga0068861_102150506 3300005719 Bacteria 558
215 Ga0068851_10006836 3300005834 Bacteria 5222
216 Ga0068851_10242932 3300005834 Bacteria 1019
217 Ga0068851_10297844 3300005834 Bacteria 927
218 Ga0068870_10115492 3300005840 Bacteria 1539
219 Ga0068870_11103437 3300005840 Bacteria 571
220 Ga0068870_11304424 3300005840 Bacteria 529
221 Ga0068863_100020937 3300005841 Bacteria 6246
222 Ga0068863_100145324 3300005841 Bacteria 2268
223 Ga0068863_100248762 3300005841 Bacteria 1717
224 Ga0068863_100322531 3300005841 Bacteria 1500
225 Ga0068863_100919818 3300005841 Bacteria 875
226 Ga0068863_100968943 3300005841 Bacteria 852
227 Ga0068858_100009260 3300005842 Bacteria 9405
228 Ga0068858_100015823 3300005842 Bacteria 7091
229 Ga0068858_100039082 3300005842 Bacteria 4402
230 Ga0068858_101712586 3300005842 Bacteria 621
231 Ga0068860_100000823 3300005843 Bacteria 34706
232 Ga0068860_100002377 3300005843 Bacteria 19765
233 Ga0068860_102184324 3300005843 Bacteria 574
234 Ga0068860_102198881 3300005843 Bacteria 572
235 Ga0068862_100020457 3300005844 Bacteria 5529
236 Ga0068862_100083098 3300005844 Bacteria 2781
237 Ga0068862_100155446 3300005844 Bacteria 2038
238 Ga0070717_10402880 3300006028 Bacteria 1229
239 Ga0075365_10034760 3300006038 Bacteria 3257
240 Ga0075368_10044982 3300006042 Bacteria 1743
241 Ga0075368_10077612 3300006042 Bacteria 1349
242 Ga0075368_10214063 3300006042 Bacteria 817
243 Ga0075363_100007044 3300006048 Bacteria 5140
244 Ga0075363_100023200 3300006048 Bacteria 3142
245 Ga0075363_100662658 3300006048 Bacteria 628
246 Ga0075364_10060988 3300006051 Bacteria 2473
247 Ga0075364_10240909 3300006051 Bacteria 1229
248 Ga0075432_10224244 3300006058 Bacteria 753
249 Ga0070715_10150703 3300006163 Bacteria 1139
250 Ga0075362_10018715 3300006177 Bacteria 2870
251 Ga0075362_10020141 3300006177 Bacteria 2784
252 Ga0075362_10082986 3300006177 Bacteria 1479
253 Ga0075362_10244067 3300006177 Bacteria 882
254 Ga0075367_10011834 3300006178 Bacteria 4633
255 Ga0075367_10018888 3300006178 Bacteria 3811
256 Ga0075367_10035526 3300006178 Bacteria 2885
257 Ga0075367_10770495 3300006178 Bacteria 612
258 Ga0075369_10188331 3300006186 Bacteria 950
259 Ga0075369_10617699 3300006186 Bacteria 519
260 Ga0075366_10005480 3300006195 Bacteria 6878
261 Ga0075366_10013052 3300006195 Bacteria 4725
262 Ga0075366_10033393 3300006195 Bacteria 3031
263 Ga0075366_10165121 3300006195 Bacteria 1342
264 Ga0075366_10274205 3300006195 Bacteria 1030
265 Ga0075366_10467880 3300006195 Bacteria 778
266 Ga0075366_10493981 3300006195 Bacteria 756
267 Ga0075366_10668837 3300006195 Bacteria 644
268 Ga0075366_10692020 3300006195 Bacteria 633
269 Ga0075366_10852792 3300006195 Bacteria 567
270 Ga0097621_100041619 3300006237 Bacteria 3699
271 Ga0097621_100144783 3300006237 Bacteria 2033
272 Ga0097621_100205376 3300006237 Bacteria 1712
273 Ga0097621_100379376 3300006237 Bacteria 1262
274 Ga0097621_100486992 3300006237 Bacteria 1115
275 Ga0075370_10001367 3300006353 Bacteria 10507
276 Ga0075370_10008912 3300006353 Bacteria 5184
277 Ga0075370_10009322 3300006353 Bacteria 5094
278 Ga0075370_10044073 3300006353 Bacteria 2522
279 Ga0075370_10125623 3300006353 Bacteria 1495
280 Ga0075370_10330160 3300006353 Bacteria 909
281 Ga0068871_100041620 3300006358 Bacteria 3684
282 Ga0068871_100071350 3300006358 Bacteria 2856
283 Ga0068871_100092045 3300006358 Bacteria 2528
284 Ga0068871_100099750 3300006358 Bacteria 2431
285 Ga0068871_100178396 3300006358 Bacteria 1824
286 Ga0068871_100410478 3300006358 Bacteria 1207
287 Ga0068865_100022066 3300006881 Bacteria 4146
288 Ga0068865_100027661 3300006881 Bacteria 3748
289 Ga0068865_100138799 3300006881 Bacteria 1830
290 Ga0068865_100192432 3300006881 Bacteria 1579
291 Ga0068865_100730783 3300006881 Bacteria 848
292 Ga0097620_100019167 3300006931 Bacteria 6872
293 Ga0097620_100303607 3300006931 Bacteria 1690
294 Ga0097620_100825852 3300006931 Bacteria 1013
295 Ga0097620_101245625 3300006931 Bacteria 819
296 Ga0097620_101504314 3300006931 Bacteria 743
297 Ga0099823_1000139 3300006944 Bacteria 37935
298 Ga0105240_10025383 3300009093 Bacteria 7788
299 Ga0105240_10831510 3300009093 Bacteria 998
300 Ga0105240_12102309 3300009093 Bacteria 586
301 Ga0111539_10492745 3300009094 Bacteria 1427
302 Ga0111539_10844621 3300009094 Bacteria 1065
303 Ga0105245_10300993 3300009098 Bacteria 1574
304 Ga0105245_10390721 3300009098 Bacteria 1388
305 Ga0105243_10011388 3300009148 Bacteria 6730
306 Ga0105243_10019382 3300009148 Bacteria 5158
307 Ga0105243_10180637 3300009148 Bacteria 1835
308 Ga0105243_10486408 3300009148 Bacteria 1166
309 Ga0105243_10607787 3300009148 Bacteria 1054
310 Ga0105243_11908092 3300009148 Bacteria 627
311 Ga0105243_12597967 3300009148 Bacteria 546
312 Ga0105241_10297786 3300009174 Bacteria 1383
313 Ga0105242_10265232 3300009176 Bacteria 1553
314 Ga0105242_10578597 3300009176 Bacteria 1081
315 Ga0105242_11914769 3300009176 Bacteria 634
316 Ga0105248_10388190 3300009177 Bacteria 1572
317 Ga0105248_10517157 3300009177 Bacteria 1346
318 Ga0105248_10895710 3300009177 Bacteria 1002
319 Ga0105248_10896995 3300009177 Bacteria 1001
320 Ga0105248_11564606 3300009177 Bacteria 747
321 Ga0105248_12500067 3300009177 Bacteria 589
322 Ga0105248_13006353 3300009177 Bacteria 537
323 Ga0105237_10139088 3300009545 Bacteria 2423
324 Ga0105237_11657179 3300009545 Bacteria 647
325 Ga0105238_10792889 3300009551 Bacteria 963
326 Ga0105238_11840629 3300009551 Bacteria 638
327 Ga0105249_10023493 3300009553 Bacteria 5532
328 Ga0105249_10315700 3300009553 Bacteria 1572
329 Ga0105249_10331773 3300009553 Bacteria 1535
330 Ga0105249_13192281 3300009553 Bacteria 527
331 Ga0105246_10420354 3300011119 Bacteria 1115
332 Ga0105246_11524683 3300011119 Bacteria 629
333 Ga0157319_1000008 3300012497 Bacteria 315600
334 Ga0157327_1069140 3300012512 Bacteria 544
335 Ga0157326_1049789 3300012513 Bacteria 612
336 Ga0157338_1015236 3300012515 Bacteria 837
337 Ga0157338_1082067 3300012515 Bacteria 523
338 Ga0157373_10969136 3300013100 Bacteria 633
339 Ga0157371_10710919 3300013102 Bacteria 753
340 Ga0157369_10083325 3300013105 Bacteria 3421
341 Ga0157374_10047942 3300013296 Bacteria 3963
342 Ga0157374_10276787 3300013296 Bacteria 1656
343 Ga0157374_10330368 3300013296 Bacteria 1512
344 Ga0157374_10636760 3300013296 Bacteria 1077
345 Ga0157374_11681404 3300013296 Bacteria 659
346 Ga0157378_10001703 3300013297 Bacteria 19776
347 Ga0157378_10107143 3300013297 Bacteria 2557
348 Ga0157378_10833545 3300013297 Bacteria 950
349 Ga0157378_10847354 3300013297 Bacteria 942
350 Ga0157378_11025087 3300013297 Bacteria 860
351 Ga0157378_11279908 3300013297 Bacteria 774
352 Ga0163162_10002252 3300013306 Bacteria 18114
353 Ga0163162_10205553 3300013306 Bacteria 2098
354 Ga0163162_10567478 3300013306 Bacteria 1262
355 Ga0163162_10763510 3300013306 Bacteria 1086
356 Ga0163162_11126408 3300013306 Bacteria 889
357 Ga0163162_11426421 3300013306 Bacteria 788
358 Ga0157375_10010275 3300013308 Bacteria 8238
359 Ga0157375_10026436 3300013308 Bacteria 5409
360 Ga0157375_10393941 3300013308 Bacteria 1552
361 Ga0157375_10856734 3300013308 Bacteria 1055
362 Ga0157375_10886198 3300013308 Bacteria 1037
363 Ga0157375_11334889 3300013308 Bacteria 844
364 Ga0163163_10009458 3300014325 Bacteria 8703
365 Ga0157380_10022401 3300014326 Bacteria 4755
366 Ga0157380_10082572 3300014326 Bacteria 2630
367 Ga0157380_10215534 3300014326 Bacteria 1714
368 Ga0157380_10234391 3300014326 Bacteria 1651
369 Ga0157380_10648826 3300014326 Bacteria 1052
370 Ga0157380_10679288 3300014326 Bacteria 1031
371 Ga0157380_11905092 3300014326 Bacteria 655
372 Ga0157380_12599806 3300014326 Bacteria 572
373 Ga0157377_10000032 3300014745 Bacteria 121003
374 Ga0157377_10482165 3300014745 Bacteria 863
375 Ga0157377_10543479 3300014745 Bacteria 819
376 Ga0157379_10018511 3300014968 Bacteria 6144
377 Ga0157379_10167102 3300014968 Bacteria 1986
378 Ga0157379_10173362 3300014968 Bacteria 1947
379 Ga0157379_10176376 3300014968 Bacteria 1930
380 Ga0157379_10869691 3300014968 Bacteria 854
381 Ga0157379_12380228 3300014968 Bacteria 528
382 Ga0157376_10072799 3300014969 Bacteria 2924
383 Ga0157376_10115161 3300014969 Bacteria 2373
384 Ga0157376_10176155 3300014969 Bacteria 1951
385 Ga0157376_10311930 3300014969 Bacteria 1493
386 Ga0157376_11279008 3300014969 Bacteria 763
387 Ga0163161_10011306 3300017792 Bacteria 6186
388 Ga0163161_10076960 3300017792 Bacteria 2450
389 Ga0163161_10175027 3300017792 Bacteria 1643
390 Ga0163161_11496459 3300017792 Bacteria 592
391 Ga0206353_11968656 3300020082 Bacteria 880
392 Ga0213872_10000007 3300021361 Bacteria 228206
393 Ga0213872_10000113 3300021361 Bacteria 74827
394 Ga0213872_10000169 3300021361 Bacteria 58596
395 Ga0213872_10045076 3300021361 Bacteria 2006
396 Ga0207666_1013498 3300025271 Bacteria 1147
397 Ga0209673_1002844 3300025273 Bacteria 11093
398 Ga0209673_1012105 3300025273 Bacteria 3502
399 Ga0207673_1011311 3300025290 Bacteria 1154
400 Ga0209564_1000008 3300025295 Bacteria 953227
401 Ga0209758_1056274 3300025297 Bacteria 1330
402 Ga0209050_1003036 3300025298 Bacteria 12951
403 Ga0209256_1001514 3300025299 Bacteria 23507
404 Ga0209256_1001861 3300025299 Bacteria 19505
405 Ga0209051_1001714 3300025303 Bacteria 17502
406 Ga0209257_1002401 3300025304 Bacteria 18726
407 Ga0209257_1003376 3300025304 Bacteria 13783
408 Ga0207697_10012918 3300025315 Bacteria 3491
409 Ga0207697_10080924 3300025315 Bacteria 1368
410 Ga0207697_10209233 3300025315 Bacteria 859
411 Ga0207656_10036539 3300025321 Bacteria 2062
412 Ga0207656_10190847 3300025321 Bacteria 986
413 Ga0207682_10011971 3300025893 Bacteria 3387
414 Ga0207682_10018556 3300025893 Bacteria 2721
415 Ga0207682_10023185 3300025893 Bacteria 2450
416 Ga0207682_10023230 3300025893 Bacteria 2448
417 Ga0207682_10057400 3300025893 Bacteria 1623
418 Ga0207682_10395949 3300025893 Bacteria 652
419 Ga0207682_10632514 3300025893 Bacteria 503
420 Ga0207642_10012685 3300025899 Bacteria 3051
421 Ga0207642_10125938 3300025899 Bacteria 1329
422 Ga0207642_10436508 3300025899 Bacteria 791
423 Ga0207642_10619984 3300025899 Bacteria 675
424 Ga0207642_10648214 3300025899 Bacteria 661
425 Ga0207688_10118475 3300025901 Bacteria 1543
426 Ga0207688_10270158 3300025901 Bacteria 1034
427 Ga0207680_10002140 3300025903 Bacteria 9255
428 Ga0207680_10040216 3300025903 Bacteria 2719
429 Ga0207680_10079200 3300025903 Bacteria 2060
430 Ga0207685_10034723 3300025905 Bacteria 1834
431 Ga0207645_10008229 3300025907 Bacteria 7294
432 Ga0207645_10064973 3300025907 Bacteria 2331
433 Ga0207645_10092055 3300025907 Bacteria 1950
434 Ga0207645_10166892 3300025907 Bacteria 1442
435 Ga0207645_10169808 3300025907 Bacteria 1429
436 Ga0207643_10814551 3300025908 Bacteria 605
437 Ga0207643_11037368 3300025908 Bacteria 530
438 Ga0207705_10206379 3300025909 Bacteria 1490
439 Ga0207705_10447972 3300025909 Bacteria 1001
440 Ga0207705_11474304 3300025909 Bacteria 516
441 Ga0207684_10003939 3300025910 Bacteria 14206
442 Ga0207654_10768313 3300025911 Bacteria 695
443 Ga0207707_10089670 3300025912 Bacteria 2688
444 Ga0207707_11242312 3300025912 Bacteria 601
445 Ga0207695_10278778 3300025913 Bacteria 1566
446 Ga0207695_10511468 3300025913 Bacteria 1083
447 Ga0207671_10716690 3300025914 Bacteria 795
448 Ga0207662_10018329 3300025918 Bacteria 3970
449 Ga0207662_10414550 3300025918 Bacteria 915
450 Ga0207657_10077079 3300025919 Bacteria 2811
451 Ga0207657_10195314 3300025919 Bacteria 1630
452 Ga0207649_10411979 3300025920 Bacteria 1013
453 Ga0207649_10541013 3300025920 Bacteria 890
454 Ga0207649_10701694 3300025920 Bacteria 785
455 Ga0207649_10853022 3300025920 Bacteria 713
456 Ga0207652_10030048 3300025921 Bacteria 4548
457 Ga0207652_10496707 3300025921 Bacteria 1099
458 Ga0207646_10064185 3300025922 Bacteria 3278
459 Ga0207681_10000424 3300025923 Bacteria 29435
460 Ga0207681_10004628 3300025923 Bacteria 8460
461 Ga0207694_11179796 3300025924 Bacteria 648
462 Ga0207650_10000149 3300025925 Bacteria 83837
463 Ga0207650_10064948 3300025925 Bacteria 2733
464 Ga0207650_10072993 3300025925 Bacteria 2584
465 Ga0207650_10117692 3300025925 Bacteria 2065
466 Ga0207650_10569624 3300025925 Bacteria 950
467 Ga0207650_10615117 3300025925 Bacteria 914
468 Ga0207650_10752449 3300025925 Bacteria 825
469 Ga0207650_11641712 3300025925 Bacteria 545
470 Ga0207659_10000394 3300025926 Bacteria 26304
471 Ga0207659_10020943 3300025926 Bacteria 4331
472 Ga0207659_10024900 3300025926 Bacteria 4016
473 Ga0207659_10137933 3300025926 Bacteria 1890
474 Ga0207659_10236538 3300025926 Bacteria 1476
475 Ga0207659_10257534 3300025926 Bacteria 1418
476 Ga0207659_10387274 3300025926 Bacteria 1167
477 Ga0207659_11303001 3300025926 Bacteria 624
478 Ga0207687_10086829 3300025927 Bacteria 2272
479 Ga0207644_10002654 3300025931 Bacteria 11522
480 Ga0207644_10014945 3300025931 Bacteria 5204
481 Ga0207644_10032869 3300025931 Bacteria 3623
482 Ga0207644_10120885 3300025931 Bacteria 1993
483 Ga0207644_10153013 3300025931 Bacteria 1786
484 Ga0207644_10389588 3300025931 Bacteria 1137
485 Ga0207644_11686718 3300025931 Bacteria 531
486 Ga0207690_10492518 3300025932 Bacteria 991
487 Ga0207706_10013512 3300025933 Bacteria 7420
488 Ga0207706_10031863 3300025933 Bacteria 4696
489 Ga0207706_10089250 3300025933 Bacteria 2710
490 Ga0207706_10153810 3300025933 Bacteria 2023
491 Ga0207706_10706666 3300025933 Bacteria 861
492 Ga0207686_10094012 3300025934 Bacteria 1986
493 Ga0207686_10296859 3300025934 Bacteria 1199
494 Ga0207709_10002313 3300025935 Bacteria 12063
495 Ga0207709_10017851 3300025935 Bacteria 3967
496 Ga0207709_10066755 3300025935 Bacteria 2267
497 Ga0207670_10007649 3300025936 Bacteria 6048
498 Ga0207669_10000874 3300025937 Bacteria 12794
499 Ga0207669_10259192 3300025937 Bacteria 1299
500 Ga0207669_10345841 3300025937 Bacteria 1147
501 Ga0207669_10542011 3300025937 Bacteria 937
502 Ga0207669_10572292 3300025937 Bacteria 914
503 Ga0207669_10802869 3300025937 Bacteria 780
504 Ga0207669_11361640 3300025937 Bacteria 604
505 Ga0207704_10003689 3300025938 Bacteria 6966
506 Ga0207704_10010623 3300025938 Bacteria 4498
507 Ga0207704_10076880 3300025938 Bacteria 2141
508 Ga0207704_10165230 3300025938 Bacteria 1580
509 Ga0207691_10000362 3300025940 Bacteria 45799
510 Ga0207691_10004404 3300025940 Bacteria 13651
511 Ga0207691_10018804 3300025940 Bacteria 6544
512 Ga0207691_10091796 3300025940 Bacteria 2720
513 Ga0207691_10108570 3300025940 Bacteria 2469
514 Ga0207691_10134149 3300025940 Bacteria 2185
515 Ga0207691_10196881 3300025940 Bacteria 1755
516 Ga0207691_10345213 3300025940 Bacteria 1274
517 Ga0207691_10481740 3300025940 Bacteria 1054
518 Ga0207711_10305643 3300025941 Bacteria 1468
519 Ga0207711_10328711 3300025941 Bacteria 1414
520 Ga0207689_10116843 3300025942 Bacteria 2193
521 Ga0207689_10201594 3300025942 Bacteria 1642
522 Ga0207679_10008471 3300025945 Bacteria 6549
523 Ga0207679_10117450 3300025945 Bacteria 2111
524 Ga0207679_10162987 3300025945 Bacteria 1827
525 Ga0207679_10290377 3300025945 Bacteria 1406
526 Ga0207667_11151442 3300025949 Bacteria 757
527 Ga0207651_10004135 3300025960 Bacteria 7251
528 Ga0207651_10004672 3300025960 Bacteria 6942
529 Ga0207651_10013837 3300025960 Bacteria 4634
530 Ga0207651_10225908 3300025960 Bacteria 1516
531 Ga0207651_10281631 3300025960 Bacteria 1374
532 Ga0207651_10445494 3300025960 Bacteria 1110
533 Ga0207712_10017553 3300025961 Bacteria 4650
534 Ga0207712_10055218 3300025961 Bacteria 2793
535 Ga0207712_11839712 3300025961 Bacteria 542
536 Ga0207668_10238457 3300025972 Bacteria 1470
537 Ga0207668_10266149 3300025972 Bacteria 1399
538 Ga0207668_10500838 3300025972 Bacteria 1045
539 Ga0207668_10798522 3300025972 Bacteria 835
540 Ga0207668_11740898 3300025972 Bacteria 562
541 Ga0207640_10315871 3300025981 Bacteria 1242
542 Ga0207640_10341027 3300025981 Bacteria 1200
543 Ga0207640_11379541 3300025981 Bacteria 631
544 Ga0207658_10002509 3300025986 Bacteria 13356
545 Ga0207658_10062467 3300025986 Bacteria 2787
546 Ga0207658_10087577 3300025986 Bacteria 2405
547 Ga0207677_10001522 3300026023 Bacteria 12255
548 Ga0207677_10336598 3300026023 Bacteria 1259
549 Ga0207677_10825094 3300026023 Bacteria 831
550 Ga0207703_10001816 3300026035 Bacteria 19028
551 Ga0207703_10006009 3300026035 Bacteria 9719
552 Ga0207703_10026459 3300026035 Bacteria 4567
553 Ga0207703_11234226 3300026035 Bacteria 719
554 Ga0207703_12376183 3300026035 Bacteria 506
555 Ga0207639_11319384 3300026041 Bacteria 677
556 Ga0207639_11747235 3300026041 Bacteria 582
557 Ga0207678_10048547 3300026067 Bacteria 3669
558 Ga0207678_10053039 3300026067 Bacteria 3495
559 Ga0207678_10070597 3300026067 Bacteria 2995
560 Ga0207678_10396564 3300026067 Bacteria 1194
561 Ga0207678_10462280 3300026067 Bacteria 1104
562 Ga0207678_10487681 3300026067 Bacteria 1074
563 Ga0207678_11551838 3300026067 Bacteria 584
564 Ga0207708_10241223 3300026075 Bacteria 1454
565 Ga0207708_10419361 3300026075 Bacteria 1110
566 Ga0207708_10434475 3300026075 Bacteria 1091
567 Ga0207702_10430548 3300026078 Bacteria 1277
568 Ga0207641_10001603 3300026088 Bacteria 22077
569 Ga0207641_10003329 3300026088 Bacteria 14294
570 Ga0207641_10137677 3300026088 Bacteria 2199
571 Ga0207641_10480246 3300026088 Bacteria 1204
572 Ga0207641_11146783 3300026088 Bacteria 776
573 Ga0207648_10000179 3300026089 Bacteria 66602
574 Ga0207648_10001296 3300026089 Bacteria 27908
575 Ga0207648_10008674 3300026089 Bacteria 9809
576 Ga0207648_10019115 3300026089 Bacteria 6182
577 Ga0207648_10019133 3300026089 Bacteria 6180
578 Ga0207648_10166974 3300026089 Bacteria 1945
579 Ga0207648_10196866 3300026089 Bacteria 1787
580 Ga0207648_10205111 3300026089 Bacteria 1749
581 Ga0207648_10359772 3300026089 Bacteria 1313
582 Ga0207648_10476807 3300026089 Bacteria 1139
583 Ga0207648_11142243 3300026089 Bacteria 731
584 Ga0207676_10002741 3300026095 Bacteria 12542
585 Ga0207676_10003295 3300026095 Bacteria 11473
586 Ga0207676_10057781 3300026095 Bacteria 3057
587 Ga0207676_10137131 3300026095 Bacteria 2089
588 Ga0207676_10489734 3300026095 Bacteria 1166
589 Ga0207676_10717926 3300026095 Bacteria 970
590 Ga0207674_10018099 3300026116 Bacteria 7668
591 Ga0207674_10720183 3300026116 Bacteria 963
592 Ga0207675_100005391 3300026118 Bacteria 12258
593 Ga0207675_100060714 3300026118 Bacteria 3529
594 Ga0207675_100109200 3300026118 Bacteria 2610
595 Ga0207675_101840538 3300026118 Bacteria 624
596 Ga0207683_10007622 3300026121 Bacteria 9271
597 Ga0207683_10077759 3300026121 Bacteria 2939
598 Ga0207683_10148626 3300026121 Bacteria 2114
599 Ga0207683_10172975 3300026121 Bacteria 1957
600 Ga0207683_10340467 3300026121 Bacteria 1375
601 Ga0207683_10365924 3300026121 Bacteria 1324
602 Ga0207683_10371751 3300026121 Bacteria 1313
603 Ga0207683_10393263 3300026121 Bacteria 1275
604 Ga0207683_10397274 3300026121 Bacteria 1268
605 Ga0207683_11073810 3300026121 Bacteria 747
606 Ga0207683_12191684 3300026121 Bacteria 501
607 Ga0207698_10037653 3300026142 Bacteria 3565
608 Ga0207698_10051692 3300026142 Bacteria 3143
609 Ga0207698_10102569 3300026142 Bacteria 2375
610 Ga0207698_10197954 3300026142 Bacteria 1796
611 Ga0207698_11377944 3300026142 Bacteria 720
612 Ga0207698_11942351 3300026142 Bacteria 603
613 Ga0207698_12236916 3300026142 Bacteria 559
614 Ga0209389_1009996 3300027296 Bacteria 8525
615 Ga0209813_10037004 3300027866 Bacteria 1469
616 Ga0207428_10887327 3300027907 Bacteria 630
617 Ga0268266_10233462 3300028379 Bacteria 1695
618 Ga0268265_10011328 3300028380 Bacteria 6031
619 Ga0268265_10025797 3300028380 Bacteria 4176
620 Ga0268265_10119897 3300028380 Bacteria 2165
621 Ga0268265_10453036 3300028380 Bacteria 1199
622 Ga0268264_10000613 3300028381 Bacteria 42687
623 Ga0268264_10001082 3300028381 Bacteria 26946
624 Ga0268264_10313684 3300028381 Bacteria 1480
625 Ga0268264_10742224 3300028381 Bacteria 977
626 Ga0307517_10234325 3300028786 Bacteria 1097
627 Ga0307515_10000011 3300028794 Bacteria 633903
628 Ga0307515_10042972 3300028794 Bacteria 7045
629 Ga0307515_10308906 3300028794 Bacteria 1258
630 Ga0268256_1039369 3300030500 Bacteria 1068
631 Ga0265328_10031796 3300031239 Bacteria 1961
632 Ga0265331_10012133 3300031250 Bacteria 4682
633 Ga0265327_10000012 3300031251 Bacteria 530403
634 Ga0307513_10004316 3300031456 Bacteria 18998
635 Ga0307513_10132408 3300031456 Bacteria 2436
636 Ga0307513_10838018 3300031456 Bacteria 626
637 Ga0307513_11088277 3300031456 Bacteria 511
638 Ga0307509_10338413 3300031507 Bacteria 1233
639 Ga0307509_10703438 3300031507 Bacteria 677
640 Ga0307408_100046772 3300031548 Bacteria 3096
641 Ga0307408_100067929 3300031548 Bacteria 2623
642 Ga0307408_100245180 3300031548 Bacteria 1475
643 Ga0307408_100364749 3300031548 Bacteria 1230
644 Ga0307408_100643190 3300031548 Bacteria 947
645 Ga0307508_10858261 3300031616 Bacteria 530
646 Ga0307514_10288637 3300031649 Bacteria 931
647 Ga0307516_10054923 3300031730 Bacteria 3890
648 Ga0307405_10006962 3300031731 Bacteria 5616
649 Ga0307405_10077374 3300031731 Bacteria 2162
650 Ga0307405_10201709 3300031731 Bacteria 1445
651 Ga0307413_10027914 3300031824 Bacteria 3135
652 Ga0307413_10098905 3300031824 Bacteria 1922
653 Ga0307413_10135801 3300031824 Bacteria 1691
654 Ga0307413_10162646 3300031824 Bacteria 1570
655 Ga0307413_10769197 3300031824 Bacteria 807
656 Ga0307413_10926665 3300031824 Bacteria 742
657 Ga0307410_10497151 3300031852 Bacteria 1003
658 Ga0307406_10114919 3300031901 Bacteria 1860
659 Ga0307406_10343430 3300031901 Bacteria 1163
660 Ga0307406_10519260 3300031901 Bacteria 969
661 Ga0307406_10823680 3300031901 Bacteria 785
662 Ga0307406_11911303 3300031901 Bacteria 529
663 Ga0307406_12068333 3300031901 Bacteria 510
664 Ga0307407_10189680 3300031903 Bacteria 1369
665 Ga0307407_10565453 3300031903 Bacteria 842
666 Ga0307412_10024007 3300031911 Bacteria 3760
667 Ga0307412_10040307 3300031911 Bacteria 3021
668 Ga0307412_10111670 3300031911 Bacteria 1953
669 Ga0307412_10523842 3300031911 Bacteria 991
670 Ga0307412_10535341 3300031911 Bacteria 981
671 Ga0307412_10873179 3300031911 Bacteria 786
672 Ga0307412_11513614 3300031911 Bacteria 610
673 Ga0307409_100000580 3300031995 Bacteria 15944
674 Ga0307409_100026581 3300031995 Bacteria 4084
675 Ga0307409_101067130 3300031995 Bacteria 828
676 Ga0307409_101499088 3300031995 Bacteria 702
677 Ga0307409_101875151 3300031995 Bacteria 629
678 Ga0307416_100014097 3300032002 Bacteria 5460
679 Ga0307416_100048530 3300032002 Bacteria 3369
680 Ga0307416_100346539 3300032002 Bacteria 1501
681 Ga0307416_100747460 3300032002 Bacteria 1070
682 Ga0307416_100795052 3300032002 Bacteria 1041
683 Ga0307416_102210043 3300032002 Bacteria 651
684 Ga0307416_103739532 3300032002 Bacteria 509
685 Ga0307414_10033322 3300032004 Bacteria 3404
686 Ga0307414_11319694 3300032004 Bacteria 670
687 Ga0307411_10040049 3300032005 Bacteria 2969
688 Ga0307411_12023186 3300032005 Bacteria 538
689 Ga0307415_100002051 3300032126 Bacteria 9953
690 Ga0307415_100164374 3300032126 Bacteria 1724
691 Ga0307510_10129128 3300033180 Bacteria 2207
692 Ga0373923_0180129 3300035111 Bacteria 971
693 Ga0373943_0241854 3300035170 Bacteria 1011
694 Ga0373946_0015671 3300035171 Bacteria 2878
695 Ga0373946_0077615 3300035171 Bacteria 1448
696 Ga0373955_0199906 3300035172 Bacteria 1190
697 Ga0373924_0060328 3300035410 Bacteria 1586
698 Ga0373924_0066829 3300035410 Bacteria 1512
699 Ga0373927_0064689 3300035695 Bacteria 2366
700 Ga0373933_0186583 3300035724 Bacteria 1324
701 Ga0373947_0254198 3300035725 Bacteria 1163
702 Ga0373947_0355056 3300035725 Bacteria 984
703 Ga0373937_0138600 3300036401 Bacteria 2275
704 Ga0373937_0189006 3300036401 Bacteria 1935
705 Ga0373937_0684064 3300036401 Bacteria 972
706 Ga0373925_0820296 3300037068 Bacteria 767
707 Ga0395905_0005984 3300037471 Bacteria 12318
708 Ga0395905_0046642 3300037471 Bacteria 4063
709 Ga0436361_0005759 3300039447 Bacteria 6838
710 Ga0436361_0159126 3300039447 Bacteria 34073
711 Ga0436361_0163583 3300039447 Bacteria 173204
712 Ga0436361_0287659 3300039447 Bacteria 26995
713 Ga0436361_0511282 3300039447 Bacteria 4027
714 Ga0451847_1012534 3300041503 Bacteria 665
715 Ga0451853_0097426 3300041512 Bacteria 1040
716 Ga0451853_0642104 3300041512 Bacteria 826
717 Ga0451853_3600406 3300041512 Bacteria 515
718 Ga0439437_005197 3300042000 Bacteria 1430
719 Ga0439449_0113590 3300042007 Bacteria 1004
720 Ga0439450_008587 3300042008 Bacteria 1911
721 Ga0439454_047565 3300042011 Bacteria 717
722 Ga0439457_087577 3300042014 Bacteria 719
723 Ga0439462_0114925 3300042015 Bacteria 746
724 Ga0450890_001348 3300042127 Bacteria 3543
725 Ga0439458_0012264 3300042157 Bacteria 1922
726 Ga0439459_0001699 3300042438 Bacteria 3284
727 Ga0439459_0053842 3300042438 Bacteria 891
728 Ga0439464_0136631 3300042439 Bacteria 761
729 Ga0439460_0015272 3300042461 Bacteria 2030
730 Ga0451577_0002309 3300042876 Bacteria 23046
731 Ga0451577_0004741 3300042876 Bacteria 14236
732 Ga0451577_0057615 3300042876 Bacteria 3463
733 Ga0451577_0186853 3300042876 Bacteria 1869
734 Ga0451577_0401658 3300042876 Bacteria 1244
735 Ga0453683_0134334 3300044673 Bacteria 1560
736 Ga0466963_0036295 3300044694 Bacteria 3214
737 Ga0453684_0152551 3300044712 Bacteria 2743
738 Ga0453684_0449212 3300044712 Bacteria 1435
739 Ga0453684_0472337 3300044712 Bacteria 1392
740 Ga0453684_0486060 3300044712 Bacteria 1369
741 Ga0453684_2160814 3300044712 Bacteria 557
742 Ga0451576_0017940 3300045051 Bacteria 7769
743 Ga0451576_0269844 3300045051 Bacteria 1779
744 Ga0451576_0432924 3300045051 Bacteria 1380
745 Ga0451576_0505559 3300045051 Bacteria 1269
746 Ga0495603_0678813 3300046455 Bacteria 589
747 Ga0495590_0005559 3300046457 Bacteria 4987
748 Ga0495590_0030446 3300046457 Bacteria 1891
749 Ga0495629_0147853 3300046459 Bacteria 1633
750 Ga0495629_0400983 3300046459 Bacteria 932
751 Ga0495650_0164730 3300046471 Bacteria 788
752 Ga0495580_0018628 3300046472 Bacteria 5167
753 Ga0495582_0346028 3300046473 Bacteria 856
754 Ga0495582_0667812 3300046473 Bacteria 601
755 Ga0495664_0769055 3300046477 Bacteria 567
756 Ga0495616_0042778 3300046513 Bacteria 2304
757 Ga0495618_0361677 3300046514 Bacteria 893
758 Ga0495620_0184932 3300046515 Bacteria 805
759 Ga0495630_0532220 3300046517 Bacteria 901
760 Ga0495632_0002758 3300046519 Bacteria 13043
761 Ga0495642_0040928 3300046528 Bacteria 1884
762 Ga0495665_0314203 3300046531 Bacteria 801
763 Ga0495586_0687931 3300046535 Bacteria 591
764 Ga0495598_0019659 3300046537 Bacteria 1774
765 Ga0495598_0056608 3300046537 Bacteria 1197
766 Ga0495621_0170619 3300046539 Bacteria 864
767 Ga0495621_0334028 3300046539 Bacteria 633
768 Ga0495597_0004807 3300046542 Bacteria 7296
769 Ga0495597_0090320 3300046542 Bacteria 1301
770 Ga0495645_0139146 3300046543 Bacteria 1695
771 Ga0495633_0119090 3300046558 Bacteria 1223
772 Ga0495667_0465622 3300046559 Bacteria 793
773 Ga0495656_0085595 3300046615 Bacteria 1432
774 Ga0495668_0295181 3300046616 Bacteria 888
775 Ga0495611_0212509 3300046648 Bacteria 901
776 Ga0495625_0037297 3300046660 Bacteria 3567
777 Ga0495625_0435796 3300046660 Bacteria 812
778 Ga0495599_0822246 3300046678 Bacteria 530
779 Ga0495646_0222927 3300046680 Bacteria 1019
780 Ga0495647_0129412 3300046681 Bacteria 1068
781 Ga0495647_0340863 3300046681 Bacteria 681
782 Ga0495658_0009588 3300046683 Bacteria 4827
783 Ga0495670_0045101 3300046691 Bacteria 2201
784 Ga0495670_0470091 3300046691 Bacteria 682
785 Ga0495671_0610324 3300046692 Bacteria 519
786 Ga0495649_0003342 3300046694 Bacteria 10883
787 Ga0495589_0130142 3300046794 Bacteria 1209
788 Ga0495600_0228094 3300046809 Bacteria 1190
789 Ga0495660_0014020 3300046810 Bacteria 4647
790 Ga0495581_0381395 3300047315 Bacteria 823
791 Ga0495636_0593339 3300047318 Bacteria 541
792 Ga0495674_0558910 3300047319 Bacteria 910
793 Ga0495687_000961 3300047443 Bacteria 29557
794 Ga0495677_0435001 3300047445 Bacteria 520
795 Ga0495673_0159432 3300047469 Bacteria 867
796 Ga0495684_0168753 3300047471 Bacteria 1629
797 Ga0495684_0204812 3300047471 Bacteria 1453
798 Ga0495686_0003513 3300047472 Bacteria 13526
799 Ga0495614_0056011 3300048089 Bacteria 1692
800 Ga0496100_0112887 3300048903 Bacteria 1891
801 Ga0496101_0216873 3300048904 Bacteria 1484
802 Ga0496101_0605386 3300048904 Bacteria 866
803 Ga0496104_0032470 3300048907 Bacteria 4859
804 Ga0496104_1273983 3300048907 Bacteria 638
805 Ga0496105_0167701 3300048908 Bacteria 1801
806 Ga0496106_0609388 3300048909 Bacteria 874
807 Ga0496106_0813138 3300048909 Bacteria 741
808 Ga0496108_0023125 3300048911 Bacteria 5112
809 Ga0496108_0468684 3300048911 Bacteria 1100
810 Ga0496110_1109111 3300048913 Bacteria 699
811 Ga0496114_0260955 3300048917 Bacteria 1525
812 Ga0495682_0063931 3300049460 Bacteria 1327
813 Ga0501034_0813782 3300049571 Bacteria 826
814 Ga0501036_0619635 3300049572 Bacteria 897
815 Ga0501043_0000057 3300049579 Bacteria 103997
816 Ga0501046_0000075 3300049580 Bacteria 104000
817 Ga0501047_0000081 3300049581 Bacteria 122697
818 Ga0501048_0002636 3300049582 Bacteria 13718
819 Ga0501072_0601076 3300049588 Bacteria 867
820 Ga0501044_0479483 3300049823 Bacteria 1147
821 nmdc:mga03683_32074_c1 3300050489 Bacteria 2112
822 nmdc:mga03683_331666_c1 3300050489 Bacteria 718
823 nmdc:mga03683_5307_c1 3300050489 Bacteria 4346
824 nmdc:mga03n38_31311_c1 3300050490 Bacteria 2244
825 nmdc:mga03n38_539560_c1 3300050490 Bacteria 659
826 nmdc:mga00v17_17305_c1 3300050491 Bacteria 4078
827 nmdc:mga00v17_51935_c1 3300050491 Bacteria 2493
828 nmdc:mga0yw44_26539_c1 3300050492 Bacteria 3310
829 nmdc:mga0k408_124397_c1 3300050493 Bacteria 1529
830 nmdc:mga0k408_124630_c1 3300050493 Bacteria 1528
831 nmdc:mga0k408_12508_c2 3300050493 Bacteria 3792
832 nmdc:mga0k408_161_c1 3300050493 Bacteria 34843
833 nmdc:mga0k408_33581_c1 3300050493 Bacteria 2935
834 nmdc:mga0k408_370100_c1 3300050493 Bacteria 854
835 nmdc:mga0k408_4516_c2 3300050493 Bacteria 4792
836 nmdc:mga0k408_471693_c1 3300050493 Bacteria 745
837 nmdc:mga0k408_59045_c1 3300050493 Bacteria 2228
838 nmdc:mga0k408_7247_c1 3300050493 Bacteria 5928
839 nmdc:mga06z11_217694_c1 3300050494 Bacteria 1115
840 nmdc:mga06z11_270468_c1 3300050494 Bacteria 1005
841 nmdc:mga06z11_300775_c1 3300050494 Bacteria 954
842 nmdc:mga06z11_5767_c1 3300050494 Bacteria 4993
843 nmdc:mga06z11_71043_c1 3300050494 Bacteria 1842
844 nmdc:mga04h51_156977_c1 3300050495 Bacteria 873
845 nmdc:mga04h51_90418_c1 3300050495 Bacteria 1101
846 nmdc:mga07m45_15317_c1 3300050496 Bacteria 4094
847 nmdc:mga07m45_19971_c1 3300050496 Bacteria 3636
848 nmdc:mga07m45_3946_c1 3300050496 Bacteria 7209
849 nmdc:mga07m45_66710_c1 3300050496 Bacteria 2045
850 nmdc:mga07m45_77856_c1 3300050496 Bacteria 1892
851 nmdc:mga07m45_8519_c1 3300050496 Bacteria 5276
852 nmdc:mga09592_1255242_c1 3300050508 Bacteria 610
853 nmdc:mga08y16_114587_c1 3300050511 Bacteria 2806
854 nmdc:mga0sz30_115113_c1 3300050516 Bacteria 1180
855 nmdc:mga0sz30_355741_c1 3300050516 Bacteria 655
856 nmdc:mga0sz30_59260_c1 3300050516 Bacteria 1633
857 nmdc:mga0sz30_82516_c1 3300050516 Bacteria 1392
858 Ga0495601_0011961 3300053077 Bacteria 5202
859 Ga0495612_0079864 3300053078 Bacteria 1374
860 Ga0495619_0285994 3300053085 Bacteria 1142
861 Ga0500578_0256393 3300053086 Bacteria 1052
862 Ga0500658_0000889 3300053134 Bacteria 12243
863 Ga0500568_0002988 3300053139 Bacteria 9674
864 Ga0500622_0004274 3300053156 Bacteria 9058
865 Ga0500633_0127717 3300053160 Bacteria 948
866 2644341102 2643221660 Bacteria 4208257
867 2831869068 2831864461 Bacteria 6502356
868 2886850377 2886848708 Bacteria 5632523
869 2928118017 2928115317 Bacteria 6477646
870 Ga0207688_10031142
871 rootH1_10042584
872 rootH2_10005996
873 rootL2_10000300
874 rootH1_10006628
875 rootH1_10102547
876 Ga0055526_1000414
877 Ga0055524_1003149
878 Ga0055524_1006310
879 Ga0055530_10023684
880 Ga0055540_1008994
881 Ga0055531_10006730
882 Ga0055531_10015923
883 Ga0055543_1003646
884 Ga0065165_1000177
885 Ga0065712_10089833
886 Ga0065715_10189229
887 Ga0065707_10401843
888 Ga0070658_10655752
889 Ga0070658_10982660
890 Ga0070676_10056576
891 Ga0070676_10077465
892 Ga0070676_10097211
893 Ga0070676_10157832
894 Ga0070676_10169876
895 Ga0070676_10242391
896 Ga0070676_10396006
897 Ga0070683_100937722
898 Ga0070690_100020420
899 Ga0070690_100282481
900 Ga0070670_100001787
901 Ga0070670_100004549
902 Ga0070670_100096015
903 Ga0070670_102269641
904 Ga0070677_10019535
905 Ga0070677_10021218
906 Ga0070677_10034831
907 Ga0070677_10035303
908 Ga0070677_10057427
909 Ga0070677_10067530
910 Ga0070677_10082720
911 Ga0068869_100090154
912 Ga0068869_100254584
913 Ga0068869_100520378
914 Ga0068869_100784857
915 Ga0070666_10006757
916 Ga0070666_10125512
917 Ga0070666_10172011
918 Ga0070666_10254780
919 Ga0070666_11172574
920 Ga0070682_100770342
921 Ga0070682_101471806
922 Ga0068868_100000966
923 Ga0068868_100057566
924 Ga0068868_100900218
925 Ga0070660_101711672
926 Ga0070689_101691667
927 Ga0070687_100041173
928 Ga0070687_100545901
929 Ga0070661_100655004
930 Ga0070661_100899812
931 Ga0070661_101048422
932 Ga0070661_101052009
933 Ga0070692_10156390
934 Ga0070668_100036969
935 Ga0070668_100068511
936 Ga0070668_100173369
937 Ga0070668_101427346
938 Ga0070669_100002645
939 Ga0070669_100005844
940 Ga0070669_100545998
941 Ga0070669_100663035
942 Ga0070669_100950294
943 Ga0070675_100008036
944 Ga0070675_100023867
945 Ga0070675_100080667
946 Ga0070675_100113048
947 Ga0070675_100280683
948 Ga0070675_100401053
949 Ga0070675_100574867
950 Ga0070675_100992024
951 Ga0070671_100011057
952 Ga0070671_100033755
953 Ga0070671_100060500
954 Ga0070671_100086706
955 Ga0070671_100207302
956 Ga0070671_100208222
957 Ga0070671_101529847
958 Ga0070674_100002485
959 Ga0070674_100004974
960 Ga0070674_100102944
961 Ga0070674_100328581
962 Ga0070674_100538909
963 Ga0070674_101522411
964 Ga0070673_100050040
965 Ga0070673_100099910
966 Ga0070673_100110202
967 Ga0070673_100118826
968 Ga0070673_100216515
969 Ga0070673_100244226
970 Ga0070673_100262754
971 Ga0070688_100917710
972 Ga0070688_101061042
973 Ga0070688_101161690
974 Ga0070659_100571255
975 Ga0070667_100016643
976 Ga0070667_100021277
977 Ga0070667_100023158
978 Ga0070667_100108445
979 Ga0070667_100459072
980 Ga0070701_10425311
981 Ga0070701_11026543
982 Ga0070700_100129428
983 Ga0070700_100239757
984 Ga0070700_100373625
985 Ga0070663_100053248
986 Ga0070663_100155356
987 Ga0070663_100158128
988 Ga0070663_100276145
989 Ga0070663_100503933
990 Ga0070663_101226741
991 Ga0070678_100006239
992 Ga0070678_100013205
993 Ga0070678_100077866
994 Ga0070678_100139409
995 Ga0070678_100149221
996 Ga0070678_100315241
997 Ga0070678_100644762
998 Ga0070678_100854067
999 Ga0070678_101754248
1000 Ga0070662_100017313
1001 Ga0070662_100148518
1002 Ga0070662_100930474
1003 Ga0070662_101261260
1004 Ga0070681_10176293
1005 Ga0068867_100000081
1006 Ga0068867_100001379
1007 Ga0068867_100002071
1008 Ga0068867_100005640
1009 Ga0068867_100036861
1010 Ga0068867_100095371
1011 Ga0068867_100386107
1012 Ga0070685_11365074
1013 Ga0070707_101628618
1014 Ga0070698_100182583
1015 Ga0070679_100108254
1016 Ga0070679_100351676
1017 Ga0070684_100031515
1018 Ga0070684_100441279
1019 Ga0068853_100339802
1020 Ga0068853_100349786
1021 Ga0068853_100701222
1022 Ga0070672_100002675
1023 Ga0070672_100007718
1024 Ga0070672_100016975
1025 Ga0070672_100036721
1026 Ga0070672_100092834
1027 Ga0070672_100149059
1028 Ga0070672_100214937
1029 Ga0070672_100418586
1030 Ga0070672_101223181
1031 Ga0070672_101655886
1032 Ga0070672_101701795
1033 Ga0070686_100243514
1034 Ga0070665_100905789
1035 Ga0070665_102111455
1036 Ga0070665_102509977
1037 Ga0070664_100204112
1038 Ga0070664_100310215
1039 Ga0070664_100357144
1040 Ga0070664_100861591
1041 Ga0070664_100904666
1042 Ga0070664_101008604
1043 Ga0070664_101213416
1044 Ga0070664_101422802
1045 Ga0070664_101844679
1046 Ga0068857_100042432
1047 Ga0068857_100593438
1048 Ga0068857_101213316
1049 Ga0068854_100149364
1050 Ga0068854_100344134
1051 Ga0068854_100391608
1052 Ga0068854_101526736
1053 Ga0068856_102256930
1054 Ga0070702_100582819
1055 Ga0070702_100943430
1056 Ga0070702_101063810
1057 Ga0068852_100005075
1058 Ga0068852_100141798
1059 Ga0068852_100175965
1060 Ga0068852_100236513
1061 Ga0068852_100467849
1062 Ga0068852_100521452
1063 Ga0068852_102229897
1064 Ga0068852_102667666
1065 Ga0068859_100019167
1066 Ga0068859_100303608
1067 Ga0068859_100825868
1068 Ga0068859_101245626
1069 Ga0068859_101504309
1070 Ga0068864_100002065
1071 Ga0068864_100013594
1072 Ga0068864_100087903
1073 Ga0068864_100178614
1074 Ga0068864_100209955
1075 Ga0068864_101314593
1076 Ga0068866_10003257
1077 Ga0068866_10016475
1078 Ga0068866_10551714
1079 Ga0068866_10571549
1080 Ga0068866_10918464
1081 Ga0068861_100236372
1082 Ga0068861_100720802
1083 Ga0068861_102150506
1084 Ga0068851_10006836
1085 Ga0068851_10242932
1086 Ga0068851_10297844
1087 Ga0068870_10115492
1088 Ga0068870_11103437
1089 Ga0068870_11304424
1090 Ga0068863_100020937
1091 Ga0068863_100145324
1092 Ga0068863_100248762
1093 Ga0068863_100322531
1094 Ga0068863_100919818
1095 Ga0068863_100968943
1096 Ga0068858_100009260
1097 Ga0068858_100015823
1098 Ga0068858_100039082
1099 Ga0068858_101712586
1100 Ga0068860_100000823
1101 Ga0068860_100002377
1102 Ga0068860_102184324
1103 Ga0068860_102198881
1104 Ga0068862_100020457
1105 Ga0068862_100083098
1106 Ga0068862_100155446
1107 Ga0070717_10402880
1108 Ga0075365_10034760
1109 Ga0075368_10044982
1110 Ga0075368_10077612
1111 Ga0075368_10214063
1112 Ga0075363_100007044
1113 Ga0075363_100023200
1114 Ga0075363_100662658
1115 Ga0075364_10060988
1116 Ga0075364_10240909
1117 Ga0075432_10224244
1118 Ga0070715_10150703
1119 Ga0075362_10018715
1120 Ga0075362_10020141
1121 Ga0075362_10082986
1122 Ga0075362_10244067
1123 Ga0075367_10011834
1124 Ga0075367_10018888
1125 Ga0075367_10035526
1126 Ga0075367_10770495
1127 Ga0075369_10188331
1128 Ga0075369_10617699
1129 Ga0075366_10005480
1130 Ga0075366_10013052
1131 Ga0075366_10033393
1132 Ga0075366_10165121
1133 Ga0075366_10274205
1134 Ga0075366_10467880
1135 Ga0075366_10493981
1136 Ga0075366_10668837
1137 Ga0075366_10692020
1138 Ga0075366_10852792
1139 Ga0097621_100041619
1140 Ga0097621_100144783
1141 Ga0097621_100205376
1142 Ga0097621_100379376
1143 Ga0097621_100486992
1144 Ga0075370_10001367
1145 Ga0075370_10008912
1146 Ga0075370_10009322
1147 Ga0075370_10044073
1148 Ga0075370_10125623
1149 Ga0075370_10330160
1150 Ga0068871_100041620
1151 Ga0068871_100071350
1152 Ga0068871_100092045
1153 Ga0068871_100099750
1154 Ga0068871_100178396
1155 Ga0068871_100410478
1156 Ga0068865_100022066
1157 Ga0068865_100027661
1158 Ga0068865_100138799
1159 Ga0068865_100192432
1160 Ga0068865_100730783
1161 Ga0097620_100019167
1162 Ga0097620_100303607
1163 Ga0097620_100825852
1164 Ga0097620_101245625
1165 Ga0097620_101504314
1166 Ga0099823_1000139
1167 Ga0105240_10025383
1168 Ga0105240_10831510
1169 Ga0105240_12102309
1170 Ga0111539_10492745
1171 Ga0111539_10844621
1172 Ga0105245_10300993
1173 Ga0105245_10390721
1174 Ga0105243_10011388
1175 Ga0105243_10019382
1176 Ga0105243_10180637
1177 Ga0105243_10486408
1178 Ga0105243_10607787
1179 Ga0105243_11908092
1180 Ga0105243_12597967
1181 Ga0105241_10297786
1182 Ga0105242_10265232
1183 Ga0105242_10578597
1184 Ga0105242_11914769
1185 Ga0105248_10388190
1186 Ga0105248_10517157
1187 Ga0105248_10895710
1188 Ga0105248_10896995
1189 Ga0105248_11564606
1190 Ga0105248_12500067
1191 Ga0105248_13006353
1192 Ga0105237_10139088
1193 Ga0105237_11657179
1194 Ga0105238_10792889
1195 Ga0105238_11840629
1196 Ga0105249_10023493
1197 Ga0105249_10315700
1198 Ga0105249_10331773
1199 Ga0105249_13192281
1200 Ga0105246_10420354
1201 Ga0105246_11524683
1202 Ga0157319_1000008
1203 Ga0157327_1069140
1204 Ga0157326_1049789
1205 Ga0157338_1015236
1206 Ga0157338_1082067
1207 Ga0157373_10969136
1208 Ga0157371_10710919
1209 Ga0157369_10083325
1210 Ga0157374_10047942
1211 Ga0157374_10276787
1212 Ga0157374_10330368
1213 Ga0157374_10636760
1214 Ga0157374_11681404
1215 Ga0157378_10001703
1216 Ga0157378_10107143
1217 Ga0157378_10833545
1218 Ga0157378_10847354
1219 Ga0157378_11025087
1220 Ga0157378_11279908
1221 Ga0163162_10002252
1222 Ga0163162_10205553
1223 Ga0163162_10567478
1224 Ga0163162_10763510
1225 Ga0163162_11126408
1226 Ga0163162_11426421
1227 Ga0157375_10010275
1228 Ga0157375_10026436
1229 Ga0157375_10393941
1230 Ga0157375_10856734
1231 Ga0157375_10886198
1232 Ga0157375_11334889
1233 Ga0163163_10009458
1234 Ga0157380_10022401
1235 Ga0157380_10082572
1236 Ga0157380_10215534
1237 Ga0157380_10234391
1238 Ga0157380_10648826
1239 Ga0157380_10679288
1240 Ga0157380_11905092
1241 Ga0157380_12599806
1242 Ga0157377_10000032
1243 Ga0157377_10482165
1244 Ga0157377_10543479
1245 Ga0157379_10018511
1246 Ga0157379_10167102
1247 Ga0157379_10173362
1248 Ga0157379_10176376
1249 Ga0157379_10869691
1250 Ga0157379_12380228
1251 Ga0157376_10072799
1252 Ga0157376_10115161
1253 Ga0157376_10176155
1254 Ga0157376_10311930
1255 Ga0157376_11279008
1256 Ga0163161_10011306
1257 Ga0163161_10076960
1258 Ga0163161_10175027
1259 Ga0163161_11496459
1260 Ga0206353_11968656
1261 Ga0213872_10000007
1262 Ga0213872_10000113
1263 Ga0213872_10000169
1264 Ga0213872_10045076
1265 Ga0207666_1013498
1266 Ga0209673_1002844
1267 Ga0209673_1012105
1268 Ga0207673_1011311
1269 Ga0209564_1000008
1270 Ga0209758_1056274
1271 Ga0209050_1003036
1272 Ga0209256_1001514
1273 Ga0209256_1001861
1274 Ga0209051_1001714
1275 Ga0209257_1002401
1276 Ga0209257_1003376
1277 Ga0207697_10012918
1278 Ga0207697_10080924
1279 Ga0207697_10209233
1280 Ga0207656_10036539
1281 Ga0207656_10190847
1282 Ga0207682_10011971
1283 Ga0207682_10018556
1284 Ga0207682_10023185
1285 Ga0207682_10023230
1286 Ga0207682_10057400
1287 Ga0207682_10395949
1288 Ga0207682_10632514
1289 Ga0207642_10012685
1290 Ga0207642_10125938
1291 Ga0207642_10436508
1292 Ga0207642_10619984
1293 Ga0207642_10648214
1294 Ga0207688_10118475
1295 Ga0207688_10270158
1296 Ga0207680_10002140
1297 Ga0207680_10040216
1298 Ga0207680_10079200
1299 Ga0207685_10034723
1300 Ga0207645_10008229
1301 Ga0207645_10064973
1302 Ga0207645_10092055
1303 Ga0207645_10166892
1304 Ga0207645_10169808
1305 Ga0207643_10814551
1306 Ga0207643_11037368
1307 Ga0207705_10206379
1308 Ga0207705_10447972
1309 Ga0207705_11474304
1310 Ga0207684_10003939
1311 Ga0207654_10768313
1312 Ga0207707_10089670
1313 Ga0207707_11242312
1314 Ga0207695_10278778
1315 Ga0207695_10511468
1316 Ga0207671_10716690
1317 Ga0207662_10018329
1318 Ga0207662_10414550
1319 Ga0207657_10077079
1320 Ga0207657_10195314
1321 Ga0207649_10411979
1322 Ga0207649_10541013
1323 Ga0207649_10701694
1324 Ga0207649_10853022
1325 Ga0207652_10030048
1326 Ga0207652_10496707
1327 Ga0207646_10064185
1328 Ga0207681_10000424
1329 Ga0207681_10004628
1330 Ga0207694_11179796
1331 Ga0207650_10000149
1332 Ga0207650_10064948
1333 Ga0207650_10072993
1334 Ga0207650_10117692
1335 Ga0207650_10569624
1336 Ga0207650_10615117
1337 Ga0207650_10752449
1338 Ga0207650_11641712
1339 Ga0207659_10000394
1340 Ga0207659_10020943
1341 Ga0207659_10024900
1342 Ga0207659_10137933
1343 Ga0207659_10236538
1344 Ga0207659_10257534
1345 Ga0207659_10387274
1346 Ga0207659_11303001
1347 Ga0207687_10086829
1348 Ga0207644_10002654
1349 Ga0207644_10014945
1350 Ga0207644_10032869
1351 Ga0207644_10120885
1352 Ga0207644_10153013
1353 Ga0207644_10389588
1354 Ga0207644_11686718
1355 Ga0207690_10492518
1356 Ga0207706_10013512
1357 Ga0207706_10031863
1358 Ga0207706_10089250
1359 Ga0207706_10153810
1360 Ga0207706_10706666
1361 Ga0207686_10094012
1362 Ga0207686_10296859
1363 Ga0207709_10002313
1364 Ga0207709_10017851
1365 Ga0207709_10066755
1366 Ga0207670_10007649
1367 Ga0207669_10000874
1368 Ga0207669_10259192
1369 Ga0207669_10345841
1370 Ga0207669_10542011
1371 Ga0207669_10572292
1372 Ga0207669_10802869
1373 Ga0207669_11361640
1374 Ga0207704_10003689
1375 Ga0207704_10010623
1376 Ga0207704_10076880
1377 Ga0207704_10165230
1378 Ga0207691_10000362
1379 Ga0207691_10004404
1380 Ga0207691_10018804
1381 Ga0207691_10091796
1382 Ga0207691_10108570
1383 Ga0207691_10134149
1384 Ga0207691_10196881
1385 Ga0207691_10345213
1386 Ga0207691_10481740
1387 Ga0207711_10305643
1388 Ga0207711_10328711
1389 Ga0207689_10116843
1390 Ga0207689_10201594
1391 Ga0207679_10008471
1392 Ga0207679_10117450
1393 Ga0207679_10162987
1394 Ga0207679_10290377
1395 Ga0207667_11151442
1396 Ga0207651_10004135
1397 Ga0207651_10004672
1398 Ga0207651_10013837
1399 Ga0207651_10225908
1400 Ga0207651_10281631
1401 Ga0207651_10445494
1402 Ga0207712_10017553
1403 Ga0207712_10055218
1404 Ga0207712_11839712
1405 Ga0207668_10238457
1406 Ga0207668_10266149
1407 Ga0207668_10500838
1408 Ga0207668_10798522
1409 Ga0207668_11740898
1410 Ga0207640_10315871
1411 Ga0207640_10341027
1412 Ga0207640_11379541
1413 Ga0207658_10002509
1414 Ga0207658_10062467
1415 Ga0207658_10087577
1416 Ga0207677_10001522
1417 Ga0207677_10336598
1418 Ga0207677_10825094
1419 Ga0207703_10001816
1420 Ga0207703_10006009
1421 Ga0207703_10026459
1422 Ga0207703_11234226
1423 Ga0207703_12376183
1424 Ga0207639_11319384
1425 Ga0207639_11747235
1426 Ga0207678_10048547
1427 Ga0207678_10053039
1428 Ga0207678_10070597
1429 Ga0207678_10396564
1430 Ga0207678_10462280
1431 Ga0207678_10487681
1432 Ga0207678_11551838
1433 Ga0207708_10241223
1434 Ga0207708_10419361
1435 Ga0207708_10434475
1436 Ga0207702_10430548
1437 Ga0207641_10001603
1438 Ga0207641_10003329
1439 Ga0207641_10137677
1440 Ga0207641_10480246
1441 Ga0207641_11146783
1442 Ga0207648_10000179
1443 Ga0207648_10001296
1444 Ga0207648_10008674
1445 Ga0207648_10019115
1446 Ga0207648_10019133
1447 Ga0207648_10166974
1448 Ga0207648_10196866
1449 Ga0207648_10205111
1450 Ga0207648_10359772
1451 Ga0207648_10476807
1452 Ga0207648_11142243
1453 Ga0207676_10002741
1454 Ga0207676_10003295
1455 Ga0207676_10057781
1456 Ga0207676_10137131
1457 Ga0207676_10489734
1458 Ga0207676_10717926
1459 Ga0207674_10018099
1460 Ga0207674_10720183
1461 Ga0207675_100005391
1462 Ga0207675_100060714
1463 Ga0207675_100109200
1464 Ga0207675_101840538
1465 Ga0207683_10007622
1466 Ga0207683_10077759
1467 Ga0207683_10148626
1468 Ga0207683_10172975
1469 Ga0207683_10340467
1470 Ga0207683_10365924
1471 Ga0207683_10371751
1472 Ga0207683_10393263
1473 Ga0207683_10397274
1474 Ga0207683_11073810
1475 Ga0207683_12191684
1476 Ga0207698_10037653
1477 Ga0207698_10051692
1478 Ga0207698_10102569
1479 Ga0207698_10197954
1480 Ga0207698_11377944
1481 Ga0207698_11942351
1482 Ga0207698_12236916
1483 Ga0209389_1009996
1484 Ga0209813_10037004
1485 Ga0207428_10887327
1486 Ga0268266_10233462
1487 Ga0268265_10011328
1488 Ga0268265_10025797
1489 Ga0268265_10119897
1490 Ga0268265_10453036
1491 Ga0268264_10000613
1492 Ga0268264_10001082
1493 Ga0268264_10313684
1494 Ga0268264_10742224
1495 Ga0307517_10234325
1496 Ga0307515_10000011
1497 Ga0307515_10042972
1498 Ga0307515_10308906
1499 Ga0268256_1039369
1500 Ga0265328_10031796
1501 Ga0265331_10012133
1502 Ga0265327_10000012
1503 Ga0307513_10004316
1504 Ga0307513_10132408
1505 Ga0307513_10838018
1506 Ga0307513_11088277
1507 Ga0307509_10338413
1508 Ga0307509_10703438
1509 Ga0307408_100046772
1510 Ga0307408_100067929
1511 Ga0307408_100245180
1512 Ga0307408_100364749
1513 Ga0307408_100643190
1514 Ga0307508_10858261
1515 Ga0307514_10288637
1516 Ga0307516_10054923
1517 Ga0307405_10006962
1518 Ga0307405_10077374
1519 Ga0307405_10201709
1520 Ga0307413_10027914
1521 Ga0307413_10098905
1522 Ga0307413_10135801
1523 Ga0307413_10162646
1524 Ga0307413_10769197
1525 Ga0307413_10926665
1526 Ga0307410_10497151
1527 Ga0307406_10114919
1528 Ga0307406_10343430
1529 Ga0307406_10519260
1530 Ga0307406_10823680
1531 Ga0307406_11911303
1532 Ga0307406_12068333
1533 Ga0307407_10189680
1534 Ga0307407_10565453
1535 Ga0307412_10024007
1536 Ga0307412_10040307
1537 Ga0307412_10111670
1538 Ga0307412_10523842
1539 Ga0307412_10535341
1540 Ga0307412_10873179
1541 Ga0307412_11513614
1542 Ga0307409_100000580
1543 Ga0307409_100026581
1544 Ga0307409_101067130
1545 Ga0307409_101499088
1546 Ga0307409_101875151
1547 Ga0307416_100014097
1548 Ga0307416_100048530
1549 Ga0307416_100346539
1550 Ga0307416_100747460
1551 Ga0307416_100795052
1552 Ga0307416_102210043
1553 Ga0307416_103739532
1554 Ga0307414_10033322
1555 Ga0307414_11319694
1556 Ga0307411_10040049
1557 Ga0307411_12023186
1558 Ga0307415_100002051
1559 Ga0307415_100164374
1560 Ga0307510_10129128
1561 Ga0373923_0180129
1562 Ga0373943_0241854
1563 Ga0373946_0015671
1564 Ga0373946_0077615
1565 Ga0373955_0199906
1566 Ga0373924_0060328
1567 Ga0373924_0066829
1568 Ga0373927_0064689
1569 Ga0373933_0186583
1570 Ga0373947_0254198
1571 Ga0373947_0355056
1572 Ga0373937_0138600
1573 Ga0373937_0189006
1574 Ga0373937_0684064
1575 Ga0373925_0820296
1576 Ga0395905_0005984
1577 Ga0395905_0046642
1578 Ga0436361_0005759
1579 Ga0436361_0159126
1580 Ga0436361_0163583
1581 Ga0436361_0287659
1582 Ga0436361_0511282
1583 Ga0451847_1012534
1584 Ga0451853_0097426
1585 Ga0451853_0642104
1586 Ga0451853_3600406
1587 Ga0439437_005197
1588 Ga0439449_0113590
1589 Ga0439450_008587
1590 Ga0439454_047565
1591 Ga0439457_087577
1592 Ga0439462_0114925
1593 Ga0450890_001348
1594 Ga0439458_0012264
1595 Ga0439459_0001699
1596 Ga0439459_0053842
1597 Ga0439464_0136631
1598 Ga0439460_0015272
1599 Ga0451577_0002309
1600 Ga0451577_0004741
1601 Ga0451577_0057615
1602 Ga0451577_0186853
1603 Ga0451577_0401658
1604 Ga0453683_0134334
1605 Ga0466963_0036295
1606 Ga0453684_0152551
1607 Ga0453684_0449212
1608 Ga0453684_0472337
1609 Ga0453684_0486060
1610 Ga0453684_2160814
1611 Ga0451576_0017940
1612 Ga0451576_0269844
1613 Ga0451576_0432924
1614 Ga0451576_0505559
1615 Ga0495603_0678813
1616 Ga0495590_0005559
1617 Ga0495590_0030446
1618 Ga0495629_0147853
1619 Ga0495629_0400983
1620 Ga0495650_0164730
1621 Ga0495580_0018628
1622 Ga0495582_0346028
1623 Ga0495582_0667812
1624 Ga0495664_0769055
1625 Ga0495616_0042778
1626 Ga0495618_0361677
1627 Ga0495620_0184932
1628 Ga0495630_0532220
1629 Ga0495632_0002758
1630 Ga0495642_0040928
1631 Ga0495665_0314203
1632 Ga0495586_0687931
1633 Ga0495598_0019659
1634 Ga0495598_0056608
1635 Ga0495621_0170619
1636 Ga0495621_0334028
1637 Ga0495597_0004807
1638 Ga0495597_0090320
1639 Ga0495645_0139146
1640 Ga0495633_0119090
1641 Ga0495667_0465622
1642 Ga0495656_0085595
1643 Ga0495668_0295181
1644 Ga0495611_0212509
1645 Ga0495625_0037297
1646 Ga0495625_0435796
1647 Ga0495599_0822246
1648 Ga0495646_0222927
1649 Ga0495647_0129412
1650 Ga0495647_0340863
1651 Ga0495658_0009588
1652 Ga0495670_0045101
1653 Ga0495670_0470091
1654 Ga0495671_0610324
1655 Ga0495649_0003342
1656 Ga0495589_0130142
1657 Ga0495600_0228094
1658 Ga0495660_0014020
1659 Ga0495581_0381395
1660 Ga0495636_0593339
1661 Ga0495674_0558910
1662 Ga0495687_000961
1663 Ga0495677_0435001
1664 Ga0495673_0159432
1665 Ga0495684_0168753
1666 Ga0495684_0204812
1667 Ga0495686_0003513
1668 Ga0495614_0056011
1669 Ga0496100_0112887
1670 Ga0496101_0216873
1671 Ga0496101_0605386
1672 Ga0496104_0032470
1673 Ga0496104_1273983
1674 Ga0496105_0167701
1675 Ga0496106_0609388
1676 Ga0496106_0813138
1677 Ga0496108_0023125
1678 Ga0496108_0468684
1679 Ga0496110_1109111
1680 Ga0496114_0260955
1681 Ga0495682_0063931
1682 Ga0501034_0813782
1683 Ga0501036_0619635
1684 Ga0501043_0000057
1685 Ga0501046_0000075
1686 Ga0501047_0000081
1687 Ga0501048_0002636
1688 Ga0501072_0601076
1689 Ga0501044_0479483
1690 nmdc:mga03683_32074_c1
1691 nmdc:mga03683_331666_c1
1692 nmdc:mga03683_5307_c1
1693 nmdc:mga03n38_31311_c1
1694 nmdc:mga03n38_539560_c1
1695 nmdc:mga00v17_17305_c1
1696 nmdc:mga00v17_51935_c1
1697 nmdc:mga0yw44_26539_c1
1698 nmdc:mga0k408_124397_c1
1699 nmdc:mga0k408_124630_c1
1700 nmdc:mga0k408_12508_c2
1701 nmdc:mga0k408_161_c1
1702 nmdc:mga0k408_33581_c1
1703 nmdc:mga0k408_370100_c1
1704 nmdc:mga0k408_4516_c2
1705 nmdc:mga0k408_471693_c1
1706 nmdc:mga0k408_59045_c1
1707 nmdc:mga0k408_7247_c1
1708 nmdc:mga06z11_217694_c1
1709 nmdc:mga06z11_270468_c1
1710 nmdc:mga06z11_300775_c1
1711 nmdc:mga06z11_5767_c1
1712 nmdc:mga06z11_71043_c1
1713 nmdc:mga04h51_156977_c1
1714 nmdc:mga04h51_90418_c1
1715 nmdc:mga07m45_15317_c1
1716 nmdc:mga07m45_19971_c1
1717 nmdc:mga07m45_3946_c1
1718 nmdc:mga07m45_66710_c1
1719 nmdc:mga07m45_77856_c1
1720 nmdc:mga07m45_8519_c1
1721 nmdc:mga09592_1255242_c1
1722 nmdc:mga08y16_114587_c1
1723 nmdc:mga0sz30_115113_c1
1724 nmdc:mga0sz30_355741_c1
1725 nmdc:mga0sz30_59260_c1
1726 nmdc:mga0sz30_82516_c1
1727 Ga0495601_0011961
1728 Ga0495612_0079864
1729 Ga0495619_0285994
1730 Ga0500578_0256393
1731 Ga0500658_0000889
1732 Ga0500568_0002988
1733 Ga0500622_0004274
1734 Ga0500633_0127717
1735 2644341102
1736 2831869068
1737 2886850377
1738 2928118017

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

23

129

0.97

PF01230

HIT

HIT domain

31

127

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uvm-assembly1.cif.gz_A hit family hydrolase from clostridium thermocellum cth-393 0.9538 7 114
4egu-assembly1.cif.gz_B 0.95a resolution structure of a histidine triad protein from clostridium difficile 0.9535 5 113
3omf-assembly1.cif.gz_A crystal structure of a histidine triad family protein from entamoeba histolytica, bound to amp 0.9412 9 113
3n1t-assembly2.cif.gz_E crystal structure of the h101a mutant echint gmp complex 0.9345 11 114
3n1s-assembly2.cif.gz_F crystal structure of wild type echint gmp complex 0.9312 7 114
ID Description Score Start End Superfamily
5uvmA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9624 7 113 3.30.428.10
4eguB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9535 5 113 3.30.428.10
3oxkA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9398 9 113 3.30.428.10
1kpcB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9267 9 118 3.30.428.10
af_Q8K3P7_29_147_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9201 6 109 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A1W9GZF2-F1-model_v4 Histidine triad nucleotide-binding protein 0.9935 7 113 GO:0003824
AF-A0A1I7EZ11-F1-model_v4 Histidine triad (HIT) family protein 0.9917 7 113 GO:0003824
AF-A0A536SZ33-F1-model_v4 Histidine triad nucleotide-binding protein 0.9908 7 113 GO:0003824
AF-A0A356HRU5-F1-model_v4 deleted 0.9866 5 113
AF-A0A1H6FFC4-F1-model_v4 HIT-like protein (EC 3.-.-.-) 0.9855 7 113 GO:0016787

Map