F484126

General Info

Members Datasets Scaffolds Average Seq Length
869 423 1738 174

Family's Representative Sequence

Representative Sequence 3300046558|Ga0495633_0010539|Ga0495633_0010539_2889_3473
Length 194
Sequence MSMTSYKRLFCESLTKAAHIPVRGLFSCLALVLLLAGCARGVSSAPGDAPNLERWVAEVRARPAPALEPLPVMQQFETFEYAAQGMRDPFADAWVNPDAGNGLRPDPNRRKEPLEAFPLDSLNMVGTIGTGPAQVALVMAPDKVTYRVRSGIYMGQSDGRVTGVSDGHIELIELVPDGAGGWLERPASIALDDQ

Samples

Sample ID Description Type Environment
1 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
83 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
84 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
85 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
99 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
107 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
108 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
109 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
110 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
112 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
113 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
178 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
179 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
180 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
181 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
182 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
202 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
203 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
204 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
205 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
206 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
207 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
208 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
209 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
210 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
211 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
212 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
213 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
214 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
215 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
216 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
217 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
218 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
219 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
220 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
221 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
222 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
223 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
224 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
225 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
226 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
227 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
228 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
229 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
230 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
231 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
232 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
233 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
234 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
235 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
236 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
237 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
238 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
239 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
240 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
241 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
242 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
243 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
244 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
245 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
246 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
247 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
248 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
249 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
250 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
251 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
252 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
253 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
254 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
255 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
256 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
257 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
258 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
261 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
262 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
263 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
264 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
265 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
266 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
267 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
268 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
269 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
270 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
271 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
272 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
273 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
274 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
275 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
276 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
277 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
285 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
286 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
287 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
288 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
292 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
293 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
294 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
295 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
296 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
297 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
298 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
299 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
300 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
301 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
302 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
303 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
304 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
305 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
319 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
320 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
321 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
322 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
323 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
324 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
325 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
326 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
327 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
328 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
329 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
330 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
331 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
332 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
333 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
334 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
335 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
338 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
339 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
340 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
341 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
342 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
343 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
344 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
345 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
346 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
347 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
348 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
349 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
350 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
351 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
352 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
353 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
354 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
355 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
356 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
357 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
358 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
359 2643221559 Lysobacter sp. Root559 Isolate Unclassified
360 2643221573 Lysobacter sp. Root604 Isolate Unclassified
361 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
362 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
363 2643221586 Lysobacter sp. Root667 Isolate Unclassified
364 2643221593 Lysobacter sp. Root690 Isolate Unclassified
365 2643221612 Lysobacter sp. Root76 Isolate Unclassified
366 2643221695 Lysobacter sp. Root494 Isolate Unclassified
367 2643221720 Lysobacter sp. Root916 Isolate Unclassified
368 2643221727 Lysobacter sp. Root96 Isolate Unclassified
369 2643221728 Lysobacter sp. Root983 Isolate Unclassified
370 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
371 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
372 2734482264 Dyella sp. AD052 Isolate Unclassified
373 2738543009 Luteibacter sp. OK325 Isolate Unclassified
374 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
375 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
376 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
377 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
378 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
379 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
380 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
381 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
382 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
383 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
384 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
385 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
386 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
387 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
388 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
389 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
390 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
391 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
392 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
393 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
394 2919085039 Luteibacter sp. 1214 Isolate Unclassified
395 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
396 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
397 2919404418 Luteibacter sp. 3190 Isolate Unclassified
398 2919513703 Luteimonas sp. 3794 Isolate Unclassified
399 2919675420 Luteimonas terrae 4099 Isolate Unclassified
400 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
401 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
402 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
403 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
404 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
405 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
406 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
407 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
408 2941471342 Luteibacter sp. 621 Isolate Unclassified
409 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
410 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
411 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
412 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
413 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
414 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
415 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
416 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
417 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
418 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
419 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
420 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
421 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
422 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
423 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.91
Metatranscriptomes 0.81
Isolates 8.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 13.81
Nodule 0.12
Rhizoplane 4.95
Rhizosphere 62.49
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495633_0010539 3300046558 Bacteria 5039
2 SwRhRL2b_contig_3797405 2162886007 Bacteria 1475
3 JGI24736J21556_1001617 3300001904 Bacteria 4089
4 JGI24740J21852_10040405 3300001979 Bacteria 1414
5 JGI24738J21930_10001153 3300002075 Bacteria 7468
6 JGI25156J39149_1007841 3300002705 Bacteria 2755
7 JGI25157J39369_1001663 3300002741 Bacteria 7572
8 JGI25152J39213_1000069 3300002773 Bacteria 67815
9 JGI25150J39212_1000214 3300002774 Bacteria 31523
10 JGI25150J39212_1000407 3300002774 Bacteria 19982
11 JGI25150J39212_1027756 3300002774 Bacteria 807
12 JGI25151J46595_10000105 3300003187 Bacteria 113763
13 JGI25151J46595_10000116 3300003187 Bacteria 107172
14 JGI25153J46596_10000077 3300003215 Bacteria 113763
15 rootH2_10004458 3300003320 Bacteria 5849
16 rootH2_10044786 3300003320 Bacteria 1918
17 rootL2_10073749 3300003322 Bacteria 1619
18 rootH1_10107485 3300003323 Bacteria 1101
19 rootH1_10232895 3300003323 Bacteria 1448
20 Ga0006558J51389_1028497 3300003558 Bacteria 1276
21 Ga0006554J51385_1022338 3300003567 Bacteria 3527
22 Ga0006562J51391_1012709 3300003578 Bacteria 7210
23 Ga0006562J51391_1012711 3300003578 Bacteria 2130
24 Ga0055542_1012758 3300003762 Bacteria 1442
25 Ga0055529_1005753 3300003763 Bacteria 1768
26 Ga0055526_1003098 3300003771 Bacteria 10789
27 Ga0055537_1000088 3300003773 Bacteria 66713
28 Ga0055537_1000812 3300003773 Bacteria 15462
29 Ga0055524_1000074 3300003775 Bacteria 122843
30 Ga0055524_1016948 3300003775 Bacteria 2588
31 Ga0055524_1061261 3300003775 Bacteria 778
32 Ga0055536_1001746 3300003781 Bacteria 12830
33 Ga0055536_1006277 3300003781 Bacteria 5598
34 Ga0055534_1000097 3300003784 Bacteria 67619
35 Ga0055534_1000154 3300003784 Bacteria 51139
36 Ga0055534_1011218 3300003784 Bacteria 1833
37 Ga0055528_1000028 3300003790 Bacteria 122843
38 Ga0055528_1001412 3300003790 Bacteria 14714
39 Ga0055528_1002336 3300003790 Bacteria 10259
40 Ga0055530_10001477 3300003791 Bacteria 17070
41 Ga0055531_10002804 3300003794 Bacteria 11428
42 Ga0055531_10013393 3300003794 Bacteria 3780
43 Ga0055531_10017692 3300003794 Bacteria 2992
44 Ga0055531_10030559 3300003794 Bacteria 1805
45 Ga0058692_1000013 3300003856 Bacteria 316299
46 Ga0058692_1000035 3300003856 Bacteria 152983
47 Ga0065165_1000913 3300005262 Bacteria 38106
48 Ga0065704_10098945 3300005289 Bacteria 2332
49 Ga0065704_10281216 3300005289 Bacteria 921
50 Ga0065715_10170654 3300005293 Bacteria 1549
51 Ga0070658_10709156 3300005327 Bacteria 873
52 Ga0070670_100022831 3300005331 Bacteria 5384
53 Ga0070670_100046378 3300005331 Bacteria 3736
54 Ga0070670_100073464 3300005331 Bacteria 2937
55 Ga0070680_100389732 3300005336 Bacteria 1187
56 Ga0070682_100008369 3300005337 Bacteria 5835
57 Ga0070682_100105533 3300005337 Bacteria 1868
58 Ga0070660_100089225 3300005339 Bacteria 2429
59 Ga0070661_100214433 3300005344 Bacteria 1475
60 Ga0070661_100330707 3300005344 Bacteria 1192
61 Ga0070661_100491765 3300005344 Bacteria 981
62 Ga0070668_100070732 3300005347 Bacteria 2717
63 Ga0070668_100203858 3300005347 Bacteria 1624
64 Ga0070668_101260099 3300005347 Bacteria 671
65 Ga0070669_100054658 3300005353 Bacteria 2925
66 Ga0070669_101051101 3300005353 Bacteria 700
67 Ga0070675_100494163 3300005354 Bacteria 1102
68 Ga0070671_100010249 3300005355 Bacteria 7523
69 Ga0070671_101041160 3300005355 Bacteria 718
70 Ga0070674_100053729 3300005356 Bacteria 2783
71 Ga0070673_100426619 3300005364 Bacteria 1189
72 Ga0070673_101124699 3300005364 Bacteria 734
73 Ga0070659_100144222 3300005366 Bacteria 1940
74 Ga0070667_100000085 3300005367 Bacteria 117695
75 Ga0070714_100752166 3300005435 Bacteria 942
76 Ga0070700_100575143 3300005441 Bacteria 879
77 Ga0070663_100000045 3300005455 Bacteria 56569
78 Ga0070663_100081842 3300005455 Bacteria 2374
79 Ga0070663_100194098 3300005455 Bacteria 1582
80 Ga0070678_100011851 3300005456 Bacteria 5394
81 Ga0070678_100094369 3300005456 Bacteria 2303
82 Ga0070681_10336561 3300005458 Bacteria 1419
83 Ga0070681_10350114 3300005458 Bacteria 1387
84 Ga0068867_100047934 3300005459 Bacteria 3142
85 Ga0070679_100058369 3300005530 Bacteria 3845
86 Ga0068853_100003376 3300005539 Bacteria 12224
87 Ga0068853_100170552 3300005539 Bacteria 1968
88 Ga0070672_100057956 3300005543 Bacteria 3042
89 Ga0070696_100004017 3300005546 Bacteria 9808
90 Ga0070693_100017003 3300005547 Bacteria 3775
91 Ga0070665_100071908 3300005548 Bacteria 3466
92 Ga0070665_100166741 3300005548 Bacteria 2205
93 Ga0070665_100924316 3300005548 Bacteria 885
94 Ga0068855_100013007 3300005563 Bacteria 10042
95 Ga0068855_101271375 3300005563 Bacteria 763
96 Ga0070664_100084386 3300005564 Bacteria 2742
97 Ga0070664_101231545 3300005564 Bacteria 706
98 Ga0068854_100176852 3300005578 Bacteria 1664
99 Ga0068856_100000524 3300005614 Bacteria 42396
100 Ga0068851_10354686 3300005834 Bacteria 854
101 Ga0068851_10625703 3300005834 Bacteria 657
102 Ga0068863_100123053 3300005841 Bacteria 2475
103 Ga0068858_101627569 3300005842 Unclassified 637
104 Ga0081539_10019407 3300005985 Bacteria 4655
105 Ga0075365_10193304 3300006038 Bacteria 1424
106 Ga0075364_10000775 3300006051 Bacteria 16800
107 Ga0075364_10010917 3300006051 Bacteria 5504
108 Ga0075364_10037648 3300006051 Bacteria 3133
109 Ga0075364_10577264 3300006051 Bacteria 768
110 Ga0075369_10181360 3300006186 Bacteria 969
111 Ga0075369_10296146 3300006186 Bacteria 755
112 Ga0075370_10085036 3300006353 Bacteria 1821
113 Ga0097620_100383554 3300006931 Bacteria 1501
114 Ga0105251_10019456 3300009011 Bacteria 3586
115 Ga0105244_10023892 3300009036 Bacteria 3343
116 Ga0105244_10038830 3300009036 Bacteria 2481
117 Ga0105244_10104717 3300009036 Bacteria 1381
118 Ga0105240_10023122 3300009093 Bacteria 8229
119 Ga0105240_10128175 3300009093 Bacteria 3046
120 Ga0105240_10130625 3300009093 Bacteria 3013
121 Ga0105247_10002807 3300009101 Bacteria 11651
122 Ga0105247_10640208 3300009101 Bacteria 793
123 Ga0105243_10122895 3300009148 Bacteria 2192
124 Ga0105243_10207021 3300009148 Bacteria 1724
125 Ga0105241_10252420 3300009174 Bacteria 1496
126 Ga0105248_10000980 3300009177 Bacteria 31690
127 Ga0105237_10000036 3300009545 Bacteria 191142
128 Ga0105237_10006112 3300009545 Bacteria 13457
129 Ga0105237_10546847 3300009545 Bacteria 1164
130 Ga0105249_10000335 3300009553 Bacteria 47511
131 Ga0105028_107380 3300009993 Bacteria 1149
132 Ga0105239_10000027 3300010375 Bacteria 248028
133 Ga0105239_10202899 3300010375 Bacteria 2222
134 Ga0105239_10416482 3300010375 Bacteria 1521
135 Ga0105239_10992781 3300010375 Bacteria 965
136 Ga0157318_1002656 3300012482 Bacteria 990
137 Ga0157329_1001393 3300012491 Bacteria 1221
138 Ga0157313_1002762 3300012503 Bacteria 1080
139 Ga0157327_1000513 3300012512 Bacteria 2101
140 Ga0157373_10073514 3300013100 Bacteria 2412
141 Ga0157373_10152758 3300013100 Bacteria 1624
142 Ga0157373_10377225 3300013100 Bacteria 1014
143 Ga0157371_10000184 3300013102 Bacteria 92100
144 Ga0157371_10079356 3300013102 Bacteria 2325
145 Ga0157371_10120730 3300013102 Bacteria 1863
146 Ga0157371_10190080 3300013102 Bacteria 1470
147 Ga0157371_10678202 3300013102 Bacteria 770
148 Ga0157370_10000045 3300013104 Bacteria 127627
149 Ga0157370_10001564 3300013104 Bacteria 28327
150 Ga0157370_10015409 3300013104 Bacteria 7770
151 Ga0157370_10019467 3300013104 Bacteria 6808
152 Ga0157370_10096821 3300013104 Bacteria 2768
153 Ga0157370_10270060 3300013104 Bacteria 1571
154 Ga0157370_10366785 3300013104 Bacteria 1327
155 Ga0157370_10435598 3300013104 Bacteria 1206
156 Ga0157369_10000745 3300013105 Bacteria 41913
157 Ga0157369_10011268 3300013105 Bacteria 10158
158 Ga0157369_10048745 3300013105 Bacteria 4595
159 Ga0163162_10325108 3300013306 Bacteria 1670
160 Ga0163162_10398573 3300013306 Bacteria 1509
161 Ga0157372_10021401 3300013307 Bacteria 6986
162 Ga0157372_10162705 3300013307 Bacteria 2580
163 Ga0157372_10787582 3300013307 Bacteria 1105
164 Ga0157375_10140509 3300013308 Bacteria 2542
165 Ga0157375_10169912 3300013308 Bacteria 2327
166 Ga0157380_10098081 3300014326 Bacteria 2434
167 Ga0157380_10371759 3300014326 Bacteria 1346
168 Ga0157380_10530188 3300014326 Bacteria 1150
169 Ga0182008_10004060 3300014497 Bacteria 8640
170 Ga0182008_10023563 3300014497 Bacteria 3142
171 Ga0182008_10037026 3300014497 Bacteria 2441
172 Ga0182008_10311799 3300014497 Bacteria 826
173 Ga0157379_10935563 3300014968 Bacteria 824
174 Ga0182006_1000479 3300015261 Bacteria 31307
175 Ga0182006_1003624 3300015261 Bacteria 7845
176 Ga0182006_1022419 3300015261 Bacteria 2625
177 Ga0182007_10000219 3300015262 Bacteria 38463
178 Ga0182007_10033459 3300015262 Bacteria 1742
179 Ga0182005_1000113 3300015265 Bacteria 58004
180 Ga0182005_1000213 3300015265 Bacteria 38351
181 Ga0182005_1001646 3300015265 Bacteria 8686
182 Ga0182005_1001924 3300015265 Bacteria 7868
183 Ga0182005_1006350 3300015265 Bacteria 3624
184 Ga0183360_10001 3300015689 Bacteria 3943671
185 Ga0163161_10007925 3300017792 Bacteria 7353
186 Ga0163161_10020842 3300017792 Bacteria 4603
187 Ga0163161_10050833 3300017792 Bacteria 3001
188 Ga0163161_10118324 3300017792 Bacteria 1988
189 Ga0163161_10480889 3300017792 Bacteria 1008
190 Ga0206356_10491941 3300020070 Bacteria 2892
191 Ga0206353_10172233 3300020082 Bacteria 1369
192 Ga0224712_10118197 3300022467 Bacteria 1145
193 Ga0209674_100791 3300025226 Bacteria 10635
194 Ga0209147_102946 3300025229 Bacteria 3688
195 Ga0209437_102834 3300025233 Bacteria 3253
196 Ga0207425_1000045 3300025245 Bacteria 194257
197 Ga0207425_1004713 3300025245 Bacteria 4025
198 Ga0209646_1002196 3300025246 Bacteria 4508
199 Ga0209026_1000223 3300025250 Bacteria 77328
200 Ga0209148_1000762 3300025254 Bacteria 24561
201 Ga0209759_1014486 3300025256 Bacteria 2083
202 Ga0209129_1000057 3300025258 Bacteria 253632
203 Ga0209129_1001090 3300025258 Bacteria 15870
204 Ga0209565_1000023 3300025263 Bacteria 388244
205 Ga0209565_1000034 3300025263 Bacteria 312950
206 Ga0209565_1019738 3300025263 Bacteria 1433
207 Ga0209455_1000430 3300025272 Bacteria 32798
208 Ga0209673_1000039 3300025273 Bacteria 312950
209 Ga0209673_1000047 3300025273 Bacteria 289276
210 Ga0209673_1029483 3300025273 Bacteria 1746
211 Ga0209130_1002629 3300025284 Bacteria 8633
212 Ga0209130_1024994 3300025284 Bacteria 1298
213 Ga0209675_1000016 3300025291 Bacteria 391965
214 Ga0209675_1000023 3300025291 Bacteria 312950
215 Ga0209675_1008269 3300025291 Bacteria 3851
216 Ga0209675_1046930 3300025291 Bacteria 910
217 Ga0209676_1000027 3300025292 Bacteria 560222
218 Ga0209676_1000037 3300025292 Bacteria 457562
219 Ga0209676_1000160 3300025292 Bacteria 161069
220 Ga0209676_1000280 3300025292 Bacteria 105988
221 Ga0209676_1002509 3300025292 Bacteria 12849
222 Ga0209676_1003026 3300025292 Bacteria 10906
223 Ga0209025_1000013 3300025294 Bacteria 871757
224 Ga0209025_1000023 3300025294 Bacteria 541307
225 Ga0209025_1002654 3300025294 Bacteria 18290
226 Ga0209025_1028791 3300025294 Bacteria 2709
227 Ga0209025_1030183 3300025294 Bacteria 2601
228 Ga0209564_1000066 3300025295 Bacteria 312899
229 Ga0209564_1000194 3300025295 Bacteria 141518
230 Ga0209564_1004607 3300025295 Bacteria 8314
231 Ga0209758_1000014 3300025297 Bacteria 871757
232 Ga0209758_1008048 3300025297 Bacteria 6957
233 Ga0209050_1000352 3300025298 Bacteria 88558
234 Ga0209050_1000714 3300025298 Bacteria 48752
235 Ga0209050_1000833 3300025298 Bacteria 42666
236 Ga0209050_1010110 3300025298 Bacteria 4698
237 Ga0209050_1026372 3300025298 Bacteria 1946
238 Ga0209256_1000048 3300025299 Bacteria 312899
239 Ga0209256_1003154 3300025299 Bacteria 11970
240 Ga0209256_1003863 3300025299 Bacteria 9967
241 Ga0209256_1005406 3300025299 Bacteria 7382
242 Ga0209256_1020798 3300025299 Bacteria 2036
243 Ga0209256_1020801 3300025299 Bacteria 2036
244 Ga0207426_1017565 3300025302 Bacteria 2540
245 Ga0209051_1001947 3300025303 Bacteria 15883
246 Ga0209051_1002836 3300025303 Bacteria 11944
247 Ga0209051_1006389 3300025303 Bacteria 6657
248 Ga0209257_1000046 3300025304 Bacteria 477765
249 Ga0209257_1000177 3300025304 Bacteria 161069
250 Ga0209257_1000198 3300025304 Bacteria 149013
251 Ga0209257_1000219 3300025304 Bacteria 135666
252 Ga0209257_1000383 3300025304 Bacteria 88315
253 Ga0209257_1003088 3300025304 Bacteria 14974
254 Ga0209257_1003813 3300025304 Bacteria 12380
255 Ga0209257_1007629 3300025304 Bacteria 6484
256 Ga0209257_1026691 3300025304 Bacteria 1939
257 Ga0209257_1034119 3300025304 Bacteria 1592
258 Ga0209257_1066742 3300025304 Bacteria 961
259 Ga0207655_1033595 3300025728 Bacteria 2321
260 Ga0207713_1066409 3300025735 Bacteria 1350
261 Ga0207682_10014641 3300025893 Bacteria 3057
262 Ga0207710_10005864 3300025900 Bacteria 5268
263 Ga0207647_10000015 3300025904 Bacteria 138626
264 Ga0207647_10076216 3300025904 Bacteria 2017
265 Ga0207705_10108347 3300025909 Bacteria 2050
266 Ga0207654_10128999 3300025911 Bacteria 1598
267 Ga0207707_10026404 3300025912 Bacteria 5076
268 Ga0207707_10369250 3300025912 Bacteria 1235
269 Ga0207695_10000441 3300025913 Bacteria 90937
270 Ga0207695_10003481 3300025913 Bacteria 22147
271 Ga0207671_10000135 3300025914 Bacteria 112401
272 Ga0207671_10003134 3300025914 Bacteria 16798
273 Ga0207657_10003190 3300025919 Bacteria 17543
274 Ga0207657_10351503 3300025919 Bacteria 1162
275 Ga0207649_10152857 3300025920 Bacteria 1591
276 Ga0207652_10131701 3300025921 Bacteria 2230
277 Ga0207652_10494603 3300025921 Bacteria 1101
278 Ga0207681_10041006 3300025923 Bacteria 3084
279 Ga0207681_10690832 3300025923 Bacteria 848
280 Ga0207694_10025255 3300025924 Bacteria 4515
281 Ga0207694_10159608 3300025924 Bacteria 1820
282 Ga0207650_10047972 3300025925 Bacteria 3149
283 Ga0207650_10048024 3300025925 Bacteria 3146
284 Ga0207650_10051036 3300025925 Bacteria 3060
285 Ga0207644_10060876 3300025931 Bacteria 2732
286 Ga0207644_10113072 3300025931 Bacteria 2056
287 Ga0207690_10250292 3300025932 Bacteria 1368
288 Ga0207706_10589886 3300025933 Bacteria 955
289 Ga0207709_10002407 3300025935 Bacteria 11766
290 Ga0207709_10020776 3300025935 Bacteria 3708
291 Ga0207669_10045553 3300025937 Bacteria 2585
292 Ga0207691_10019809 3300025940 Bacteria 6364
293 Ga0207711_10004824 3300025941 Bacteria 11459
294 Ga0207679_10124890 3300025945 Bacteria 2055
295 Ga0207667_10075026 3300025949 Bacteria 3512
296 Ga0207667_10263378 3300025949 Bacteria 1763
297 Ga0207667_11129593 3300025949 Bacteria 766
298 Ga0207651_10216836 3300025960 Bacteria 1544
299 Ga0207712_10001764 3300025961 Bacteria 14433
300 Ga0207668_10023924 3300025972 Bacteria 3935
301 Ga0207640_10003213 3300025981 Bacteria 8805
302 Ga0207658_10000032 3300025986 Bacteria 162260
303 Ga0207658_10244527 3300025986 Bacteria 1522
304 Ga0207677_10307158 3300026023 Bacteria 1313
305 Ga0207639_10031649 3300026041 Bacteria 3889
306 Ga0207639_10131720 3300026041 Bacteria 2071
307 Ga0207678_10000457 3300026067 Bacteria 37030
308 Ga0207678_10000643 3300026067 Bacteria 32112
309 Ga0207678_10147929 3300026067 Bacteria 2005
310 Ga0207702_10003652 3300026078 Bacteria 13940
311 Ga0207641_10243464 3300026088 Bacteria 1677
312 Ga0207648_10208557 3300026089 Bacteria 1734
313 Ga0207676_10065408 3300026095 Bacteria 2895
314 Ga0207683_10020246 3300026121 Bacteria 5688
315 Ga0207683_10022073 3300026121 Bacteria 5462
316 Ga0209371_1000007 3300027312 Bacteria 1050654
317 Ga0209371_1000043 3300027312 Bacteria 331009
318 Ga0209981_1027589 3300027378 Bacteria 827
319 Ga0209981_1030747 3300027378 Bacteria 787
320 Ga0209984_1003224 3300027424 Bacteria 1857
321 Ga0210000_1003909 3300027462 Bacteria 2157
322 Ga0209995_1000902 3300027471 Bacteria 4606
323 Ga0209999_1000249 3300027543 Bacteria 7797
324 Ga0209982_1002809 3300027552 Bacteria 2452
325 Ga0209970_1002517 3300027614 Bacteria 3108
326 Ga0209983_1006804 3300027665 Bacteria 2346
327 Ga0209971_1000743 3300027682 Bacteria 8388
328 Ga0209974_10034122 3300027876 Bacteria 1690
329 Ga0268266_10124490 3300028379 Bacteria 2298
330 Ga0268266_10187018 3300028379 Bacteria 1889
331 Ga0268266_10358741 3300028379 Bacteria 1371
332 Ga0268266_10727213 3300028379 Bacteria 957
333 Ga0268256_1000008 3300030500 Bacteria 1050654
334 Ga0268256_1000044 3300030500 Bacteria 330997
335 Ga0316176_1036603 3300030732 Bacteria 2284
336 Ga0316176_1043775 3300030732 Bacteria 994
337 Ga0314311_1072890 3300030733 Bacteria 2202
338 Ga0316183_1159014 3300030742 Bacteria 2300
339 Ga0316181_1256419 3300030744 Bacteria 1529
340 Ga0316182_1115502 3300030745 Bacteria 4516
341 Ga0307513_10037233 3300031456 Bacteria 5417
342 Ga0307513_10267221 3300031456 Bacteria 1496
343 Ga0307408_100022323 3300031548 Bacteria 4299
344 Ga0307408_100216471 3300031548 Bacteria 1560
345 Ga0307408_101240522 3300031548 Bacteria 697
346 Ga0307405_10022245 3300031731 Bacteria 3581
347 Ga0307405_10070178 3300031731 Bacteria 2249
348 Ga0307413_10001208 3300031824 Bacteria 9557
349 Ga0307413_10020613 3300031824 Bacteria 3511
350 Ga0307413_10041782 3300031824 Bacteria 2688
351 Ga0307413_10044622 3300031824 Bacteria 2621
352 Ga0307413_10050947 3300031824 Bacteria 2491
353 Ga0307413_10073588 3300031824 Bacteria 2160
354 Ga0307413_10388326 3300031824 Bacteria 1090
355 Ga0307413_10475602 3300031824 Bacteria 997
356 Ga0307413_10773997 3300031824 Bacteria 804
357 Ga0307413_10870234 3300031824 Bacteria 763
358 Ga0307413_11370484 3300031824 Bacteria 621
359 Ga0307410_10014783 3300031852 Bacteria 4607
360 Ga0307410_10123834 3300031852 Bacteria 1889
361 Ga0307410_10149155 3300031852 Bacteria 1739
362 Ga0307410_10300824 3300031852 Bacteria 1266
363 Ga0307410_10368852 3300031852 Bacteria 1152
364 Ga0307406_10000978 3300031901 Bacteria 15942
365 Ga0307406_10013019 3300031901 Bacteria 4756
366 Ga0307406_10312628 3300031901 Bacteria 1212
367 Ga0307406_10699296 3300031901 Bacteria 846
368 Ga0307407_10076809 3300031903 Bacteria 2006
369 Ga0307407_10127462 3300031903 Bacteria 1623
370 Ga0307407_10228856 3300031903 Bacteria 1261
371 Ga0307412_10000418 3300031911 Bacteria 25962
372 Ga0307412_10001816 3300031911 Bacteria 11811
373 Ga0307412_10031352 3300031911 Bacteria 3357
374 Ga0307412_10045343 3300031911 Bacteria 2873
375 Ga0307412_10075722 3300031911 Bacteria 2309
376 Ga0307412_10091960 3300031911 Bacteria 2125
377 Ga0307412_10192504 3300031911 Bacteria 1543
378 Ga0307412_10335285 3300031911 Bacteria 1208
379 Ga0307409_100031440 3300031995 Bacteria 3831
380 Ga0307409_100046744 3300031995 Bacteria 3279
381 Ga0307409_100996607 3300031995 Bacteria 856
382 Ga0307416_100014059 3300032002 Bacteria 5466
383 Ga0307416_100039180 3300032002 Bacteria 3666
384 Ga0307416_101238140 3300032002 Bacteria 852
385 Ga0307414_10001338 3300032004 Bacteria 12742
386 Ga0307414_10003104 3300032004 Bacteria 8824
387 Ga0307414_10021898 3300032004 Bacteria 4023
388 Ga0307414_10036736 3300032004 Bacteria 3273
389 Ga0307414_10055143 3300032004 Bacteria 2781
390 Ga0307414_10062348 3300032004 Bacteria 2645
391 Ga0307414_10079320 3300032004 Bacteria 2396
392 Ga0307414_10116249 3300032004 Bacteria 2047
393 Ga0307414_10155622 3300032004 Bacteria 1809
394 Ga0307414_10260251 3300032004 Bacteria 1447
395 Ga0307414_10344181 3300032004 Bacteria 1277
396 Ga0307414_10641852 3300032004 Bacteria 956
397 Ga0307414_10676518 3300032004 Bacteria 932
398 Ga0307411_10002861 3300032005 Bacteria 7797
399 Ga0307411_10054444 3300032005 Bacteria 2627
400 Ga0307411_10056552 3300032005 Bacteria 2586
401 Ga0307411_10105527 3300032005 Bacteria 2003
402 Ga0307411_10165982 3300032005 Bacteria 1660
403 Ga0307411_10183876 3300032005 Bacteria 1589
404 Ga0307411_10203128 3300032005 Bacteria 1524
405 Ga0307411_10237077 3300032005 Bacteria 1426
406 Ga0307411_10506159 3300032005 Bacteria 1022
407 Ga0307411_10558553 3300032005 Bacteria 978
408 Ga0307411_10562721 3300032005 Bacteria 974
409 Ga0373928_0179764 3300035084 Bacteria 601
410 Ga0395899_0017129 3300037312 Bacteria 5522
411 Ga0395900_0042677 3300037418 Bacteria 4673
412 Ga0395898_0176943 3300037466 Bacteria 2039
413 Ga0395905_0000337 3300037471 Bacteria 67116
414 Ga0395905_0006093 3300037471 Bacteria 12181
415 Ga0395905_0019088 3300037471 Bacteria 6503
416 Ga0395905_0376645 3300037471 Bacteria 1313
417 Ga0395905_0565449 3300037471 Bacteria 1038
418 Ga0395901_0088389 3300038443 Bacteria 3241
419 Ga0395901_0578455 3300038443 Bacteria 1135
420 Ga0237819_00177 3300038705 Bacteria 23554
421 Ga0237819_02977 3300038705 Bacteria 3158
422 Ga0237816_03081 3300039145 Bacteria 1236
423 Ga0439436_0000007 3300041404 Bacteria 120812
424 Ga0439436_0034362 3300041404 Bacteria 1466
425 Ga0439439_0018180 3300041406 Bacteria 1735
426 Ga0439447_000808 3300041407 Bacteria 11507
427 Ga0439465_0000214 3300041413 Bacteria 15475
428 Ga0439465_0000377 3300041413 Bacteria 12805
429 Ga0439465_0000615 3300041413 Bacteria 10825
430 Ga0439465_0003455 3300041413 Bacteria 5153
431 Ga0439465_0017038 3300041413 Bacteria 2267
432 Ga0451787_725098 3300041441 Bacteria 935
433 Ga0451789_0245027 3300041443 Bacteria 704
434 Ga0451789_1055925 3300041443 Bacteria 932
435 Ga0451791_0725227 3300041451 Bacteria 669
436 Ga0451791_0976915 3300041451 Bacteria 1541
437 Ga0451791_1601024 3300041451 Bacteria 728
438 Ga0451793_1805861 3300041452 Bacteria 1186
439 Ga0451797_1565887 3300041453 Bacteria 849
440 Ga0451795_0661403 3300041456 Bacteria 1255
441 Ga0451800_1649814 3300041459 Bacteria 2090
442 Ga0451806_152401 3300041462 Bacteria 4074
443 Ga0451804_0876128 3300041463 Bacteria 735
444 Ga0451804_1077436 3300041463 Bacteria 3811
445 Ga0451804_1170276 3300041463 Bacteria 621
446 Ga0451807_0590162 3300041486 Bacteria 4065
447 Ga0451807_1916965 3300041486 Bacteria 1280
448 Ga0451837_1238404 3300041494 Bacteria 940
449 Ga0451837_1399073 3300041494 Bacteria 2360
450 Ga0451847_0196122 3300041503 Bacteria 1097
451 Ga0451843_0056262 3300041509 Bacteria 2570
452 Ga0451843_0193634 3300041509 Bacteria 1300
453 Ga0451843_1149050 3300041509 Bacteria 2679
454 Ga0451853_1261890 3300041512 Bacteria 2001
455 Ga0451853_1606826 3300041512 Bacteria 698
456 Ga0451853_3210631 3300041512 Unclassified 688
457 Ga0451853_4086402 3300041512 Bacteria 847
458 Ga0439433_0026674 3300041999 Bacteria 1308
459 Ga0439433_0030390 3300041999 Bacteria 1235
460 Ga0439433_0077449 3300041999 Bacteria 806
461 Ga0439445_0012311 3300042004 Bacteria 2053
462 Ga0439445_0064993 3300042004 Bacteria 1003
463 Ga0439432_009293 3300042006 Bacteria 3432
464 Ga0439432_015910 3300042006 Bacteria 2534
465 Ga0439432_022919 3300042006 Bacteria 2060
466 Ga0439432_026696 3300042006 Bacteria 1890
467 Ga0439449_0000277 3300042007 Bacteria 18577
468 Ga0439449_0003655 3300042007 Bacteria 5969
469 Ga0439449_0009760 3300042007 Bacteria 3632
470 Ga0439449_0022386 3300042007 Bacteria 2366
471 Ga0439449_0050465 3300042007 Bacteria 1539
472 Ga0439452_009962 3300042010 Bacteria 2782
473 Ga0439455_0043457 3300042012 Bacteria 1157
474 Ga0439462_0060166 3300042015 Bacteria 1028
475 Ga0450911_000685 3300042115 Bacteria 10057
476 Ga0450923_020142 3300042125 Bacteria 1291
477 Ga0450908_000033 3300042184 Bacteria 31285
478 Ga0466982_0010498 3300044672 Bacteria 4813
479 Ga0453684_0000159 3300044712 Bacteria 300297
480 Ga0466957_0041473 3300044842 Bacteria 2784
481 Ga0451576_0000120 3300045051 Bacteria 199365
482 Ga0466958_0509475 3300045836 Bacteria 781
483 Ga0495617_000196 3300046452 Bacteria 38054
484 Ga0495617_000318 3300046452 Bacteria 27031
485 Ga0495627_010605 3300046453 Bacteria 3342
486 Ga0495627_032692 3300046453 Bacteria 1636
487 Ga0495627_051825 3300046453 Bacteria 1232
488 Ga0495591_034329 3300046458 Bacteria 1494
489 Ga0495638_0002849 3300046460 Bacteria 13863
490 Ga0495638_0004464 3300046460 Bacteria 10598
491 Ga0495638_0132268 3300046460 Bacteria 1464
492 Ga0495650_0011065 3300046471 Bacteria 4979
493 Ga0495584_0000437 3300046491 Bacteria 28733
494 Ga0495585_0001305 3300046492 Bacteria 19892
495 Ga0495585_0176303 3300046492 Bacteria 1101
496 Ga0495607_0004515 3300046501 Bacteria 10213
497 Ga0495607_0015294 3300046501 Bacteria 4976
498 Ga0495607_0016250 3300046501 Bacteria 4805
499 Ga0495607_0020055 3300046501 Bacteria 4232
500 Ga0495607_0422864 3300046501 Bacteria 602
501 Ga0495583_0015969 3300046506 Bacteria 4056
502 Ga0495606_0003552 3300046507 Bacteria 16459
503 Ga0495606_0005186 3300046507 Bacteria 12602
504 Ga0495606_0060310 3300046507 Bacteria 2430
505 Ga0495606_0077532 3300046507 Bacteria 2074
506 Ga0495606_0127978 3300046507 Bacteria 1512
507 Ga0495610_0000971 3300046512 Bacteria 26490
508 Ga0495610_0015601 3300046512 Bacteria 4406
509 Ga0495610_0016193 3300046512 Bacteria 4303
510 Ga0495616_0001042 3300046513 Bacteria 19821
511 Ga0495616_0184079 3300046513 Bacteria 926
512 Ga0495620_0000846 3300046515 Bacteria 18912
513 Ga0495620_0001915 3300046515 Bacteria 12191
514 Ga0495631_0000878 3300046518 Bacteria 18807
515 Ga0495631_0002764 3300046518 Bacteria 9736
516 Ga0495631_0010947 3300046518 Bacteria 4477
517 Ga0495632_0000014 3300046519 Bacteria 243913
518 Ga0495632_0005070 3300046519 Bacteria 8810
519 Ga0495632_0071240 3300046519 Bacteria 1670
520 Ga0495643_0002141 3300046522 Bacteria 16245
521 Ga0495648_0002749 3300046524 Bacteria 15883
522 Ga0495648_0053514 3300046524 Bacteria 2445
523 Ga0495663_0001222 3300046525 Bacteria 8226
524 Ga0495663_0001801 3300046525 Bacteria 6631
525 Ga0495663_0003902 3300046525 Bacteria 4248
526 Ga0495663_0009609 3300046525 Bacteria 2682
527 Ga0495663_0009906 3300046525 Bacteria 2647
528 Ga0495663_0032003 3300046525 Bacteria 1564
529 Ga0495663_0228027 3300046525 Bacteria 656
530 Ga0495598_0001908 3300046537 Bacteria 4217
531 Ga0495609_0002407 3300046538 Bacteria 11518
532 Ga0495609_0223113 3300046538 Bacteria 782
533 Ga0495621_0031148 3300046539 Bacteria 1828
534 Ga0495621_0044186 3300046539 Bacteria 1574
535 Ga0495622_0068953 3300046557 Bacteria 1633
536 Ga0495633_0023836 3300046558 Bacteria 3028
537 Ga0495633_0100422 3300046558 Bacteria 1343
538 Ga0495633_0191777 3300046558 Bacteria 939
539 Ga0495656_0003602 3300046615 Bacteria 5247
540 Ga0495656_0063588 3300046615 Bacteria 1618
541 Ga0495668_0000890 3300046616 Bacteria 33634
542 Ga0495668_0002891 3300046616 Bacteria 13564
543 Ga0495668_0413290 3300046616 Bacteria 742
544 Ga0495611_0000003 3300046648 Bacteria 395679
545 Ga0495611_0002170 3300046648 Bacteria 9153
546 Ga0495625_0000019 3300046660 Bacteria 298330
547 Ga0495625_0053094 3300046660 Bacteria 2900
548 Ga0495625_0107868 3300046660 Bacteria 1905
549 Ga0495659_0005748 3300046664 Bacteria 3911
550 Ga0495661_0008753 3300046665 Bacteria 6984
551 Ga0495670_0000478 3300046691 Bacteria 18969
552 Ga0495670_0002610 3300046691 Bacteria 8900
553 Ga0495670_0051527 3300046691 Bacteria 2060
554 Ga0495670_0061678 3300046691 Bacteria 1885
555 Ga0495670_0380437 3300046691 Bacteria 762
556 Ga0495671_0003233 3300046692 Bacteria 10116
557 Ga0495671_0004102 3300046692 Bacteria 8783
558 Ga0495649_0030625 3300046694 Bacteria 2971
559 Ga0495589_0000408 3300046794 Bacteria 32385
560 Ga0495660_0000122 3300046810 Bacteria 85116
561 Ga0495660_0000268 3300046810 Bacteria 48969
562 Ga0495660_0047807 3300046810 Bacteria 2341
563 Ga0495660_0188229 3300046810 Bacteria 994
564 Ga0495636_0008861 3300047318 Bacteria 3961
565 Ga0495636_0021723 3300047318 Bacteria 2592
566 Ga0495636_0027609 3300047318 Bacteria 2312
567 Ga0495636_0028371 3300047318 Bacteria 2283
568 Ga0495672_0001225 3300047320 Bacteria 25853
569 Ga0495683_0004599 3300047323 Bacteria 7789
570 Ga0495677_0104255 3300047445 Bacteria 1075
571 Ga0495679_000017 3300047446 Bacteria 263230
572 Ga0495673_0000004 3300047469 Bacteria 1354526
573 Ga0495673_0000347 3300047469 Bacteria 58250
574 Ga0495673_0001675 3300047469 Bacteria 17049
575 Ga0495681_0286146 3300047470 Bacteria 641
576 Ga0495686_0000024 3300047472 Bacteria 400343
577 Ga0495686_0000409 3300047472 Bacteria 67869
578 Ga0495686_0004194 3300047472 Bacteria 11971
579 Ga0495686_0007418 3300047472 Bacteria 8224
580 Ga0495686_0016046 3300047472 Bacteria 5090
581 Ga0495686_0037336 3300047472 Bacteria 3112
582 Ga0495686_0092833 3300047472 Bacteria 1830
583 Ga0495686_0117408 3300047472 Bacteria 1589
584 Ga0495615_0022313 3300048090 Bacteria 1439
585 Ga0496100_0028515 3300048903 Bacteria 3444
586 Ga0496100_0323639 3300048903 Bacteria 1159
587 Ga0496100_0513306 3300048903 Bacteria 924
588 Ga0496101_0002654 3300048904 Bacteria 10984
589 Ga0496101_0044626 3300048904 Bacteria 3172
590 Ga0496101_0449636 3300048904 Bacteria 1016
591 Ga0496102_0202573 3300048905 Bacteria 1871
592 Ga0496104_0014408 3300048907 Bacteria 7145
593 Ga0496104_0148328 3300048907 Bacteria 2252
594 Ga0496105_0028149 3300048908 Bacteria 4595
595 Ga0496105_0045875 3300048908 Bacteria 3606
596 Ga0496106_0010123 3300048909 Bacteria 6965
597 Ga0496106_0037617 3300048909 Bacteria 3621
598 Ga0496106_0411828 3300048909 Bacteria 1086
599 Ga0496108_0018627 3300048911 Bacteria 5688
600 Ga0496108_0164470 3300048911 Bacteria 1918
601 Ga0496108_0832326 3300048911 Bacteria 795
602 Ga0496108_1267421 3300048911 Bacteria 621
603 Ga0496109_0043422 3300048912 Bacteria 4074
604 Ga0496109_0592418 3300048912 Bacteria 1045
605 Ga0496110_0756592 3300048913 Bacteria 875
606 Ga0496110_0860118 3300048913 Bacteria 812
607 Ga0496111_0007874 3300048914 Bacteria 7021
608 Ga0496112_0055973 3300048915 Bacteria 3881
609 Ga0496113_0046111 3300048916 Bacteria 3235
610 Ga0496113_0105163 3300048916 Bacteria 2191
611 Ga0496114_0004048 3300048917 Bacteria 11322
612 Ga0496116_0002306 3300048919 Bacteria 20233
613 Ga0496116_0019218 3300048919 Bacteria 5237
614 Ga0496116_0064796 3300048919 Bacteria 2347
615 Ga0496116_0101306 3300048919 Bacteria 1720
616 Ga0496117_0001871 3300048920 Bacteria 28369
617 Ga0496117_0004092 3300048920 Bacteria 16354
618 Ga0496117_0004983 3300048920 Bacteria 14248
619 Ga0496117_0008606 3300048920 Bacteria 9668
620 Ga0496117_0024752 3300048920 Bacteria 4735
621 Ga0496117_0048375 3300048920 Bacteria 3038
622 Ga0496117_0073042 3300048920 Bacteria 2290
623 Ga0496117_0268874 3300048920 Bacteria 919
624 Ga0496117_0374621 3300048920 Bacteria 727
625 Ga0496118_0001013 3300048921 Bacteria 43722
626 Ga0496118_0001607 3300048921 Bacteria 33397
627 Ga0496118_0002036 3300048921 Bacteria 28593
628 Ga0496118_0035718 3300048921 Bacteria 4030
629 Ga0496118_0049568 3300048921 Bacteria 3232
630 Ga0496118_0054643 3300048921 Bacteria 3022
631 Ga0496118_0099230 3300048921 Bacteria 1975
632 Ga0496118_0160364 3300048921 Bacteria 1392
633 Ga0496118_0175261 3300048921 Bacteria 1303
634 Ga0496118_0198680 3300048921 Bacteria 1190
635 Ga0496119_0000235 3300048922 Bacteria 77921
636 Ga0496119_0003558 3300048922 Bacteria 16083
637 Ga0496119_0010179 3300048922 Bacteria 7940
638 Ga0496119_0010619 3300048922 Bacteria 7722
639 Ga0496119_0046207 3300048922 Bacteria 2721
640 Ga0496120_0000208 3300048923 Bacteria 100328
641 Ga0496120_0000282 3300048923 Bacteria 85605
642 Ga0496120_0000970 3300048923 Bacteria 39064
643 Ga0496120_0283125 3300048923 Bacteria 765
644 Ga0496121_0000109 3300048924 Bacteria 187307
645 Ga0496121_0000480 3300048924 Bacteria 77305
646 Ga0496121_0000752 3300048924 Bacteria 59582
647 Ga0496121_0002095 3300048924 Bacteria 31379
648 Ga0496121_0007074 3300048924 Bacteria 13624
649 Ga0496121_0011014 3300048924 Bacteria 10095
650 Ga0496121_0017014 3300048924 Bacteria 7462
651 Ga0496121_0018291 3300048924 Bacteria 7077
652 Ga0496121_0079150 3300048924 Bacteria 2610
653 Ga0496121_0100282 3300048924 Bacteria 2235
654 Ga0496122_0001004 3300048925 Bacteria 49981
655 Ga0496122_0009282 3300048925 Bacteria 10401
656 Ga0496122_0025748 3300048925 Bacteria 5096
657 Ga0496122_0026466 3300048925 Bacteria 4998
658 Ga0496122_0034096 3300048925 Bacteria 4173
659 Ga0496122_0095588 3300048925 Bacteria 2007
660 Ga0496122_0177692 3300048925 Bacteria 1274
661 Ga0496122_0251634 3300048925 Bacteria 987
662 Ga0496122_0346190 3300048925 Bacteria 778
663 Ga0496123_0000239 3300048926 Bacteria 110475
664 Ga0496123_0003580 3300048926 Bacteria 17215
665 Ga0496123_0008951 3300048926 Bacteria 9101
666 Ga0496123_0029599 3300048926 Bacteria 4026
667 Ga0496123_0044731 3300048926 Bacteria 3024
668 Ga0496123_0057107 3300048926 Bacteria 2544
669 Ga0496123_0057633 3300048926 Bacteria 2526
670 Ga0496123_0062757 3300048926 Bacteria 2378
671 Ga0496123_0063283 3300048926 Bacteria 2365
672 Ga0496124_0000218 3300048927 Bacteria 112156
673 Ga0496124_0001341 3300048927 Bacteria 36941
674 Ga0496124_0001511 3300048927 Bacteria 33889
675 Ga0496124_0003515 3300048927 Bacteria 19085
676 Ga0496124_0004411 3300048927 Bacteria 16416
677 Ga0496124_0006332 3300048927 Bacteria 12919
678 Ga0496124_0007149 3300048927 Bacteria 11948
679 Ga0496124_0008850 3300048927 Bacteria 10453
680 Ga0496124_0077460 3300048927 Bacteria 2742
681 Ga0496124_0080829 3300048927 Bacteria 2673
682 Ga0496124_0134881 3300048927 Bacteria 1955
683 Ga0496124_0230198 3300048927 Bacteria 1386
684 Ga0496124_0271211 3300048927 Bacteria 1242
685 Ga0496125_0004406 3300048928 Bacteria 16271
686 Ga0496125_0005552 3300048928 Bacteria 13957
687 Ga0496125_0005750 3300048928 Bacteria 13642
688 Ga0496125_0006890 3300048928 Bacteria 12166
689 Ga0496125_0044519 3300048928 Bacteria 3752
690 Ga0496125_0056447 3300048928 Bacteria 3188
691 Ga0496125_0090789 3300048928 Bacteria 2291
692 Ga0496126_0005914 3300048929 Bacteria 13798
693 Ga0496126_0009365 3300048929 Bacteria 10408
694 Ga0496126_0042951 3300048929 Bacteria 4173
695 Ga0496126_0061724 3300048929 Bacteria 3366
696 Ga0496126_0136876 3300048929 Bacteria 2112
697 Ga0496126_0149731 3300048929 Bacteria 2001
698 Ga0496126_0196653 3300048929 Bacteria 1705
699 Ga0496126_0235085 3300048929 Bacteria 1533
700 Ga0496126_0620767 3300048929 Bacteria 849
701 Ga0495678_000496 3300049459 Bacteria 38859
702 Ga0495682_0005490 3300049460 Bacteria 5258
703 Ga0495682_0011390 3300049460 Bacteria 3422
704 Ga0501290_022888 3300049513 Bacteria 864
705 Ga0501031_0005288 3300049568 Bacteria 8410
706 Ga0501031_0017026 3300049568 Bacteria 4722
707 Ga0501031_0251651 3300049568 Bacteria 1148
708 Ga0501032_0034586 3300049569 Bacteria 3458
709 Ga0501032_0079460 3300049569 Bacteria 2184
710 Ga0501033_0000625 3300049570 Bacteria 32789
711 Ga0501033_0068791 3300049570 Bacteria 2603
712 Ga0501033_0240145 3300049570 Bacteria 1285
713 Ga0501033_0244952 3300049570 Bacteria 1271
714 Ga0501033_0270756 3300049570 Bacteria 1200
715 Ga0501034_0001242 3300049571 Bacteria 34633
716 Ga0501034_0008327 3300049571 Bacteria 10972
717 Ga0501034_0020621 3300049571 Bacteria 6732
718 Ga0501034_0391135 3300049571 Bacteria 1314
719 Ga0501034_0412529 3300049571 Bacteria 1272
720 Ga0501034_0501945 3300049571 Bacteria 1127
721 Ga0501036_0014053 3300049572 Bacteria 6654
722 Ga0501036_0039262 3300049572 Bacteria 4006
723 Ga0501037_0001197 3300049573 Bacteria 19151
724 Ga0501037_0211476 3300049573 Bacteria 1367
725 Ga0501038_0001241 3300049574 Bacteria 23114
726 Ga0501038_0021584 3300049574 Bacteria 5778
727 Ga0501038_0489529 3300049574 Bacteria 942
728 Ga0501039_0020714 3300049575 Bacteria 5039
729 Ga0501039_0040990 3300049575 Bacteria 3575
730 Ga0501039_0578773 3300049575 Bacteria 880
731 Ga0501042_0627364 3300049578 Bacteria 781
732 Ga0501043_0020013 3300049579 Bacteria 5253
733 Ga0501043_0053496 3300049579 Bacteria 3170
734 Ga0501043_0178100 3300049579 Bacteria 1657
735 Ga0501043_0697854 3300049579 Bacteria 741
736 Ga0501043_0818585 3300049579 Bacteria 672
737 Ga0501046_0130135 3300049580 Bacteria 1909
738 Ga0501047_0055064 3300049581 Bacteria 3847
739 Ga0501047_0201272 3300049581 Bacteria 1852
740 Ga0501047_0370336 3300049581 Bacteria 1267
741 Ga0501047_0400592 3300049581 Bacteria 1205
742 Ga0501048_0219207 3300049582 Bacteria 1349
743 Ga0501068_0072238 3300049584 Bacteria 2107
744 Ga0501069_0565928 3300049585 Bacteria 681
745 Ga0501070_0271621 3300049586 Bacteria 1384
746 Ga0501070_0518607 3300049586 Bacteria 956
747 Ga0501070_0794491 3300049586 Bacteria 743
748 Ga0501073_0031382 3300049589 Bacteria 3791
749 Ga0501217_112051 3300049661 Bacteria 785
750 Ga0501223_008846 3300049663 Bacteria 2049
751 Ga0501239_012302 3300049672 Bacteria 967
752 Ga0501243_005519 3300049675 Bacteria 1901
753 Ga0501253_033769 3300049683 Bacteria 992
754 Ga0501225_0103046 3300049705 Bacteria 835
755 Ga0501245_014636 3300049708 Bacteria 1173
756 Ga0501079_0166991 3300049741 Bacteria 1716
757 Ga0501080_0002129 3300049742 Bacteria 17199
758 Ga0501080_0023252 3300049742 Bacteria 5747
759 Ga0501266_003858 3300049763 Bacteria 1856
760 Ga0501266_018515 3300049763 Bacteria 937
761 Ga0501266_021107 3300049763 Bacteria 889
762 Ga0501267_013704 3300049764 Bacteria 845
763 Ga0501268_026763 3300049765 Bacteria 1021
764 Ga0501270_018667 3300049767 Bacteria 1030
765 Ga0501035_0002247 3300049822 Bacteria 19119
766 Ga0501035_0009719 3300049822 Bacteria 8947
767 Ga0501035_0076487 3300049822 Bacteria 2960
768 Ga0501035_0084774 3300049822 Bacteria 2794
769 Ga0501035_0301957 3300049822 Bacteria 1349
770 Ga0501035_0349423 3300049822 Bacteria 1237
771 Ga0501044_0002685 3300049823 Bacteria 20231
772 Ga0501044_0019061 3300049823 Bacteria 7345
773 Ga0501044_0037487 3300049823 Bacteria 5067
774 Ga0501044_0051758 3300049823 Bacteria 4233
775 Ga0501044_0096927 3300049823 Bacteria 2970
776 Ga0501044_0277800 3300049823 Bacteria 1609
777 Ga0501045_0279450 3300049824 Bacteria 1243
778 nmdc:mga03n38_197259_c1 3300050490 Bacteria 1040
779 nmdc:mga00v17_113447_c1 3300050491 Bacteria 1721
780 nmdc:mga00v17_1287_c1 3300050491 Bacteria 13178
781 nmdc:mga00v17_129755_c1 3300050491 Bacteria 1610
782 nmdc:mga00v17_18002_c1 3300050491 Bacteria 4009
783 nmdc:mga00v17_56465_c1 3300050491 Bacteria 2401
784 nmdc:mga0yw44_122802_c1 3300050492 Bacteria 1674
785 nmdc:mga0yw44_307442_c1 3300050492 Bacteria 1063
786 nmdc:mga07m45_127220_c1 3300050496 Bacteria 1473
787 nmdc:mga0sz30_40870_c2 3300050516 Bacteria 1583
788 Ga0500643_000029 3300053087 Bacteria 211149
789 Ga0500643_006120 3300053087 Bacteria 5081
790 Ga0500555_000324 3300053103 Bacteria 20582
791 Ga0500572_070424 3300053111 Bacteria 1080
792 Ga0500597_000107 3300053120 Bacteria 17442
793 Ga0500626_103771 3300053128 Bacteria 1236
794 Ga0500622_0211417 3300053156 Bacteria 875
795 Ga0500633_0019341 3300053160 Bacteria 2035
796 Ga0500634_0000022 3300053161 Bacteria 95424
797 Ga0500645_001107 3300053730 Bacteria 14742
798 2525556445 2524614729 Bacteria 3091755
799 2538833582 2537561836 Bacteria 3910579
800 2572254414 2571042365 Bacteria 3289345
801 2578457177 2576861471 Bacteria 4648976
802 2595449018 2593339238 Bacteria 4182970
803 2595450316 2593339239 Bacteria 4124669
804 2630649674 2627854209 Bacteria 3093011
805 2643816764 2643221559 Bacteria 4424915
806 2643880859 2643221573 Bacteria 4784121
807 2643905242 2643221579 Bacteria 4443405
808 2643914929 2643221581 Bacteria 3893603
809 2643938556 2643221586 Bacteria 4446529
810 2643973780 2643221593 Bacteria 6296053
811 2644077697 2643221612 Bacteria 4361984
812 2644528286 2643221695 Bacteria 3441323
813 2644661429 2643221720 Bacteria 4694283
814 2644693988 2643221727 Bacteria 4415595
815 2644699510 2643221728 Bacteria 4797149
816 2687584496 2687453130 Bacteria 4227172
817 2721025785 2718218334 Bacteria 4765486
818 2735834242 2734482264 Unclassified 5014763
819 2739225661 2738543009 Bacteria 4944499
820 2747950267 2747842428 Bacteria 4689383
821 2748019521 2747842501 Bacteria 5293829
822 2765580318 2765235840 Bacteria 4663337
823 2816518656 2816332141 Bacteria 4436036
824 2819566271 2818991440 Bacteria 4774720
825 2842395553 2842391507 Bacteria 4486072
826 2842759151 2842757796 Bacteria 3981385
827 2842783243 2842780639 Bacteria 4337790
828 2842917114 2842914999 Bacteria 4419378
829 2842920676 2842918807 Bacteria 4289178
830 2852652312 2852649853 Bacteria 4036942
831 2852686958 2852684882 Bacteria 5463342
832 2857445138 2857442823 Bacteria 4562550
833 2874222990 2874220319 Bacteria 4594709
834 2884339122 2884338543 Bacteria 4610696
835 2895499428 2895498888 Bacteria 5283788
836 2895512449 2895511927 Bacteria 6802080
837 2895522460 2895522137 Bacteria 3284416
838 2895525768 2895525241 Bacteria 3388457
839 2904466547 2904463128 Bacteria 4775606
840 2919086202 2919085039 Bacteria 4532964
841 2919092833 2919089067 Bacteria 4560942
842 2919137423 2919134579 Bacteria 4480386
843 2919406861 2919404418 Bacteria 4232372
844 2919515029 2919513703 Bacteria 3844312
845 2919676350 2919675420 Bacteria 3969095
846 2923517356 2923516293 Bacteria 3716336
847 2928499189 2928496128 Bacteria 4631123
848 2929196502 2929195423 Bacteria 5325372
849 2931383547 2931380184 Bacteria 4455911
850 2937614958 2937610967 Bacteria 4618818
851 2939589636 2939589442 Bacteria 4214238
852 2939624300 2939622612 Bacteria 4698046
853 2939630267 2939626828 Bacteria 4695272
854 2941471955 2941471342 Bacteria 5018624
855 2941478928 2941475908 Bacteria 4145589
856 2941493088 2941489479 Bacteria 6313767
857 2953995953 2953994433 Bacteria 4303959
858 2961049755 2961047084 Bacteria 4594415
859 2961066570 2961064222 Bacteria 4749990
860 2974307809 2974307012 Bacteria 4172388
861 2977248528 2977247770 Bacteria 4160543
862 2984516985 2984514374 Bacteria 4172479
863 2987608591 2987605356 Bacteria 4187822
864 2995953169 2995948881 Bacteria 6358104
865 8002871102 8002869464 Bacteria 3588529
866 8003016991 8003014200 Bacteria 4059994
867 8021626250 8021622325 Bacteria 4844743
868 8021627691 8021626552 Bacteria 4665214
869 8021651299 8021648035 Bacteria 4772378
870 Ga0495633_0010539
871 SwRhRL2b_contig_3797405
872 JGI24736J21556_1001617
873 JGI24740J21852_10040405
874 JGI24738J21930_10001153
875 JGI25156J39149_1007841
876 JGI25157J39369_1001663
877 JGI25152J39213_1000069
878 JGI25150J39212_1000214
879 JGI25150J39212_1000407
880 JGI25150J39212_1027756
881 JGI25151J46595_10000105
882 JGI25151J46595_10000116
883 JGI25153J46596_10000077
884 rootH2_10004458
885 rootH2_10044786
886 rootL2_10073749
887 rootH1_10107485
888 rootH1_10232895
889 Ga0006558J51389_1028497
890 Ga0006554J51385_1022338
891 Ga0006562J51391_1012709
892 Ga0006562J51391_1012711
893 Ga0055542_1012758
894 Ga0055529_1005753
895 Ga0055526_1003098
896 Ga0055537_1000088
897 Ga0055537_1000812
898 Ga0055524_1000074
899 Ga0055524_1016948
900 Ga0055524_1061261
901 Ga0055536_1001746
902 Ga0055536_1006277
903 Ga0055534_1000097
904 Ga0055534_1000154
905 Ga0055534_1011218
906 Ga0055528_1000028
907 Ga0055528_1001412
908 Ga0055528_1002336
909 Ga0055530_10001477
910 Ga0055531_10002804
911 Ga0055531_10013393
912 Ga0055531_10017692
913 Ga0055531_10030559
914 Ga0058692_1000013
915 Ga0058692_1000035
916 Ga0065165_1000913
917 Ga0065704_10098945
918 Ga0065704_10281216
919 Ga0065715_10170654
920 Ga0070658_10709156
921 Ga0070670_100022831
922 Ga0070670_100046378
923 Ga0070670_100073464
924 Ga0070680_100389732
925 Ga0070682_100008369
926 Ga0070682_100105533
927 Ga0070660_100089225
928 Ga0070661_100214433
929 Ga0070661_100330707
930 Ga0070661_100491765
931 Ga0070668_100070732
932 Ga0070668_100203858
933 Ga0070668_101260099
934 Ga0070669_100054658
935 Ga0070669_101051101
936 Ga0070675_100494163
937 Ga0070671_100010249
938 Ga0070671_101041160
939 Ga0070674_100053729
940 Ga0070673_100426619
941 Ga0070673_101124699
942 Ga0070659_100144222
943 Ga0070667_100000085
944 Ga0070714_100752166
945 Ga0070700_100575143
946 Ga0070663_100000045
947 Ga0070663_100081842
948 Ga0070663_100194098
949 Ga0070678_100011851
950 Ga0070678_100094369
951 Ga0070681_10336561
952 Ga0070681_10350114
953 Ga0068867_100047934
954 Ga0070679_100058369
955 Ga0068853_100003376
956 Ga0068853_100170552
957 Ga0070672_100057956
958 Ga0070696_100004017
959 Ga0070693_100017003
960 Ga0070665_100071908
961 Ga0070665_100166741
962 Ga0070665_100924316
963 Ga0068855_100013007
964 Ga0068855_101271375
965 Ga0070664_100084386
966 Ga0070664_101231545
967 Ga0068854_100176852
968 Ga0068856_100000524
969 Ga0068851_10354686
970 Ga0068851_10625703
971 Ga0068863_100123053
972 Ga0068858_101627569
973 Ga0081539_10019407
974 Ga0075365_10193304
975 Ga0075364_10000775
976 Ga0075364_10010917
977 Ga0075364_10037648
978 Ga0075364_10577264
979 Ga0075369_10181360
980 Ga0075369_10296146
981 Ga0075370_10085036
982 Ga0097620_100383554
983 Ga0105251_10019456
984 Ga0105244_10023892
985 Ga0105244_10038830
986 Ga0105244_10104717
987 Ga0105240_10023122
988 Ga0105240_10128175
989 Ga0105240_10130625
990 Ga0105247_10002807
991 Ga0105247_10640208
992 Ga0105243_10122895
993 Ga0105243_10207021
994 Ga0105241_10252420
995 Ga0105248_10000980
996 Ga0105237_10000036
997 Ga0105237_10006112
998 Ga0105237_10546847
999 Ga0105249_10000335
1000 Ga0105028_107380
1001 Ga0105239_10000027
1002 Ga0105239_10202899
1003 Ga0105239_10416482
1004 Ga0105239_10992781
1005 Ga0157318_1002656
1006 Ga0157329_1001393
1007 Ga0157313_1002762
1008 Ga0157327_1000513
1009 Ga0157373_10073514
1010 Ga0157373_10152758
1011 Ga0157373_10377225
1012 Ga0157371_10000184
1013 Ga0157371_10079356
1014 Ga0157371_10120730
1015 Ga0157371_10190080
1016 Ga0157371_10678202
1017 Ga0157370_10000045
1018 Ga0157370_10001564
1019 Ga0157370_10015409
1020 Ga0157370_10019467
1021 Ga0157370_10096821
1022 Ga0157370_10270060
1023 Ga0157370_10366785
1024 Ga0157370_10435598
1025 Ga0157369_10000745
1026 Ga0157369_10011268
1027 Ga0157369_10048745
1028 Ga0163162_10325108
1029 Ga0163162_10398573
1030 Ga0157372_10021401
1031 Ga0157372_10162705
1032 Ga0157372_10787582
1033 Ga0157375_10140509
1034 Ga0157375_10169912
1035 Ga0157380_10098081
1036 Ga0157380_10371759
1037 Ga0157380_10530188
1038 Ga0182008_10004060
1039 Ga0182008_10023563
1040 Ga0182008_10037026
1041 Ga0182008_10311799
1042 Ga0157379_10935563
1043 Ga0182006_1000479
1044 Ga0182006_1003624
1045 Ga0182006_1022419
1046 Ga0182007_10000219
1047 Ga0182007_10033459
1048 Ga0182005_1000113
1049 Ga0182005_1000213
1050 Ga0182005_1001646
1051 Ga0182005_1001924
1052 Ga0182005_1006350
1053 Ga0183360_10001
1054 Ga0163161_10007925
1055 Ga0163161_10020842
1056 Ga0163161_10050833
1057 Ga0163161_10118324
1058 Ga0163161_10480889
1059 Ga0206356_10491941
1060 Ga0206353_10172233
1061 Ga0224712_10118197
1062 Ga0209674_100791
1063 Ga0209147_102946
1064 Ga0209437_102834
1065 Ga0207425_1000045
1066 Ga0207425_1004713
1067 Ga0209646_1002196
1068 Ga0209026_1000223
1069 Ga0209148_1000762
1070 Ga0209759_1014486
1071 Ga0209129_1000057
1072 Ga0209129_1001090
1073 Ga0209565_1000023
1074 Ga0209565_1000034
1075 Ga0209565_1019738
1076 Ga0209455_1000430
1077 Ga0209673_1000039
1078 Ga0209673_1000047
1079 Ga0209673_1029483
1080 Ga0209130_1002629
1081 Ga0209130_1024994
1082 Ga0209675_1000016
1083 Ga0209675_1000023
1084 Ga0209675_1008269
1085 Ga0209675_1046930
1086 Ga0209676_1000027
1087 Ga0209676_1000037
1088 Ga0209676_1000160
1089 Ga0209676_1000280
1090 Ga0209676_1002509
1091 Ga0209676_1003026
1092 Ga0209025_1000013
1093 Ga0209025_1000023
1094 Ga0209025_1002654
1095 Ga0209025_1028791
1096 Ga0209025_1030183
1097 Ga0209564_1000066
1098 Ga0209564_1000194
1099 Ga0209564_1004607
1100 Ga0209758_1000014
1101 Ga0209758_1008048
1102 Ga0209050_1000352
1103 Ga0209050_1000714
1104 Ga0209050_1000833
1105 Ga0209050_1010110
1106 Ga0209050_1026372
1107 Ga0209256_1000048
1108 Ga0209256_1003154
1109 Ga0209256_1003863
1110 Ga0209256_1005406
1111 Ga0209256_1020798
1112 Ga0209256_1020801
1113 Ga0207426_1017565
1114 Ga0209051_1001947
1115 Ga0209051_1002836
1116 Ga0209051_1006389
1117 Ga0209257_1000046
1118 Ga0209257_1000177
1119 Ga0209257_1000198
1120 Ga0209257_1000219
1121 Ga0209257_1000383
1122 Ga0209257_1003088
1123 Ga0209257_1003813
1124 Ga0209257_1007629
1125 Ga0209257_1026691
1126 Ga0209257_1034119
1127 Ga0209257_1066742
1128 Ga0207655_1033595
1129 Ga0207713_1066409
1130 Ga0207682_10014641
1131 Ga0207710_10005864
1132 Ga0207647_10000015
1133 Ga0207647_10076216
1134 Ga0207705_10108347
1135 Ga0207654_10128999
1136 Ga0207707_10026404
1137 Ga0207707_10369250
1138 Ga0207695_10000441
1139 Ga0207695_10003481
1140 Ga0207671_10000135
1141 Ga0207671_10003134
1142 Ga0207657_10003190
1143 Ga0207657_10351503
1144 Ga0207649_10152857
1145 Ga0207652_10131701
1146 Ga0207652_10494603
1147 Ga0207681_10041006
1148 Ga0207681_10690832
1149 Ga0207694_10025255
1150 Ga0207694_10159608
1151 Ga0207650_10047972
1152 Ga0207650_10048024
1153 Ga0207650_10051036
1154 Ga0207644_10060876
1155 Ga0207644_10113072
1156 Ga0207690_10250292
1157 Ga0207706_10589886
1158 Ga0207709_10002407
1159 Ga0207709_10020776
1160 Ga0207669_10045553
1161 Ga0207691_10019809
1162 Ga0207711_10004824
1163 Ga0207679_10124890
1164 Ga0207667_10075026
1165 Ga0207667_10263378
1166 Ga0207667_11129593
1167 Ga0207651_10216836
1168 Ga0207712_10001764
1169 Ga0207668_10023924
1170 Ga0207640_10003213
1171 Ga0207658_10000032
1172 Ga0207658_10244527
1173 Ga0207677_10307158
1174 Ga0207639_10031649
1175 Ga0207639_10131720
1176 Ga0207678_10000457
1177 Ga0207678_10000643
1178 Ga0207678_10147929
1179 Ga0207702_10003652
1180 Ga0207641_10243464
1181 Ga0207648_10208557
1182 Ga0207676_10065408
1183 Ga0207683_10020246
1184 Ga0207683_10022073
1185 Ga0209371_1000007
1186 Ga0209371_1000043
1187 Ga0209981_1027589
1188 Ga0209981_1030747
1189 Ga0209984_1003224
1190 Ga0210000_1003909
1191 Ga0209995_1000902
1192 Ga0209999_1000249
1193 Ga0209982_1002809
1194 Ga0209970_1002517
1195 Ga0209983_1006804
1196 Ga0209971_1000743
1197 Ga0209974_10034122
1198 Ga0268266_10124490
1199 Ga0268266_10187018
1200 Ga0268266_10358741
1201 Ga0268266_10727213
1202 Ga0268256_1000008
1203 Ga0268256_1000044
1204 Ga0316176_1036603
1205 Ga0316176_1043775
1206 Ga0314311_1072890
1207 Ga0316183_1159014
1208 Ga0316181_1256419
1209 Ga0316182_1115502
1210 Ga0307513_10037233
1211 Ga0307513_10267221
1212 Ga0307408_100022323
1213 Ga0307408_100216471
1214 Ga0307408_101240522
1215 Ga0307405_10022245
1216 Ga0307405_10070178
1217 Ga0307413_10001208
1218 Ga0307413_10020613
1219 Ga0307413_10041782
1220 Ga0307413_10044622
1221 Ga0307413_10050947
1222 Ga0307413_10073588
1223 Ga0307413_10388326
1224 Ga0307413_10475602
1225 Ga0307413_10773997
1226 Ga0307413_10870234
1227 Ga0307413_11370484
1228 Ga0307410_10014783
1229 Ga0307410_10123834
1230 Ga0307410_10149155
1231 Ga0307410_10300824
1232 Ga0307410_10368852
1233 Ga0307406_10000978
1234 Ga0307406_10013019
1235 Ga0307406_10312628
1236 Ga0307406_10699296
1237 Ga0307407_10076809
1238 Ga0307407_10127462
1239 Ga0307407_10228856
1240 Ga0307412_10000418
1241 Ga0307412_10001816
1242 Ga0307412_10031352
1243 Ga0307412_10045343
1244 Ga0307412_10075722
1245 Ga0307412_10091960
1246 Ga0307412_10192504
1247 Ga0307412_10335285
1248 Ga0307409_100031440
1249 Ga0307409_100046744
1250 Ga0307409_100996607
1251 Ga0307416_100014059
1252 Ga0307416_100039180
1253 Ga0307416_101238140
1254 Ga0307414_10001338
1255 Ga0307414_10003104
1256 Ga0307414_10021898
1257 Ga0307414_10036736
1258 Ga0307414_10055143
1259 Ga0307414_10062348
1260 Ga0307414_10079320
1261 Ga0307414_10116249
1262 Ga0307414_10155622
1263 Ga0307414_10260251
1264 Ga0307414_10344181
1265 Ga0307414_10641852
1266 Ga0307414_10676518
1267 Ga0307411_10002861
1268 Ga0307411_10054444
1269 Ga0307411_10056552
1270 Ga0307411_10105527
1271 Ga0307411_10165982
1272 Ga0307411_10183876
1273 Ga0307411_10203128
1274 Ga0307411_10237077
1275 Ga0307411_10506159
1276 Ga0307411_10558553
1277 Ga0307411_10562721
1278 Ga0373928_0179764
1279 Ga0395899_0017129
1280 Ga0395900_0042677
1281 Ga0395898_0176943
1282 Ga0395905_0000337
1283 Ga0395905_0006093
1284 Ga0395905_0019088
1285 Ga0395905_0376645
1286 Ga0395905_0565449
1287 Ga0395901_0088389
1288 Ga0395901_0578455
1289 Ga0237819_00177
1290 Ga0237819_02977
1291 Ga0237816_03081
1292 Ga0439436_0000007
1293 Ga0439436_0034362
1294 Ga0439439_0018180
1295 Ga0439447_000808
1296 Ga0439465_0000214
1297 Ga0439465_0000377
1298 Ga0439465_0000615
1299 Ga0439465_0003455
1300 Ga0439465_0017038
1301 Ga0451787_725098
1302 Ga0451789_0245027
1303 Ga0451789_1055925
1304 Ga0451791_0725227
1305 Ga0451791_0976915
1306 Ga0451791_1601024
1307 Ga0451793_1805861
1308 Ga0451797_1565887
1309 Ga0451795_0661403
1310 Ga0451800_1649814
1311 Ga0451806_152401
1312 Ga0451804_0876128
1313 Ga0451804_1077436
1314 Ga0451804_1170276
1315 Ga0451807_0590162
1316 Ga0451807_1916965
1317 Ga0451837_1238404
1318 Ga0451837_1399073
1319 Ga0451847_0196122
1320 Ga0451843_0056262
1321 Ga0451843_0193634
1322 Ga0451843_1149050
1323 Ga0451853_1261890
1324 Ga0451853_1606826
1325 Ga0451853_3210631
1326 Ga0451853_4086402
1327 Ga0439433_0026674
1328 Ga0439433_0030390
1329 Ga0439433_0077449
1330 Ga0439445_0012311
1331 Ga0439445_0064993
1332 Ga0439432_009293
1333 Ga0439432_015910
1334 Ga0439432_022919
1335 Ga0439432_026696
1336 Ga0439449_0000277
1337 Ga0439449_0003655
1338 Ga0439449_0009760
1339 Ga0439449_0022386
1340 Ga0439449_0050465
1341 Ga0439452_009962
1342 Ga0439455_0043457
1343 Ga0439462_0060166
1344 Ga0450911_000685
1345 Ga0450923_020142
1346 Ga0450908_000033
1347 Ga0466982_0010498
1348 Ga0453684_0000159
1349 Ga0466957_0041473
1350 Ga0451576_0000120
1351 Ga0466958_0509475
1352 Ga0495617_000196
1353 Ga0495617_000318
1354 Ga0495627_010605
1355 Ga0495627_032692
1356 Ga0495627_051825
1357 Ga0495591_034329
1358 Ga0495638_0002849
1359 Ga0495638_0004464
1360 Ga0495638_0132268
1361 Ga0495650_0011065
1362 Ga0495584_0000437
1363 Ga0495585_0001305
1364 Ga0495585_0176303
1365 Ga0495607_0004515
1366 Ga0495607_0015294
1367 Ga0495607_0016250
1368 Ga0495607_0020055
1369 Ga0495607_0422864
1370 Ga0495583_0015969
1371 Ga0495606_0003552
1372 Ga0495606_0005186
1373 Ga0495606_0060310
1374 Ga0495606_0077532
1375 Ga0495606_0127978
1376 Ga0495610_0000971
1377 Ga0495610_0015601
1378 Ga0495610_0016193
1379 Ga0495616_0001042
1380 Ga0495616_0184079
1381 Ga0495620_0000846
1382 Ga0495620_0001915
1383 Ga0495631_0000878
1384 Ga0495631_0002764
1385 Ga0495631_0010947
1386 Ga0495632_0000014
1387 Ga0495632_0005070
1388 Ga0495632_0071240
1389 Ga0495643_0002141
1390 Ga0495648_0002749
1391 Ga0495648_0053514
1392 Ga0495663_0001222
1393 Ga0495663_0001801
1394 Ga0495663_0003902
1395 Ga0495663_0009609
1396 Ga0495663_0009906
1397 Ga0495663_0032003
1398 Ga0495663_0228027
1399 Ga0495598_0001908
1400 Ga0495609_0002407
1401 Ga0495609_0223113
1402 Ga0495621_0031148
1403 Ga0495621_0044186
1404 Ga0495622_0068953
1405 Ga0495633_0023836
1406 Ga0495633_0100422
1407 Ga0495633_0191777
1408 Ga0495656_0003602
1409 Ga0495656_0063588
1410 Ga0495668_0000890
1411 Ga0495668_0002891
1412 Ga0495668_0413290
1413 Ga0495611_0000003
1414 Ga0495611_0002170
1415 Ga0495625_0000019
1416 Ga0495625_0053094
1417 Ga0495625_0107868
1418 Ga0495659_0005748
1419 Ga0495661_0008753
1420 Ga0495670_0000478
1421 Ga0495670_0002610
1422 Ga0495670_0051527
1423 Ga0495670_0061678
1424 Ga0495670_0380437
1425 Ga0495671_0003233
1426 Ga0495671_0004102
1427 Ga0495649_0030625
1428 Ga0495589_0000408
1429 Ga0495660_0000122
1430 Ga0495660_0000268
1431 Ga0495660_0047807
1432 Ga0495660_0188229
1433 Ga0495636_0008861
1434 Ga0495636_0021723
1435 Ga0495636_0027609
1436 Ga0495636_0028371
1437 Ga0495672_0001225
1438 Ga0495683_0004599
1439 Ga0495677_0104255
1440 Ga0495679_000017
1441 Ga0495673_0000004
1442 Ga0495673_0000347
1443 Ga0495673_0001675
1444 Ga0495681_0286146
1445 Ga0495686_0000024
1446 Ga0495686_0000409
1447 Ga0495686_0004194
1448 Ga0495686_0007418
1449 Ga0495686_0016046
1450 Ga0495686_0037336
1451 Ga0495686_0092833
1452 Ga0495686_0117408
1453 Ga0495615_0022313
1454 Ga0496100_0028515
1455 Ga0496100_0323639
1456 Ga0496100_0513306
1457 Ga0496101_0002654
1458 Ga0496101_0044626
1459 Ga0496101_0449636
1460 Ga0496102_0202573
1461 Ga0496104_0014408
1462 Ga0496104_0148328
1463 Ga0496105_0028149
1464 Ga0496105_0045875
1465 Ga0496106_0010123
1466 Ga0496106_0037617
1467 Ga0496106_0411828
1468 Ga0496108_0018627
1469 Ga0496108_0164470
1470 Ga0496108_0832326
1471 Ga0496108_1267421
1472 Ga0496109_0043422
1473 Ga0496109_0592418
1474 Ga0496110_0756592
1475 Ga0496110_0860118
1476 Ga0496111_0007874
1477 Ga0496112_0055973
1478 Ga0496113_0046111
1479 Ga0496113_0105163
1480 Ga0496114_0004048
1481 Ga0496116_0002306
1482 Ga0496116_0019218
1483 Ga0496116_0064796
1484 Ga0496116_0101306
1485 Ga0496117_0001871
1486 Ga0496117_0004092
1487 Ga0496117_0004983
1488 Ga0496117_0008606
1489 Ga0496117_0024752
1490 Ga0496117_0048375
1491 Ga0496117_0073042
1492 Ga0496117_0268874
1493 Ga0496117_0374621
1494 Ga0496118_0001013
1495 Ga0496118_0001607
1496 Ga0496118_0002036
1497 Ga0496118_0035718
1498 Ga0496118_0049568
1499 Ga0496118_0054643
1500 Ga0496118_0099230
1501 Ga0496118_0160364
1502 Ga0496118_0175261
1503 Ga0496118_0198680
1504 Ga0496119_0000235
1505 Ga0496119_0003558
1506 Ga0496119_0010179
1507 Ga0496119_0010619
1508 Ga0496119_0046207
1509 Ga0496120_0000208
1510 Ga0496120_0000282
1511 Ga0496120_0000970
1512 Ga0496120_0283125
1513 Ga0496121_0000109
1514 Ga0496121_0000480
1515 Ga0496121_0000752
1516 Ga0496121_0002095
1517 Ga0496121_0007074
1518 Ga0496121_0011014
1519 Ga0496121_0017014
1520 Ga0496121_0018291
1521 Ga0496121_0079150
1522 Ga0496121_0100282
1523 Ga0496122_0001004
1524 Ga0496122_0009282
1525 Ga0496122_0025748
1526 Ga0496122_0026466
1527 Ga0496122_0034096
1528 Ga0496122_0095588
1529 Ga0496122_0177692
1530 Ga0496122_0251634
1531 Ga0496122_0346190
1532 Ga0496123_0000239
1533 Ga0496123_0003580
1534 Ga0496123_0008951
1535 Ga0496123_0029599
1536 Ga0496123_0044731
1537 Ga0496123_0057107
1538 Ga0496123_0057633
1539 Ga0496123_0062757
1540 Ga0496123_0063283
1541 Ga0496124_0000218
1542 Ga0496124_0001341
1543 Ga0496124_0001511
1544 Ga0496124_0003515
1545 Ga0496124_0004411
1546 Ga0496124_0006332
1547 Ga0496124_0007149
1548 Ga0496124_0008850
1549 Ga0496124_0077460
1550 Ga0496124_0080829
1551 Ga0496124_0134881
1552 Ga0496124_0230198
1553 Ga0496124_0271211
1554 Ga0496125_0004406
1555 Ga0496125_0005552
1556 Ga0496125_0005750
1557 Ga0496125_0006890
1558 Ga0496125_0044519
1559 Ga0496125_0056447
1560 Ga0496125_0090789
1561 Ga0496126_0005914
1562 Ga0496126_0009365
1563 Ga0496126_0042951
1564 Ga0496126_0061724
1565 Ga0496126_0136876
1566 Ga0496126_0149731
1567 Ga0496126_0196653
1568 Ga0496126_0235085
1569 Ga0496126_0620767
1570 Ga0495678_000496
1571 Ga0495682_0005490
1572 Ga0495682_0011390
1573 Ga0501290_022888
1574 Ga0501031_0005288
1575 Ga0501031_0017026
1576 Ga0501031_0251651
1577 Ga0501032_0034586
1578 Ga0501032_0079460
1579 Ga0501033_0000625
1580 Ga0501033_0068791
1581 Ga0501033_0240145
1582 Ga0501033_0244952
1583 Ga0501033_0270756
1584 Ga0501034_0001242
1585 Ga0501034_0008327
1586 Ga0501034_0020621
1587 Ga0501034_0391135
1588 Ga0501034_0412529
1589 Ga0501034_0501945
1590 Ga0501036_0014053
1591 Ga0501036_0039262
1592 Ga0501037_0001197
1593 Ga0501037_0211476
1594 Ga0501038_0001241
1595 Ga0501038_0021584
1596 Ga0501038_0489529
1597 Ga0501039_0020714
1598 Ga0501039_0040990
1599 Ga0501039_0578773
1600 Ga0501042_0627364
1601 Ga0501043_0020013
1602 Ga0501043_0053496
1603 Ga0501043_0178100
1604 Ga0501043_0697854
1605 Ga0501043_0818585
1606 Ga0501046_0130135
1607 Ga0501047_0055064
1608 Ga0501047_0201272
1609 Ga0501047_0370336
1610 Ga0501047_0400592
1611 Ga0501048_0219207
1612 Ga0501068_0072238
1613 Ga0501069_0565928
1614 Ga0501070_0271621
1615 Ga0501070_0518607
1616 Ga0501070_0794491
1617 Ga0501073_0031382
1618 Ga0501217_112051
1619 Ga0501223_008846
1620 Ga0501239_012302
1621 Ga0501243_005519
1622 Ga0501253_033769
1623 Ga0501225_0103046
1624 Ga0501245_014636
1625 Ga0501079_0166991
1626 Ga0501080_0002129
1627 Ga0501080_0023252
1628 Ga0501266_003858
1629 Ga0501266_018515
1630 Ga0501266_021107
1631 Ga0501267_013704
1632 Ga0501268_026763
1633 Ga0501270_018667
1634 Ga0501035_0002247
1635 Ga0501035_0009719
1636 Ga0501035_0076487
1637 Ga0501035_0084774
1638 Ga0501035_0301957
1639 Ga0501035_0349423
1640 Ga0501044_0002685
1641 Ga0501044_0019061
1642 Ga0501044_0037487
1643 Ga0501044_0051758
1644 Ga0501044_0096927
1645 Ga0501044_0277800
1646 Ga0501045_0279450
1647 nmdc:mga03n38_197259_c1
1648 nmdc:mga00v17_113447_c1
1649 nmdc:mga00v17_1287_c1
1650 nmdc:mga00v17_129755_c1
1651 nmdc:mga00v17_18002_c1
1652 nmdc:mga00v17_56465_c1
1653 nmdc:mga0yw44_122802_c1
1654 nmdc:mga0yw44_307442_c1
1655 nmdc:mga07m45_127220_c1
1656 nmdc:mga0sz30_40870_c2
1657 Ga0500643_000029
1658 Ga0500643_006120
1659 Ga0500555_000324
1660 Ga0500572_070424
1661 Ga0500597_000107
1662 Ga0500626_103771
1663 Ga0500622_0211417
1664 Ga0500633_0019341
1665 Ga0500634_0000022
1666 Ga0500645_001107
1667 2525556445
1668 2538833582
1669 2572254414
1670 2578457177
1671 2595449018
1672 2595450316
1673 2630649674
1674 2643816764
1675 2643880859
1676 2643905242
1677 2643914929
1678 2643938556
1679 2643973780
1680 2644077697
1681 2644528286
1682 2644661429
1683 2644693988
1684 2644699510
1685 2687584496
1686 2721025785
1687 2735834242
1688 2739225661
1689 2747950267
1690 2748019521
1691 2765580318
1692 2816518656
1693 2819566271
1694 2842395553
1695 2842759151
1696 2842783243
1697 2842917114
1698 2842920676
1699 2852652312
1700 2852686958
1701 2857445138
1702 2874222990
1703 2884339122
1704 2895499428
1705 2895512449
1706 2895522460
1707 2895525768
1708 2904466547
1709 2919086202
1710 2919092833
1711 2919137423
1712 2919406861
1713 2919515029
1714 2919676350
1715 2923517356
1716 2928499189
1717 2929196502
1718 2931383547
1719 2937614958
1720 2939589636
1721 2939624300
1722 2939630267
1723 2941471955
1724 2941478928
1725 2941493088
1726 2953995953
1727 2961049755
1728 2961066570
1729 2974307809
1730 2977248528
1731 2984516985
1732 2987608591
1733 2995953169
1734 8002871102
1735 8003016991
1736 8021626250
1737 8021627691
1738 8021651299

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04351

PilP

Pilus assembly protein, PilP

51

191

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2y4y-assembly1.cif.gz_A-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9279 84 173
2y4y-assembly1.cif.gz_C-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9172 90 173
2y4y-assembly1.cif.gz_A-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9172 84 173
2y4y-assembly1.cif.gz_D-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9123 88 172
2y4y-assembly1.cif.gz_B-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9047 90 173
ID Description Score Start End Superfamily
2y4yC00 Mainly Beta;Roll;SH3 type barrels.; 0.9172 90 173 2.30.30.830
2y4yC00 Mainly Beta;Roll;SH3 type barrels.; 0.8862 90 173 2.30.30.830
2lc4A00 Mainly Beta;Roll;SH3 type barrels.; 0.8465 82 175 2.30.30.830
2ivwA01 Mainly Beta;Roll;SH3 type barrels.; 0.8084 93 173 2.30.30.830
2ivwA01 Mainly Beta;Roll;SH3 type barrels.; 0.8 93 173 2.30.30.830
ID Description Score Start End GO Terms
AF-A0A3A4P2N5-F1-model_v4 Pilus assembly protein PilP 0.9401 93 172
AF-A0A382ZGV8-F1-model_v4 Pilus assembly protein PilP 0.939 83 175
AF-A0A534Q0G7-F1-model_v4 Pilus assembly protein PilP 0.9377 90 173
AF-A0A382XQ63-F1-model_v4 Pilus assembly protein PilP 0.9373 84 175
AF-A0A3B8WSG9-F1-model_v4 Pilus assembly protein PilP 0.9324 82 172

Map