F484126
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 869 | 423 | 1738 | 174 |
Family's Representative Sequence
| Representative Sequence | 3300046558|Ga0495633_0010539|Ga0495633_0010539_2889_3473 |
| Length | 194 |
| Sequence | MSMTSYKRLFCESLTKAAHIPVRGLFSCLALVLLLAGCARGVSSAPGDAPNLERWVAEVRARPAPALEPLPVMQQFETFEYAAQGMRDPFADAWVNPDAGNGLRPDPNRRKEPLEAFPLDSLNMVGTIGTGPAQVALVMAPDKVTYRVRSGIYMGQSDGRVTGVSDGHIELIELVPDGAGGWLERPASIALDDQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003558 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 18 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 69 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 83 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 84 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 85 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 97 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 109 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 110 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 112 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 179 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 180 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 181 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 182 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 183 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 184 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 185 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 187 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 188 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 189 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 190 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 192 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 193 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 194 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 195 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 196 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 199 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 200 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 201 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 202 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 203 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 204 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 205 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 206 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 207 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 218 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 219 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 220 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 221 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 222 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 223 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 224 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 225 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 226 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 227 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 228 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 229 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 230 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 231 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 232 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 233 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 234 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 235 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 236 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 281 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 282 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 283 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 284 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 287 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 288 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 289 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 290 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 291 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 292 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 293 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 294 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 295 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 296 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 297 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 298 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 299 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 300 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 301 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 302 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 305 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 323 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 324 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 325 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 326 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 327 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 328 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 329 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 332 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 333 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 334 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 335 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 339 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 340 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 341 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 342 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 343 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 344 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 345 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 346 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 347 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 348 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 349 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 350 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 351 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 352 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 353 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 354 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 355 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 356 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 357 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 358 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 359 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 360 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 361 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 362 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 363 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 364 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 365 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 366 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 367 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 368 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 369 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 370 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 371 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 372 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 373 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 374 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 375 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 376 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 377 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 378 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 379 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 380 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 381 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 382 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 383 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 384 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 385 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 386 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 387 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 388 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 389 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 390 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 391 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 392 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 393 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 394 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 395 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 396 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 397 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 398 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 399 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 400 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 401 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 402 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 403 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 404 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 405 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 406 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 407 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 408 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 409 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 410 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 411 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 412 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 413 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 414 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 415 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 416 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 417 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 418 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 419 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 420 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 421 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 422 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 423 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.91 |
| Metatranscriptomes | 0.81 |
| Isolates | 8.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 13.81 |
| Nodule | 0.12 |
| Rhizoplane | 4.95 |
| Rhizosphere | 62.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495633_0010539 | 3300046558 | Bacteria | 5039 |
| 2 | SwRhRL2b_contig_3797405 | 2162886007 | Bacteria | 1475 |
| 3 | JGI24736J21556_1001617 | 3300001904 | Bacteria | 4089 |
| 4 | JGI24740J21852_10040405 | 3300001979 | Bacteria | 1414 |
| 5 | JGI24738J21930_10001153 | 3300002075 | Bacteria | 7468 |
| 6 | JGI25156J39149_1007841 | 3300002705 | Bacteria | 2755 |
| 7 | JGI25157J39369_1001663 | 3300002741 | Bacteria | 7572 |
| 8 | JGI25152J39213_1000069 | 3300002773 | Bacteria | 67815 |
| 9 | JGI25150J39212_1000214 | 3300002774 | Bacteria | 31523 |
| 10 | JGI25150J39212_1000407 | 3300002774 | Bacteria | 19982 |
| 11 | JGI25150J39212_1027756 | 3300002774 | Bacteria | 807 |
| 12 | JGI25151J46595_10000105 | 3300003187 | Bacteria | 113763 |
| 13 | JGI25151J46595_10000116 | 3300003187 | Bacteria | 107172 |
| 14 | JGI25153J46596_10000077 | 3300003215 | Bacteria | 113763 |
| 15 | rootH2_10004458 | 3300003320 | Bacteria | 5849 |
| 16 | rootH2_10044786 | 3300003320 | Bacteria | 1918 |
| 17 | rootL2_10073749 | 3300003322 | Bacteria | 1619 |
| 18 | rootH1_10107485 | 3300003323 | Bacteria | 1101 |
| 19 | rootH1_10232895 | 3300003323 | Bacteria | 1448 |
| 20 | Ga0006558J51389_1028497 | 3300003558 | Bacteria | 1276 |
| 21 | Ga0006554J51385_1022338 | 3300003567 | Bacteria | 3527 |
| 22 | Ga0006562J51391_1012709 | 3300003578 | Bacteria | 7210 |
| 23 | Ga0006562J51391_1012711 | 3300003578 | Bacteria | 2130 |
| 24 | Ga0055542_1012758 | 3300003762 | Bacteria | 1442 |
| 25 | Ga0055529_1005753 | 3300003763 | Bacteria | 1768 |
| 26 | Ga0055526_1003098 | 3300003771 | Bacteria | 10789 |
| 27 | Ga0055537_1000088 | 3300003773 | Bacteria | 66713 |
| 28 | Ga0055537_1000812 | 3300003773 | Bacteria | 15462 |
| 29 | Ga0055524_1000074 | 3300003775 | Bacteria | 122843 |
| 30 | Ga0055524_1016948 | 3300003775 | Bacteria | 2588 |
| 31 | Ga0055524_1061261 | 3300003775 | Bacteria | 778 |
| 32 | Ga0055536_1001746 | 3300003781 | Bacteria | 12830 |
| 33 | Ga0055536_1006277 | 3300003781 | Bacteria | 5598 |
| 34 | Ga0055534_1000097 | 3300003784 | Bacteria | 67619 |
| 35 | Ga0055534_1000154 | 3300003784 | Bacteria | 51139 |
| 36 | Ga0055534_1011218 | 3300003784 | Bacteria | 1833 |
| 37 | Ga0055528_1000028 | 3300003790 | Bacteria | 122843 |
| 38 | Ga0055528_1001412 | 3300003790 | Bacteria | 14714 |
| 39 | Ga0055528_1002336 | 3300003790 | Bacteria | 10259 |
| 40 | Ga0055530_10001477 | 3300003791 | Bacteria | 17070 |
| 41 | Ga0055531_10002804 | 3300003794 | Bacteria | 11428 |
| 42 | Ga0055531_10013393 | 3300003794 | Bacteria | 3780 |
| 43 | Ga0055531_10017692 | 3300003794 | Bacteria | 2992 |
| 44 | Ga0055531_10030559 | 3300003794 | Bacteria | 1805 |
| 45 | Ga0058692_1000013 | 3300003856 | Bacteria | 316299 |
| 46 | Ga0058692_1000035 | 3300003856 | Bacteria | 152983 |
| 47 | Ga0065165_1000913 | 3300005262 | Bacteria | 38106 |
| 48 | Ga0065704_10098945 | 3300005289 | Bacteria | 2332 |
| 49 | Ga0065704_10281216 | 3300005289 | Bacteria | 921 |
| 50 | Ga0065715_10170654 | 3300005293 | Bacteria | 1549 |
| 51 | Ga0070658_10709156 | 3300005327 | Bacteria | 873 |
| 52 | Ga0070670_100022831 | 3300005331 | Bacteria | 5384 |
| 53 | Ga0070670_100046378 | 3300005331 | Bacteria | 3736 |
| 54 | Ga0070670_100073464 | 3300005331 | Bacteria | 2937 |
| 55 | Ga0070680_100389732 | 3300005336 | Bacteria | 1187 |
| 56 | Ga0070682_100008369 | 3300005337 | Bacteria | 5835 |
| 57 | Ga0070682_100105533 | 3300005337 | Bacteria | 1868 |
| 58 | Ga0070660_100089225 | 3300005339 | Bacteria | 2429 |
| 59 | Ga0070661_100214433 | 3300005344 | Bacteria | 1475 |
| 60 | Ga0070661_100330707 | 3300005344 | Bacteria | 1192 |
| 61 | Ga0070661_100491765 | 3300005344 | Bacteria | 981 |
| 62 | Ga0070668_100070732 | 3300005347 | Bacteria | 2717 |
| 63 | Ga0070668_100203858 | 3300005347 | Bacteria | 1624 |
| 64 | Ga0070668_101260099 | 3300005347 | Bacteria | 671 |
| 65 | Ga0070669_100054658 | 3300005353 | Bacteria | 2925 |
| 66 | Ga0070669_101051101 | 3300005353 | Bacteria | 700 |
| 67 | Ga0070675_100494163 | 3300005354 | Bacteria | 1102 |
| 68 | Ga0070671_100010249 | 3300005355 | Bacteria | 7523 |
| 69 | Ga0070671_101041160 | 3300005355 | Bacteria | 718 |
| 70 | Ga0070674_100053729 | 3300005356 | Bacteria | 2783 |
| 71 | Ga0070673_100426619 | 3300005364 | Bacteria | 1189 |
| 72 | Ga0070673_101124699 | 3300005364 | Bacteria | 734 |
| 73 | Ga0070659_100144222 | 3300005366 | Bacteria | 1940 |
| 74 | Ga0070667_100000085 | 3300005367 | Bacteria | 117695 |
| 75 | Ga0070714_100752166 | 3300005435 | Bacteria | 942 |
| 76 | Ga0070700_100575143 | 3300005441 | Bacteria | 879 |
| 77 | Ga0070663_100000045 | 3300005455 | Bacteria | 56569 |
| 78 | Ga0070663_100081842 | 3300005455 | Bacteria | 2374 |
| 79 | Ga0070663_100194098 | 3300005455 | Bacteria | 1582 |
| 80 | Ga0070678_100011851 | 3300005456 | Bacteria | 5394 |
| 81 | Ga0070678_100094369 | 3300005456 | Bacteria | 2303 |
| 82 | Ga0070681_10336561 | 3300005458 | Bacteria | 1419 |
| 83 | Ga0070681_10350114 | 3300005458 | Bacteria | 1387 |
| 84 | Ga0068867_100047934 | 3300005459 | Bacteria | 3142 |
| 85 | Ga0070679_100058369 | 3300005530 | Bacteria | 3845 |
| 86 | Ga0068853_100003376 | 3300005539 | Bacteria | 12224 |
| 87 | Ga0068853_100170552 | 3300005539 | Bacteria | 1968 |
| 88 | Ga0070672_100057956 | 3300005543 | Bacteria | 3042 |
| 89 | Ga0070696_100004017 | 3300005546 | Bacteria | 9808 |
| 90 | Ga0070693_100017003 | 3300005547 | Bacteria | 3775 |
| 91 | Ga0070665_100071908 | 3300005548 | Bacteria | 3466 |
| 92 | Ga0070665_100166741 | 3300005548 | Bacteria | 2205 |
| 93 | Ga0070665_100924316 | 3300005548 | Bacteria | 885 |
| 94 | Ga0068855_100013007 | 3300005563 | Bacteria | 10042 |
| 95 | Ga0068855_101271375 | 3300005563 | Bacteria | 763 |
| 96 | Ga0070664_100084386 | 3300005564 | Bacteria | 2742 |
| 97 | Ga0070664_101231545 | 3300005564 | Bacteria | 706 |
| 98 | Ga0068854_100176852 | 3300005578 | Bacteria | 1664 |
| 99 | Ga0068856_100000524 | 3300005614 | Bacteria | 42396 |
| 100 | Ga0068851_10354686 | 3300005834 | Bacteria | 854 |
| 101 | Ga0068851_10625703 | 3300005834 | Bacteria | 657 |
| 102 | Ga0068863_100123053 | 3300005841 | Bacteria | 2475 |
| 103 | Ga0068858_101627569 | 3300005842 | Unclassified | 637 |
| 104 | Ga0081539_10019407 | 3300005985 | Bacteria | 4655 |
| 105 | Ga0075365_10193304 | 3300006038 | Bacteria | 1424 |
| 106 | Ga0075364_10000775 | 3300006051 | Bacteria | 16800 |
| 107 | Ga0075364_10010917 | 3300006051 | Bacteria | 5504 |
| 108 | Ga0075364_10037648 | 3300006051 | Bacteria | 3133 |
| 109 | Ga0075364_10577264 | 3300006051 | Bacteria | 768 |
| 110 | Ga0075369_10181360 | 3300006186 | Bacteria | 969 |
| 111 | Ga0075369_10296146 | 3300006186 | Bacteria | 755 |
| 112 | Ga0075370_10085036 | 3300006353 | Bacteria | 1821 |
| 113 | Ga0097620_100383554 | 3300006931 | Bacteria | 1501 |
| 114 | Ga0105251_10019456 | 3300009011 | Bacteria | 3586 |
| 115 | Ga0105244_10023892 | 3300009036 | Bacteria | 3343 |
| 116 | Ga0105244_10038830 | 3300009036 | Bacteria | 2481 |
| 117 | Ga0105244_10104717 | 3300009036 | Bacteria | 1381 |
| 118 | Ga0105240_10023122 | 3300009093 | Bacteria | 8229 |
| 119 | Ga0105240_10128175 | 3300009093 | Bacteria | 3046 |
| 120 | Ga0105240_10130625 | 3300009093 | Bacteria | 3013 |
| 121 | Ga0105247_10002807 | 3300009101 | Bacteria | 11651 |
| 122 | Ga0105247_10640208 | 3300009101 | Bacteria | 793 |
| 123 | Ga0105243_10122895 | 3300009148 | Bacteria | 2192 |
| 124 | Ga0105243_10207021 | 3300009148 | Bacteria | 1724 |
| 125 | Ga0105241_10252420 | 3300009174 | Bacteria | 1496 |
| 126 | Ga0105248_10000980 | 3300009177 | Bacteria | 31690 |
| 127 | Ga0105237_10000036 | 3300009545 | Bacteria | 191142 |
| 128 | Ga0105237_10006112 | 3300009545 | Bacteria | 13457 |
| 129 | Ga0105237_10546847 | 3300009545 | Bacteria | 1164 |
| 130 | Ga0105249_10000335 | 3300009553 | Bacteria | 47511 |
| 131 | Ga0105028_107380 | 3300009993 | Bacteria | 1149 |
| 132 | Ga0105239_10000027 | 3300010375 | Bacteria | 248028 |
| 133 | Ga0105239_10202899 | 3300010375 | Bacteria | 2222 |
| 134 | Ga0105239_10416482 | 3300010375 | Bacteria | 1521 |
| 135 | Ga0105239_10992781 | 3300010375 | Bacteria | 965 |
| 136 | Ga0157318_1002656 | 3300012482 | Bacteria | 990 |
| 137 | Ga0157329_1001393 | 3300012491 | Bacteria | 1221 |
| 138 | Ga0157313_1002762 | 3300012503 | Bacteria | 1080 |
| 139 | Ga0157327_1000513 | 3300012512 | Bacteria | 2101 |
| 140 | Ga0157373_10073514 | 3300013100 | Bacteria | 2412 |
| 141 | Ga0157373_10152758 | 3300013100 | Bacteria | 1624 |
| 142 | Ga0157373_10377225 | 3300013100 | Bacteria | 1014 |
| 143 | Ga0157371_10000184 | 3300013102 | Bacteria | 92100 |
| 144 | Ga0157371_10079356 | 3300013102 | Bacteria | 2325 |
| 145 | Ga0157371_10120730 | 3300013102 | Bacteria | 1863 |
| 146 | Ga0157371_10190080 | 3300013102 | Bacteria | 1470 |
| 147 | Ga0157371_10678202 | 3300013102 | Bacteria | 770 |
| 148 | Ga0157370_10000045 | 3300013104 | Bacteria | 127627 |
| 149 | Ga0157370_10001564 | 3300013104 | Bacteria | 28327 |
| 150 | Ga0157370_10015409 | 3300013104 | Bacteria | 7770 |
| 151 | Ga0157370_10019467 | 3300013104 | Bacteria | 6808 |
| 152 | Ga0157370_10096821 | 3300013104 | Bacteria | 2768 |
| 153 | Ga0157370_10270060 | 3300013104 | Bacteria | 1571 |
| 154 | Ga0157370_10366785 | 3300013104 | Bacteria | 1327 |
| 155 | Ga0157370_10435598 | 3300013104 | Bacteria | 1206 |
| 156 | Ga0157369_10000745 | 3300013105 | Bacteria | 41913 |
| 157 | Ga0157369_10011268 | 3300013105 | Bacteria | 10158 |
| 158 | Ga0157369_10048745 | 3300013105 | Bacteria | 4595 |
| 159 | Ga0163162_10325108 | 3300013306 | Bacteria | 1670 |
| 160 | Ga0163162_10398573 | 3300013306 | Bacteria | 1509 |
| 161 | Ga0157372_10021401 | 3300013307 | Bacteria | 6986 |
| 162 | Ga0157372_10162705 | 3300013307 | Bacteria | 2580 |
| 163 | Ga0157372_10787582 | 3300013307 | Bacteria | 1105 |
| 164 | Ga0157375_10140509 | 3300013308 | Bacteria | 2542 |
| 165 | Ga0157375_10169912 | 3300013308 | Bacteria | 2327 |
| 166 | Ga0157380_10098081 | 3300014326 | Bacteria | 2434 |
| 167 | Ga0157380_10371759 | 3300014326 | Bacteria | 1346 |
| 168 | Ga0157380_10530188 | 3300014326 | Bacteria | 1150 |
| 169 | Ga0182008_10004060 | 3300014497 | Bacteria | 8640 |
| 170 | Ga0182008_10023563 | 3300014497 | Bacteria | 3142 |
| 171 | Ga0182008_10037026 | 3300014497 | Bacteria | 2441 |
| 172 | Ga0182008_10311799 | 3300014497 | Bacteria | 826 |
| 173 | Ga0157379_10935563 | 3300014968 | Bacteria | 824 |
| 174 | Ga0182006_1000479 | 3300015261 | Bacteria | 31307 |
| 175 | Ga0182006_1003624 | 3300015261 | Bacteria | 7845 |
| 176 | Ga0182006_1022419 | 3300015261 | Bacteria | 2625 |
| 177 | Ga0182007_10000219 | 3300015262 | Bacteria | 38463 |
| 178 | Ga0182007_10033459 | 3300015262 | Bacteria | 1742 |
| 179 | Ga0182005_1000113 | 3300015265 | Bacteria | 58004 |
| 180 | Ga0182005_1000213 | 3300015265 | Bacteria | 38351 |
| 181 | Ga0182005_1001646 | 3300015265 | Bacteria | 8686 |
| 182 | Ga0182005_1001924 | 3300015265 | Bacteria | 7868 |
| 183 | Ga0182005_1006350 | 3300015265 | Bacteria | 3624 |
| 184 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 185 | Ga0163161_10007925 | 3300017792 | Bacteria | 7353 |
| 186 | Ga0163161_10020842 | 3300017792 | Bacteria | 4603 |
| 187 | Ga0163161_10050833 | 3300017792 | Bacteria | 3001 |
| 188 | Ga0163161_10118324 | 3300017792 | Bacteria | 1988 |
| 189 | Ga0163161_10480889 | 3300017792 | Bacteria | 1008 |
| 190 | Ga0206356_10491941 | 3300020070 | Bacteria | 2892 |
| 191 | Ga0206353_10172233 | 3300020082 | Bacteria | 1369 |
| 192 | Ga0224712_10118197 | 3300022467 | Bacteria | 1145 |
| 193 | Ga0209674_100791 | 3300025226 | Bacteria | 10635 |
| 194 | Ga0209147_102946 | 3300025229 | Bacteria | 3688 |
| 195 | Ga0209437_102834 | 3300025233 | Bacteria | 3253 |
| 196 | Ga0207425_1000045 | 3300025245 | Bacteria | 194257 |
| 197 | Ga0207425_1004713 | 3300025245 | Bacteria | 4025 |
| 198 | Ga0209646_1002196 | 3300025246 | Bacteria | 4508 |
| 199 | Ga0209026_1000223 | 3300025250 | Bacteria | 77328 |
| 200 | Ga0209148_1000762 | 3300025254 | Bacteria | 24561 |
| 201 | Ga0209759_1014486 | 3300025256 | Bacteria | 2083 |
| 202 | Ga0209129_1000057 | 3300025258 | Bacteria | 253632 |
| 203 | Ga0209129_1001090 | 3300025258 | Bacteria | 15870 |
| 204 | Ga0209565_1000023 | 3300025263 | Bacteria | 388244 |
| 205 | Ga0209565_1000034 | 3300025263 | Bacteria | 312950 |
| 206 | Ga0209565_1019738 | 3300025263 | Bacteria | 1433 |
| 207 | Ga0209455_1000430 | 3300025272 | Bacteria | 32798 |
| 208 | Ga0209673_1000039 | 3300025273 | Bacteria | 312950 |
| 209 | Ga0209673_1000047 | 3300025273 | Bacteria | 289276 |
| 210 | Ga0209673_1029483 | 3300025273 | Bacteria | 1746 |
| 211 | Ga0209130_1002629 | 3300025284 | Bacteria | 8633 |
| 212 | Ga0209130_1024994 | 3300025284 | Bacteria | 1298 |
| 213 | Ga0209675_1000016 | 3300025291 | Bacteria | 391965 |
| 214 | Ga0209675_1000023 | 3300025291 | Bacteria | 312950 |
| 215 | Ga0209675_1008269 | 3300025291 | Bacteria | 3851 |
| 216 | Ga0209675_1046930 | 3300025291 | Bacteria | 910 |
| 217 | Ga0209676_1000027 | 3300025292 | Bacteria | 560222 |
| 218 | Ga0209676_1000037 | 3300025292 | Bacteria | 457562 |
| 219 | Ga0209676_1000160 | 3300025292 | Bacteria | 161069 |
| 220 | Ga0209676_1000280 | 3300025292 | Bacteria | 105988 |
| 221 | Ga0209676_1002509 | 3300025292 | Bacteria | 12849 |
| 222 | Ga0209676_1003026 | 3300025292 | Bacteria | 10906 |
| 223 | Ga0209025_1000013 | 3300025294 | Bacteria | 871757 |
| 224 | Ga0209025_1000023 | 3300025294 | Bacteria | 541307 |
| 225 | Ga0209025_1002654 | 3300025294 | Bacteria | 18290 |
| 226 | Ga0209025_1028791 | 3300025294 | Bacteria | 2709 |
| 227 | Ga0209025_1030183 | 3300025294 | Bacteria | 2601 |
| 228 | Ga0209564_1000066 | 3300025295 | Bacteria | 312899 |
| 229 | Ga0209564_1000194 | 3300025295 | Bacteria | 141518 |
| 230 | Ga0209564_1004607 | 3300025295 | Bacteria | 8314 |
| 231 | Ga0209758_1000014 | 3300025297 | Bacteria | 871757 |
| 232 | Ga0209758_1008048 | 3300025297 | Bacteria | 6957 |
| 233 | Ga0209050_1000352 | 3300025298 | Bacteria | 88558 |
| 234 | Ga0209050_1000714 | 3300025298 | Bacteria | 48752 |
| 235 | Ga0209050_1000833 | 3300025298 | Bacteria | 42666 |
| 236 | Ga0209050_1010110 | 3300025298 | Bacteria | 4698 |
| 237 | Ga0209050_1026372 | 3300025298 | Bacteria | 1946 |
| 238 | Ga0209256_1000048 | 3300025299 | Bacteria | 312899 |
| 239 | Ga0209256_1003154 | 3300025299 | Bacteria | 11970 |
| 240 | Ga0209256_1003863 | 3300025299 | Bacteria | 9967 |
| 241 | Ga0209256_1005406 | 3300025299 | Bacteria | 7382 |
| 242 | Ga0209256_1020798 | 3300025299 | Bacteria | 2036 |
| 243 | Ga0209256_1020801 | 3300025299 | Bacteria | 2036 |
| 244 | Ga0207426_1017565 | 3300025302 | Bacteria | 2540 |
| 245 | Ga0209051_1001947 | 3300025303 | Bacteria | 15883 |
| 246 | Ga0209051_1002836 | 3300025303 | Bacteria | 11944 |
| 247 | Ga0209051_1006389 | 3300025303 | Bacteria | 6657 |
| 248 | Ga0209257_1000046 | 3300025304 | Bacteria | 477765 |
| 249 | Ga0209257_1000177 | 3300025304 | Bacteria | 161069 |
| 250 | Ga0209257_1000198 | 3300025304 | Bacteria | 149013 |
| 251 | Ga0209257_1000219 | 3300025304 | Bacteria | 135666 |
| 252 | Ga0209257_1000383 | 3300025304 | Bacteria | 88315 |
| 253 | Ga0209257_1003088 | 3300025304 | Bacteria | 14974 |
| 254 | Ga0209257_1003813 | 3300025304 | Bacteria | 12380 |
| 255 | Ga0209257_1007629 | 3300025304 | Bacteria | 6484 |
| 256 | Ga0209257_1026691 | 3300025304 | Bacteria | 1939 |
| 257 | Ga0209257_1034119 | 3300025304 | Bacteria | 1592 |
| 258 | Ga0209257_1066742 | 3300025304 | Bacteria | 961 |
| 259 | Ga0207655_1033595 | 3300025728 | Bacteria | 2321 |
| 260 | Ga0207713_1066409 | 3300025735 | Bacteria | 1350 |
| 261 | Ga0207682_10014641 | 3300025893 | Bacteria | 3057 |
| 262 | Ga0207710_10005864 | 3300025900 | Bacteria | 5268 |
| 263 | Ga0207647_10000015 | 3300025904 | Bacteria | 138626 |
| 264 | Ga0207647_10076216 | 3300025904 | Bacteria | 2017 |
| 265 | Ga0207705_10108347 | 3300025909 | Bacteria | 2050 |
| 266 | Ga0207654_10128999 | 3300025911 | Bacteria | 1598 |
| 267 | Ga0207707_10026404 | 3300025912 | Bacteria | 5076 |
| 268 | Ga0207707_10369250 | 3300025912 | Bacteria | 1235 |
| 269 | Ga0207695_10000441 | 3300025913 | Bacteria | 90937 |
| 270 | Ga0207695_10003481 | 3300025913 | Bacteria | 22147 |
| 271 | Ga0207671_10000135 | 3300025914 | Bacteria | 112401 |
| 272 | Ga0207671_10003134 | 3300025914 | Bacteria | 16798 |
| 273 | Ga0207657_10003190 | 3300025919 | Bacteria | 17543 |
| 274 | Ga0207657_10351503 | 3300025919 | Bacteria | 1162 |
| 275 | Ga0207649_10152857 | 3300025920 | Bacteria | 1591 |
| 276 | Ga0207652_10131701 | 3300025921 | Bacteria | 2230 |
| 277 | Ga0207652_10494603 | 3300025921 | Bacteria | 1101 |
| 278 | Ga0207681_10041006 | 3300025923 | Bacteria | 3084 |
| 279 | Ga0207681_10690832 | 3300025923 | Bacteria | 848 |
| 280 | Ga0207694_10025255 | 3300025924 | Bacteria | 4515 |
| 281 | Ga0207694_10159608 | 3300025924 | Bacteria | 1820 |
| 282 | Ga0207650_10047972 | 3300025925 | Bacteria | 3149 |
| 283 | Ga0207650_10048024 | 3300025925 | Bacteria | 3146 |
| 284 | Ga0207650_10051036 | 3300025925 | Bacteria | 3060 |
| 285 | Ga0207644_10060876 | 3300025931 | Bacteria | 2732 |
| 286 | Ga0207644_10113072 | 3300025931 | Bacteria | 2056 |
| 287 | Ga0207690_10250292 | 3300025932 | Bacteria | 1368 |
| 288 | Ga0207706_10589886 | 3300025933 | Bacteria | 955 |
| 289 | Ga0207709_10002407 | 3300025935 | Bacteria | 11766 |
| 290 | Ga0207709_10020776 | 3300025935 | Bacteria | 3708 |
| 291 | Ga0207669_10045553 | 3300025937 | Bacteria | 2585 |
| 292 | Ga0207691_10019809 | 3300025940 | Bacteria | 6364 |
| 293 | Ga0207711_10004824 | 3300025941 | Bacteria | 11459 |
| 294 | Ga0207679_10124890 | 3300025945 | Bacteria | 2055 |
| 295 | Ga0207667_10075026 | 3300025949 | Bacteria | 3512 |
| 296 | Ga0207667_10263378 | 3300025949 | Bacteria | 1763 |
| 297 | Ga0207667_11129593 | 3300025949 | Bacteria | 766 |
| 298 | Ga0207651_10216836 | 3300025960 | Bacteria | 1544 |
| 299 | Ga0207712_10001764 | 3300025961 | Bacteria | 14433 |
| 300 | Ga0207668_10023924 | 3300025972 | Bacteria | 3935 |
| 301 | Ga0207640_10003213 | 3300025981 | Bacteria | 8805 |
| 302 | Ga0207658_10000032 | 3300025986 | Bacteria | 162260 |
| 303 | Ga0207658_10244527 | 3300025986 | Bacteria | 1522 |
| 304 | Ga0207677_10307158 | 3300026023 | Bacteria | 1313 |
| 305 | Ga0207639_10031649 | 3300026041 | Bacteria | 3889 |
| 306 | Ga0207639_10131720 | 3300026041 | Bacteria | 2071 |
| 307 | Ga0207678_10000457 | 3300026067 | Bacteria | 37030 |
| 308 | Ga0207678_10000643 | 3300026067 | Bacteria | 32112 |
| 309 | Ga0207678_10147929 | 3300026067 | Bacteria | 2005 |
| 310 | Ga0207702_10003652 | 3300026078 | Bacteria | 13940 |
| 311 | Ga0207641_10243464 | 3300026088 | Bacteria | 1677 |
| 312 | Ga0207648_10208557 | 3300026089 | Bacteria | 1734 |
| 313 | Ga0207676_10065408 | 3300026095 | Bacteria | 2895 |
| 314 | Ga0207683_10020246 | 3300026121 | Bacteria | 5688 |
| 315 | Ga0207683_10022073 | 3300026121 | Bacteria | 5462 |
| 316 | Ga0209371_1000007 | 3300027312 | Bacteria | 1050654 |
| 317 | Ga0209371_1000043 | 3300027312 | Bacteria | 331009 |
| 318 | Ga0209981_1027589 | 3300027378 | Bacteria | 827 |
| 319 | Ga0209981_1030747 | 3300027378 | Bacteria | 787 |
| 320 | Ga0209984_1003224 | 3300027424 | Bacteria | 1857 |
| 321 | Ga0210000_1003909 | 3300027462 | Bacteria | 2157 |
| 322 | Ga0209995_1000902 | 3300027471 | Bacteria | 4606 |
| 323 | Ga0209999_1000249 | 3300027543 | Bacteria | 7797 |
| 324 | Ga0209982_1002809 | 3300027552 | Bacteria | 2452 |
| 325 | Ga0209970_1002517 | 3300027614 | Bacteria | 3108 |
| 326 | Ga0209983_1006804 | 3300027665 | Bacteria | 2346 |
| 327 | Ga0209971_1000743 | 3300027682 | Bacteria | 8388 |
| 328 | Ga0209974_10034122 | 3300027876 | Bacteria | 1690 |
| 329 | Ga0268266_10124490 | 3300028379 | Bacteria | 2298 |
| 330 | Ga0268266_10187018 | 3300028379 | Bacteria | 1889 |
| 331 | Ga0268266_10358741 | 3300028379 | Bacteria | 1371 |
| 332 | Ga0268266_10727213 | 3300028379 | Bacteria | 957 |
| 333 | Ga0268256_1000008 | 3300030500 | Bacteria | 1050654 |
| 334 | Ga0268256_1000044 | 3300030500 | Bacteria | 330997 |
| 335 | Ga0316176_1036603 | 3300030732 | Bacteria | 2284 |
| 336 | Ga0316176_1043775 | 3300030732 | Bacteria | 994 |
| 337 | Ga0314311_1072890 | 3300030733 | Bacteria | 2202 |
| 338 | Ga0316183_1159014 | 3300030742 | Bacteria | 2300 |
| 339 | Ga0316181_1256419 | 3300030744 | Bacteria | 1529 |
| 340 | Ga0316182_1115502 | 3300030745 | Bacteria | 4516 |
| 341 | Ga0307513_10037233 | 3300031456 | Bacteria | 5417 |
| 342 | Ga0307513_10267221 | 3300031456 | Bacteria | 1496 |
| 343 | Ga0307408_100022323 | 3300031548 | Bacteria | 4299 |
| 344 | Ga0307408_100216471 | 3300031548 | Bacteria | 1560 |
| 345 | Ga0307408_101240522 | 3300031548 | Bacteria | 697 |
| 346 | Ga0307405_10022245 | 3300031731 | Bacteria | 3581 |
| 347 | Ga0307405_10070178 | 3300031731 | Bacteria | 2249 |
| 348 | Ga0307413_10001208 | 3300031824 | Bacteria | 9557 |
| 349 | Ga0307413_10020613 | 3300031824 | Bacteria | 3511 |
| 350 | Ga0307413_10041782 | 3300031824 | Bacteria | 2688 |
| 351 | Ga0307413_10044622 | 3300031824 | Bacteria | 2621 |
| 352 | Ga0307413_10050947 | 3300031824 | Bacteria | 2491 |
| 353 | Ga0307413_10073588 | 3300031824 | Bacteria | 2160 |
| 354 | Ga0307413_10388326 | 3300031824 | Bacteria | 1090 |
| 355 | Ga0307413_10475602 | 3300031824 | Bacteria | 997 |
| 356 | Ga0307413_10773997 | 3300031824 | Bacteria | 804 |
| 357 | Ga0307413_10870234 | 3300031824 | Bacteria | 763 |
| 358 | Ga0307413_11370484 | 3300031824 | Bacteria | 621 |
| 359 | Ga0307410_10014783 | 3300031852 | Bacteria | 4607 |
| 360 | Ga0307410_10123834 | 3300031852 | Bacteria | 1889 |
| 361 | Ga0307410_10149155 | 3300031852 | Bacteria | 1739 |
| 362 | Ga0307410_10300824 | 3300031852 | Bacteria | 1266 |
| 363 | Ga0307410_10368852 | 3300031852 | Bacteria | 1152 |
| 364 | Ga0307406_10000978 | 3300031901 | Bacteria | 15942 |
| 365 | Ga0307406_10013019 | 3300031901 | Bacteria | 4756 |
| 366 | Ga0307406_10312628 | 3300031901 | Bacteria | 1212 |
| 367 | Ga0307406_10699296 | 3300031901 | Bacteria | 846 |
| 368 | Ga0307407_10076809 | 3300031903 | Bacteria | 2006 |
| 369 | Ga0307407_10127462 | 3300031903 | Bacteria | 1623 |
| 370 | Ga0307407_10228856 | 3300031903 | Bacteria | 1261 |
| 371 | Ga0307412_10000418 | 3300031911 | Bacteria | 25962 |
| 372 | Ga0307412_10001816 | 3300031911 | Bacteria | 11811 |
| 373 | Ga0307412_10031352 | 3300031911 | Bacteria | 3357 |
| 374 | Ga0307412_10045343 | 3300031911 | Bacteria | 2873 |
| 375 | Ga0307412_10075722 | 3300031911 | Bacteria | 2309 |
| 376 | Ga0307412_10091960 | 3300031911 | Bacteria | 2125 |
| 377 | Ga0307412_10192504 | 3300031911 | Bacteria | 1543 |
| 378 | Ga0307412_10335285 | 3300031911 | Bacteria | 1208 |
| 379 | Ga0307409_100031440 | 3300031995 | Bacteria | 3831 |
| 380 | Ga0307409_100046744 | 3300031995 | Bacteria | 3279 |
| 381 | Ga0307409_100996607 | 3300031995 | Bacteria | 856 |
| 382 | Ga0307416_100014059 | 3300032002 | Bacteria | 5466 |
| 383 | Ga0307416_100039180 | 3300032002 | Bacteria | 3666 |
| 384 | Ga0307416_101238140 | 3300032002 | Bacteria | 852 |
| 385 | Ga0307414_10001338 | 3300032004 | Bacteria | 12742 |
| 386 | Ga0307414_10003104 | 3300032004 | Bacteria | 8824 |
| 387 | Ga0307414_10021898 | 3300032004 | Bacteria | 4023 |
| 388 | Ga0307414_10036736 | 3300032004 | Bacteria | 3273 |
| 389 | Ga0307414_10055143 | 3300032004 | Bacteria | 2781 |
| 390 | Ga0307414_10062348 | 3300032004 | Bacteria | 2645 |
| 391 | Ga0307414_10079320 | 3300032004 | Bacteria | 2396 |
| 392 | Ga0307414_10116249 | 3300032004 | Bacteria | 2047 |
| 393 | Ga0307414_10155622 | 3300032004 | Bacteria | 1809 |
| 394 | Ga0307414_10260251 | 3300032004 | Bacteria | 1447 |
| 395 | Ga0307414_10344181 | 3300032004 | Bacteria | 1277 |
| 396 | Ga0307414_10641852 | 3300032004 | Bacteria | 956 |
| 397 | Ga0307414_10676518 | 3300032004 | Bacteria | 932 |
| 398 | Ga0307411_10002861 | 3300032005 | Bacteria | 7797 |
| 399 | Ga0307411_10054444 | 3300032005 | Bacteria | 2627 |
| 400 | Ga0307411_10056552 | 3300032005 | Bacteria | 2586 |
| 401 | Ga0307411_10105527 | 3300032005 | Bacteria | 2003 |
| 402 | Ga0307411_10165982 | 3300032005 | Bacteria | 1660 |
| 403 | Ga0307411_10183876 | 3300032005 | Bacteria | 1589 |
| 404 | Ga0307411_10203128 | 3300032005 | Bacteria | 1524 |
| 405 | Ga0307411_10237077 | 3300032005 | Bacteria | 1426 |
| 406 | Ga0307411_10506159 | 3300032005 | Bacteria | 1022 |
| 407 | Ga0307411_10558553 | 3300032005 | Bacteria | 978 |
| 408 | Ga0307411_10562721 | 3300032005 | Bacteria | 974 |
| 409 | Ga0373928_0179764 | 3300035084 | Bacteria | 601 |
| 410 | Ga0395899_0017129 | 3300037312 | Bacteria | 5522 |
| 411 | Ga0395900_0042677 | 3300037418 | Bacteria | 4673 |
| 412 | Ga0395898_0176943 | 3300037466 | Bacteria | 2039 |
| 413 | Ga0395905_0000337 | 3300037471 | Bacteria | 67116 |
| 414 | Ga0395905_0006093 | 3300037471 | Bacteria | 12181 |
| 415 | Ga0395905_0019088 | 3300037471 | Bacteria | 6503 |
| 416 | Ga0395905_0376645 | 3300037471 | Bacteria | 1313 |
| 417 | Ga0395905_0565449 | 3300037471 | Bacteria | 1038 |
| 418 | Ga0395901_0088389 | 3300038443 | Bacteria | 3241 |
| 419 | Ga0395901_0578455 | 3300038443 | Bacteria | 1135 |
| 420 | Ga0237819_00177 | 3300038705 | Bacteria | 23554 |
| 421 | Ga0237819_02977 | 3300038705 | Bacteria | 3158 |
| 422 | Ga0237816_03081 | 3300039145 | Bacteria | 1236 |
| 423 | Ga0439436_0000007 | 3300041404 | Bacteria | 120812 |
| 424 | Ga0439436_0034362 | 3300041404 | Bacteria | 1466 |
| 425 | Ga0439439_0018180 | 3300041406 | Bacteria | 1735 |
| 426 | Ga0439447_000808 | 3300041407 | Bacteria | 11507 |
| 427 | Ga0439465_0000214 | 3300041413 | Bacteria | 15475 |
| 428 | Ga0439465_0000377 | 3300041413 | Bacteria | 12805 |
| 429 | Ga0439465_0000615 | 3300041413 | Bacteria | 10825 |
| 430 | Ga0439465_0003455 | 3300041413 | Bacteria | 5153 |
| 431 | Ga0439465_0017038 | 3300041413 | Bacteria | 2267 |
| 432 | Ga0451787_725098 | 3300041441 | Bacteria | 935 |
| 433 | Ga0451789_0245027 | 3300041443 | Bacteria | 704 |
| 434 | Ga0451789_1055925 | 3300041443 | Bacteria | 932 |
| 435 | Ga0451791_0725227 | 3300041451 | Bacteria | 669 |
| 436 | Ga0451791_0976915 | 3300041451 | Bacteria | 1541 |
| 437 | Ga0451791_1601024 | 3300041451 | Bacteria | 728 |
| 438 | Ga0451793_1805861 | 3300041452 | Bacteria | 1186 |
| 439 | Ga0451797_1565887 | 3300041453 | Bacteria | 849 |
| 440 | Ga0451795_0661403 | 3300041456 | Bacteria | 1255 |
| 441 | Ga0451800_1649814 | 3300041459 | Bacteria | 2090 |
| 442 | Ga0451806_152401 | 3300041462 | Bacteria | 4074 |
| 443 | Ga0451804_0876128 | 3300041463 | Bacteria | 735 |
| 444 | Ga0451804_1077436 | 3300041463 | Bacteria | 3811 |
| 445 | Ga0451804_1170276 | 3300041463 | Bacteria | 621 |
| 446 | Ga0451807_0590162 | 3300041486 | Bacteria | 4065 |
| 447 | Ga0451807_1916965 | 3300041486 | Bacteria | 1280 |
| 448 | Ga0451837_1238404 | 3300041494 | Bacteria | 940 |
| 449 | Ga0451837_1399073 | 3300041494 | Bacteria | 2360 |
| 450 | Ga0451847_0196122 | 3300041503 | Bacteria | 1097 |
| 451 | Ga0451843_0056262 | 3300041509 | Bacteria | 2570 |
| 452 | Ga0451843_0193634 | 3300041509 | Bacteria | 1300 |
| 453 | Ga0451843_1149050 | 3300041509 | Bacteria | 2679 |
| 454 | Ga0451853_1261890 | 3300041512 | Bacteria | 2001 |
| 455 | Ga0451853_1606826 | 3300041512 | Bacteria | 698 |
| 456 | Ga0451853_3210631 | 3300041512 | Unclassified | 688 |
| 457 | Ga0451853_4086402 | 3300041512 | Bacteria | 847 |
| 458 | Ga0439433_0026674 | 3300041999 | Bacteria | 1308 |
| 459 | Ga0439433_0030390 | 3300041999 | Bacteria | 1235 |
| 460 | Ga0439433_0077449 | 3300041999 | Bacteria | 806 |
| 461 | Ga0439445_0012311 | 3300042004 | Bacteria | 2053 |
| 462 | Ga0439445_0064993 | 3300042004 | Bacteria | 1003 |
| 463 | Ga0439432_009293 | 3300042006 | Bacteria | 3432 |
| 464 | Ga0439432_015910 | 3300042006 | Bacteria | 2534 |
| 465 | Ga0439432_022919 | 3300042006 | Bacteria | 2060 |
| 466 | Ga0439432_026696 | 3300042006 | Bacteria | 1890 |
| 467 | Ga0439449_0000277 | 3300042007 | Bacteria | 18577 |
| 468 | Ga0439449_0003655 | 3300042007 | Bacteria | 5969 |
| 469 | Ga0439449_0009760 | 3300042007 | Bacteria | 3632 |
| 470 | Ga0439449_0022386 | 3300042007 | Bacteria | 2366 |
| 471 | Ga0439449_0050465 | 3300042007 | Bacteria | 1539 |
| 472 | Ga0439452_009962 | 3300042010 | Bacteria | 2782 |
| 473 | Ga0439455_0043457 | 3300042012 | Bacteria | 1157 |
| 474 | Ga0439462_0060166 | 3300042015 | Bacteria | 1028 |
| 475 | Ga0450911_000685 | 3300042115 | Bacteria | 10057 |
| 476 | Ga0450923_020142 | 3300042125 | Bacteria | 1291 |
| 477 | Ga0450908_000033 | 3300042184 | Bacteria | 31285 |
| 478 | Ga0466982_0010498 | 3300044672 | Bacteria | 4813 |
| 479 | Ga0453684_0000159 | 3300044712 | Bacteria | 300297 |
| 480 | Ga0466957_0041473 | 3300044842 | Bacteria | 2784 |
| 481 | Ga0451576_0000120 | 3300045051 | Bacteria | 199365 |
| 482 | Ga0466958_0509475 | 3300045836 | Bacteria | 781 |
| 483 | Ga0495617_000196 | 3300046452 | Bacteria | 38054 |
| 484 | Ga0495617_000318 | 3300046452 | Bacteria | 27031 |
| 485 | Ga0495627_010605 | 3300046453 | Bacteria | 3342 |
| 486 | Ga0495627_032692 | 3300046453 | Bacteria | 1636 |
| 487 | Ga0495627_051825 | 3300046453 | Bacteria | 1232 |
| 488 | Ga0495591_034329 | 3300046458 | Bacteria | 1494 |
| 489 | Ga0495638_0002849 | 3300046460 | Bacteria | 13863 |
| 490 | Ga0495638_0004464 | 3300046460 | Bacteria | 10598 |
| 491 | Ga0495638_0132268 | 3300046460 | Bacteria | 1464 |
| 492 | Ga0495650_0011065 | 3300046471 | Bacteria | 4979 |
| 493 | Ga0495584_0000437 | 3300046491 | Bacteria | 28733 |
| 494 | Ga0495585_0001305 | 3300046492 | Bacteria | 19892 |
| 495 | Ga0495585_0176303 | 3300046492 | Bacteria | 1101 |
| 496 | Ga0495607_0004515 | 3300046501 | Bacteria | 10213 |
| 497 | Ga0495607_0015294 | 3300046501 | Bacteria | 4976 |
| 498 | Ga0495607_0016250 | 3300046501 | Bacteria | 4805 |
| 499 | Ga0495607_0020055 | 3300046501 | Bacteria | 4232 |
| 500 | Ga0495607_0422864 | 3300046501 | Bacteria | 602 |
| 501 | Ga0495583_0015969 | 3300046506 | Bacteria | 4056 |
| 502 | Ga0495606_0003552 | 3300046507 | Bacteria | 16459 |
| 503 | Ga0495606_0005186 | 3300046507 | Bacteria | 12602 |
| 504 | Ga0495606_0060310 | 3300046507 | Bacteria | 2430 |
| 505 | Ga0495606_0077532 | 3300046507 | Bacteria | 2074 |
| 506 | Ga0495606_0127978 | 3300046507 | Bacteria | 1512 |
| 507 | Ga0495610_0000971 | 3300046512 | Bacteria | 26490 |
| 508 | Ga0495610_0015601 | 3300046512 | Bacteria | 4406 |
| 509 | Ga0495610_0016193 | 3300046512 | Bacteria | 4303 |
| 510 | Ga0495616_0001042 | 3300046513 | Bacteria | 19821 |
| 511 | Ga0495616_0184079 | 3300046513 | Bacteria | 926 |
| 512 | Ga0495620_0000846 | 3300046515 | Bacteria | 18912 |
| 513 | Ga0495620_0001915 | 3300046515 | Bacteria | 12191 |
| 514 | Ga0495631_0000878 | 3300046518 | Bacteria | 18807 |
| 515 | Ga0495631_0002764 | 3300046518 | Bacteria | 9736 |
| 516 | Ga0495631_0010947 | 3300046518 | Bacteria | 4477 |
| 517 | Ga0495632_0000014 | 3300046519 | Bacteria | 243913 |
| 518 | Ga0495632_0005070 | 3300046519 | Bacteria | 8810 |
| 519 | Ga0495632_0071240 | 3300046519 | Bacteria | 1670 |
| 520 | Ga0495643_0002141 | 3300046522 | Bacteria | 16245 |
| 521 | Ga0495648_0002749 | 3300046524 | Bacteria | 15883 |
| 522 | Ga0495648_0053514 | 3300046524 | Bacteria | 2445 |
| 523 | Ga0495663_0001222 | 3300046525 | Bacteria | 8226 |
| 524 | Ga0495663_0001801 | 3300046525 | Bacteria | 6631 |
| 525 | Ga0495663_0003902 | 3300046525 | Bacteria | 4248 |
| 526 | Ga0495663_0009609 | 3300046525 | Bacteria | 2682 |
| 527 | Ga0495663_0009906 | 3300046525 | Bacteria | 2647 |
| 528 | Ga0495663_0032003 | 3300046525 | Bacteria | 1564 |
| 529 | Ga0495663_0228027 | 3300046525 | Bacteria | 656 |
| 530 | Ga0495598_0001908 | 3300046537 | Bacteria | 4217 |
| 531 | Ga0495609_0002407 | 3300046538 | Bacteria | 11518 |
| 532 | Ga0495609_0223113 | 3300046538 | Bacteria | 782 |
| 533 | Ga0495621_0031148 | 3300046539 | Bacteria | 1828 |
| 534 | Ga0495621_0044186 | 3300046539 | Bacteria | 1574 |
| 535 | Ga0495622_0068953 | 3300046557 | Bacteria | 1633 |
| 536 | Ga0495633_0023836 | 3300046558 | Bacteria | 3028 |
| 537 | Ga0495633_0100422 | 3300046558 | Bacteria | 1343 |
| 538 | Ga0495633_0191777 | 3300046558 | Bacteria | 939 |
| 539 | Ga0495656_0003602 | 3300046615 | Bacteria | 5247 |
| 540 | Ga0495656_0063588 | 3300046615 | Bacteria | 1618 |
| 541 | Ga0495668_0000890 | 3300046616 | Bacteria | 33634 |
| 542 | Ga0495668_0002891 | 3300046616 | Bacteria | 13564 |
| 543 | Ga0495668_0413290 | 3300046616 | Bacteria | 742 |
| 544 | Ga0495611_0000003 | 3300046648 | Bacteria | 395679 |
| 545 | Ga0495611_0002170 | 3300046648 | Bacteria | 9153 |
| 546 | Ga0495625_0000019 | 3300046660 | Bacteria | 298330 |
| 547 | Ga0495625_0053094 | 3300046660 | Bacteria | 2900 |
| 548 | Ga0495625_0107868 | 3300046660 | Bacteria | 1905 |
| 549 | Ga0495659_0005748 | 3300046664 | Bacteria | 3911 |
| 550 | Ga0495661_0008753 | 3300046665 | Bacteria | 6984 |
| 551 | Ga0495670_0000478 | 3300046691 | Bacteria | 18969 |
| 552 | Ga0495670_0002610 | 3300046691 | Bacteria | 8900 |
| 553 | Ga0495670_0051527 | 3300046691 | Bacteria | 2060 |
| 554 | Ga0495670_0061678 | 3300046691 | Bacteria | 1885 |
| 555 | Ga0495670_0380437 | 3300046691 | Bacteria | 762 |
| 556 | Ga0495671_0003233 | 3300046692 | Bacteria | 10116 |
| 557 | Ga0495671_0004102 | 3300046692 | Bacteria | 8783 |
| 558 | Ga0495649_0030625 | 3300046694 | Bacteria | 2971 |
| 559 | Ga0495589_0000408 | 3300046794 | Bacteria | 32385 |
| 560 | Ga0495660_0000122 | 3300046810 | Bacteria | 85116 |
| 561 | Ga0495660_0000268 | 3300046810 | Bacteria | 48969 |
| 562 | Ga0495660_0047807 | 3300046810 | Bacteria | 2341 |
| 563 | Ga0495660_0188229 | 3300046810 | Bacteria | 994 |
| 564 | Ga0495636_0008861 | 3300047318 | Bacteria | 3961 |
| 565 | Ga0495636_0021723 | 3300047318 | Bacteria | 2592 |
| 566 | Ga0495636_0027609 | 3300047318 | Bacteria | 2312 |
| 567 | Ga0495636_0028371 | 3300047318 | Bacteria | 2283 |
| 568 | Ga0495672_0001225 | 3300047320 | Bacteria | 25853 |
| 569 | Ga0495683_0004599 | 3300047323 | Bacteria | 7789 |
| 570 | Ga0495677_0104255 | 3300047445 | Bacteria | 1075 |
| 571 | Ga0495679_000017 | 3300047446 | Bacteria | 263230 |
| 572 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 573 | Ga0495673_0000347 | 3300047469 | Bacteria | 58250 |
| 574 | Ga0495673_0001675 | 3300047469 | Bacteria | 17049 |
| 575 | Ga0495681_0286146 | 3300047470 | Bacteria | 641 |
| 576 | Ga0495686_0000024 | 3300047472 | Bacteria | 400343 |
| 577 | Ga0495686_0000409 | 3300047472 | Bacteria | 67869 |
| 578 | Ga0495686_0004194 | 3300047472 | Bacteria | 11971 |
| 579 | Ga0495686_0007418 | 3300047472 | Bacteria | 8224 |
| 580 | Ga0495686_0016046 | 3300047472 | Bacteria | 5090 |
| 581 | Ga0495686_0037336 | 3300047472 | Bacteria | 3112 |
| 582 | Ga0495686_0092833 | 3300047472 | Bacteria | 1830 |
| 583 | Ga0495686_0117408 | 3300047472 | Bacteria | 1589 |
| 584 | Ga0495615_0022313 | 3300048090 | Bacteria | 1439 |
| 585 | Ga0496100_0028515 | 3300048903 | Bacteria | 3444 |
| 586 | Ga0496100_0323639 | 3300048903 | Bacteria | 1159 |
| 587 | Ga0496100_0513306 | 3300048903 | Bacteria | 924 |
| 588 | Ga0496101_0002654 | 3300048904 | Bacteria | 10984 |
| 589 | Ga0496101_0044626 | 3300048904 | Bacteria | 3172 |
| 590 | Ga0496101_0449636 | 3300048904 | Bacteria | 1016 |
| 591 | Ga0496102_0202573 | 3300048905 | Bacteria | 1871 |
| 592 | Ga0496104_0014408 | 3300048907 | Bacteria | 7145 |
| 593 | Ga0496104_0148328 | 3300048907 | Bacteria | 2252 |
| 594 | Ga0496105_0028149 | 3300048908 | Bacteria | 4595 |
| 595 | Ga0496105_0045875 | 3300048908 | Bacteria | 3606 |
| 596 | Ga0496106_0010123 | 3300048909 | Bacteria | 6965 |
| 597 | Ga0496106_0037617 | 3300048909 | Bacteria | 3621 |
| 598 | Ga0496106_0411828 | 3300048909 | Bacteria | 1086 |
| 599 | Ga0496108_0018627 | 3300048911 | Bacteria | 5688 |
| 600 | Ga0496108_0164470 | 3300048911 | Bacteria | 1918 |
| 601 | Ga0496108_0832326 | 3300048911 | Bacteria | 795 |
| 602 | Ga0496108_1267421 | 3300048911 | Bacteria | 621 |
| 603 | Ga0496109_0043422 | 3300048912 | Bacteria | 4074 |
| 604 | Ga0496109_0592418 | 3300048912 | Bacteria | 1045 |
| 605 | Ga0496110_0756592 | 3300048913 | Bacteria | 875 |
| 606 | Ga0496110_0860118 | 3300048913 | Bacteria | 812 |
| 607 | Ga0496111_0007874 | 3300048914 | Bacteria | 7021 |
| 608 | Ga0496112_0055973 | 3300048915 | Bacteria | 3881 |
| 609 | Ga0496113_0046111 | 3300048916 | Bacteria | 3235 |
| 610 | Ga0496113_0105163 | 3300048916 | Bacteria | 2191 |
| 611 | Ga0496114_0004048 | 3300048917 | Bacteria | 11322 |
| 612 | Ga0496116_0002306 | 3300048919 | Bacteria | 20233 |
| 613 | Ga0496116_0019218 | 3300048919 | Bacteria | 5237 |
| 614 | Ga0496116_0064796 | 3300048919 | Bacteria | 2347 |
| 615 | Ga0496116_0101306 | 3300048919 | Bacteria | 1720 |
| 616 | Ga0496117_0001871 | 3300048920 | Bacteria | 28369 |
| 617 | Ga0496117_0004092 | 3300048920 | Bacteria | 16354 |
| 618 | Ga0496117_0004983 | 3300048920 | Bacteria | 14248 |
| 619 | Ga0496117_0008606 | 3300048920 | Bacteria | 9668 |
| 620 | Ga0496117_0024752 | 3300048920 | Bacteria | 4735 |
| 621 | Ga0496117_0048375 | 3300048920 | Bacteria | 3038 |
| 622 | Ga0496117_0073042 | 3300048920 | Bacteria | 2290 |
| 623 | Ga0496117_0268874 | 3300048920 | Bacteria | 919 |
| 624 | Ga0496117_0374621 | 3300048920 | Bacteria | 727 |
| 625 | Ga0496118_0001013 | 3300048921 | Bacteria | 43722 |
| 626 | Ga0496118_0001607 | 3300048921 | Bacteria | 33397 |
| 627 | Ga0496118_0002036 | 3300048921 | Bacteria | 28593 |
| 628 | Ga0496118_0035718 | 3300048921 | Bacteria | 4030 |
| 629 | Ga0496118_0049568 | 3300048921 | Bacteria | 3232 |
| 630 | Ga0496118_0054643 | 3300048921 | Bacteria | 3022 |
| 631 | Ga0496118_0099230 | 3300048921 | Bacteria | 1975 |
| 632 | Ga0496118_0160364 | 3300048921 | Bacteria | 1392 |
| 633 | Ga0496118_0175261 | 3300048921 | Bacteria | 1303 |
| 634 | Ga0496118_0198680 | 3300048921 | Bacteria | 1190 |
| 635 | Ga0496119_0000235 | 3300048922 | Bacteria | 77921 |
| 636 | Ga0496119_0003558 | 3300048922 | Bacteria | 16083 |
| 637 | Ga0496119_0010179 | 3300048922 | Bacteria | 7940 |
| 638 | Ga0496119_0010619 | 3300048922 | Bacteria | 7722 |
| 639 | Ga0496119_0046207 | 3300048922 | Bacteria | 2721 |
| 640 | Ga0496120_0000208 | 3300048923 | Bacteria | 100328 |
| 641 | Ga0496120_0000282 | 3300048923 | Bacteria | 85605 |
| 642 | Ga0496120_0000970 | 3300048923 | Bacteria | 39064 |
| 643 | Ga0496120_0283125 | 3300048923 | Bacteria | 765 |
| 644 | Ga0496121_0000109 | 3300048924 | Bacteria | 187307 |
| 645 | Ga0496121_0000480 | 3300048924 | Bacteria | 77305 |
| 646 | Ga0496121_0000752 | 3300048924 | Bacteria | 59582 |
| 647 | Ga0496121_0002095 | 3300048924 | Bacteria | 31379 |
| 648 | Ga0496121_0007074 | 3300048924 | Bacteria | 13624 |
| 649 | Ga0496121_0011014 | 3300048924 | Bacteria | 10095 |
| 650 | Ga0496121_0017014 | 3300048924 | Bacteria | 7462 |
| 651 | Ga0496121_0018291 | 3300048924 | Bacteria | 7077 |
| 652 | Ga0496121_0079150 | 3300048924 | Bacteria | 2610 |
| 653 | Ga0496121_0100282 | 3300048924 | Bacteria | 2235 |
| 654 | Ga0496122_0001004 | 3300048925 | Bacteria | 49981 |
| 655 | Ga0496122_0009282 | 3300048925 | Bacteria | 10401 |
| 656 | Ga0496122_0025748 | 3300048925 | Bacteria | 5096 |
| 657 | Ga0496122_0026466 | 3300048925 | Bacteria | 4998 |
| 658 | Ga0496122_0034096 | 3300048925 | Bacteria | 4173 |
| 659 | Ga0496122_0095588 | 3300048925 | Bacteria | 2007 |
| 660 | Ga0496122_0177692 | 3300048925 | Bacteria | 1274 |
| 661 | Ga0496122_0251634 | 3300048925 | Bacteria | 987 |
| 662 | Ga0496122_0346190 | 3300048925 | Bacteria | 778 |
| 663 | Ga0496123_0000239 | 3300048926 | Bacteria | 110475 |
| 664 | Ga0496123_0003580 | 3300048926 | Bacteria | 17215 |
| 665 | Ga0496123_0008951 | 3300048926 | Bacteria | 9101 |
| 666 | Ga0496123_0029599 | 3300048926 | Bacteria | 4026 |
| 667 | Ga0496123_0044731 | 3300048926 | Bacteria | 3024 |
| 668 | Ga0496123_0057107 | 3300048926 | Bacteria | 2544 |
| 669 | Ga0496123_0057633 | 3300048926 | Bacteria | 2526 |
| 670 | Ga0496123_0062757 | 3300048926 | Bacteria | 2378 |
| 671 | Ga0496123_0063283 | 3300048926 | Bacteria | 2365 |
| 672 | Ga0496124_0000218 | 3300048927 | Bacteria | 112156 |
| 673 | Ga0496124_0001341 | 3300048927 | Bacteria | 36941 |
| 674 | Ga0496124_0001511 | 3300048927 | Bacteria | 33889 |
| 675 | Ga0496124_0003515 | 3300048927 | Bacteria | 19085 |
| 676 | Ga0496124_0004411 | 3300048927 | Bacteria | 16416 |
| 677 | Ga0496124_0006332 | 3300048927 | Bacteria | 12919 |
| 678 | Ga0496124_0007149 | 3300048927 | Bacteria | 11948 |
| 679 | Ga0496124_0008850 | 3300048927 | Bacteria | 10453 |
| 680 | Ga0496124_0077460 | 3300048927 | Bacteria | 2742 |
| 681 | Ga0496124_0080829 | 3300048927 | Bacteria | 2673 |
| 682 | Ga0496124_0134881 | 3300048927 | Bacteria | 1955 |
| 683 | Ga0496124_0230198 | 3300048927 | Bacteria | 1386 |
| 684 | Ga0496124_0271211 | 3300048927 | Bacteria | 1242 |
| 685 | Ga0496125_0004406 | 3300048928 | Bacteria | 16271 |
| 686 | Ga0496125_0005552 | 3300048928 | Bacteria | 13957 |
| 687 | Ga0496125_0005750 | 3300048928 | Bacteria | 13642 |
| 688 | Ga0496125_0006890 | 3300048928 | Bacteria | 12166 |
| 689 | Ga0496125_0044519 | 3300048928 | Bacteria | 3752 |
| 690 | Ga0496125_0056447 | 3300048928 | Bacteria | 3188 |
| 691 | Ga0496125_0090789 | 3300048928 | Bacteria | 2291 |
| 692 | Ga0496126_0005914 | 3300048929 | Bacteria | 13798 |
| 693 | Ga0496126_0009365 | 3300048929 | Bacteria | 10408 |
| 694 | Ga0496126_0042951 | 3300048929 | Bacteria | 4173 |
| 695 | Ga0496126_0061724 | 3300048929 | Bacteria | 3366 |
| 696 | Ga0496126_0136876 | 3300048929 | Bacteria | 2112 |
| 697 | Ga0496126_0149731 | 3300048929 | Bacteria | 2001 |
| 698 | Ga0496126_0196653 | 3300048929 | Bacteria | 1705 |
| 699 | Ga0496126_0235085 | 3300048929 | Bacteria | 1533 |
| 700 | Ga0496126_0620767 | 3300048929 | Bacteria | 849 |
| 701 | Ga0495678_000496 | 3300049459 | Bacteria | 38859 |
| 702 | Ga0495682_0005490 | 3300049460 | Bacteria | 5258 |
| 703 | Ga0495682_0011390 | 3300049460 | Bacteria | 3422 |
| 704 | Ga0501290_022888 | 3300049513 | Bacteria | 864 |
| 705 | Ga0501031_0005288 | 3300049568 | Bacteria | 8410 |
| 706 | Ga0501031_0017026 | 3300049568 | Bacteria | 4722 |
| 707 | Ga0501031_0251651 | 3300049568 | Bacteria | 1148 |
| 708 | Ga0501032_0034586 | 3300049569 | Bacteria | 3458 |
| 709 | Ga0501032_0079460 | 3300049569 | Bacteria | 2184 |
| 710 | Ga0501033_0000625 | 3300049570 | Bacteria | 32789 |
| 711 | Ga0501033_0068791 | 3300049570 | Bacteria | 2603 |
| 712 | Ga0501033_0240145 | 3300049570 | Bacteria | 1285 |
| 713 | Ga0501033_0244952 | 3300049570 | Bacteria | 1271 |
| 714 | Ga0501033_0270756 | 3300049570 | Bacteria | 1200 |
| 715 | Ga0501034_0001242 | 3300049571 | Bacteria | 34633 |
| 716 | Ga0501034_0008327 | 3300049571 | Bacteria | 10972 |
| 717 | Ga0501034_0020621 | 3300049571 | Bacteria | 6732 |
| 718 | Ga0501034_0391135 | 3300049571 | Bacteria | 1314 |
| 719 | Ga0501034_0412529 | 3300049571 | Bacteria | 1272 |
| 720 | Ga0501034_0501945 | 3300049571 | Bacteria | 1127 |
| 721 | Ga0501036_0014053 | 3300049572 | Bacteria | 6654 |
| 722 | Ga0501036_0039262 | 3300049572 | Bacteria | 4006 |
| 723 | Ga0501037_0001197 | 3300049573 | Bacteria | 19151 |
| 724 | Ga0501037_0211476 | 3300049573 | Bacteria | 1367 |
| 725 | Ga0501038_0001241 | 3300049574 | Bacteria | 23114 |
| 726 | Ga0501038_0021584 | 3300049574 | Bacteria | 5778 |
| 727 | Ga0501038_0489529 | 3300049574 | Bacteria | 942 |
| 728 | Ga0501039_0020714 | 3300049575 | Bacteria | 5039 |
| 729 | Ga0501039_0040990 | 3300049575 | Bacteria | 3575 |
| 730 | Ga0501039_0578773 | 3300049575 | Bacteria | 880 |
| 731 | Ga0501042_0627364 | 3300049578 | Bacteria | 781 |
| 732 | Ga0501043_0020013 | 3300049579 | Bacteria | 5253 |
| 733 | Ga0501043_0053496 | 3300049579 | Bacteria | 3170 |
| 734 | Ga0501043_0178100 | 3300049579 | Bacteria | 1657 |
| 735 | Ga0501043_0697854 | 3300049579 | Bacteria | 741 |
| 736 | Ga0501043_0818585 | 3300049579 | Bacteria | 672 |
| 737 | Ga0501046_0130135 | 3300049580 | Bacteria | 1909 |
| 738 | Ga0501047_0055064 | 3300049581 | Bacteria | 3847 |
| 739 | Ga0501047_0201272 | 3300049581 | Bacteria | 1852 |
| 740 | Ga0501047_0370336 | 3300049581 | Bacteria | 1267 |
| 741 | Ga0501047_0400592 | 3300049581 | Bacteria | 1205 |
| 742 | Ga0501048_0219207 | 3300049582 | Bacteria | 1349 |
| 743 | Ga0501068_0072238 | 3300049584 | Bacteria | 2107 |
| 744 | Ga0501069_0565928 | 3300049585 | Bacteria | 681 |
| 745 | Ga0501070_0271621 | 3300049586 | Bacteria | 1384 |
| 746 | Ga0501070_0518607 | 3300049586 | Bacteria | 956 |
| 747 | Ga0501070_0794491 | 3300049586 | Bacteria | 743 |
| 748 | Ga0501073_0031382 | 3300049589 | Bacteria | 3791 |
| 749 | Ga0501217_112051 | 3300049661 | Bacteria | 785 |
| 750 | Ga0501223_008846 | 3300049663 | Bacteria | 2049 |
| 751 | Ga0501239_012302 | 3300049672 | Bacteria | 967 |
| 752 | Ga0501243_005519 | 3300049675 | Bacteria | 1901 |
| 753 | Ga0501253_033769 | 3300049683 | Bacteria | 992 |
| 754 | Ga0501225_0103046 | 3300049705 | Bacteria | 835 |
| 755 | Ga0501245_014636 | 3300049708 | Bacteria | 1173 |
| 756 | Ga0501079_0166991 | 3300049741 | Bacteria | 1716 |
| 757 | Ga0501080_0002129 | 3300049742 | Bacteria | 17199 |
| 758 | Ga0501080_0023252 | 3300049742 | Bacteria | 5747 |
| 759 | Ga0501266_003858 | 3300049763 | Bacteria | 1856 |
| 760 | Ga0501266_018515 | 3300049763 | Bacteria | 937 |
| 761 | Ga0501266_021107 | 3300049763 | Bacteria | 889 |
| 762 | Ga0501267_013704 | 3300049764 | Bacteria | 845 |
| 763 | Ga0501268_026763 | 3300049765 | Bacteria | 1021 |
| 764 | Ga0501270_018667 | 3300049767 | Bacteria | 1030 |
| 765 | Ga0501035_0002247 | 3300049822 | Bacteria | 19119 |
| 766 | Ga0501035_0009719 | 3300049822 | Bacteria | 8947 |
| 767 | Ga0501035_0076487 | 3300049822 | Bacteria | 2960 |
| 768 | Ga0501035_0084774 | 3300049822 | Bacteria | 2794 |
| 769 | Ga0501035_0301957 | 3300049822 | Bacteria | 1349 |
| 770 | Ga0501035_0349423 | 3300049822 | Bacteria | 1237 |
| 771 | Ga0501044_0002685 | 3300049823 | Bacteria | 20231 |
| 772 | Ga0501044_0019061 | 3300049823 | Bacteria | 7345 |
| 773 | Ga0501044_0037487 | 3300049823 | Bacteria | 5067 |
| 774 | Ga0501044_0051758 | 3300049823 | Bacteria | 4233 |
| 775 | Ga0501044_0096927 | 3300049823 | Bacteria | 2970 |
| 776 | Ga0501044_0277800 | 3300049823 | Bacteria | 1609 |
| 777 | Ga0501045_0279450 | 3300049824 | Bacteria | 1243 |
| 778 | nmdc:mga03n38_197259_c1 | 3300050490 | Bacteria | 1040 |
| 779 | nmdc:mga00v17_113447_c1 | 3300050491 | Bacteria | 1721 |
| 780 | nmdc:mga00v17_1287_c1 | 3300050491 | Bacteria | 13178 |
| 781 | nmdc:mga00v17_129755_c1 | 3300050491 | Bacteria | 1610 |
| 782 | nmdc:mga00v17_18002_c1 | 3300050491 | Bacteria | 4009 |
| 783 | nmdc:mga00v17_56465_c1 | 3300050491 | Bacteria | 2401 |
| 784 | nmdc:mga0yw44_122802_c1 | 3300050492 | Bacteria | 1674 |
| 785 | nmdc:mga0yw44_307442_c1 | 3300050492 | Bacteria | 1063 |
| 786 | nmdc:mga07m45_127220_c1 | 3300050496 | Bacteria | 1473 |
| 787 | nmdc:mga0sz30_40870_c2 | 3300050516 | Bacteria | 1583 |
| 788 | Ga0500643_000029 | 3300053087 | Bacteria | 211149 |
| 789 | Ga0500643_006120 | 3300053087 | Bacteria | 5081 |
| 790 | Ga0500555_000324 | 3300053103 | Bacteria | 20582 |
| 791 | Ga0500572_070424 | 3300053111 | Bacteria | 1080 |
| 792 | Ga0500597_000107 | 3300053120 | Bacteria | 17442 |
| 793 | Ga0500626_103771 | 3300053128 | Bacteria | 1236 |
| 794 | Ga0500622_0211417 | 3300053156 | Bacteria | 875 |
| 795 | Ga0500633_0019341 | 3300053160 | Bacteria | 2035 |
| 796 | Ga0500634_0000022 | 3300053161 | Bacteria | 95424 |
| 797 | Ga0500645_001107 | 3300053730 | Bacteria | 14742 |
| 798 | 2525556445 | 2524614729 | Bacteria | 3091755 |
| 799 | 2538833582 | 2537561836 | Bacteria | 3910579 |
| 800 | 2572254414 | 2571042365 | Bacteria | 3289345 |
| 801 | 2578457177 | 2576861471 | Bacteria | 4648976 |
| 802 | 2595449018 | 2593339238 | Bacteria | 4182970 |
| 803 | 2595450316 | 2593339239 | Bacteria | 4124669 |
| 804 | 2630649674 | 2627854209 | Bacteria | 3093011 |
| 805 | 2643816764 | 2643221559 | Bacteria | 4424915 |
| 806 | 2643880859 | 2643221573 | Bacteria | 4784121 |
| 807 | 2643905242 | 2643221579 | Bacteria | 4443405 |
| 808 | 2643914929 | 2643221581 | Bacteria | 3893603 |
| 809 | 2643938556 | 2643221586 | Bacteria | 4446529 |
| 810 | 2643973780 | 2643221593 | Bacteria | 6296053 |
| 811 | 2644077697 | 2643221612 | Bacteria | 4361984 |
| 812 | 2644528286 | 2643221695 | Bacteria | 3441323 |
| 813 | 2644661429 | 2643221720 | Bacteria | 4694283 |
| 814 | 2644693988 | 2643221727 | Bacteria | 4415595 |
| 815 | 2644699510 | 2643221728 | Bacteria | 4797149 |
| 816 | 2687584496 | 2687453130 | Bacteria | 4227172 |
| 817 | 2721025785 | 2718218334 | Bacteria | 4765486 |
| 818 | 2735834242 | 2734482264 | Unclassified | 5014763 |
| 819 | 2739225661 | 2738543009 | Bacteria | 4944499 |
| 820 | 2747950267 | 2747842428 | Bacteria | 4689383 |
| 821 | 2748019521 | 2747842501 | Bacteria | 5293829 |
| 822 | 2765580318 | 2765235840 | Bacteria | 4663337 |
| 823 | 2816518656 | 2816332141 | Bacteria | 4436036 |
| 824 | 2819566271 | 2818991440 | Bacteria | 4774720 |
| 825 | 2842395553 | 2842391507 | Bacteria | 4486072 |
| 826 | 2842759151 | 2842757796 | Bacteria | 3981385 |
| 827 | 2842783243 | 2842780639 | Bacteria | 4337790 |
| 828 | 2842917114 | 2842914999 | Bacteria | 4419378 |
| 829 | 2842920676 | 2842918807 | Bacteria | 4289178 |
| 830 | 2852652312 | 2852649853 | Bacteria | 4036942 |
| 831 | 2852686958 | 2852684882 | Bacteria | 5463342 |
| 832 | 2857445138 | 2857442823 | Bacteria | 4562550 |
| 833 | 2874222990 | 2874220319 | Bacteria | 4594709 |
| 834 | 2884339122 | 2884338543 | Bacteria | 4610696 |
| 835 | 2895499428 | 2895498888 | Bacteria | 5283788 |
| 836 | 2895512449 | 2895511927 | Bacteria | 6802080 |
| 837 | 2895522460 | 2895522137 | Bacteria | 3284416 |
| 838 | 2895525768 | 2895525241 | Bacteria | 3388457 |
| 839 | 2904466547 | 2904463128 | Bacteria | 4775606 |
| 840 | 2919086202 | 2919085039 | Bacteria | 4532964 |
| 841 | 2919092833 | 2919089067 | Bacteria | 4560942 |
| 842 | 2919137423 | 2919134579 | Bacteria | 4480386 |
| 843 | 2919406861 | 2919404418 | Bacteria | 4232372 |
| 844 | 2919515029 | 2919513703 | Bacteria | 3844312 |
| 845 | 2919676350 | 2919675420 | Bacteria | 3969095 |
| 846 | 2923517356 | 2923516293 | Bacteria | 3716336 |
| 847 | 2928499189 | 2928496128 | Bacteria | 4631123 |
| 848 | 2929196502 | 2929195423 | Bacteria | 5325372 |
| 849 | 2931383547 | 2931380184 | Bacteria | 4455911 |
| 850 | 2937614958 | 2937610967 | Bacteria | 4618818 |
| 851 | 2939589636 | 2939589442 | Bacteria | 4214238 |
| 852 | 2939624300 | 2939622612 | Bacteria | 4698046 |
| 853 | 2939630267 | 2939626828 | Bacteria | 4695272 |
| 854 | 2941471955 | 2941471342 | Bacteria | 5018624 |
| 855 | 2941478928 | 2941475908 | Bacteria | 4145589 |
| 856 | 2941493088 | 2941489479 | Bacteria | 6313767 |
| 857 | 2953995953 | 2953994433 | Bacteria | 4303959 |
| 858 | 2961049755 | 2961047084 | Bacteria | 4594415 |
| 859 | 2961066570 | 2961064222 | Bacteria | 4749990 |
| 860 | 2974307809 | 2974307012 | Bacteria | 4172388 |
| 861 | 2977248528 | 2977247770 | Bacteria | 4160543 |
| 862 | 2984516985 | 2984514374 | Bacteria | 4172479 |
| 863 | 2987608591 | 2987605356 | Bacteria | 4187822 |
| 864 | 2995953169 | 2995948881 | Bacteria | 6358104 |
| 865 | 8002871102 | 8002869464 | Bacteria | 3588529 |
| 866 | 8003016991 | 8003014200 | Bacteria | 4059994 |
| 867 | 8021626250 | 8021622325 | Bacteria | 4844743 |
| 868 | 8021627691 | 8021626552 | Bacteria | 4665214 |
| 869 | 8021651299 | 8021648035 | Bacteria | 4772378 |
| 870 | Ga0495633_0010539 | |||
| 871 | SwRhRL2b_contig_3797405 | |||
| 872 | JGI24736J21556_1001617 | |||
| 873 | JGI24740J21852_10040405 | |||
| 874 | JGI24738J21930_10001153 | |||
| 875 | JGI25156J39149_1007841 | |||
| 876 | JGI25157J39369_1001663 | |||
| 877 | JGI25152J39213_1000069 | |||
| 878 | JGI25150J39212_1000214 | |||
| 879 | JGI25150J39212_1000407 | |||
| 880 | JGI25150J39212_1027756 | |||
| 881 | JGI25151J46595_10000105 | |||
| 882 | JGI25151J46595_10000116 | |||
| 883 | JGI25153J46596_10000077 | |||
| 884 | rootH2_10004458 | |||
| 885 | rootH2_10044786 | |||
| 886 | rootL2_10073749 | |||
| 887 | rootH1_10107485 | |||
| 888 | rootH1_10232895 | |||
| 889 | Ga0006558J51389_1028497 | |||
| 890 | Ga0006554J51385_1022338 | |||
| 891 | Ga0006562J51391_1012709 | |||
| 892 | Ga0006562J51391_1012711 | |||
| 893 | Ga0055542_1012758 | |||
| 894 | Ga0055529_1005753 | |||
| 895 | Ga0055526_1003098 | |||
| 896 | Ga0055537_1000088 | |||
| 897 | Ga0055537_1000812 | |||
| 898 | Ga0055524_1000074 | |||
| 899 | Ga0055524_1016948 | |||
| 900 | Ga0055524_1061261 | |||
| 901 | Ga0055536_1001746 | |||
| 902 | Ga0055536_1006277 | |||
| 903 | Ga0055534_1000097 | |||
| 904 | Ga0055534_1000154 | |||
| 905 | Ga0055534_1011218 | |||
| 906 | Ga0055528_1000028 | |||
| 907 | Ga0055528_1001412 | |||
| 908 | Ga0055528_1002336 | |||
| 909 | Ga0055530_10001477 | |||
| 910 | Ga0055531_10002804 | |||
| 911 | Ga0055531_10013393 | |||
| 912 | Ga0055531_10017692 | |||
| 913 | Ga0055531_10030559 | |||
| 914 | Ga0058692_1000013 | |||
| 915 | Ga0058692_1000035 | |||
| 916 | Ga0065165_1000913 | |||
| 917 | Ga0065704_10098945 | |||
| 918 | Ga0065704_10281216 | |||
| 919 | Ga0065715_10170654 | |||
| 920 | Ga0070658_10709156 | |||
| 921 | Ga0070670_100022831 | |||
| 922 | Ga0070670_100046378 | |||
| 923 | Ga0070670_100073464 | |||
| 924 | Ga0070680_100389732 | |||
| 925 | Ga0070682_100008369 | |||
| 926 | Ga0070682_100105533 | |||
| 927 | Ga0070660_100089225 | |||
| 928 | Ga0070661_100214433 | |||
| 929 | Ga0070661_100330707 | |||
| 930 | Ga0070661_100491765 | |||
| 931 | Ga0070668_100070732 | |||
| 932 | Ga0070668_100203858 | |||
| 933 | Ga0070668_101260099 | |||
| 934 | Ga0070669_100054658 | |||
| 935 | Ga0070669_101051101 | |||
| 936 | Ga0070675_100494163 | |||
| 937 | Ga0070671_100010249 | |||
| 938 | Ga0070671_101041160 | |||
| 939 | Ga0070674_100053729 | |||
| 940 | Ga0070673_100426619 | |||
| 941 | Ga0070673_101124699 | |||
| 942 | Ga0070659_100144222 | |||
| 943 | Ga0070667_100000085 | |||
| 944 | Ga0070714_100752166 | |||
| 945 | Ga0070700_100575143 | |||
| 946 | Ga0070663_100000045 | |||
| 947 | Ga0070663_100081842 | |||
| 948 | Ga0070663_100194098 | |||
| 949 | Ga0070678_100011851 | |||
| 950 | Ga0070678_100094369 | |||
| 951 | Ga0070681_10336561 | |||
| 952 | Ga0070681_10350114 | |||
| 953 | Ga0068867_100047934 | |||
| 954 | Ga0070679_100058369 | |||
| 955 | Ga0068853_100003376 | |||
| 956 | Ga0068853_100170552 | |||
| 957 | Ga0070672_100057956 | |||
| 958 | Ga0070696_100004017 | |||
| 959 | Ga0070693_100017003 | |||
| 960 | Ga0070665_100071908 | |||
| 961 | Ga0070665_100166741 | |||
| 962 | Ga0070665_100924316 | |||
| 963 | Ga0068855_100013007 | |||
| 964 | Ga0068855_101271375 | |||
| 965 | Ga0070664_100084386 | |||
| 966 | Ga0070664_101231545 | |||
| 967 | Ga0068854_100176852 | |||
| 968 | Ga0068856_100000524 | |||
| 969 | Ga0068851_10354686 | |||
| 970 | Ga0068851_10625703 | |||
| 971 | Ga0068863_100123053 | |||
| 972 | Ga0068858_101627569 | |||
| 973 | Ga0081539_10019407 | |||
| 974 | Ga0075365_10193304 | |||
| 975 | Ga0075364_10000775 | |||
| 976 | Ga0075364_10010917 | |||
| 977 | Ga0075364_10037648 | |||
| 978 | Ga0075364_10577264 | |||
| 979 | Ga0075369_10181360 | |||
| 980 | Ga0075369_10296146 | |||
| 981 | Ga0075370_10085036 | |||
| 982 | Ga0097620_100383554 | |||
| 983 | Ga0105251_10019456 | |||
| 984 | Ga0105244_10023892 | |||
| 985 | Ga0105244_10038830 | |||
| 986 | Ga0105244_10104717 | |||
| 987 | Ga0105240_10023122 | |||
| 988 | Ga0105240_10128175 | |||
| 989 | Ga0105240_10130625 | |||
| 990 | Ga0105247_10002807 | |||
| 991 | Ga0105247_10640208 | |||
| 992 | Ga0105243_10122895 | |||
| 993 | Ga0105243_10207021 | |||
| 994 | Ga0105241_10252420 | |||
| 995 | Ga0105248_10000980 | |||
| 996 | Ga0105237_10000036 | |||
| 997 | Ga0105237_10006112 | |||
| 998 | Ga0105237_10546847 | |||
| 999 | Ga0105249_10000335 | |||
| 1000 | Ga0105028_107380 | |||
| 1001 | Ga0105239_10000027 | |||
| 1002 | Ga0105239_10202899 | |||
| 1003 | Ga0105239_10416482 | |||
| 1004 | Ga0105239_10992781 | |||
| 1005 | Ga0157318_1002656 | |||
| 1006 | Ga0157329_1001393 | |||
| 1007 | Ga0157313_1002762 | |||
| 1008 | Ga0157327_1000513 | |||
| 1009 | Ga0157373_10073514 | |||
| 1010 | Ga0157373_10152758 | |||
| 1011 | Ga0157373_10377225 | |||
| 1012 | Ga0157371_10000184 | |||
| 1013 | Ga0157371_10079356 | |||
| 1014 | Ga0157371_10120730 | |||
| 1015 | Ga0157371_10190080 | |||
| 1016 | Ga0157371_10678202 | |||
| 1017 | Ga0157370_10000045 | |||
| 1018 | Ga0157370_10001564 | |||
| 1019 | Ga0157370_10015409 | |||
| 1020 | Ga0157370_10019467 | |||
| 1021 | Ga0157370_10096821 | |||
| 1022 | Ga0157370_10270060 | |||
| 1023 | Ga0157370_10366785 | |||
| 1024 | Ga0157370_10435598 | |||
| 1025 | Ga0157369_10000745 | |||
| 1026 | Ga0157369_10011268 | |||
| 1027 | Ga0157369_10048745 | |||
| 1028 | Ga0163162_10325108 | |||
| 1029 | Ga0163162_10398573 | |||
| 1030 | Ga0157372_10021401 | |||
| 1031 | Ga0157372_10162705 | |||
| 1032 | Ga0157372_10787582 | |||
| 1033 | Ga0157375_10140509 | |||
| 1034 | Ga0157375_10169912 | |||
| 1035 | Ga0157380_10098081 | |||
| 1036 | Ga0157380_10371759 | |||
| 1037 | Ga0157380_10530188 | |||
| 1038 | Ga0182008_10004060 | |||
| 1039 | Ga0182008_10023563 | |||
| 1040 | Ga0182008_10037026 | |||
| 1041 | Ga0182008_10311799 | |||
| 1042 | Ga0157379_10935563 | |||
| 1043 | Ga0182006_1000479 | |||
| 1044 | Ga0182006_1003624 | |||
| 1045 | Ga0182006_1022419 | |||
| 1046 | Ga0182007_10000219 | |||
| 1047 | Ga0182007_10033459 | |||
| 1048 | Ga0182005_1000113 | |||
| 1049 | Ga0182005_1000213 | |||
| 1050 | Ga0182005_1001646 | |||
| 1051 | Ga0182005_1001924 | |||
| 1052 | Ga0182005_1006350 | |||
| 1053 | Ga0183360_10001 | |||
| 1054 | Ga0163161_10007925 | |||
| 1055 | Ga0163161_10020842 | |||
| 1056 | Ga0163161_10050833 | |||
| 1057 | Ga0163161_10118324 | |||
| 1058 | Ga0163161_10480889 | |||
| 1059 | Ga0206356_10491941 | |||
| 1060 | Ga0206353_10172233 | |||
| 1061 | Ga0224712_10118197 | |||
| 1062 | Ga0209674_100791 | |||
| 1063 | Ga0209147_102946 | |||
| 1064 | Ga0209437_102834 | |||
| 1065 | Ga0207425_1000045 | |||
| 1066 | Ga0207425_1004713 | |||
| 1067 | Ga0209646_1002196 | |||
| 1068 | Ga0209026_1000223 | |||
| 1069 | Ga0209148_1000762 | |||
| 1070 | Ga0209759_1014486 | |||
| 1071 | Ga0209129_1000057 | |||
| 1072 | Ga0209129_1001090 | |||
| 1073 | Ga0209565_1000023 | |||
| 1074 | Ga0209565_1000034 | |||
| 1075 | Ga0209565_1019738 | |||
| 1076 | Ga0209455_1000430 | |||
| 1077 | Ga0209673_1000039 | |||
| 1078 | Ga0209673_1000047 | |||
| 1079 | Ga0209673_1029483 | |||
| 1080 | Ga0209130_1002629 | |||
| 1081 | Ga0209130_1024994 | |||
| 1082 | Ga0209675_1000016 | |||
| 1083 | Ga0209675_1000023 | |||
| 1084 | Ga0209675_1008269 | |||
| 1085 | Ga0209675_1046930 | |||
| 1086 | Ga0209676_1000027 | |||
| 1087 | Ga0209676_1000037 | |||
| 1088 | Ga0209676_1000160 | |||
| 1089 | Ga0209676_1000280 | |||
| 1090 | Ga0209676_1002509 | |||
| 1091 | Ga0209676_1003026 | |||
| 1092 | Ga0209025_1000013 | |||
| 1093 | Ga0209025_1000023 | |||
| 1094 | Ga0209025_1002654 | |||
| 1095 | Ga0209025_1028791 | |||
| 1096 | Ga0209025_1030183 | |||
| 1097 | Ga0209564_1000066 | |||
| 1098 | Ga0209564_1000194 | |||
| 1099 | Ga0209564_1004607 | |||
| 1100 | Ga0209758_1000014 | |||
| 1101 | Ga0209758_1008048 | |||
| 1102 | Ga0209050_1000352 | |||
| 1103 | Ga0209050_1000714 | |||
| 1104 | Ga0209050_1000833 | |||
| 1105 | Ga0209050_1010110 | |||
| 1106 | Ga0209050_1026372 | |||
| 1107 | Ga0209256_1000048 | |||
| 1108 | Ga0209256_1003154 | |||
| 1109 | Ga0209256_1003863 | |||
| 1110 | Ga0209256_1005406 | |||
| 1111 | Ga0209256_1020798 | |||
| 1112 | Ga0209256_1020801 | |||
| 1113 | Ga0207426_1017565 | |||
| 1114 | Ga0209051_1001947 | |||
| 1115 | Ga0209051_1002836 | |||
| 1116 | Ga0209051_1006389 | |||
| 1117 | Ga0209257_1000046 | |||
| 1118 | Ga0209257_1000177 | |||
| 1119 | Ga0209257_1000198 | |||
| 1120 | Ga0209257_1000219 | |||
| 1121 | Ga0209257_1000383 | |||
| 1122 | Ga0209257_1003088 | |||
| 1123 | Ga0209257_1003813 | |||
| 1124 | Ga0209257_1007629 | |||
| 1125 | Ga0209257_1026691 | |||
| 1126 | Ga0209257_1034119 | |||
| 1127 | Ga0209257_1066742 | |||
| 1128 | Ga0207655_1033595 | |||
| 1129 | Ga0207713_1066409 | |||
| 1130 | Ga0207682_10014641 | |||
| 1131 | Ga0207710_10005864 | |||
| 1132 | Ga0207647_10000015 | |||
| 1133 | Ga0207647_10076216 | |||
| 1134 | Ga0207705_10108347 | |||
| 1135 | Ga0207654_10128999 | |||
| 1136 | Ga0207707_10026404 | |||
| 1137 | Ga0207707_10369250 | |||
| 1138 | Ga0207695_10000441 | |||
| 1139 | Ga0207695_10003481 | |||
| 1140 | Ga0207671_10000135 | |||
| 1141 | Ga0207671_10003134 | |||
| 1142 | Ga0207657_10003190 | |||
| 1143 | Ga0207657_10351503 | |||
| 1144 | Ga0207649_10152857 | |||
| 1145 | Ga0207652_10131701 | |||
| 1146 | Ga0207652_10494603 | |||
| 1147 | Ga0207681_10041006 | |||
| 1148 | Ga0207681_10690832 | |||
| 1149 | Ga0207694_10025255 | |||
| 1150 | Ga0207694_10159608 | |||
| 1151 | Ga0207650_10047972 | |||
| 1152 | Ga0207650_10048024 | |||
| 1153 | Ga0207650_10051036 | |||
| 1154 | Ga0207644_10060876 | |||
| 1155 | Ga0207644_10113072 | |||
| 1156 | Ga0207690_10250292 | |||
| 1157 | Ga0207706_10589886 | |||
| 1158 | Ga0207709_10002407 | |||
| 1159 | Ga0207709_10020776 | |||
| 1160 | Ga0207669_10045553 | |||
| 1161 | Ga0207691_10019809 | |||
| 1162 | Ga0207711_10004824 | |||
| 1163 | Ga0207679_10124890 | |||
| 1164 | Ga0207667_10075026 | |||
| 1165 | Ga0207667_10263378 | |||
| 1166 | Ga0207667_11129593 | |||
| 1167 | Ga0207651_10216836 | |||
| 1168 | Ga0207712_10001764 | |||
| 1169 | Ga0207668_10023924 | |||
| 1170 | Ga0207640_10003213 | |||
| 1171 | Ga0207658_10000032 | |||
| 1172 | Ga0207658_10244527 | |||
| 1173 | Ga0207677_10307158 | |||
| 1174 | Ga0207639_10031649 | |||
| 1175 | Ga0207639_10131720 | |||
| 1176 | Ga0207678_10000457 | |||
| 1177 | Ga0207678_10000643 | |||
| 1178 | Ga0207678_10147929 | |||
| 1179 | Ga0207702_10003652 | |||
| 1180 | Ga0207641_10243464 | |||
| 1181 | Ga0207648_10208557 | |||
| 1182 | Ga0207676_10065408 | |||
| 1183 | Ga0207683_10020246 | |||
| 1184 | Ga0207683_10022073 | |||
| 1185 | Ga0209371_1000007 | |||
| 1186 | Ga0209371_1000043 | |||
| 1187 | Ga0209981_1027589 | |||
| 1188 | Ga0209981_1030747 | |||
| 1189 | Ga0209984_1003224 | |||
| 1190 | Ga0210000_1003909 | |||
| 1191 | Ga0209995_1000902 | |||
| 1192 | Ga0209999_1000249 | |||
| 1193 | Ga0209982_1002809 | |||
| 1194 | Ga0209970_1002517 | |||
| 1195 | Ga0209983_1006804 | |||
| 1196 | Ga0209971_1000743 | |||
| 1197 | Ga0209974_10034122 | |||
| 1198 | Ga0268266_10124490 | |||
| 1199 | Ga0268266_10187018 | |||
| 1200 | Ga0268266_10358741 | |||
| 1201 | Ga0268266_10727213 | |||
| 1202 | Ga0268256_1000008 | |||
| 1203 | Ga0268256_1000044 | |||
| 1204 | Ga0316176_1036603 | |||
| 1205 | Ga0316176_1043775 | |||
| 1206 | Ga0314311_1072890 | |||
| 1207 | Ga0316183_1159014 | |||
| 1208 | Ga0316181_1256419 | |||
| 1209 | Ga0316182_1115502 | |||
| 1210 | Ga0307513_10037233 | |||
| 1211 | Ga0307513_10267221 | |||
| 1212 | Ga0307408_100022323 | |||
| 1213 | Ga0307408_100216471 | |||
| 1214 | Ga0307408_101240522 | |||
| 1215 | Ga0307405_10022245 | |||
| 1216 | Ga0307405_10070178 | |||
| 1217 | Ga0307413_10001208 | |||
| 1218 | Ga0307413_10020613 | |||
| 1219 | Ga0307413_10041782 | |||
| 1220 | Ga0307413_10044622 | |||
| 1221 | Ga0307413_10050947 | |||
| 1222 | Ga0307413_10073588 | |||
| 1223 | Ga0307413_10388326 | |||
| 1224 | Ga0307413_10475602 | |||
| 1225 | Ga0307413_10773997 | |||
| 1226 | Ga0307413_10870234 | |||
| 1227 | Ga0307413_11370484 | |||
| 1228 | Ga0307410_10014783 | |||
| 1229 | Ga0307410_10123834 | |||
| 1230 | Ga0307410_10149155 | |||
| 1231 | Ga0307410_10300824 | |||
| 1232 | Ga0307410_10368852 | |||
| 1233 | Ga0307406_10000978 | |||
| 1234 | Ga0307406_10013019 | |||
| 1235 | Ga0307406_10312628 | |||
| 1236 | Ga0307406_10699296 | |||
| 1237 | Ga0307407_10076809 | |||
| 1238 | Ga0307407_10127462 | |||
| 1239 | Ga0307407_10228856 | |||
| 1240 | Ga0307412_10000418 | |||
| 1241 | Ga0307412_10001816 | |||
| 1242 | Ga0307412_10031352 | |||
| 1243 | Ga0307412_10045343 | |||
| 1244 | Ga0307412_10075722 | |||
| 1245 | Ga0307412_10091960 | |||
| 1246 | Ga0307412_10192504 | |||
| 1247 | Ga0307412_10335285 | |||
| 1248 | Ga0307409_100031440 | |||
| 1249 | Ga0307409_100046744 | |||
| 1250 | Ga0307409_100996607 | |||
| 1251 | Ga0307416_100014059 | |||
| 1252 | Ga0307416_100039180 | |||
| 1253 | Ga0307416_101238140 | |||
| 1254 | Ga0307414_10001338 | |||
| 1255 | Ga0307414_10003104 | |||
| 1256 | Ga0307414_10021898 | |||
| 1257 | Ga0307414_10036736 | |||
| 1258 | Ga0307414_10055143 | |||
| 1259 | Ga0307414_10062348 | |||
| 1260 | Ga0307414_10079320 | |||
| 1261 | Ga0307414_10116249 | |||
| 1262 | Ga0307414_10155622 | |||
| 1263 | Ga0307414_10260251 | |||
| 1264 | Ga0307414_10344181 | |||
| 1265 | Ga0307414_10641852 | |||
| 1266 | Ga0307414_10676518 | |||
| 1267 | Ga0307411_10002861 | |||
| 1268 | Ga0307411_10054444 | |||
| 1269 | Ga0307411_10056552 | |||
| 1270 | Ga0307411_10105527 | |||
| 1271 | Ga0307411_10165982 | |||
| 1272 | Ga0307411_10183876 | |||
| 1273 | Ga0307411_10203128 | |||
| 1274 | Ga0307411_10237077 | |||
| 1275 | Ga0307411_10506159 | |||
| 1276 | Ga0307411_10558553 | |||
| 1277 | Ga0307411_10562721 | |||
| 1278 | Ga0373928_0179764 | |||
| 1279 | Ga0395899_0017129 | |||
| 1280 | Ga0395900_0042677 | |||
| 1281 | Ga0395898_0176943 | |||
| 1282 | Ga0395905_0000337 | |||
| 1283 | Ga0395905_0006093 | |||
| 1284 | Ga0395905_0019088 | |||
| 1285 | Ga0395905_0376645 | |||
| 1286 | Ga0395905_0565449 | |||
| 1287 | Ga0395901_0088389 | |||
| 1288 | Ga0395901_0578455 | |||
| 1289 | Ga0237819_00177 | |||
| 1290 | Ga0237819_02977 | |||
| 1291 | Ga0237816_03081 | |||
| 1292 | Ga0439436_0000007 | |||
| 1293 | Ga0439436_0034362 | |||
| 1294 | Ga0439439_0018180 | |||
| 1295 | Ga0439447_000808 | |||
| 1296 | Ga0439465_0000214 | |||
| 1297 | Ga0439465_0000377 | |||
| 1298 | Ga0439465_0000615 | |||
| 1299 | Ga0439465_0003455 | |||
| 1300 | Ga0439465_0017038 | |||
| 1301 | Ga0451787_725098 | |||
| 1302 | Ga0451789_0245027 | |||
| 1303 | Ga0451789_1055925 | |||
| 1304 | Ga0451791_0725227 | |||
| 1305 | Ga0451791_0976915 | |||
| 1306 | Ga0451791_1601024 | |||
| 1307 | Ga0451793_1805861 | |||
| 1308 | Ga0451797_1565887 | |||
| 1309 | Ga0451795_0661403 | |||
| 1310 | Ga0451800_1649814 | |||
| 1311 | Ga0451806_152401 | |||
| 1312 | Ga0451804_0876128 | |||
| 1313 | Ga0451804_1077436 | |||
| 1314 | Ga0451804_1170276 | |||
| 1315 | Ga0451807_0590162 | |||
| 1316 | Ga0451807_1916965 | |||
| 1317 | Ga0451837_1238404 | |||
| 1318 | Ga0451837_1399073 | |||
| 1319 | Ga0451847_0196122 | |||
| 1320 | Ga0451843_0056262 | |||
| 1321 | Ga0451843_0193634 | |||
| 1322 | Ga0451843_1149050 | |||
| 1323 | Ga0451853_1261890 | |||
| 1324 | Ga0451853_1606826 | |||
| 1325 | Ga0451853_3210631 | |||
| 1326 | Ga0451853_4086402 | |||
| 1327 | Ga0439433_0026674 | |||
| 1328 | Ga0439433_0030390 | |||
| 1329 | Ga0439433_0077449 | |||
| 1330 | Ga0439445_0012311 | |||
| 1331 | Ga0439445_0064993 | |||
| 1332 | Ga0439432_009293 | |||
| 1333 | Ga0439432_015910 | |||
| 1334 | Ga0439432_022919 | |||
| 1335 | Ga0439432_026696 | |||
| 1336 | Ga0439449_0000277 | |||
| 1337 | Ga0439449_0003655 | |||
| 1338 | Ga0439449_0009760 | |||
| 1339 | Ga0439449_0022386 | |||
| 1340 | Ga0439449_0050465 | |||
| 1341 | Ga0439452_009962 | |||
| 1342 | Ga0439455_0043457 | |||
| 1343 | Ga0439462_0060166 | |||
| 1344 | Ga0450911_000685 | |||
| 1345 | Ga0450923_020142 | |||
| 1346 | Ga0450908_000033 | |||
| 1347 | Ga0466982_0010498 | |||
| 1348 | Ga0453684_0000159 | |||
| 1349 | Ga0466957_0041473 | |||
| 1350 | Ga0451576_0000120 | |||
| 1351 | Ga0466958_0509475 | |||
| 1352 | Ga0495617_000196 | |||
| 1353 | Ga0495617_000318 | |||
| 1354 | Ga0495627_010605 | |||
| 1355 | Ga0495627_032692 | |||
| 1356 | Ga0495627_051825 | |||
| 1357 | Ga0495591_034329 | |||
| 1358 | Ga0495638_0002849 | |||
| 1359 | Ga0495638_0004464 | |||
| 1360 | Ga0495638_0132268 | |||
| 1361 | Ga0495650_0011065 | |||
| 1362 | Ga0495584_0000437 | |||
| 1363 | Ga0495585_0001305 | |||
| 1364 | Ga0495585_0176303 | |||
| 1365 | Ga0495607_0004515 | |||
| 1366 | Ga0495607_0015294 | |||
| 1367 | Ga0495607_0016250 | |||
| 1368 | Ga0495607_0020055 | |||
| 1369 | Ga0495607_0422864 | |||
| 1370 | Ga0495583_0015969 | |||
| 1371 | Ga0495606_0003552 | |||
| 1372 | Ga0495606_0005186 | |||
| 1373 | Ga0495606_0060310 | |||
| 1374 | Ga0495606_0077532 | |||
| 1375 | Ga0495606_0127978 | |||
| 1376 | Ga0495610_0000971 | |||
| 1377 | Ga0495610_0015601 | |||
| 1378 | Ga0495610_0016193 | |||
| 1379 | Ga0495616_0001042 | |||
| 1380 | Ga0495616_0184079 | |||
| 1381 | Ga0495620_0000846 | |||
| 1382 | Ga0495620_0001915 | |||
| 1383 | Ga0495631_0000878 | |||
| 1384 | Ga0495631_0002764 | |||
| 1385 | Ga0495631_0010947 | |||
| 1386 | Ga0495632_0000014 | |||
| 1387 | Ga0495632_0005070 | |||
| 1388 | Ga0495632_0071240 | |||
| 1389 | Ga0495643_0002141 | |||
| 1390 | Ga0495648_0002749 | |||
| 1391 | Ga0495648_0053514 | |||
| 1392 | Ga0495663_0001222 | |||
| 1393 | Ga0495663_0001801 | |||
| 1394 | Ga0495663_0003902 | |||
| 1395 | Ga0495663_0009609 | |||
| 1396 | Ga0495663_0009906 | |||
| 1397 | Ga0495663_0032003 | |||
| 1398 | Ga0495663_0228027 | |||
| 1399 | Ga0495598_0001908 | |||
| 1400 | Ga0495609_0002407 | |||
| 1401 | Ga0495609_0223113 | |||
| 1402 | Ga0495621_0031148 | |||
| 1403 | Ga0495621_0044186 | |||
| 1404 | Ga0495622_0068953 | |||
| 1405 | Ga0495633_0023836 | |||
| 1406 | Ga0495633_0100422 | |||
| 1407 | Ga0495633_0191777 | |||
| 1408 | Ga0495656_0003602 | |||
| 1409 | Ga0495656_0063588 | |||
| 1410 | Ga0495668_0000890 | |||
| 1411 | Ga0495668_0002891 | |||
| 1412 | Ga0495668_0413290 | |||
| 1413 | Ga0495611_0000003 | |||
| 1414 | Ga0495611_0002170 | |||
| 1415 | Ga0495625_0000019 | |||
| 1416 | Ga0495625_0053094 | |||
| 1417 | Ga0495625_0107868 | |||
| 1418 | Ga0495659_0005748 | |||
| 1419 | Ga0495661_0008753 | |||
| 1420 | Ga0495670_0000478 | |||
| 1421 | Ga0495670_0002610 | |||
| 1422 | Ga0495670_0051527 | |||
| 1423 | Ga0495670_0061678 | |||
| 1424 | Ga0495670_0380437 | |||
| 1425 | Ga0495671_0003233 | |||
| 1426 | Ga0495671_0004102 | |||
| 1427 | Ga0495649_0030625 | |||
| 1428 | Ga0495589_0000408 | |||
| 1429 | Ga0495660_0000122 | |||
| 1430 | Ga0495660_0000268 | |||
| 1431 | Ga0495660_0047807 | |||
| 1432 | Ga0495660_0188229 | |||
| 1433 | Ga0495636_0008861 | |||
| 1434 | Ga0495636_0021723 | |||
| 1435 | Ga0495636_0027609 | |||
| 1436 | Ga0495636_0028371 | |||
| 1437 | Ga0495672_0001225 | |||
| 1438 | Ga0495683_0004599 | |||
| 1439 | Ga0495677_0104255 | |||
| 1440 | Ga0495679_000017 | |||
| 1441 | Ga0495673_0000004 | |||
| 1442 | Ga0495673_0000347 | |||
| 1443 | Ga0495673_0001675 | |||
| 1444 | Ga0495681_0286146 | |||
| 1445 | Ga0495686_0000024 | |||
| 1446 | Ga0495686_0000409 | |||
| 1447 | Ga0495686_0004194 | |||
| 1448 | Ga0495686_0007418 | |||
| 1449 | Ga0495686_0016046 | |||
| 1450 | Ga0495686_0037336 | |||
| 1451 | Ga0495686_0092833 | |||
| 1452 | Ga0495686_0117408 | |||
| 1453 | Ga0495615_0022313 | |||
| 1454 | Ga0496100_0028515 | |||
| 1455 | Ga0496100_0323639 | |||
| 1456 | Ga0496100_0513306 | |||
| 1457 | Ga0496101_0002654 | |||
| 1458 | Ga0496101_0044626 | |||
| 1459 | Ga0496101_0449636 | |||
| 1460 | Ga0496102_0202573 | |||
| 1461 | Ga0496104_0014408 | |||
| 1462 | Ga0496104_0148328 | |||
| 1463 | Ga0496105_0028149 | |||
| 1464 | Ga0496105_0045875 | |||
| 1465 | Ga0496106_0010123 | |||
| 1466 | Ga0496106_0037617 | |||
| 1467 | Ga0496106_0411828 | |||
| 1468 | Ga0496108_0018627 | |||
| 1469 | Ga0496108_0164470 | |||
| 1470 | Ga0496108_0832326 | |||
| 1471 | Ga0496108_1267421 | |||
| 1472 | Ga0496109_0043422 | |||
| 1473 | Ga0496109_0592418 | |||
| 1474 | Ga0496110_0756592 | |||
| 1475 | Ga0496110_0860118 | |||
| 1476 | Ga0496111_0007874 | |||
| 1477 | Ga0496112_0055973 | |||
| 1478 | Ga0496113_0046111 | |||
| 1479 | Ga0496113_0105163 | |||
| 1480 | Ga0496114_0004048 | |||
| 1481 | Ga0496116_0002306 | |||
| 1482 | Ga0496116_0019218 | |||
| 1483 | Ga0496116_0064796 | |||
| 1484 | Ga0496116_0101306 | |||
| 1485 | Ga0496117_0001871 | |||
| 1486 | Ga0496117_0004092 | |||
| 1487 | Ga0496117_0004983 | |||
| 1488 | Ga0496117_0008606 | |||
| 1489 | Ga0496117_0024752 | |||
| 1490 | Ga0496117_0048375 | |||
| 1491 | Ga0496117_0073042 | |||
| 1492 | Ga0496117_0268874 | |||
| 1493 | Ga0496117_0374621 | |||
| 1494 | Ga0496118_0001013 | |||
| 1495 | Ga0496118_0001607 | |||
| 1496 | Ga0496118_0002036 | |||
| 1497 | Ga0496118_0035718 | |||
| 1498 | Ga0496118_0049568 | |||
| 1499 | Ga0496118_0054643 | |||
| 1500 | Ga0496118_0099230 | |||
| 1501 | Ga0496118_0160364 | |||
| 1502 | Ga0496118_0175261 | |||
| 1503 | Ga0496118_0198680 | |||
| 1504 | Ga0496119_0000235 | |||
| 1505 | Ga0496119_0003558 | |||
| 1506 | Ga0496119_0010179 | |||
| 1507 | Ga0496119_0010619 | |||
| 1508 | Ga0496119_0046207 | |||
| 1509 | Ga0496120_0000208 | |||
| 1510 | Ga0496120_0000282 | |||
| 1511 | Ga0496120_0000970 | |||
| 1512 | Ga0496120_0283125 | |||
| 1513 | Ga0496121_0000109 | |||
| 1514 | Ga0496121_0000480 | |||
| 1515 | Ga0496121_0000752 | |||
| 1516 | Ga0496121_0002095 | |||
| 1517 | Ga0496121_0007074 | |||
| 1518 | Ga0496121_0011014 | |||
| 1519 | Ga0496121_0017014 | |||
| 1520 | Ga0496121_0018291 | |||
| 1521 | Ga0496121_0079150 | |||
| 1522 | Ga0496121_0100282 | |||
| 1523 | Ga0496122_0001004 | |||
| 1524 | Ga0496122_0009282 | |||
| 1525 | Ga0496122_0025748 | |||
| 1526 | Ga0496122_0026466 | |||
| 1527 | Ga0496122_0034096 | |||
| 1528 | Ga0496122_0095588 | |||
| 1529 | Ga0496122_0177692 | |||
| 1530 | Ga0496122_0251634 | |||
| 1531 | Ga0496122_0346190 | |||
| 1532 | Ga0496123_0000239 | |||
| 1533 | Ga0496123_0003580 | |||
| 1534 | Ga0496123_0008951 | |||
| 1535 | Ga0496123_0029599 | |||
| 1536 | Ga0496123_0044731 | |||
| 1537 | Ga0496123_0057107 | |||
| 1538 | Ga0496123_0057633 | |||
| 1539 | Ga0496123_0062757 | |||
| 1540 | Ga0496123_0063283 | |||
| 1541 | Ga0496124_0000218 | |||
| 1542 | Ga0496124_0001341 | |||
| 1543 | Ga0496124_0001511 | |||
| 1544 | Ga0496124_0003515 | |||
| 1545 | Ga0496124_0004411 | |||
| 1546 | Ga0496124_0006332 | |||
| 1547 | Ga0496124_0007149 | |||
| 1548 | Ga0496124_0008850 | |||
| 1549 | Ga0496124_0077460 | |||
| 1550 | Ga0496124_0080829 | |||
| 1551 | Ga0496124_0134881 | |||
| 1552 | Ga0496124_0230198 | |||
| 1553 | Ga0496124_0271211 | |||
| 1554 | Ga0496125_0004406 | |||
| 1555 | Ga0496125_0005552 | |||
| 1556 | Ga0496125_0005750 | |||
| 1557 | Ga0496125_0006890 | |||
| 1558 | Ga0496125_0044519 | |||
| 1559 | Ga0496125_0056447 | |||
| 1560 | Ga0496125_0090789 | |||
| 1561 | Ga0496126_0005914 | |||
| 1562 | Ga0496126_0009365 | |||
| 1563 | Ga0496126_0042951 | |||
| 1564 | Ga0496126_0061724 | |||
| 1565 | Ga0496126_0136876 | |||
| 1566 | Ga0496126_0149731 | |||
| 1567 | Ga0496126_0196653 | |||
| 1568 | Ga0496126_0235085 | |||
| 1569 | Ga0496126_0620767 | |||
| 1570 | Ga0495678_000496 | |||
| 1571 | Ga0495682_0005490 | |||
| 1572 | Ga0495682_0011390 | |||
| 1573 | Ga0501290_022888 | |||
| 1574 | Ga0501031_0005288 | |||
| 1575 | Ga0501031_0017026 | |||
| 1576 | Ga0501031_0251651 | |||
| 1577 | Ga0501032_0034586 | |||
| 1578 | Ga0501032_0079460 | |||
| 1579 | Ga0501033_0000625 | |||
| 1580 | Ga0501033_0068791 | |||
| 1581 | Ga0501033_0240145 | |||
| 1582 | Ga0501033_0244952 | |||
| 1583 | Ga0501033_0270756 | |||
| 1584 | Ga0501034_0001242 | |||
| 1585 | Ga0501034_0008327 | |||
| 1586 | Ga0501034_0020621 | |||
| 1587 | Ga0501034_0391135 | |||
| 1588 | Ga0501034_0412529 | |||
| 1589 | Ga0501034_0501945 | |||
| 1590 | Ga0501036_0014053 | |||
| 1591 | Ga0501036_0039262 | |||
| 1592 | Ga0501037_0001197 | |||
| 1593 | Ga0501037_0211476 | |||
| 1594 | Ga0501038_0001241 | |||
| 1595 | Ga0501038_0021584 | |||
| 1596 | Ga0501038_0489529 | |||
| 1597 | Ga0501039_0020714 | |||
| 1598 | Ga0501039_0040990 | |||
| 1599 | Ga0501039_0578773 | |||
| 1600 | Ga0501042_0627364 | |||
| 1601 | Ga0501043_0020013 | |||
| 1602 | Ga0501043_0053496 | |||
| 1603 | Ga0501043_0178100 | |||
| 1604 | Ga0501043_0697854 | |||
| 1605 | Ga0501043_0818585 | |||
| 1606 | Ga0501046_0130135 | |||
| 1607 | Ga0501047_0055064 | |||
| 1608 | Ga0501047_0201272 | |||
| 1609 | Ga0501047_0370336 | |||
| 1610 | Ga0501047_0400592 | |||
| 1611 | Ga0501048_0219207 | |||
| 1612 | Ga0501068_0072238 | |||
| 1613 | Ga0501069_0565928 | |||
| 1614 | Ga0501070_0271621 | |||
| 1615 | Ga0501070_0518607 | |||
| 1616 | Ga0501070_0794491 | |||
| 1617 | Ga0501073_0031382 | |||
| 1618 | Ga0501217_112051 | |||
| 1619 | Ga0501223_008846 | |||
| 1620 | Ga0501239_012302 | |||
| 1621 | Ga0501243_005519 | |||
| 1622 | Ga0501253_033769 | |||
| 1623 | Ga0501225_0103046 | |||
| 1624 | Ga0501245_014636 | |||
| 1625 | Ga0501079_0166991 | |||
| 1626 | Ga0501080_0002129 | |||
| 1627 | Ga0501080_0023252 | |||
| 1628 | Ga0501266_003858 | |||
| 1629 | Ga0501266_018515 | |||
| 1630 | Ga0501266_021107 | |||
| 1631 | Ga0501267_013704 | |||
| 1632 | Ga0501268_026763 | |||
| 1633 | Ga0501270_018667 | |||
| 1634 | Ga0501035_0002247 | |||
| 1635 | Ga0501035_0009719 | |||
| 1636 | Ga0501035_0076487 | |||
| 1637 | Ga0501035_0084774 | |||
| 1638 | Ga0501035_0301957 | |||
| 1639 | Ga0501035_0349423 | |||
| 1640 | Ga0501044_0002685 | |||
| 1641 | Ga0501044_0019061 | |||
| 1642 | Ga0501044_0037487 | |||
| 1643 | Ga0501044_0051758 | |||
| 1644 | Ga0501044_0096927 | |||
| 1645 | Ga0501044_0277800 | |||
| 1646 | Ga0501045_0279450 | |||
| 1647 | nmdc:mga03n38_197259_c1 | |||
| 1648 | nmdc:mga00v17_113447_c1 | |||
| 1649 | nmdc:mga00v17_1287_c1 | |||
| 1650 | nmdc:mga00v17_129755_c1 | |||
| 1651 | nmdc:mga00v17_18002_c1 | |||
| 1652 | nmdc:mga00v17_56465_c1 | |||
| 1653 | nmdc:mga0yw44_122802_c1 | |||
| 1654 | nmdc:mga0yw44_307442_c1 | |||
| 1655 | nmdc:mga07m45_127220_c1 | |||
| 1656 | nmdc:mga0sz30_40870_c2 | |||
| 1657 | Ga0500643_000029 | |||
| 1658 | Ga0500643_006120 | |||
| 1659 | Ga0500555_000324 | |||
| 1660 | Ga0500572_070424 | |||
| 1661 | Ga0500597_000107 | |||
| 1662 | Ga0500626_103771 | |||
| 1663 | Ga0500622_0211417 | |||
| 1664 | Ga0500633_0019341 | |||
| 1665 | Ga0500634_0000022 | |||
| 1666 | Ga0500645_001107 | |||
| 1667 | 2525556445 | |||
| 1668 | 2538833582 | |||
| 1669 | 2572254414 | |||
| 1670 | 2578457177 | |||
| 1671 | 2595449018 | |||
| 1672 | 2595450316 | |||
| 1673 | 2630649674 | |||
| 1674 | 2643816764 | |||
| 1675 | 2643880859 | |||
| 1676 | 2643905242 | |||
| 1677 | 2643914929 | |||
| 1678 | 2643938556 | |||
| 1679 | 2643973780 | |||
| 1680 | 2644077697 | |||
| 1681 | 2644528286 | |||
| 1682 | 2644661429 | |||
| 1683 | 2644693988 | |||
| 1684 | 2644699510 | |||
| 1685 | 2687584496 | |||
| 1686 | 2721025785 | |||
| 1687 | 2735834242 | |||
| 1688 | 2739225661 | |||
| 1689 | 2747950267 | |||
| 1690 | 2748019521 | |||
| 1691 | 2765580318 | |||
| 1692 | 2816518656 | |||
| 1693 | 2819566271 | |||
| 1694 | 2842395553 | |||
| 1695 | 2842759151 | |||
| 1696 | 2842783243 | |||
| 1697 | 2842917114 | |||
| 1698 | 2842920676 | |||
| 1699 | 2852652312 | |||
| 1700 | 2852686958 | |||
| 1701 | 2857445138 | |||
| 1702 | 2874222990 | |||
| 1703 | 2884339122 | |||
| 1704 | 2895499428 | |||
| 1705 | 2895512449 | |||
| 1706 | 2895522460 | |||
| 1707 | 2895525768 | |||
| 1708 | 2904466547 | |||
| 1709 | 2919086202 | |||
| 1710 | 2919092833 | |||
| 1711 | 2919137423 | |||
| 1712 | 2919406861 | |||
| 1713 | 2919515029 | |||
| 1714 | 2919676350 | |||
| 1715 | 2923517356 | |||
| 1716 | 2928499189 | |||
| 1717 | 2929196502 | |||
| 1718 | 2931383547 | |||
| 1719 | 2937614958 | |||
| 1720 | 2939589636 | |||
| 1721 | 2939624300 | |||
| 1722 | 2939630267 | |||
| 1723 | 2941471955 | |||
| 1724 | 2941478928 | |||
| 1725 | 2941493088 | |||
| 1726 | 2953995953 | |||
| 1727 | 2961049755 | |||
| 1728 | 2961066570 | |||
| 1729 | 2974307809 | |||
| 1730 | 2977248528 | |||
| 1731 | 2984516985 | |||
| 1732 | 2987608591 | |||
| 1733 | 2995953169 | |||
| 1734 | 8002871102 | |||
| 1735 | 8003016991 | |||
| 1736 | 8021626250 | |||
| 1737 | 8021627691 | |||
| 1738 | 8021651299 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2y4y-assembly1.cif.gz_A-2 | structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa | 0.9279 | 84 | 173 |
| 2y4y-assembly1.cif.gz_C-2 | structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa | 0.9172 | 90 | 173 |
| 2y4y-assembly1.cif.gz_A-2 | structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa | 0.9172 | 84 | 173 |
| 2y4y-assembly1.cif.gz_D-2 | structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa | 0.9123 | 88 | 172 |
| 2y4y-assembly1.cif.gz_B-2 | structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa | 0.9047 | 90 | 173 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2y4yC00 | Mainly Beta;Roll;SH3 type barrels.; | 0.9172 | 90 | 173 | 2.30.30.830 |
| 2y4yC00 | Mainly Beta;Roll;SH3 type barrels.; | 0.8862 | 90 | 173 | 2.30.30.830 |
| 2lc4A00 | Mainly Beta;Roll;SH3 type barrels.; | 0.8465 | 82 | 175 | 2.30.30.830 |
| 2ivwA01 | Mainly Beta;Roll;SH3 type barrels.; | 0.8084 | 93 | 173 | 2.30.30.830 |
| 2ivwA01 | Mainly Beta;Roll;SH3 type barrels.; | 0.8 | 93 | 173 | 2.30.30.830 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3A4P2N5-F1-model_v4 | Pilus assembly protein PilP | 0.9401 | 93 | 172 |
|
| AF-A0A382ZGV8-F1-model_v4 | Pilus assembly protein PilP | 0.939 | 83 | 175 |
|
| AF-A0A534Q0G7-F1-model_v4 | Pilus assembly protein PilP | 0.9377 | 90 | 173 |
|
| AF-A0A382XQ63-F1-model_v4 | Pilus assembly protein PilP | 0.9373 | 84 | 175 |
|
| AF-A0A3B8WSG9-F1-model_v4 | Pilus assembly protein PilP | 0.9324 | 82 | 172 |
|