F484137

General Info

Members Datasets Scaffolds Average Seq Length
869 759 1739 311

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8005658619|8005658841
Length 318
Sequence KSAKMSVKIALALTGCLTAFGQTALAADAASCGTVRISDVGWTDLASTNASFIAVLEALGYKADVKTVGVPVTYSSMKNKEIDVFLGNWMPAQKGAIQPYIDDKSIESVRANLEGAKYTLATNAAGAKLGIKDFKDIAAHKADLDGKIYGIEPGNEGNEMITSLIKADTFGLKGFDVVESSEQGMLSQVTRADKEKKPIIFLAWAPHPMNVAHEITYLAGGDDTVFGPNYGGATVYTVVRGGYTTDCPNIGKLLKNMSFSLDMENAIMGKILDDGEDPSKAAKAWLKAHPAVVEPWLAGVTTKDGKDGLAAVKKGLGL

Samples

Sample ID Description Type Environment
1 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
40 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
53 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
56 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
57 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
58 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
59 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
60 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
63 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
64 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
65 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
67 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
68 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
87 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
89 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
99 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
100 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
101 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
102 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
103 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
104 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
108 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
109 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
110 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
111 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
121 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
122 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
123 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
131 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
132 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
133 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
134 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
135 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
136 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
137 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
138 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
139 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
151 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
154 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
156 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
157 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
158 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
159 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
160 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
161 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
162 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
163 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
164 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
165 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
166 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
195 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
196 2509276019 Ensifer aridi TW10 Isolate Nodule
197 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
198 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
199 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
200 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
201 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
202 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
203 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
204 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
205 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
206 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
207 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
208 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
209 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
210 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
211 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
212 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
213 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
214 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
215 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
216 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
217 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
218 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
219 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
220 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
221 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
222 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
223 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
224 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
225 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
226 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
227 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
228 2516143018 Ensifer sp. BR816 Isolate Nodule
229 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
230 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
231 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
232 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
233 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
234 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
235 2519899620 Rhizobium sp. Pop5 Isolate Nodule
236 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
237 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
238 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
239 2534681786 Brucella suis 92/29 Isolate Unclassified
240 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
241 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
242 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
243 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
244 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
245 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
246 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
247 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
248 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
249 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
250 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
251 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
252 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
253 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
254 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
255 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
256 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
257 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
258 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
259 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
260 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
261 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
262 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
263 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
264 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
265 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
266 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
267 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
268 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
269 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
270 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
271 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
272 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
273 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
274 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
275 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
276 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
277 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
278 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
279 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
280 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
281 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
282 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
283 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
284 2643221557 Ensifer sp. Root558 Isolate Unclassified
285 2643221568 Rhizobium sp. Root564 Isolate Unclassified
286 2643221582 Rhizobium sp. Root651 Isolate Unclassified
287 2643221599 Rhizobium sp. Root708 Isolate Unclassified
288 2643221607 Rhizobium sp. Root73 Isolate Unclassified
289 2643221610 Ensifer sp. Root74 Isolate Unclassified
290 2643221618 Ensifer sp. Root231 Isolate Unclassified
291 2643221626 Ensifer sp. Root31 Isolate Unclassified
292 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
293 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
294 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
295 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
296 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
297 2643221655 Ensifer sp. Root1252 Isolate Unclassified
298 2643221659 Ensifer sp. Root127 Isolate Unclassified
299 2643221668 Ensifer sp. Root423 Isolate Unclassified
300 2643221675 Ensifer sp. Root1298 Isolate Unclassified
301 2643221680 Ensifer sp. Root1312 Isolate Unclassified
302 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
303 2643221688 Rhizobium sp. Root482 Isolate Unclassified
304 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
305 2643221693 Rhizobium sp. Root491 Isolate Unclassified
306 2643221698 Ensifer sp. Root142 Isolate Unclassified
307 2643221712 Ensifer sp. Root258 Isolate Unclassified
308 2643221718 Rhizobium sp. Root268 Isolate Unclassified
309 2643221719 Rhizobium sp. Root274 Isolate Unclassified
310 2643221723 Ensifer sp. Root278 Isolate Unclassified
311 2643221726 Ensifer sp. Root954 Isolate Unclassified
312 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
313 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
314 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
315 2718217882 Rhizobium sp. N741 Isolate Nodule
316 2718217927 Rhizobium sp. N324 Isolate Nodule
317 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
318 2718218009 Rhizobium sp. N561 Isolate Nodule
319 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
320 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
321 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
322 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
323 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
324 2718218363 Rhizobium sp. N113 Isolate Nodule
325 2718218365 Rhizobium sp. N731 Isolate Nodule
326 2718218366 Rhizobium sp. N621 Isolate Nodule
327 2718218423 Rhizobium sp. N941 Isolate Nodule
328 2721755514 Rhizobium sp. N6212 Isolate Nodule
329 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
330 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
331 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
332 2721755809 Rhizobium sp. N541 Isolate Nodule
333 2721755810 Rhizobium sp. N871 Isolate Nodule
334 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
335 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
336 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
337 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
338 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
339 2728369365 Rhizobium sp. N1341 Isolate Nodule
340 2728369397 Rhizobium sp. N1314 Isolate Nodule
341 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
342 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
343 2751185800 Brucella pituitosa AA2 Isolate Unclassified
344 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
345 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
346 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
347 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
348 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
349 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
350 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
351 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
352 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
353 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
354 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
355 2791355260 Rhizobium sp. L9 Isolate Nodule
356 2791355261 Rhizobium sp. J15 Isolate Nodule
357 2791355262 Rhizobium sp. M1 Isolate Nodule
358 2791355263 Rhizobium chutanense C5 Isolate Nodule
359 2791355264 Rhizobium sp. S9 Isolate Nodule
360 2791355266 Rhizobium sp. L43 Isolate Nodule
361 2791355267 Rhizobium sp. L18 Isolate Nodule
362 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
363 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
364 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
365 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
366 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
367 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
368 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
369 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
370 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
371 2802429633 Rhizobium anhuiense J3 Isolate Nodule
372 2802429634 Rhizobium anhuiense S10 Isolate Nodule
373 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
374 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
375 2802429637 Rhizobium anhuiense C15 Isolate Nodule
376 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
377 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
378 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
379 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
380 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
381 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
382 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
383 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
384 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
385 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
386 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
387 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
388 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
389 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
390 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
391 2838048938 Rhizobium pisi 27/80 Isolate Nodule
392 2838061910 Rhizobium phaseoli L15 Isolate Nodule
393 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
394 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
395 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
396 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
397 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
398 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
399 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
400 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
401 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
402 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
403 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
404 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
405 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
406 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
407 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
408 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
409 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
410 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
411 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
412 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
413 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
414 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
415 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
416 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
417 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
418 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
419 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
420 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
421 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
422 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
423 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
424 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
425 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
426 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
427 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
428 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
429 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
430 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
431 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
432 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
433 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
434 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
435 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
436 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
437 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
438 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
439 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
440 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
441 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
442 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
443 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
444 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
445 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
446 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
447 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
448 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
449 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
450 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
451 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
452 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
453 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
454 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
455 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
456 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
457 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
458 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
459 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
460 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
461 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
462 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
463 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
464 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
465 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
466 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
467 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
468 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
469 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
470 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
471 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
472 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
473 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
474 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
475 2844163670 Ensifer sp. 1H6 Isolate Unclassified
476 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
477 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
478 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
479 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
480 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
481 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
482 2854911287 Brucella lupini LUP21 Isolate Unclassified
483 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
484 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
485 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
486 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
487 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
488 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
489 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
490 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
491 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
492 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
493 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
494 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
495 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
496 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
497 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
498 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
499 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
500 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
501 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
502 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
503 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
504 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
505 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
506 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
507 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
508 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
509 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
510 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
511 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
512 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
513 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
514 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
515 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
516 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
517 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
518 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
519 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
520 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
521 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
522 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
523 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
524 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
525 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
526 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
527 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
528 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
529 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
530 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
531 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
532 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
533 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
534 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
535 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
536 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
537 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
538 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
539 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
540 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
541 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
542 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
543 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
544 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
545 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
546 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
547 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
548 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
549 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
550 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
551 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
552 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
553 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
554 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
555 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
556 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
557 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
558 2933599457 Rhizobium phaseoli M3 Isolate Nodule
559 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
560 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
561 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
562 2936381700 Rhizobium chutanense C16 Isolate Unclassified
563 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
564 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
565 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
566 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
567 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
568 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
569 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
570 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
571 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
572 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
573 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
574 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
575 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
576 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
577 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
578 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
579 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
580 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
581 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
582 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
583 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
584 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
585 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
586 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
587 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
588 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
589 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
590 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
591 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
592 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
593 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
594 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
595 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
596 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
597 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
598 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
599 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
600 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
601 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
602 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
603 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
604 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
605 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
606 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
607 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
608 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
609 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
610 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
611 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
612 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
613 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
614 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
615 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
616 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
617 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
618 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
619 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
620 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
621 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
622 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
623 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
624 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
625 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
626 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
627 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
628 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
629 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
630 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
631 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
632 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
633 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
634 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
635 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
636 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
637 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
638 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
639 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
640 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
641 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
642 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
643 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
644 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
645 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
646 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
647 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
648 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
649 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
650 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
651 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
652 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
653 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
654 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
655 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
656 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
657 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
658 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
659 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
660 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
661 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
662 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
663 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
664 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
665 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
666 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
667 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
668 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
669 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
670 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
671 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
672 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
673 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
674 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
675 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
676 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
677 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
678 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
679 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
680 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
681 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
682 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
683 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
684 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
685 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
686 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
687 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
688 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
689 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
690 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
691 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
692 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
693 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
694 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
695 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
696 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
697 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
698 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
699 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
700 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
701 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
702 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
703 2996887358 Rhizobium sp. R711 Isolate Nodule
704 2996893221 Rhizobium sp. R635 Isolate Nodule
705 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
706 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
707 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
708 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
709 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
710 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
711 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
712 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
713 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
714 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
715 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
716 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
717 8005258706 Rhizobium sp. R693 Isolate Nodule
718 8005275841 Rhizobium sp. N4311 Isolate Nodule
719 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
720 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
721 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
722 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
723 8005321885 Rhizobium sp. R72 Isolate Nodule
724 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
725 8005382845 Rhizobium sp. R634 Isolate Nodule
726 8005395548 Rhizobium sp. R339 Isolate Nodule
727 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
728 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
729 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
730 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
731 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
732 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
733 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
734 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
735 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
736 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
737 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
738 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
739 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
740 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
741 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
742 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
743 8018176218 Rhizobium sp. N122 Isolate Nodule
744 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
745 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
746 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
747 8024501048 Rhizobium sp. H4 Isolate Nodule
748 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
749 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
750 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
751 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
752 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
753 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
754 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
755 8056382006 Rhizobium croatiense 13T Isolate Nodule
756 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
757 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere
758 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
759 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 31.42
Metatranscriptomes 3.45
Isolates 65.13

Biome Distribution

Category Percentage (%)
Aerial Root 0.58
Bulb 0
Endosphere 11.97
Nodule 48.68
Rhizoplane 1.84
Rhizosphere 17.49
Stem 0
Stem Tuber 0.12
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000014 3300002704 Bacteria 196159
2 JGI25156J39149_1000037 3300002705 Bacteria 109690
3 JGI25156J39149_1000079 3300002705 Bacteria 73408
4 JGI25162J39368_1000217 3300002737 Bacteria 59945
5 JGI25154J39366_1000052 3300002738 Bacteria 120209
6 JGI25157J39369_1000040 3300002741 Bacteria 126165
7 JGI25152J39213_1002416 3300002773 Bacteria 7115
8 JGI25159J45721_1002103 3300002987 Bacteria 7815
9 JGI25151J46595_10011640 3300003187 Bacteria 4036
10 JGI25151J46595_10011704 3300003187 Bacteria 4021
11 JGI25165J46597_1000371 3300003214 Bacteria 50062
12 JGI25165J46597_1007941 3300003214 Bacteria 1712
13 JGI25153J46596_10032916 3300003215 Bacteria 1720
14 JGI25153J46596_10053025 3300003215 Bacteria 1150
15 rootL2_10205427 3300003322 Bacteria 3147
16 rootH1_10051068 3300003316 Bacteria 3554
17 rootH1_10051068 3300003323 Bacteria 3370
18 rootH1_10128832 3300003323 Bacteria 1878
19 JGI25160J50197_1000021 3300003354 Bacteria 215789
20 JGI25160J50197_1011587 3300003354 Bacteria 3115
21 JGI25160J50197_1032898 3300003354 Bacteria 1311
22 JGI25161J50226_1000283 3300003374 Bacteria 28981
23 JGI25161J50226_1001614 3300003374 Bacteria 6543
24 Ga0006562J51391_1009538 3300003578 Bacteria 1580
25 Ga0055526_1001319 3300003771 Bacteria 17763
26 Ga0055526_1014566 3300003771 Bacteria 3224
27 Ga0055526_1020556 3300003771 Bacteria 2342
28 Ga0055524_1000779 3300003775 Bacteria 21386
29 Ga0055524_1005323 3300003775 Bacteria 5770
30 Ga0055524_1008271 3300003775 Bacteria 4333
31 Ga0055536_1001985 3300003781 Bacteria 11735
32 Ga0055528_1002808 3300003790 Bacteria 9106
33 Ga0055528_1004596 3300003790 Bacteria 6612
34 Ga0055530_10012975 3300003791 Bacteria 2873
35 Ga0055540_1002222 3300003792 Bacteria 10527
36 Ga0055531_10024082 3300003794 Bacteria 2259
37 Ga0055543_1000060 3300004625 Bacteria 98330
38 Ga0055543_1000102 3300004625 Bacteria 73861
39 Ga0065165_1000033 3300005262 Bacteria 215827
40 Ga0065165_1010332 3300005262 Bacteria 4047
41 Ga0065165_1031464 3300005262 Bacteria 1676
42 Ga0070666_10207602 3300005335 Bacteria 1379
43 Ga0070669_100074863 3300005353 Bacteria 2510
44 Ga0070671_100011226 3300005355 Bacteria 7194
45 Ga0070667_100071705 3300005367 Bacteria 2950
46 Ga0070665_100009296 3300005548 Bacteria 9949
47 Ga0075365_10140915 3300006038 Bacteria 1674
48 Ga0075368_10029289 3300006042 Bacteria 2128
49 Ga0075363_100023075 3300006048 Bacteria 3150
50 Ga0075364_10006414 3300006051 Bacteria 6911
51 Ga0075364_10044704 3300006051 Bacteria 2881
52 Ga0075362_10022134 3300006177 Bacteria 2675
53 Ga0075367_10002965 3300006178 Bacteria 7934
54 Ga0075367_10018265 3300006178 Bacteria 3866
55 Ga0075366_10016046 3300006195 Bacteria 4301
56 Ga0075366_10099457 3300006195 Bacteria 1745
57 Ga0075370_10018991 3300006353 Bacteria 3734
58 Ga0075370_10226157 3300006353 Bacteria 1106
59 Ga0075430_100107384 3300006846 Bacteria 2328
60 Ga0079104_1000015 3300006946 Bacteria 321803
61 Ga0079104_1001889 3300006946 Bacteria 12663
62 Ga0099826_10002571 3300006948 Bacteria 11813
63 Ga0099826_10020046 3300006948 Bacteria 5017
64 Ga0105251_10034832 3300009011 Bacteria 2488
65 Ga0105240_10000014 3300009093 Bacteria 482033
66 Ga0105247_10172028 3300009101 Bacteria 1441
67 Ga0105237_10002639 3300009545 Bacteria 22073
68 Ga0123341_1065539 3300009765 Bacteria 1685
69 Ga0105239_10002361 3300010375 Bacteria 24069
70 Ga0157373_10057610 3300013100 Bacteria 2756
71 Ga0157370_10000329 3300013104 Bacteria 59662
72 Ga0157370_10000616 3300013104 Bacteria 44220
73 Ga0157369_10010177 3300013105 Bacteria 10733
74 Ga0171463_1007 3300013249 Bacteria 301198
75 Ga0182008_10018664 3300014497 Bacteria 3589
76 Ga0182005_1001345 3300015265 Bacteria 10013
77 Ga0183363_1049 3300015690 Bacteria 38978
78 Ga0163161_10265779 3300017792 Bacteria 1341
79 Ga0214542_1017328 3300021321 Bacteria 6553
80 Ga0214543_1000022 3300021327 Bacteria 241930
81 Ga0228711_1000026 3300022739 Bacteria 101497
82 Ga0228710_1000005 3300022740 Bacteria 233531
83 Ga0209435_100027 3300025206 Bacteria 196217
84 Ga0209436_100061 3300025208 Bacteria 58629
85 Ga0209436_101773 3300025208 Bacteria 7065
86 Ga0209437_100051 3300025233 Bacteria 392523
87 Ga0207425_1003320 3300025245 Bacteria 5203
88 Ga0209646_1000086 3300025246 Bacteria 196217
89 Ga0209026_1000082 3300025250 Bacteria 196315
90 Ga0209677_100273 3300025253 Bacteria 34599
91 Ga0209759_1000063 3300025256 Bacteria 196315
92 Ga0209129_1000636 3300025258 Bacteria 23480
93 Ga0209129_1001005 3300025258 Bacteria 16799
94 Ga0209129_1007582 3300025258 Bacteria 3196
95 Ga0209129_1018834 3300025258 Bacteria 1317
96 Ga0209233_1000190 3300025261 Bacteria 130713
97 Ga0209233_1000228 3300025261 Bacteria 100100
98 Ga0209673_1000010 3300025273 Bacteria 596656
99 Ga0209673_1003412 3300025273 Bacteria 9414
100 Ga0209673_1005547 3300025273 Bacteria 6313
101 Ga0209130_1000017 3300025284 Bacteria 388431
102 Ga0209130_1000020 3300025284 Bacteria 379297
103 Ga0209130_1025544 3300025284 Bacteria 1278
104 Ga0209676_1002904 3300025292 Bacteria 11226
105 Ga0209025_1000154 3300025294 Bacteria 170288
106 Ga0209025_1000161 3300025294 Bacteria 166506
107 Ga0209025_1000927 3300025294 Bacteria 44856
108 Ga0209025_1008474 3300025294 Bacteria 7394
109 Ga0209025_1026536 3300025294 Bacteria 2903
110 Ga0209025_1046881 3300025294 Bacteria 1772
111 Ga0209564_1000013 3300025295 Bacteria 775755
112 Ga0209564_1000265 3300025295 Bacteria 110606
113 Ga0209564_1006203 3300025295 Bacteria 6532
114 Ga0209564_1018890 3300025295 Bacteria 2601
115 Ga0209758_1040654 3300025297 Bacteria 1751
116 Ga0209758_1041355 3300025297 Bacteria 1724
117 Ga0209050_1006557 3300025298 Bacteria 6841
118 Ga0209050_1019226 3300025298 Bacteria 2607
119 Ga0209256_1000153 3300025299 Bacteria 144736
120 Ga0209256_1002253 3300025299 Bacteria 16393
121 Ga0209256_1003715 3300025299 Bacteria 10352
122 Ga0209256_1006735 3300025299 Bacteria 5953
123 Ga0207426_1000006 3300025302 Bacteria 1025969
124 Ga0207426_1000008 3300025302 Bacteria 848730
125 Ga0207426_1001616 3300025302 Bacteria 17829
126 Ga0209051_1003619 3300025303 Bacteria 10029
127 Ga0209257_1011582 3300025304 Bacteria 4222
128 Ga0207695_10000037 3300025913 Bacteria 476303
129 Ga0207671_10000271 3300025914 Bacteria 77228
130 Ga0207681_10068465 3300025923 Bacteria 2466
131 Ga0207681_10098973 3300025923 Bacteria 2099
132 Ga0207644_10039200 3300025931 Bacteria 3343
133 Ga0207711_10107074 3300025941 Bacteria 2482
134 Ga0207639_10246704 3300026041 Bacteria 1555
135 Ga0209281_1000034 3300027111 Bacteria 382562
136 Ga0209281_1000082 3300027111 Bacteria 257684
137 Ga0209281_1001218 3300027111 Bacteria 17333
138 Ga0209371_1000022 3300027312 Bacteria 536342
139 Ga0209371_1000892 3300027312 Bacteria 23789
140 Ga0209371_1006391 3300027312 Bacteria 4369
141 Ga0209282_1000006 3300027666 Bacteria 276998
142 Ga0209282_1010102 3300027666 Bacteria 5967
143 Ga0209282_1014812 3300027666 Bacteria 4965
144 Ga0209813_10051482 3300027866 Bacteria 1288
145 Ga0268266_10028323 3300028379 Bacteria 4762
146 Ga0307515_10000017 3300028794 Bacteria 550465
147 Ga0307515_10007366 3300028794 Bacteria 21774
148 Ga0307515_10119597 3300028794 Bacteria 2995
149 Ga0268256_1000019 3300030500 Bacteria 587949
150 Ga0268256_1009929 3300030500 Bacteria 3119
151 Ga0268256_1015530 3300030500 Bacteria 2217
152 Ga0307513_10007887 3300031456 Bacteria 13721
153 Ga0315914_1000003 3300031967 Bacteria 314370
154 Ga0307409_100296009 3300031995 Bacteria 1503
155 Ga0307416_100297826 3300032002 Bacteria 1601
156 Ga0307414_10015231 3300032004 Bacteria 4638
157 Ga0315913_1000001 3300033430 Bacteria 284459
158 Ga0315915_1000008 3300033464 Bacteria 258517
159 Ga0400483_144584 3300039062 Bacteria 2969
160 Ga0400483_144715 3300039062 Bacteria 3421
161 Ga0400483_173528 3300039062 Bacteria 3156
162 Ga0400483_223083 3300039062 Bacteria 2434
163 Ga0400483_260895 3300039062 Bacteria 1664
164 Ga0439436_0019138 3300041404 Bacteria 2045
165 Ga0439465_0015359 3300041413 Bacteria 2389
166 Ga0450906_010017 3300042145 Bacteria 1798
167 Ga0450918_007143 3300042531 Bacteria 1984
168 Ga0451576_0004828 3300045051 Bacteria 17257
169 Ga0451576_0308659 3300045051 Bacteria 1655
170 Ga0495592_0034282 3300046454 Bacteria 3827
171 Ga0495638_0001972 3300046460 Bacteria 17564
172 Ga0495605_0001262 3300046474 Bacteria 16753
173 Ga0495585_0023209 3300046492 Bacteria 3560
174 Ga0495583_0086207 3300046506 Bacteria 1358
175 Ga0495606_0065072 3300046507 Bacteria 2318
176 Ga0495631_0001657 3300046518 Bacteria 13246
177 Ga0495632_0007478 3300046519 Bacteria 6855
178 Ga0495652_0049727 3300046529 Bacteria 3588
179 Ga0495668_0002537 3300046616 Bacteria 14890
180 Ga0495625_0003630 3300046660 Bacteria 15136
181 Ga0495588_0029296 3300046674 Bacteria 2761
182 Ga0495658_0064662 3300046683 Bacteria 2108
183 Ga0495600_0009780 3300046809 Bacteria 5928
184 Ga0495604_0011494 3300047317 Bacteria 7031
185 Ga0495636_0015013 3300047318 Bacteria 3085
186 Ga0495676_0272520 3300047321 Bacteria 1148
187 Ga0495686_0001854 3300047472 Bacteria 21201
188 Ga0495686_0031028 3300047472 Bacteria 3468
189 Ga0496101_0152173 3300048904 Bacteria 1770
190 Ga0496102_0028396 3300048905 Bacteria 4996
191 Ga0496102_0071198 3300048905 Bacteria 3192
192 Ga0496103_0013796 3300048906 Bacteria 4797
193 Ga0496103_0066901 3300048906 Bacteria 2243
194 Ga0496106_0000726 3300048909 Bacteria 23754
195 Ga0496106_0119525 3300048909 Bacteria 2058
196 Ga0496111_0042549 3300048914 Bacteria 3262
197 Ga0496112_0318658 3300048915 Bacteria 1499
198 Ga0496116_0000105 3300048919 Bacteria 192704
199 Ga0496116_0018029 3300048919 Bacteria 5455
200 Ga0496116_0043165 3300048919 Bacteria 3074
201 Ga0496116_0103151 3300048919 Bacteria 1698
202 Ga0496117_0000002 3300048920 Bacteria 2483758
203 Ga0496117_0002822 3300048920 Bacteria 21139
204 Ga0496118_0000566 3300048921 Bacteria 61208
205 Ga0496118_0001151 3300048921 Bacteria 40832
206 Ga0496118_0051779 3300048921 Bacteria 3138
207 Ga0496119_0004810 3300048922 Bacteria 13249
208 Ga0496119_0006275 3300048922 Bacteria 11084
209 Ga0496119_0015928 3300048922 Bacteria 5754
210 Ga0496119_0034056 3300048922 Bacteria 3363
211 Ga0496119_0036609 3300048922 Bacteria 3200
212 Ga0496120_0000309 3300048923 Bacteria 81375
213 Ga0496120_0007332 3300048923 Bacteria 8228
214 Ga0496120_0039582 3300048923 Bacteria 2779
215 Ga0496120_0041824 3300048923 Bacteria 2681
216 Ga0496121_0000003 3300048924 Bacteria 1191431
217 Ga0496121_0000115 3300048924 Bacteria 178411
218 Ga0496121_0005249 3300048924 Bacteria 16749
219 Ga0496121_0010864 3300048924 Bacteria 10179
220 Ga0496121_0022954 3300048924 Bacteria 6029
221 Ga0496121_0066555 3300048924 Bacteria 2924
222 Ga0496121_0099353 3300048924 Bacteria 2249
223 Ga0496122_0000004 3300048925 Bacteria 645283
224 Ga0496122_0012131 3300048925 Bacteria 8629
225 Ga0496122_0028967 3300048925 Bacteria 4683
226 Ga0496122_0193979 3300048925 Bacteria 1195
227 Ga0496123_0000007 3300048926 Bacteria 645283
228 Ga0496123_0000048 3300048926 Bacteria 244152
229 Ga0496123_0039398 3300048926 Bacteria 3306
230 Ga0496123_0051512 3300048926 Bacteria 2740
231 Ga0496123_0080369 3300048926 Bacteria 1987
232 Ga0496124_0006013 3300048927 Bacteria 13382
233 Ga0496124_0019302 3300048927 Bacteria 6349
234 Ga0496124_0020334 3300048927 Bacteria 6139
235 Ga0496124_0093364 3300048927 Bacteria 2449
236 Ga0496125_0000786 3300048928 Bacteria 51737
237 Ga0496125_0012488 3300048928 Bacteria 8428
238 Ga0496125_0207141 3300048928 Bacteria 1277
239 Ga0496126_0000188 3300048929 Bacteria 139625
240 Ga0496126_0018391 3300048929 Bacteria 6925
241 Ga0496126_0106305 3300048929 Bacteria 2449
242 Ga0496126_0132397 3300048929 Bacteria 2153
243 Ga0496126_0133141 3300048929 Bacteria 2146
244 Ga0496126_0202373 3300048929 Bacteria 1676
245 Ga0495678_029376 3300049459 Bacteria 2309
246 Ga0501032_0045777 3300049569 Bacteria 2958
247 Ga0501034_0236504 3300049571 Bacteria 1774
248 Ga0501036_0298713 3300049572 Bacteria 1347
249 Ga0501039_0095078 3300049575 Bacteria 2323
250 Ga0501047_0088435 3300049581 Bacteria 2975
251 Ga0501047_0105200 3300049581 Bacteria 2703
252 Ga0501073_0067618 3300049589 Bacteria 2491
253 Ga0501083_0017355 3300049744 Bacteria 5017
254 Ga0501035_0045529 3300049822 Bacteria 3948
255 nmdc:mga03n38_11439_c1 3300050490 Bacteria 3308
256 nmdc:mga00v17_180_c1 3300050491 Bacteria 37485
257 nmdc:mga00v17_61578_c1 3300050491 Bacteria 2307
258 nmdc:mga0yw44_288549_c1 3300050492 Bacteria 1098
259 nmdc:mga0yw44_86764_c1 3300050492 Bacteria 1972
260 nmdc:mga0k408_114401_c1 3300050493 Bacteria 1596
261 nmdc:mga06z11_34915_c1 3300050494 Bacteria 2471
262 nmdc:mga07m45_1993_c2 3300050496 Bacteria 3806
263 Ga0500560_000226 3300053107 Bacteria 6867
264 Ga0500572_005574 3300053111 Bacteria 2857
265 Ga0500618_000056 3300053125 Bacteria 98509
266 Ga0500655_020055 3300053133 Bacteria 1248
267 Ga0500568_0000905 3300053139 Bacteria 20463
268 Ga0500568_0001684 3300053139 Bacteria 13800
269 Ga0500568_0016980 3300053139 Bacteria 3222
270 Ga0500573_0001807 3300053140 Bacteria 10387
271 Ga0500616_0000576 3300053153 Bacteria 44650
272 Ga0500624_000308 3300053157 Bacteria 16712
273 Ga0500636_0007056 3300053177 Bacteria 6481
274 Ga0590071_002472 3300059421 Bacteria 4652
275 Ga0587066_009157 3300059490 Bacteria 1396
276 Ga0587066_009472 3300059490 Bacteria 1381
277 Ga0587070_003881 3300059491 Bacteria 1842
278 Ga0587073_0003784 3300059492 Bacteria 2111
279 Ga0587077_013975 3300059493 Bacteria 1314
280 Ga0587080_008198 3300059503 Bacteria 1489
281 Ga0587082_002034 3300059504 Bacteria 2219
282 Ga0587083_0000710 3300059505 Bacteria 3242
283 Ga0587086_008220 3300059507 Bacteria 1214
284 Ga0587088_005697 3300059508 Bacteria 1650
285 Ga0587090_004207 3300059510 Bacteria 1730
286 Ga0587091_004029 3300059511 Bacteria 1896
287 Ga0587092_010567 3300059512 Bacteria 1266
288 Ga0587098_004289 3300059604 Bacteria 1337
289 Ga0587106_000696 3300059605 Bacteria 2563
290 Ga0587099_000630 3300059622 Bacteria 2147
291 Ga0587128_001425 3300059630 Bacteria 2254
292 Ga0587062_007327 3300059639 Bacteria 1284
293 Ga0587067_000720 3300059640 Bacteria 3145
294 Ga0587068_003981 3300059641 Bacteria 1927
295 Ga0587069_004470 3300059642 Bacteria 1577
296 Ga0587072_004751 3300059643 Bacteria 1994
297 Ga0587072_014464 3300059643 Bacteria 1330
298 Ga0587075_004587 3300059644 Bacteria 1612
299 Ga0587076_009544 3300059645 Bacteria 1381
300 Ga0587078_004960 3300059646 Bacteria 1407
301 Ga0587107_003208 3300059652 Bacteria 1564
302 Ga0587071_003113 3300060344 Bacteria 2340
303 Ga0587111_0004573 3300060346 Bacteria 2071
304 Ga0501082_0162527 3300060353 Bacteria 1941
305 8005658841 8005658619 Bacteria 4500593
306 2509108144 2508501122 Bacteria 6292184
307 2509376681 2509276019 Bacteria 6802256
308 2509391800 2509276021 Bacteria 7634384
309 2510134182 2510065019 Bacteria 6903379
310 2510305333 2510065057 Bacteria 6649661
311 2511133213 2510917022 Bacteria 6504556
312 2511199260 2510917030 Bacteria 7460662
313 2511390169 2511231027 Bacteria 5013807
314 2511502471 2511231052 Bacteria 6974333
315 2512533847 2512047086 Bacteria 6850303
316 2512970404 2512875026 Bacteria 6861065
317 2513567736 2513237084 Bacteria 7231967
318 2513577182 2513237085 Bacteria 7695351
319 2513588349 2513237086 Bacteria 7265287
320 2513590862 2513237087 Bacteria 5817514
321 2513597665 2513237088 Bacteria 6927906
322 2513601468 2513237089 Bacteria 6553624
323 2513619527 2513237091 Bacteria 6900273
324 2513707854 2513237103 Bacteria 7647401
325 2513884462 2513237140 Bacteria 7076289
326 2513904496 2513237143 Bacteria 6664116
327 2513908538 2513237144 Bacteria 7530820
328 2513925178 2513237146 Bacteria 7166346
329 2513983665 2513237156 Bacteria 6402557
330 2513997676 2513237159 Bacteria 6810126
331 2514003086 2513237160 Bacteria 6650282
332 2514018070 2513237162 Bacteria 7468464
333 2515113349 2515075009 Bacteria 7288508
334 2515609264 2515154107 Bacteria 6795637
335 2515638942 2515154113 Bacteria 7807172
336 2515645504 2515154114 Bacteria 7848616
337 2515655110 2515154116 Bacteria 7552979
338 2515739717 2515154134 Bacteria 7220242
339 2516206184 2516143018 Bacteria 6951533
340 2516893846 2516653046 Bacteria 6989037
341 2517036952 2516653077 Bacteria 7555578
342 2517077313 2516653085 Bacteria 7346596
343 2517096069 2517093000 Bacteria 7412387
344 2517407692 2517287029 Bacteria 6905599
345 2517570558 2517487022 Bacteria 7227575
346 2520377027 2519899620 Bacteria 6499161
347 2524448333 2524023207 Bacteria 6813453
348 2524458861 2524023209 Bacteria 6679728
349 2530646570 2529292951 Bacteria 6916614
350 2535485262 2534681786 Bacteria 3308809
351 2537877059 2537561587 Bacteria 5425293
352 2551677393 2551306084 Bacteria 8942552
353 2551689820 2551306085 Bacteria 7347181
354 2551694951 2551306086 Bacteria 6843938
355 2551703975 2551306087 Bacteria 7351905
356 2551710104 2551306089 Bacteria 7162724
357 2551722118 2551306090 Bacteria 7953713
358 2551725746 2551306091 Bacteria 7086830
359 2551732511 2551306092 Bacteria 6992595
360 2551739449 2551306093 Bacteria 7064773
361 2554248401 2554235003 Bacteria 5877155
362 2558863956 2558860100 Bacteria 8458965
363 2559295517 2558860242 Bacteria 5568029
364 2585167451 2582581283 Bacteria 6030556
365 2585223089 2582581298 Bacteria 7315509
366 2585265675 2582581306 Bacteria 6450535
367 2585271356 2582581307 Bacteria 6597605
368 2585323099 2582581315 Bacteria 7318924
369 2585331211 2582581316 Bacteria 7774528
370 2585388880 2582581865 Bacteria 6644329
371 2585395421 2582581866 Bacteria 6859583
372 2585400961 2582581867 Bacteria 7184437
373 2585524741 2585427526 Bacteria 7258840
374 2585531219 2585427527 Bacteria 7273426
375 2585538424 2585427528 Bacteria 6842387
376 2585545672 2585427529 Bacteria 7395659
377 2585552858 2585427530 Bacteria 7383882
378 2585559099 2585427531 Bacteria 6992870
379 2585822137 2585427590 Bacteria 6824633
380 2585836377 2585427593 Bacteria 7141551
381 2585898480 2585427608 Bacteria 6544331
382 2585903955 2585427609 Bacteria 6667127
383 2587980927 2585428125 Bacteria 6662905
384 2599332010 2599185156 Bacteria 5403036
385 2599417085 2599185170 Bacteria 7295545
386 2599601834 2599185210 Bacteria 5624189
387 2600194855 2599185352 Bacteria 7228948
388 2600374105 2600254933 Bacteria 4750527
389 2601609910 2600255279 Bacteria 5605316
390 2601746685 2600255308 Bacteria 5611129
391 2616293134 2615840624 Bacteria 6557588
392 2616311038 2615840626 Bacteria 7921970
393 2616554476 2615840698 Bacteria 7319877
394 2617384838 2617270742 Bacteria 6808054
395 2643804191 2643221557 Bacteria 7184309
396 2643856571 2643221568 Bacteria 5187270
397 2643920167 2643221582 Bacteria 5804683
398 2644007037 2643221599 Bacteria 6292121
399 2644050228 2643221607 Bacteria 6314006
400 2644065035 2643221610 Bacteria 7480339
401 2644105254 2643221618 Bacteria 7717186
402 2644145670 2643221626 Bacteria 8069654
403 2644191816 2643221634 Bacteria 6705461
404 2644204711 2643221636 Bacteria 6583769
405 2644208781 2643221637 Bacteria 5345260
406 2644242566 2643221643 Bacteria 5749658
407 2644298914 2643221653 Bacteria 4569637
408 2644309667 2643221655 Bacteria 7722067
409 2644331165 2643221659 Bacteria 7890716
410 2644376556 2643221668 Bacteria 7306521
411 2644416708 2643221675 Bacteria 7473456
412 2644449748 2643221680 Bacteria 7473610
413 2644483148 2643221686 Bacteria 6310811
414 2644494302 2643221688 Bacteria 5260751
415 2644497795 2643221689 Bacteria 6042950
416 2644521788 2643221693 Bacteria 5513853
417 2644543396 2643221698 Bacteria 7756764
418 2644616191 2643221712 Bacteria 7729434
419 2644652311 2643221718 Bacteria 5345506
420 2644657143 2643221719 Bacteria 4568197
421 2644675814 2643221723 Bacteria 7095460
422 2644689880 2643221726 Bacteria 7455827
423 2657681736 2657244999 Bacteria 5946535
424 2671111205 2667528174 Bacteria 6435400
425 2692315278 2690316117 Bacteria 6800650
426 2719182023 2718217882 Bacteria 6556348
427 2719386635 2718217927 Bacteria 6972593
428 2719666383 2718217997 Bacteria 6740740
429 2719732739 2718218009 Bacteria 6478651
430 2720492803 2718218199 Bacteria 6740745
431 2720614270 2718218232 Bacteria 6720332
432 2720621039 2718218233 Bacteria 6662049
433 2720632362 2718218235 Bacteria 6630699
434 2720776090 2718218269 Bacteria 6906114
435 2721148114 2718218363 Bacteria 6524337
436 2721159566 2718218365 Bacteria 6274507
437 2721164950 2718218366 Bacteria 6425255
438 2721400339 2718218423 Bacteria 6438183
439 2722841120 2721755514 Bacteria 6424414
440 2723027689 2721755556 Bacteria 6745503
441 2723561317 2721755684 Bacteria 6859907
442 2723567940 2721755685 Bacteria 6704835
443 2724039152 2721755809 Bacteria 6438790
444 2724045495 2721755810 Bacteria 6479005
445 2724090697 2721755819 Bacteria 6906405
446 2724105205 2721755822 Bacteria 6726041
447 2724111033 2721755823 Bacteria 6752556
448 2725951370 2724679232 Bacteria 7646494
449 2730108625 2728369352 Bacteria 6745171
450 2730165258 2728369365 Bacteria 6555560
451 2730299198 2728369397 Bacteria 6274511
452 2738944074 2738541317 Bacteria 5340176
453 2739033065 2738541333 Bacteria 7106503
454 2753359914 2751185800 Bacteria 5467370
455 2753462366 2751185821 Bacteria 6189929
456 2757571802 2757320392 Bacteria 3737298
457 2758642234 2758568016 Bacteria 5645291
458 2766066108 2765235942 Bacteria 7445910
459 2776914198 2775507049 Bacteria 6284736
460 2778175658 2775507266 Bacteria 7392367
461 2792581447 2791355082 Bacteria 5973319
462 2792620573 2791355091 Bacteria 6135441
463 2792625932 2791355092 Bacteria 6248105
464 2792638872 2791355094 Bacteria 7011481
465 2793315863 2791355259 Bacteria 7254731
466 2793319406 2791355260 Bacteria 6598818
467 2793328490 2791355261 Bacteria 6661293
468 2793335449 2791355262 Bacteria 6774204
469 2793339499 2791355263 Bacteria 6872478
470 2793347024 2791355264 Bacteria 6429314
471 2793361911 2791355266 Bacteria 7116587
472 2793367666 2791355267 Bacteria 7222458
473 2802716760 2802428858 Bacteria 6636079
474 2802725572 2802428859 Bacteria 6667919
475 2802730337 2802428860 Bacteria 6525526
476 2802737692 2802428861 Bacteria 6534206
477 2802742919 2802428862 Bacteria 6633353
478 2802750343 2802428863 Bacteria 6410669
479 2804752922 2802429268 Bacteria 6094027
480 2805926846 2802429605 Bacteria 6875453
481 2805932759 2802429606 Bacteria 6346811
482 2806045204 2802429633 Bacteria 7341974
483 2806050001 2802429634 Bacteria 7083200
484 2806056839 2802429635 Bacteria 7650140
485 2806064220 2802429636 Bacteria 7597525
486 2806071488 2802429637 Bacteria 7067217
487 2808987748 2808606387 Bacteria 5697198
488 2819241077 2818991272 Bacteria 4622173
489 2819559233 2818991439 Bacteria 6907412
490 2819609365 2818991448 Bacteria 6772224
491 2819641323 2818991453 Bacteria 7181617
492 2819685162 2818991461 Bacteria 7026071
493 2821125751 2821123053 Bacteria 7836056
494 2834581507 2834578030 Bacteria 3530182
495 2837654668 2837651117 Bacteria 3772164
496 2837681673 2837678835 Bacteria 5252418
497 2838021682 2838016132 Bacteria 6577831
498 2838023626 2838022645 Bacteria 6494267
499 2838033375 2838029111 Bacteria 6603031
500 2838038709 2838035591 Bacteria 7166484
501 2838045197 2838042994 Bacteria 6046894
502 2838053324 2838048938 Bacteria 6044578
503 2838065442 2838061910 Bacteria 6794874
504 2838069922 2838068647 Bacteria 6208656
505 2838079782 2838074704 Bacteria 6785777
506 2838661369 2838661181 Bacteria 7385261
507 2838670588 2838668709 Bacteria 6671819
508 2838683218 2838680041 Bacteria 6545511
509 2838686813 2838686498 Bacteria 7807632
510 2838697838 2838694306 Bacteria 6853137
511 2838702959 2838701080 Bacteria 6669771
512 2838710953 2838707686 Bacteria 6619912
513 2838714479 2838714209 Bacteria 5525906
514 2838721720 2838719591 Bacteria 5523910
515 2838730229 2838729681 Bacteria 7400765
516 2838737798 2838736955 Bacteria 5760694
517 2838742756 2838742623 Bacteria 7396178
518 2839997515 2839993093 Bacteria 5512535
519 2840768994 2840764183 Bacteria 6358399
520 2841841833 2841840854 Bacteria 5761912
521 2841848704 2841846520 Bacteria 5345850
522 2841854641 2841851746 Bacteria 7532261
523 2841862302 2841859092 Bacteria 5436171
524 2841867186 2841864319 Bacteria 6742987
525 2842079127 2842077413 Bacteria 6508645
526 2842113029 2842110456 Bacteria 7656360
527 2842118362 2842118031 Bacteria 7033875
528 2842125265 2842124991 Bacteria 5346824
529 2842130492 2842130223 Bacteria 4909145
530 2842141612 2842140634 Bacteria 5759631
531 2842147783 2842146304 Bacteria 5957337
532 2842154338 2842152218 Bacteria 4908957
533 2842158339 2842156927 Bacteria 6894975
534 2842168558 2842163707 Bacteria 6916235
535 2842170721 2842170452 Bacteria 5525737
536 2842177958 2842175837 Bacteria 4908771
537 2842181955 2842180545 Bacteria 6888678
538 2842187588 2842187318 Bacteria 5524014
539 2842195829 2842192696 Bacteria 6147454
540 2842199140 2842198810 Bacteria 6608673
541 2842209587 2842205361 Bacteria 6340321
542 2842211899 2842211629 Bacteria 5523832
543 2842218179 2842217011 Bacteria 7497767
544 2842226482 2842224351 Bacteria 5524473
545 2842230046 2842229732 Bacteria 7475766
546 2842240275 2842237096 Bacteria 6620661
547 2842243935 2842243621 Bacteria 7421798
548 2842252849 2842250916 Bacteria 6579627
549 2842257980 2842257432 Bacteria 7401195
550 2842269513 2842264693 Bacteria 6472963
551 2842271649 2842271015 Bacteria 7807131
552 2842283041 2842278818 Bacteria 6340002
553 2842285379 2842285085 Bacteria 6011953
554 2842292789 2842291075 Bacteria 7076806
555 2842298212 2842298080 Bacteria 6123127
556 2842305280 2842304105 Bacteria 7023636
557 2842313993 2842311132 Bacteria 6616990
558 2842319767 2842317721 Bacteria 6793725
559 2842348455 2842341865 Bacteria 7003929
560 2842360188 2842357229 Bacteria 6485165
561 2842368322 2842363717 Bacteria 6844742
562 2842373849 2842370503 Bacteria 7038661
563 2842379186 2842377471 Bacteria 7140707
564 2842384873 2842384541 Bacteria 7057858
565 2842400115 2842395702 Bacteria 6780583
566 2842402739 2842402390 Bacteria 6681310
567 2842409890 2842409023 Bacteria 6687331
568 2842416538 2842415677 Bacteria 6596907
569 2842423536 2842422224 Bacteria 6239196
570 2842430485 2842428310 Bacteria 6767288
571 2842436703 2842434925 Bacteria 6502746
572 2842443455 2842441272 Bacteria 6769273
573 2842449325 2842447887 Bacteria 6754142
574 2842466739 2842462802 Bacteria 6588055
575 2842471427 2842469257 Bacteria 6752936
576 2842479959 2842475841 Bacteria 6603183
577 2842483841 2842482326 Bacteria 7212537
578 2842492296 2842489311 Bacteria 6620893
579 2842497843 2842495871 Bacteria 6820686
580 2842505256 2842502639 Bacteria 6604161
581 2842514265 2842509118 Bacteria 6850950
582 2842519086 2842515876 Bacteria 5436280
583 2842522080 2842521101 Bacteria 6569494
584 2842872162 2842871566 Bacteria 4827117
585 2842924345 2842922631 Bacteria 5824079
586 2844164013 2844163670 Bacteria 7266046
587 2844458110 2844454524 Bacteria 7952546
588 2847419665 2847417321 Bacteria 6913799
589 2848994666 2848992105 Bacteria 6810864
590 2850081682 2850079185 Bacteria 6848280
591 2852390489 2852387548 Bacteria 8025568
592 2854901351 2854896431 Bacteria 5869725
593 2854912571 2854911287 Bacteria 5582813
594 2854919021 2854916844 Bacteria 5725939
595 2855023611 2855020534 Bacteria 3204685
596 2855826570 2855825444 Bacteria 6785811
597 2855841961 2855839649 Bacteria 7135830
598 2855877181 2855872281 Bacteria 6964271
599 2857517187 2857516855 Bacteria 7787325
600 2857532312 2857531043 Bacteria 6754041
601 2858802636 2858800743 Bacteria 6603254
602 2891373590 2891373044 Bacteria 5202277
603 2894655707 2894652903 Bacteria 4587256
604 2894820511 2894817345 Bacteria 4892941
605 2896391104 2896384573 Bacteria 7700774
606 2899261217 2899259804 Bacteria 3320927
607 2899275940 2899275550 Bacteria 3958688
608 2899794093 2899792073 Bacteria 4926588
609 2899806228 2899803654 Bacteria 5577784
610 2899849541 2899845264 Bacteria 5672268
611 2904582097 2904578770 Bacteria 5302906
612 2913296127 2913295892 Bacteria 6333755
613 2913313584 2913308742 Bacteria 5350706
614 2915653293 2915650412 Bacteria 4288180
615 2915982872 2915980308 Bacteria 6624279
616 2915989859 2915986958 Bacteria 6739310
617 2915994721 2915993759 Bacteria 7016183
618 2916002111 2916000859 Bacteria 6865702
619 2916008970 2916007675 Bacteria 6898660
620 2916018993 2916014648 Bacteria 6946486
621 2916022984 2916021584 Bacteria 6854472
622 2916033823 2916028427 Bacteria 6748433
623 2916041868 2916035215 Bacteria 6755766
624 2916044341 2916041962 Bacteria 6820487
625 2916050389 2916048683 Bacteria 6543552
626 2916060301 2916055098 Bacteria 6758838
627 2916065472 2916061851 Bacteria 6737736
628 2916070183 2916068649 Bacteria 6943657
629 2916078332 2916076590 Bacteria 6596108
630 2919106224 2919100787 Bacteria 7710546
631 2919114515 2919114240 Bacteria 5700270
632 2919123122 2919119836 Bacteria 5208557
633 2919169506 2919166419 Bacteria 4952238
634 2919410227 2919408235 Bacteria 6149349
635 2920761304 2920760137 Bacteria 7427611
636 2920825494 2920822456 Bacteria 6897201
637 2921203165 2921201388 Bacteria 6926299
638 2921212524 2921208531 Bacteria 6745326
639 2921238213 2921237296 Bacteria 6876710
640 2921244534 2921244191 Bacteria 6568419
641 2921253720 2921250672 Bacteria 6677771
642 2921261928 2921257292 Bacteria 6808382
643 2921269445 2921263974 Bacteria 6864552
644 2921283648 2921282425 Bacteria 6826397
645 2921291047 2921289301 Bacteria 7316391
646 2921303888 2921296804 Bacteria 7176999
647 2924144531 2924144063 Bacteria 6883928
648 2924151692 2924150972 Bacteria 7169444
649 2924164874 2924158325 Bacteria 7188855
650 2924167434 2924165586 Bacteria 7260590
651 2924178463 2924172951 Bacteria 6749356
652 2924183534 2924179722 Bacteria 6843264
653 2924187446 2924186466 Bacteria 6876637
654 2924200144 2924193448 Bacteria 6955718
655 2924207165 2924200457 Bacteria 6757188
656 2924210766 2924207177 Bacteria 6917007
657 2924215829 2924214083 Bacteria 7080103
658 2924225600 2924221636 Bacteria 7113495
659 2924235144 2924228884 Bacteria 6633132
660 2926755530 2926754445 Bacteria 5964435
661 2926762658 2926760298 Bacteria 5505990
662 2929141035 2929138655 Bacteria 5810547
663 2933008983 2933006813 Bacteria 4912075
664 2933014741 2933011516 Bacteria 5439334
665 2933023527 2933016740 Bacteria 6355406
666 2933571087 2933570622 Bacteria 7023390
667 2933588914 2933586486 Bacteria 7667493
668 2933596422 2933594066 Bacteria 5594265
669 2933600728 2933599457 Bacteria 5858799
670 2935896777 2935894831 Bacteria 6620579
671 2935901719 2935901341 Bacteria 7341747
672 2936379641 2936375103 Bacteria 6652732
673 2936387811 2936381700 Bacteria 7006523
674 2937002726 2936996657 Bacteria 6298727
675 2937005287 2937002841 Bacteria 6934057
676 2937012823 2937009748 Bacteria 6746052
677 2937021912 2937016420 Bacteria 6782579
678 2937027298 2937023124 Bacteria 6815156
679 2937033378 2937029754 Bacteria 6424026
680 2937038444 2937036028 Bacteria 6846469
681 2937048502 2937042894 Bacteria 6741576
682 2937050957 2937049772 Bacteria 6757901
683 2937062903 2937056579 Bacteria 7107896
684 2937065100 2937063883 Bacteria 7199456
685 2937075891 2937071275 Bacteria 6984483
686 2937080652 2937078374 Bacteria 6610289
687 2937085424 2937084907 Bacteria 6618516
688 2937093139 2937091812 Bacteria 6979387
689 2937099728 2937098957 Bacteria 7249374
690 2937107317 2937106411 Bacteria 6947143
691 2937117719 2937113482 Bacteria 6505872
692 2937124552 2937119839 Bacteria 6597547
693 2937132722 2937126314 Bacteria 6771275
694 2941504724 2941499720 Bacteria 7599444
695 2957380735 2957375807 Bacteria 6425588
696 2957388215 2957382221 Bacteria 6737050
697 2957394614 2957388812 Bacteria 6778072
698 2957397215 2957395598 Bacteria 6822399
699 2957408245 2957402308 Bacteria 6741770
700 2957414700 2957408893 Bacteria 6558585
701 2957418990 2957415311 Bacteria 6991633
702 2957423627 2957422303 Bacteria 7172205
703 2957430730 2957430029 Bacteria 7022557
704 2957443582 2957437181 Bacteria 6568994
705 2957445553 2957443900 Bacteria 6869977
706 2957455737 2957450854 Bacteria 6765715
707 2957458464 2957457609 Bacteria 6967680
708 2957471048 2957464669 Bacteria 6568877
709 2957472405 2957471148 Bacteria 6797643
710 2957483127 2957478035 Bacteria 6756658
711 2957486002 2957484790 Bacteria 6703082
712 2957495175 2957491536 Bacteria 6695180
713 2957499251 2957498199 Bacteria 7126688
714 2957507021 2957505466 Bacteria 7253085
715 2960589871 2960584000 Bacteria 6864594
716 2960594059 2960591022 Bacteria 6622873
717 2960602148 2960597568 Bacteria 6550735
718 2960605075 2960603979 Bacteria 6898737
719 2960613141 2960610863 Bacteria 6691244
720 2960619838 2960617483 Bacteria 6727748
721 2960629738 2960624210 Bacteria 6875384
722 2960635588 2960631154 Bacteria 6732508
723 2960640156 2960637947 Bacteria 7296468
724 2960647213 2960645483 Bacteria 7211087
725 2960655080 2960652885 Bacteria 7083688
726 2960666995 2960660292 Bacteria 7041660
727 2960670684 2960667422 Bacteria 6763020
728 2960674845 2960674078 Bacteria 6609048
729 2960680851 2960680706 Bacteria 6624464
730 2960688163 2960687367 Bacteria 6535474
731 2960697308 2960693952 Bacteria 6749742
732 2964614423 2964607997 Bacteria 7101408
733 2964618135 2964615318 Bacteria 6809089
734 2964623222 2964621998 Bacteria 6834995
735 2964629999 2964628898 Bacteria 7083044
736 2964639185 2964636051 Bacteria 7091832
737 2964646207 2964643177 Bacteria 6820887
738 2964656231 2964649959 Bacteria 6675118
739 2964657360 2964656573 Bacteria 7100150
740 2964667707 2964663802 Bacteria 7019362
741 2964675093 2964670856 Bacteria 6851364
742 2964679786 2964678106 Bacteria 6792020
743 2964686064 2964685014 Bacteria 6839111
744 2964694762 2964691889 Bacteria 6802758
745 2964699612 2964698721 Bacteria 6765331
746 2964705813 2964705432 Bacteria 7114648
747 2964718842 2964712639 Bacteria 6695970
748 2964721278 2964719344 Bacteria 7286602
749 2967666001 2967664464 Bacteria 6948836
750 2967677742 2967671571 Bacteria 7021409
751 2967679534 2967678726 Bacteria 7264382
752 2967689286 2967686174 Bacteria 6678622
753 2967699444 2967693043 Bacteria 6804451
754 2967702578 2967699805 Bacteria 6854538
755 2967711462 2967706974 Bacteria 7186053
756 2967721062 2967714385 Bacteria 7000047
757 2967722427 2967721400 Bacteria 7073753
758 2967729453 2967728569 Bacteria 6641507
759 2967741674 2967735183 Bacteria 6827012
760 2967743112 2967742019 Bacteria 6794534
761 2967755171 2967748971 Bacteria 6733771
762 2967759693 2967755722 Bacteria 6814706
763 2967762872 2967762386 Bacteria 6923502
764 2967775584 2967769361 Bacteria 6587838
765 2967777799 2967775926 Bacteria 6738189
766 2970020503 2970019648 Bacteria 7072033
767 2970028056 2970026789 Bacteria 6785236
768 2970035939 2970033650 Bacteria 7118744
769 2970041342 2970040964 Bacteria 6731123
770 2970051507 2970047711 Bacteria 7088379
771 2970056183 2970054988 Bacteria 6611507
772 2970065459 2970061556 Bacteria 7099761
773 2970070948 2970068827 Bacteria 7123112
774 2970079378 2970076120 Bacteria 6697332
775 2970084653 2970082768 Bacteria 6183754
776 2970089272 2970088815 Bacteria 6933825
777 2970099928 2970095765 Bacteria 6936963
778 2970104010 2970102677 Bacteria 6812532
779 2970116187 2970109326 Bacteria 6863976
780 2970122530 2970116247 Bacteria 6501857
781 2970126087 2970122695 Bacteria 6625855
782 2970135507 2970129317 Bacteria 6806560
783 2970141742 2970136068 Bacteria 7207982
784 2970147252 2970143518 Bacteria 6446480
785 2970150591 2970149975 Bacteria 6779706
786 2970158574 2970156795 Bacteria 7168044
787 2970168233 2970164137 Bacteria 6861252
788 2970171620 2970170962 Bacteria 6876229
789 2970181148 2970177841 Bacteria 6768001
790 2970185593 2970184632 Bacteria 7054431
791 2970192316 2970191845 Bacteria 7032787
792 2977523209 2977516862 Bacteria 6940108
793 2977528124 2977523885 Bacteria 6960446
794 2977536440 2977530762 Bacteria 6951399
795 2977544107 2977537788 Bacteria 6929320
796 2977550531 2977544691 Bacteria 6875412
797 2977558518 2977551784 Bacteria 7125765
798 2977559901 2977558990 Bacteria 6863948
799 2977572733 2977565890 Bacteria 6901543
800 2977574130 2977572785 Bacteria 6763888
801 2977585655 2977579622 Bacteria 6772100
802 2978971907 2978969890 Bacteria 5400756
803 2979092029 2979089926 Bacteria 5670289
804 2979100582 2979095461 Bacteria 5669583
805 2979104087 2979100975 Bacteria 5423623
806 2984511343 2984509177 Bacteria 5274802
807 2984522296 2984518228 Bacteria 5277463
808 2984541598 2984537506 Bacteria 5277481
809 2984590191 2984587000 Bacteria 5263363
810 2984603871 2984601300 Bacteria 5455244
811 2989350062 2989349275 Bacteria 6349068
812 2989775994 2989771324 Bacteria 5605128
813 2989779477 2989776772 Bacteria 4843317
814 2996892809 2996887358 Bacteria 5795980
815 2996894912 2996893221 Bacteria 5823108
816 3003934477 3003930520 Bacteria 5667563
817 3005414333 3005409236 Bacteria 7188837
818 3005418952 3005416602 Bacteria 7064308
819 3005448683 3005445848 Bacteria 6906074
820 3005454916 3005452660 Bacteria 5889319
821 643826560 643692032 Bacteria 6891900
822 648739461 648276728 Bacteria 6968865
823 650740727 650716007 Bacteria 5573770
824 8003571801 8003570095 Bacteria 5747666
825 8003994398 8003992118 Bacteria 7266902
826 8004002096 8003999396 Bacteria 7063185
827 8005249915 8005246636 Bacteria 4933972
828 8005259424 8005258706 Bacteria 6184835
829 8005281444 8005275841 Bacteria 6929066
830 8005284589 8005282627 Bacteria 6675747
831 8005303355 8005301065 Bacteria 6614431
832 8005309628 8005307578 Bacteria 7395396
833 8005318156 8005314921 Bacteria 7072929
834 8005327336 8005321885 Bacteria 5795980
835 8005381162 8005376324 Bacteria 6590079
836 8005388886 8005382845 Bacteria 6732062
837 8005395870 8005395548 Bacteria 6806915
838 8005437510 8005430974 Bacteria 6689030
839 8005464033 8005460587 Bacteria 7157962
840 8005501123 8005497431 Bacteria 6477605
841 8005561452 8005556819 Bacteria 6908598
842 8005568230 8005563573 Bacteria 7153261
843 8005573231 8005570704 Bacteria 6957481
844 8005622491 8005619151 Bacteria 7030230
845 8005629992 8005626139 Bacteria 6534237
846 8005646048 8005645114 Bacteria 6950293
847 8005672541 8005668836 Bacteria 6953162
848 8005682659 8005682033 Bacteria 6726518
849 8005691874 8005688590 Bacteria 6610080
850 8005697640 8005695170 Bacteria 6912330
851 8018127972 8018127388 Bacteria 7351159
852 8018151328 8018150411 Bacteria 5549903
853 8018164338 8018163183 Bacteria 7277977
854 8018176823 8018176218 Bacteria 6896178
855 8023682932 8023680758 Bacteria 7729763
856 8024482632 8024479707 Bacteria 6954785
857 8024488270 8024486573 Bacteria 6540512
858 8024504662 8024501048 Bacteria 6427847
859 8045864452 8045864390 Bacteria 5043873
860 8046771712 8046767195 Bacteria 7547379
861 8049295529 8049293176 Bacteria 6128433
862 8054463154 8054460903 Bacteria 4872905
863 8054563192 8054558443 Bacteria 5204801
864 8054568280 8054563764 Bacteria 5592885
865 8056377611 8056375014 Bacteria 7006639
866 8056386260 8056382006 Bacteria 6408074
867 8056875777 8056875544 Bacteria 4355797
868 8057134907 8057132660 Bacteria 4061191
869 8057575467 8057575449 Bacteria 7367519
870 8057879889 8057874678 Bacteria 7494653
871 JGI25155J39150_1000014
872 JGI25156J39149_1000037
873 JGI25156J39149_1000079
874 JGI25162J39368_1000217
875 JGI25154J39366_1000052
876 JGI25157J39369_1000040
877 JGI25152J39213_1002416
878 JGI25159J45721_1002103
879 JGI25151J46595_10011640
880 JGI25151J46595_10011704
881 JGI25165J46597_1000371
882 JGI25165J46597_1007941
883 JGI25153J46596_10032916
884 JGI25153J46596_10053025
885 rootL2_10205427
886 rootH1_10051068
887 rootH1_10128832
888 JGI25160J50197_1000021
889 JGI25160J50197_1011587
890 JGI25160J50197_1032898
891 JGI25161J50226_1000283
892 JGI25161J50226_1001614
893 Ga0006562J51391_1009538
894 Ga0055526_1001319
895 Ga0055526_1014566
896 Ga0055526_1020556
897 Ga0055524_1000779
898 Ga0055524_1005323
899 Ga0055524_1008271
900 Ga0055536_1001985
901 Ga0055528_1002808
902 Ga0055528_1004596
903 Ga0055530_10012975
904 Ga0055540_1002222
905 Ga0055531_10024082
906 Ga0055543_1000060
907 Ga0055543_1000102
908 Ga0065165_1000033
909 Ga0065165_1010332
910 Ga0065165_1031464
911 Ga0070666_10207602
912 Ga0070669_100074863
913 Ga0070671_100011226
914 Ga0070667_100071705
915 Ga0070665_100009296
916 Ga0075365_10140915
917 Ga0075368_10029289
918 Ga0075363_100023075
919 Ga0075364_10006414
920 Ga0075364_10044704
921 Ga0075362_10022134
922 Ga0075367_10002965
923 Ga0075367_10018265
924 Ga0075366_10016046
925 Ga0075366_10099457
926 Ga0075370_10018991
927 Ga0075370_10226157
928 Ga0075430_100107384
929 Ga0079104_1000015
930 Ga0079104_1001889
931 Ga0099826_10002571
932 Ga0099826_10020046
933 Ga0105251_10034832
934 Ga0105240_10000014
935 Ga0105247_10172028
936 Ga0105237_10002639
937 Ga0123341_1065539
938 Ga0105239_10002361
939 Ga0157373_10057610
940 Ga0157370_10000329
941 Ga0157370_10000616
942 Ga0157369_10010177
943 Ga0171463_1007
944 Ga0182008_10018664
945 Ga0182005_1001345
946 Ga0183363_1049
947 Ga0163161_10265779
948 Ga0214542_1017328
949 Ga0214543_1000022
950 Ga0228711_1000026
951 Ga0228710_1000005
952 Ga0209435_100027
953 Ga0209436_100061
954 Ga0209436_101773
955 Ga0209437_100051
956 Ga0207425_1003320
957 Ga0209646_1000086
958 Ga0209026_1000082
959 Ga0209677_100273
960 Ga0209759_1000063
961 Ga0209129_1000636
962 Ga0209129_1001005
963 Ga0209129_1007582
964 Ga0209129_1018834
965 Ga0209233_1000190
966 Ga0209233_1000228
967 Ga0209673_1000010
968 Ga0209673_1003412
969 Ga0209673_1005547
970 Ga0209130_1000017
971 Ga0209130_1000020
972 Ga0209130_1025544
973 Ga0209676_1002904
974 Ga0209025_1000154
975 Ga0209025_1000161
976 Ga0209025_1000927
977 Ga0209025_1008474
978 Ga0209025_1026536
979 Ga0209025_1046881
980 Ga0209564_1000013
981 Ga0209564_1000265
982 Ga0209564_1006203
983 Ga0209564_1018890
984 Ga0209758_1040654
985 Ga0209758_1041355
986 Ga0209050_1006557
987 Ga0209050_1019226
988 Ga0209256_1000153
989 Ga0209256_1002253
990 Ga0209256_1003715
991 Ga0209256_1006735
992 Ga0207426_1000006
993 Ga0207426_1000008
994 Ga0207426_1001616
995 Ga0209051_1003619
996 Ga0209257_1011582
997 Ga0207695_10000037
998 Ga0207671_10000271
999 Ga0207681_10068465
1000 Ga0207681_10098973
1001 Ga0207644_10039200
1002 Ga0207711_10107074
1003 Ga0207639_10246704
1004 Ga0209281_1000034
1005 Ga0209281_1000082
1006 Ga0209281_1001218
1007 Ga0209371_1000022
1008 Ga0209371_1000892
1009 Ga0209371_1006391
1010 Ga0209282_1000006
1011 Ga0209282_1010102
1012 Ga0209282_1014812
1013 Ga0209813_10051482
1014 Ga0268266_10028323
1015 Ga0307515_10000017
1016 Ga0307515_10007366
1017 Ga0307515_10119597
1018 Ga0268256_1000019
1019 Ga0268256_1009929
1020 Ga0268256_1015530
1021 Ga0307513_10007887
1022 Ga0315914_1000003
1023 Ga0307409_100296009
1024 Ga0307416_100297826
1025 Ga0307414_10015231
1026 Ga0315913_1000001
1027 Ga0315915_1000008
1028 Ga0400483_144584
1029 Ga0400483_144715
1030 Ga0400483_173528
1031 Ga0400483_223083
1032 Ga0400483_260895
1033 Ga0439436_0019138
1034 Ga0439465_0015359
1035 Ga0450906_010017
1036 Ga0450918_007143
1037 Ga0451576_0004828
1038 Ga0451576_0308659
1039 Ga0495592_0034282
1040 Ga0495638_0001972
1041 Ga0495605_0001262
1042 Ga0495585_0023209
1043 Ga0495583_0086207
1044 Ga0495606_0065072
1045 Ga0495631_0001657
1046 Ga0495632_0007478
1047 Ga0495652_0049727
1048 Ga0495668_0002537
1049 Ga0495625_0003630
1050 Ga0495588_0029296
1051 Ga0495658_0064662
1052 Ga0495600_0009780
1053 Ga0495604_0011494
1054 Ga0495636_0015013
1055 Ga0495676_0272520
1056 Ga0495686_0001854
1057 Ga0495686_0031028
1058 Ga0496101_0152173
1059 Ga0496102_0028396
1060 Ga0496102_0071198
1061 Ga0496103_0013796
1062 Ga0496103_0066901
1063 Ga0496106_0000726
1064 Ga0496106_0119525
1065 Ga0496111_0042549
1066 Ga0496112_0318658
1067 Ga0496116_0000105
1068 Ga0496116_0018029
1069 Ga0496116_0043165
1070 Ga0496116_0103151
1071 Ga0496117_0000002
1072 Ga0496117_0002822
1073 Ga0496118_0000566
1074 Ga0496118_0001151
1075 Ga0496118_0051779
1076 Ga0496119_0004810
1077 Ga0496119_0006275
1078 Ga0496119_0015928
1079 Ga0496119_0034056
1080 Ga0496119_0036609
1081 Ga0496120_0000309
1082 Ga0496120_0007332
1083 Ga0496120_0039582
1084 Ga0496120_0041824
1085 Ga0496121_0000003
1086 Ga0496121_0000115
1087 Ga0496121_0005249
1088 Ga0496121_0010864
1089 Ga0496121_0022954
1090 Ga0496121_0066555
1091 Ga0496121_0099353
1092 Ga0496122_0000004
1093 Ga0496122_0012131
1094 Ga0496122_0028967
1095 Ga0496122_0193979
1096 Ga0496123_0000007
1097 Ga0496123_0000048
1098 Ga0496123_0039398
1099 Ga0496123_0051512
1100 Ga0496123_0080369
1101 Ga0496124_0006013
1102 Ga0496124_0019302
1103 Ga0496124_0020334
1104 Ga0496124_0093364
1105 Ga0496125_0000786
1106 Ga0496125_0012488
1107 Ga0496125_0207141
1108 Ga0496126_0000188
1109 Ga0496126_0018391
1110 Ga0496126_0106305
1111 Ga0496126_0132397
1112 Ga0496126_0133141
1113 Ga0496126_0202373
1114 Ga0495678_029376
1115 Ga0501032_0045777
1116 Ga0501034_0236504
1117 Ga0501036_0298713
1118 Ga0501039_0095078
1119 Ga0501047_0088435
1120 Ga0501047_0105200
1121 Ga0501073_0067618
1122 Ga0501083_0017355
1123 Ga0501035_0045529
1124 nmdc:mga03n38_11439_c1
1125 nmdc:mga00v17_180_c1
1126 nmdc:mga00v17_61578_c1
1127 nmdc:mga0yw44_288549_c1
1128 nmdc:mga0yw44_86764_c1
1129 nmdc:mga0k408_114401_c1
1130 nmdc:mga06z11_34915_c1
1131 nmdc:mga07m45_1993_c2
1132 Ga0500560_000226
1133 Ga0500572_005574
1134 Ga0500618_000056
1135 Ga0500655_020055
1136 Ga0500568_0000905
1137 Ga0500568_0001684
1138 Ga0500568_0016980
1139 Ga0500573_0001807
1140 Ga0500616_0000576
1141 Ga0500624_000308
1142 Ga0500636_0007056
1143 Ga0590071_002472
1144 Ga0587066_009157
1145 Ga0587066_009472
1146 Ga0587070_003881
1147 Ga0587073_0003784
1148 Ga0587077_013975
1149 Ga0587080_008198
1150 Ga0587082_002034
1151 Ga0587083_0000710
1152 Ga0587086_008220
1153 Ga0587088_005697
1154 Ga0587090_004207
1155 Ga0587091_004029
1156 Ga0587092_010567
1157 Ga0587098_004289
1158 Ga0587106_000696
1159 Ga0587099_000630
1160 Ga0587128_001425
1161 Ga0587062_007327
1162 Ga0587067_000720
1163 Ga0587068_003981
1164 Ga0587069_004470
1165 Ga0587072_004751
1166 Ga0587072_014464
1167 Ga0587075_004587
1168 Ga0587076_009544
1169 Ga0587078_004960
1170 Ga0587107_003208
1171 Ga0587071_003113
1172 Ga0587111_0004573
1173 Ga0501082_0162527
1174 8005658841
1175 2509108144
1176 2509376681
1177 2509391800
1178 2510134182
1179 2510305333
1180 2511133213
1181 2511199260
1182 2511390169
1183 2511502471
1184 2512533847
1185 2512970404
1186 2513567736
1187 2513577182
1188 2513588349
1189 2513590862
1190 2513597665
1191 2513601468
1192 2513619527
1193 2513707854
1194 2513884462
1195 2513904496
1196 2513908538
1197 2513925178
1198 2513983665
1199 2513997676
1200 2514003086
1201 2514018070
1202 2515113349
1203 2515609264
1204 2515638942
1205 2515645504
1206 2515655110
1207 2515739717
1208 2516206184
1209 2516893846
1210 2517036952
1211 2517077313
1212 2517096069
1213 2517407692
1214 2517570558
1215 2520377027
1216 2524448333
1217 2524458861
1218 2530646570
1219 2535485262
1220 2537877059
1221 2551677393
1222 2551689820
1223 2551694951
1224 2551703975
1225 2551710104
1226 2551722118
1227 2551725746
1228 2551732511
1229 2551739449
1230 2554248401
1231 2558863956
1232 2559295517
1233 2585167451
1234 2585223089
1235 2585265675
1236 2585271356
1237 2585323099
1238 2585331211
1239 2585388880
1240 2585395421
1241 2585400961
1242 2585524741
1243 2585531219
1244 2585538424
1245 2585545672
1246 2585552858
1247 2585559099
1248 2585822137
1249 2585836377
1250 2585898480
1251 2585903955
1252 2587980927
1253 2599332010
1254 2599417085
1255 2599601834
1256 2600194855
1257 2600374105
1258 2601609910
1259 2601746685
1260 2616293134
1261 2616311038
1262 2616554476
1263 2617384838
1264 2643804191
1265 2643856571
1266 2643920167
1267 2644007037
1268 2644050228
1269 2644065035
1270 2644105254
1271 2644145670
1272 2644191816
1273 2644204711
1274 2644208781
1275 2644242566
1276 2644298914
1277 2644309667
1278 2644331165
1279 2644376556
1280 2644416708
1281 2644449748
1282 2644483148
1283 2644494302
1284 2644497795
1285 2644521788
1286 2644543396
1287 2644616191
1288 2644652311
1289 2644657143
1290 2644675814
1291 2644689880
1292 2657681736
1293 2671111205
1294 2692315278
1295 2719182023
1296 2719386635
1297 2719666383
1298 2719732739
1299 2720492803
1300 2720614270
1301 2720621039
1302 2720632362
1303 2720776090
1304 2721148114
1305 2721159566
1306 2721164950
1307 2721400339
1308 2722841120
1309 2723027689
1310 2723561317
1311 2723567940
1312 2724039152
1313 2724045495
1314 2724090697
1315 2724105205
1316 2724111033
1317 2725951370
1318 2730108625
1319 2730165258
1320 2730299198
1321 2738944074
1322 2739033065
1323 2753359914
1324 2753462366
1325 2757571802
1326 2758642234
1327 2766066108
1328 2776914198
1329 2778175658
1330 2792581447
1331 2792620573
1332 2792625932
1333 2792638872
1334 2793315863
1335 2793319406
1336 2793328490
1337 2793335449
1338 2793339499
1339 2793347024
1340 2793361911
1341 2793367666
1342 2802716760
1343 2802725572
1344 2802730337
1345 2802737692
1346 2802742919
1347 2802750343
1348 2804752922
1349 2805926846
1350 2805932759
1351 2806045204
1352 2806050001
1353 2806056839
1354 2806064220
1355 2806071488
1356 2808987748
1357 2819241077
1358 2819559233
1359 2819609365
1360 2819641323
1361 2819685162
1362 2821125751
1363 2834581507
1364 2837654668
1365 2837681673
1366 2838021682
1367 2838023626
1368 2838033375
1369 2838038709
1370 2838045197
1371 2838053324
1372 2838065442
1373 2838069922
1374 2838079782
1375 2838661369
1376 2838670588
1377 2838683218
1378 2838686813
1379 2838697838
1380 2838702959
1381 2838710953
1382 2838714479
1383 2838721720
1384 2838730229
1385 2838737798
1386 2838742756
1387 2839997515
1388 2840768994
1389 2841841833
1390 2841848704
1391 2841854641
1392 2841862302
1393 2841867186
1394 2842079127
1395 2842113029
1396 2842118362
1397 2842125265
1398 2842130492
1399 2842141612
1400 2842147783
1401 2842154338
1402 2842158339
1403 2842168558
1404 2842170721
1405 2842177958
1406 2842181955
1407 2842187588
1408 2842195829
1409 2842199140
1410 2842209587
1411 2842211899
1412 2842218179
1413 2842226482
1414 2842230046
1415 2842240275
1416 2842243935
1417 2842252849
1418 2842257980
1419 2842269513
1420 2842271649
1421 2842283041
1422 2842285379
1423 2842292789
1424 2842298212
1425 2842305280
1426 2842313993
1427 2842319767
1428 2842348455
1429 2842360188
1430 2842368322
1431 2842373849
1432 2842379186
1433 2842384873
1434 2842400115
1435 2842402739
1436 2842409890
1437 2842416538
1438 2842423536
1439 2842430485
1440 2842436703
1441 2842443455
1442 2842449325
1443 2842466739
1444 2842471427
1445 2842479959
1446 2842483841
1447 2842492296
1448 2842497843
1449 2842505256
1450 2842514265
1451 2842519086
1452 2842522080
1453 2842872162
1454 2842924345
1455 2844164013
1456 2844458110
1457 2847419665
1458 2848994666
1459 2850081682
1460 2852390489
1461 2854901351
1462 2854912571
1463 2854919021
1464 2855023611
1465 2855826570
1466 2855841961
1467 2855877181
1468 2857517187
1469 2857532312
1470 2858802636
1471 2891373590
1472 2894655707
1473 2894820511
1474 2896391104
1475 2899261217
1476 2899275940
1477 2899794093
1478 2899806228
1479 2899849541
1480 2904582097
1481 2913296127
1482 2913313584
1483 2915653293
1484 2915982872
1485 2915989859
1486 2915994721
1487 2916002111
1488 2916008970
1489 2916018993
1490 2916022984
1491 2916033823
1492 2916041868
1493 2916044341
1494 2916050389
1495 2916060301
1496 2916065472
1497 2916070183
1498 2916078332
1499 2919106224
1500 2919114515
1501 2919123122
1502 2919169506
1503 2919410227
1504 2920761304
1505 2920825494
1506 2921203165
1507 2921212524
1508 2921238213
1509 2921244534
1510 2921253720
1511 2921261928
1512 2921269445
1513 2921283648
1514 2921291047
1515 2921303888
1516 2924144531
1517 2924151692
1518 2924164874
1519 2924167434
1520 2924178463
1521 2924183534
1522 2924187446
1523 2924200144
1524 2924207165
1525 2924210766
1526 2924215829
1527 2924225600
1528 2924235144
1529 2926755530
1530 2926762658
1531 2929141035
1532 2933008983
1533 2933014741
1534 2933023527
1535 2933571087
1536 2933588914
1537 2933596422
1538 2933600728
1539 2935896777
1540 2935901719
1541 2936379641
1542 2936387811
1543 2937002726
1544 2937005287
1545 2937012823
1546 2937021912
1547 2937027298
1548 2937033378
1549 2937038444
1550 2937048502
1551 2937050957
1552 2937062903
1553 2937065100
1554 2937075891
1555 2937080652
1556 2937085424
1557 2937093139
1558 2937099728
1559 2937107317
1560 2937117719
1561 2937124552
1562 2937132722
1563 2941504724
1564 2957380735
1565 2957388215
1566 2957394614
1567 2957397215
1568 2957408245
1569 2957414700
1570 2957418990
1571 2957423627
1572 2957430730
1573 2957443582
1574 2957445553
1575 2957455737
1576 2957458464
1577 2957471048
1578 2957472405
1579 2957483127
1580 2957486002
1581 2957495175
1582 2957499251
1583 2957507021
1584 2960589871
1585 2960594059
1586 2960602148
1587 2960605075
1588 2960613141
1589 2960619838
1590 2960629738
1591 2960635588
1592 2960640156
1593 2960647213
1594 2960655080
1595 2960666995
1596 2960670684
1597 2960674845
1598 2960680851
1599 2960688163
1600 2960697308
1601 2964614423
1602 2964618135
1603 2964623222
1604 2964629999
1605 2964639185
1606 2964646207
1607 2964656231
1608 2964657360
1609 2964667707
1610 2964675093
1611 2964679786
1612 2964686064
1613 2964694762
1614 2964699612
1615 2964705813
1616 2964718842
1617 2964721278
1618 2967666001
1619 2967677742
1620 2967679534
1621 2967689286
1622 2967699444
1623 2967702578
1624 2967711462
1625 2967721062
1626 2967722427
1627 2967729453
1628 2967741674
1629 2967743112
1630 2967755171
1631 2967759693
1632 2967762872
1633 2967775584
1634 2967777799
1635 2970020503
1636 2970028056
1637 2970035939
1638 2970041342
1639 2970051507
1640 2970056183
1641 2970065459
1642 2970070948
1643 2970079378
1644 2970084653
1645 2970089272
1646 2970099928
1647 2970104010
1648 2970116187
1649 2970122530
1650 2970126087
1651 2970135507
1652 2970141742
1653 2970147252
1654 2970150591
1655 2970158574
1656 2970168233
1657 2970171620
1658 2970181148
1659 2970185593
1660 2970192316
1661 2977523209
1662 2977528124
1663 2977536440
1664 2977544107
1665 2977550531
1666 2977558518
1667 2977559901
1668 2977572733
1669 2977574130
1670 2977585655
1671 2978971907
1672 2979092029
1673 2979100582
1674 2979104087
1675 2984511343
1676 2984522296
1677 2984541598
1678 2984590191
1679 2984603871
1680 2989350062
1681 2989775994
1682 2989779477
1683 2996892809
1684 2996894912
1685 3003934477
1686 3005414333
1687 3005418952
1688 3005448683
1689 3005454916
1690 643826560
1691 648739461
1692 650740727
1693 8003571801
1694 8003994398
1695 8004002096
1696 8005249915
1697 8005259424
1698 8005281444
1699 8005284589
1700 8005303355
1701 8005309628
1702 8005318156
1703 8005327336
1704 8005381162
1705 8005388886
1706 8005395870
1707 8005437510
1708 8005464033
1709 8005501123
1710 8005561452
1711 8005568230
1712 8005573231
1713 8005622491
1714 8005629992
1715 8005646048
1716 8005672541
1717 8005682659
1718 8005691874
1719 8005697640
1720 8018127972
1721 8018151328
1722 8018164338
1723 8018176823
1724 8023682932
1725 8024482632
1726 8024488270
1727 8024504662
1728 8045864452
1729 8046771712
1730 8049295529
1731 8054463154
1732 8054563192
1733 8054568280
1734 8056377611
1735 8056386260
1736 8056875777
1737 8057134907
1738 8057575467
1739 8057879889

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04069

OpuAC

Substrate binding domain of ABC-type glycine betaine transport system

33

288

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tmg-assembly4.cif.gz_D crystal structure of glycine betaine, l-proline abc transporter, glycine/betaine/l-proline-binding protein (prox) from borrelia burgdorferi 0.9365 20 297
3l6h-assembly1.cif.gz_A crystal structure of lactococcal opuac in its closed-liganded conformation complexed with glycine betaine 0.9337 20 281
3tmg-assembly4.cif.gz_D crystal structure of glycine betaine, l-proline abc transporter, glycine/betaine/l-proline-binding protein (prox) from borrelia burgdorferi 0.9263 20 297
2rej-assembly2.cif.gz_B abc-transporter choline binding protein in unliganded semi-closed conformation 0.9241 19 303
3l6h-assembly1.cif.gz_A crystal structure of lactococcal opuac in its closed-liganded conformation complexed with glycine betaine 0.9162 20 281
ID Description Score Start End Superfamily
2regA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9984 20 303 3.40.190.10
2regA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9598 20 303 3.40.190.10
2rejA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Glycine betaine-binding periplasmic protein; domain 2 0.9395 103 210 3.40.190.100
3l6hA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.939 20 281 3.40.190.10
2rejA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Glycine betaine-binding periplasmic protein; domain 2 0.9155 103 210 3.40.190.100
ID Description Score Start End GO Terms
AF-A0A7C1SZW2-F1-model_v4 Choline ABC transporter substrate-binding protein 0.9906 21 303 GO:0015871
GO:0022857
GO:0033265
GO:0042597
GO:0043190
AF-A0A849FZL3-F1-model_v4 Choline ABC transporter substrate-binding protein 0.9883 52 303 GO:0015871
GO:0022857
GO:0033265
GO:0042597
GO:0043190
AF-A0A7C1SZW2-F1-model_v4 Choline ABC transporter substrate-binding protein 0.9872 21 303 GO:0015871
GO:0022857
GO:0033265
GO:0042597
GO:0043190
AF-A0A0Q0F315-F1-model_v4 deleted 0.9862 22 303
AF-A0A534J6A0-F1-model_v4 Choline ABC transporter substrate-binding protein 0.9856 20 300 GO:0005275
GO:0015226
GO:0015871
GO:0031460
GO:0033265
GO:0042597
GO:0043190

Map