F484140
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 870 | 289 | 1740 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300003187|JGI25151J46595_10000121|JGI25151J46595_1000012192 |
| Length | 174 |
| Sequence | MSDFEAVDHKAPFVPLDDLDRRILAQMQEDASLTNQELAEKVHASPPTCLRRVRRLVESGVIEKQVAILDPSRLGSTLTAIVEITLDVQAAEKMTEFEALVRDEPAILQCHRVSPGPDFVLIAQVADMPAYHALVHRAFTAQANVRNVRTFFSVHRSKFETRIAAAALKSDQGT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 2 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 4 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 5 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 10 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 39 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 40 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 43 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 65 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 105 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 107 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 108 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 109 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 110 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 111 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 112 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 113 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 114 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 115 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 116 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 117 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 118 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 119 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 120 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 121 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 122 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 123 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 124 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 125 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 126 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 127 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 128 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 129 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 130 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 131 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 132 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 133 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 134 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 135 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 136 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 137 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 138 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 139 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 140 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 141 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 216 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 217 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 218 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 219 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 220 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 221 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 223 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 224 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 225 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 226 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 227 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 228 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 229 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 230 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 231 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 232 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 233 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 234 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 235 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 238 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 243 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 244 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 245 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 246 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 247 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 248 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 249 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 250 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 251 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 252 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 253 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 254 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 255 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 258 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 259 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 260 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 261 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 262 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 264 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 265 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 266 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 267 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 268 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 269 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 270 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 271 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 272 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 273 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 274 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 275 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 276 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 277 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 278 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 279 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 280 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 281 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 282 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 283 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 284 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 285 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 286 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 287 | 2941479691 | |||
| 288 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 289 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.9 |
| Metatranscriptomes | 0.11 |
| Isolates | 2.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.92 |
| Nodule | 0.57 |
| Rhizoplane | 3.56 |
| Rhizosphere | 78.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10000121 | 3300003187 | Bacteria | 106308 |
| 2 | JGI25158J39367_1014859 | 3300002739 | Bacteria | 1001 |
| 3 | JGI25152J39213_1000167 | 3300002773 | Bacteria | 44888 |
| 4 | JGI25150J39212_1003873 | 3300002774 | Bacteria | 3434 |
| 5 | JGI25159J45721_1001390 | 3300002987 | Bacteria | 10054 |
| 6 | JGI25159J45721_1025954 | 3300002987 | Bacteria | 1018 |
| 7 | JGI25159J45721_1025965 | 3300002987 | Bacteria | 1018 |
| 8 | JGI25153J46596_10007800 | 3300003215 | Bacteria | 5201 |
| 9 | rootL2_10271811 | 3300003322 | Bacteria | 1375 |
| 10 | JGI25160J50197_1043176 | 3300003354 | Bacteria | 1018 |
| 11 | JGI25160J50197_1043192 | 3300003354 | Bacteria | 1018 |
| 12 | JGI25161J50226_1001036 | 3300003374 | Bacteria | 9569 |
| 13 | JGI25161J50226_1011032 | 3300003374 | Bacteria | 1160 |
| 14 | JGI25161J50226_1016535 | 3300003374 | Bacteria | 788 |
| 15 | Ga0055525_1000023 | 3300003759 | Bacteria | 359920 |
| 16 | Ga0055542_1020354 | 3300003762 | Bacteria | 974 |
| 17 | Ga0055529_1004675 | 3300003763 | Bacteria | 2059 |
| 18 | Ga0055526_1023986 | 3300003771 | Bacteria | 2013 |
| 19 | Ga0055537_1019145 | 3300003773 | Bacteria | 1072 |
| 20 | Ga0055524_1000038 | 3300003775 | Bacteria | 162683 |
| 21 | Ga0055524_1000608 | 3300003775 | Bacteria | 25678 |
| 22 | Ga0055524_1023971 | 3300003775 | Bacteria | 1950 |
| 23 | Ga0055524_1049207 | 3300003775 | Bacteria | 974 |
| 24 | Ga0055536_1039444 | 3300003781 | Bacteria | 1134 |
| 25 | Ga0055534_1011502 | 3300003784 | Bacteria | 1794 |
| 26 | Ga0055534_1024600 | 3300003784 | Bacteria | 974 |
| 27 | Ga0055528_1008217 | 3300003790 | Bacteria | 4509 |
| 28 | Ga0055530_10008998 | 3300003791 | Bacteria | 3903 |
| 29 | Ga0055530_10014933 | 3300003791 | Bacteria | 2561 |
| 30 | Ga0055531_10006255 | 3300003794 | Bacteria | 6794 |
| 31 | Ga0055531_10009487 | 3300003794 | Bacteria | 4968 |
| 32 | Ga0055543_1004210 | 3300004625 | Bacteria | 3984 |
| 33 | Ga0055543_1025449 | 3300004625 | Bacteria | 1056 |
| 34 | Ga0065165_1000495 | 3300005262 | Bacteria | 60868 |
| 35 | Ga0065165_1012767 | 3300005262 | Bacteria | 3396 |
| 36 | Ga0065165_1059071 | 3300005262 | Bacteria | 1056 |
| 37 | Ga0065715_10050641 | 3300005293 | Bacteria | 1648 |
| 38 | Ga0070658_10405392 | 3300005327 | Bacteria | 1171 |
| 39 | Ga0070658_10428996 | 3300005327 | Bacteria | 1138 |
| 40 | Ga0070658_10755289 | 3300005327 | Bacteria | 844 |
| 41 | Ga0070680_100069973 | 3300005336 | Bacteria | 2882 |
| 42 | Ga0070682_100166225 | 3300005337 | Bacteria | 1529 |
| 43 | Ga0070660_100515437 | 3300005339 | Bacteria | 995 |
| 44 | Ga0070661_100051185 | 3300005344 | Bacteria | 3022 |
| 45 | Ga0070659_100015332 | 3300005366 | Bacteria | 5739 |
| 46 | Ga0070659_100183538 | 3300005366 | Bacteria | 1717 |
| 47 | Ga0070667_100001997 | 3300005367 | Bacteria | 18078 |
| 48 | Ga0070663_100505741 | 3300005455 | Bacteria | 1004 |
| 49 | Ga0070663_101283141 | 3300005455 | Bacteria | 646 |
| 50 | Ga0070662_100119361 | 3300005457 | Bacteria | 2019 |
| 51 | Ga0070662_100614532 | 3300005457 | Bacteria | 915 |
| 52 | Ga0068853_100137258 | 3300005539 | Bacteria | 2193 |
| 53 | Ga0068853_101156634 | 3300005539 | Bacteria | 747 |
| 54 | Ga0070665_100121741 | 3300005548 | Bacteria | 2611 |
| 55 | Ga0068855_100132767 | 3300005563 | Bacteria | 2842 |
| 56 | Ga0068855_100239212 | 3300005563 | Bacteria | 2029 |
| 57 | Ga0070664_100507058 | 3300005564 | Bacteria | 1112 |
| 58 | Ga0068852_100729038 | 3300005616 | Bacteria | 1003 |
| 59 | Ga0075364_10007806 | 3300006051 | Bacteria | 6372 |
| 60 | Ga0075364_10082872 | 3300006051 | Bacteria | 2122 |
| 61 | Ga0075364_10161940 | 3300006051 | Bacteria | 1510 |
| 62 | Ga0075362_10168836 | 3300006177 | Bacteria | 1056 |
| 63 | Ga0097621_100990574 | 3300006237 | Bacteria | 786 |
| 64 | Ga0068871_100677623 | 3300006358 | Bacteria | 943 |
| 65 | Ga0099826_10000008 | 3300006948 | Bacteria | 380974 |
| 66 | Ga0099826_10353032 | 3300006948 | Bacteria | 731 |
| 67 | Ga0105244_10003553 | 3300009036 | Bacteria | 11073 |
| 68 | Ga0105244_10038011 | 3300009036 | Bacteria | 2512 |
| 69 | Ga0105244_10041854 | 3300009036 | Bacteria | 2373 |
| 70 | Ga0105240_10001254 | 3300009093 | Bacteria | 44050 |
| 71 | Ga0105240_11706671 | 3300009093 | Bacteria | 657 |
| 72 | Ga0105245_10026281 | 3300009098 | Bacteria | 5122 |
| 73 | Ga0105245_10429914 | 3300009098 | Bacteria | 1325 |
| 74 | Ga0105245_10846549 | 3300009098 | Bacteria | 954 |
| 75 | Ga0105243_10074704 | 3300009148 | Bacteria | 2750 |
| 76 | Ga0105241_10024835 | 3300009174 | Bacteria | 4452 |
| 77 | Ga0105242_10000856 | 3300009176 | Bacteria | 23602 |
| 78 | Ga0105242_10406341 | 3300009176 | Bacteria | 1272 |
| 79 | Ga0105237_10194228 | 3300009545 | Bacteria | 2029 |
| 80 | Ga0105238_10271302 | 3300009551 | Bacteria | 1677 |
| 81 | Ga0105239_10294628 | 3300010375 | Bacteria | 1827 |
| 82 | Ga0157373_10073814 | 3300013100 | Bacteria | 2407 |
| 83 | Ga0157371_10289658 | 3300013102 | Bacteria | 1184 |
| 84 | Ga0157370_10448132 | 3300013104 | Bacteria | 1187 |
| 85 | Ga0157370_10479810 | 3300013104 | Bacteria | 1143 |
| 86 | Ga0157374_10104660 | 3300013296 | Bacteria | 2717 |
| 87 | Ga0157374_10324838 | 3300013296 | Bacteria | 1525 |
| 88 | Ga0157372_10349370 | 3300013307 | Bacteria | 1723 |
| 89 | Ga0157372_10697570 | 3300013307 | Bacteria | 1181 |
| 90 | Ga0157372_10726086 | 3300013307 | Bacteria | 1155 |
| 91 | Ga0157376_11112608 | 3300014969 | Bacteria | 816 |
| 92 | Ga0182006_1085358 | 3300015261 | Bacteria | 1145 |
| 93 | Ga0182007_10046502 | 3300015262 | Bacteria | 1437 |
| 94 | Ga0209436_100040 | 3300025208 | Bacteria | 75392 |
| 95 | Ga0209436_117835 | 3300025208 | Bacteria | 1026 |
| 96 | Ga0209436_117836 | 3300025208 | Bacteria | 1026 |
| 97 | Ga0209672_102913 | 3300025228 | Bacteria | 3818 |
| 98 | Ga0209563_100011 | 3300025230 | Bacteria | 1187808 |
| 99 | Ga0209258_105110 | 3300025242 | Bacteria | 2303 |
| 100 | Ga0207425_1000009 | 3300025245 | Bacteria | 593135 |
| 101 | Ga0207425_1000257 | 3300025245 | Bacteria | 39389 |
| 102 | Ga0207425_1009042 | 3300025245 | Bacteria | 2505 |
| 103 | Ga0207425_1036925 | 3300025245 | Bacteria | 945 |
| 104 | Ga0209677_105405 | 3300025253 | Bacteria | 3341 |
| 105 | Ga0209148_1000580 | 3300025254 | Bacteria | 33685 |
| 106 | Ga0209129_1000051 | 3300025258 | Bacteria | 267104 |
| 107 | Ga0209129_1006067 | 3300025258 | Bacteria | 4041 |
| 108 | Ga0209565_1001480 | 3300025263 | Bacteria | 10257 |
| 109 | Ga0209565_1002538 | 3300025263 | Bacteria | 6491 |
| 110 | Ga0209565_1004936 | 3300025263 | Bacteria | 3969 |
| 111 | Ga0209565_1005910 | 3300025263 | Bacteria | 3503 |
| 112 | Ga0209565_1029299 | 3300025263 | Bacteria | 1082 |
| 113 | Ga0209565_1031673 | 3300025263 | Bacteria | 1026 |
| 114 | Ga0209565_1032621 | 3300025263 | Bacteria | 1007 |
| 115 | Ga0209455_1003081 | 3300025272 | Bacteria | 6087 |
| 116 | Ga0209673_1021734 | 3300025273 | Bacteria | 2235 |
| 117 | Ga0209130_1000217 | 3300025284 | Bacteria | 75515 |
| 118 | Ga0209130_1006188 | 3300025284 | Bacteria | 3937 |
| 119 | Ga0209675_1001533 | 3300025291 | Bacteria | 13200 |
| 120 | Ga0209675_1020283 | 3300025291 | Bacteria | 1806 |
| 121 | Ga0209675_1040020 | 3300025291 | Bacteria | 1034 |
| 122 | Ga0209676_1005251 | 3300025292 | Bacteria | 6851 |
| 123 | Ga0209025_1000019 | 3300025294 | Bacteria | 631548 |
| 124 | Ga0209025_1026873 | 3300025294 | Bacteria | 2873 |
| 125 | Ga0209564_1004433 | 3300025295 | Bacteria | 8595 |
| 126 | Ga0209564_1005893 | 3300025295 | Bacteria | 6795 |
| 127 | Ga0209564_1031656 | 3300025295 | Bacteria | 1611 |
| 128 | Ga0209564_1050090 | 3300025295 | Bacteria | 1026 |
| 129 | Ga0209758_1000054 | 3300025297 | Bacteria | 337655 |
| 130 | Ga0209758_1000379 | 3300025297 | Bacteria | 77337 |
| 131 | Ga0209050_1000040 | 3300025298 | Bacteria | 408492 |
| 132 | Ga0209050_1001052 | 3300025298 | Bacteria | 33980 |
| 133 | Ga0209050_1006080 | 3300025298 | Bacteria | 7296 |
| 134 | Ga0209256_1000018 | 3300025299 | Bacteria | 568467 |
| 135 | Ga0209256_1000307 | 3300025299 | Bacteria | 85852 |
| 136 | Ga0209256_1003794 | 3300025299 | Bacteria | 10160 |
| 137 | Ga0209256_1006054 | 3300025299 | Bacteria | 6600 |
| 138 | Ga0209256_1111938 | 3300025299 | Bacteria | 547 |
| 139 | Ga0207426_1012456 | 3300025302 | Bacteria | 3191 |
| 140 | Ga0209051_1033870 | 3300025303 | Bacteria | 1923 |
| 141 | Ga0209051_1034706 | 3300025303 | Bacteria | 1887 |
| 142 | Ga0209257_1000054 | 3300025304 | Bacteria | 416957 |
| 143 | Ga0209257_1002267 | 3300025304 | Bacteria | 19627 |
| 144 | Ga0207655_1003797 | 3300025728 | Bacteria | 11020 |
| 145 | Ga0207655_1019168 | 3300025728 | Bacteria | 3591 |
| 146 | Ga0207655_1038594 | 3300025728 | Bacteria | 2085 |
| 147 | Ga0207705_10017793 | 3300025909 | Bacteria | 5083 |
| 148 | Ga0207705_10908233 | 3300025909 | Bacteria | 682 |
| 149 | Ga0207695_10075242 | 3300025913 | Bacteria | 3436 |
| 150 | Ga0207671_10055267 | 3300025914 | Bacteria | 2941 |
| 151 | Ga0207660_10057463 | 3300025917 | Bacteria | 2787 |
| 152 | Ga0207657_10005222 | 3300025919 | Bacteria | 13606 |
| 153 | Ga0207657_10076231 | 3300025919 | Bacteria | 2829 |
| 154 | Ga0207649_10029886 | 3300025920 | Bacteria | 3222 |
| 155 | Ga0207649_11112317 | 3300025920 | Unclassified | 623 |
| 156 | Ga0207694_10399624 | 3300025924 | Bacteria | 1142 |
| 157 | Ga0207690_10018849 | 3300025932 | Bacteria | 4237 |
| 158 | Ga0207706_10076717 | 3300025933 | Bacteria | 2939 |
| 159 | Ga0207686_10000388 | 3300025934 | Bacteria | 30596 |
| 160 | Ga0207709_10010359 | 3300025935 | Bacteria | 5134 |
| 161 | Ga0207704_10067996 | 3300025938 | Bacteria | 2244 |
| 162 | Ga0207689_10574443 | 3300025942 | Bacteria | 948 |
| 163 | Ga0207667_10001574 | 3300025949 | Bacteria | 28701 |
| 164 | Ga0207667_10105606 | 3300025949 | Bacteria | 2906 |
| 165 | Ga0207640_10114022 | 3300025981 | Bacteria | 1922 |
| 166 | Ga0207658_10024757 | 3300025986 | Bacteria | 4200 |
| 167 | Ga0207639_10691664 | 3300026041 | Bacteria | 946 |
| 168 | Ga0207678_10075104 | 3300026067 | Bacteria | 2895 |
| 169 | Ga0207678_10196412 | 3300026067 | Bacteria | 1724 |
| 170 | Ga0207678_10693728 | 3300026067 | Bacteria | 896 |
| 171 | Ga0207648_10522445 | 3300026089 | Bacteria | 1088 |
| 172 | Ga0207674_10046745 | 3300026116 | Bacteria | 4442 |
| 173 | Ga0209371_1019009 | 3300027312 | Bacteria | 1728 |
| 174 | Ga0209371_1044808 | 3300027312 | Bacteria | 877 |
| 175 | Ga0209282_1000005 | 3300027666 | Bacteria | 380858 |
| 176 | Ga0268266_10095208 | 3300028379 | Bacteria | 2615 |
| 177 | Ga0268256_1011399 | 3300030500 | Bacteria | 2814 |
| 178 | Ga0268256_1050650 | 3300030500 | Bacteria | 877 |
| 179 | Ga0316181_1270997 | 3300030744 | Bacteria | 2331 |
| 180 | Ga0307408_100000281 | 3300031548 | Bacteria | 51252 |
| 181 | Ga0307408_100000347 | 3300031548 | Bacteria | 43439 |
| 182 | Ga0307408_100000747 | 3300031548 | Bacteria | 26307 |
| 183 | Ga0307408_100000803 | 3300031548 | Bacteria | 25130 |
| 184 | Ga0307408_100081507 | 3300031548 | Bacteria | 2419 |
| 185 | Ga0307408_100935997 | 3300031548 | Bacteria | 795 |
| 186 | Ga0307412_10000109 | 3300031911 | Bacteria | 64548 |
| 187 | Ga0307416_100004731 | 3300032002 | Bacteria | 8254 |
| 188 | Ga0395899_0000492 | 3300037312 | Bacteria | 44106 |
| 189 | Ga0395899_0001821 | 3300037312 | Bacteria | 17656 |
| 190 | Ga0395899_0005599 | 3300037312 | Bacteria | 9742 |
| 191 | Ga0395899_0019791 | 3300037312 | Bacteria | 5107 |
| 192 | Ga0395899_0096207 | 3300037312 | Bacteria | 2141 |
| 193 | Ga0395899_0200356 | 3300037312 | Bacteria | 1392 |
| 194 | Ga0395900_0001043 | 3300037418 | Bacteria | 35555 |
| 195 | Ga0395900_0001113 | 3300037418 | Bacteria | 34100 |
| 196 | Ga0395900_0001615 | 3300037418 | Bacteria | 26551 |
| 197 | Ga0395900_0111926 | 3300037418 | Bacteria | 2803 |
| 198 | Ga0395900_0181484 | 3300037418 | Bacteria | 2138 |
| 199 | Ga0395900_0211437 | 3300037418 | Bacteria | 1958 |
| 200 | Ga0395900_0228915 | 3300037418 | Bacteria | 1870 |
| 201 | Ga0395900_0294867 | 3300037418 | Bacteria | 1609 |
| 202 | Ga0395900_0315102 | 3300037418 | Bacteria | 1546 |
| 203 | Ga0395900_0653861 | 3300037418 | Bacteria | 987 |
| 204 | Ga0395900_0773455 | 3300037418 | Bacteria | 889 |
| 205 | Ga0395900_1370422 | 3300037418 | Bacteria | 620 |
| 206 | Ga0395898_0256797 | 3300037466 | Bacteria | 1666 |
| 207 | Ga0395898_0373227 | 3300037466 | Bacteria | 1360 |
| 208 | Ga0395898_0702172 | 3300037466 | Bacteria | 953 |
| 209 | Ga0395898_0894135 | 3300037466 | Bacteria | 826 |
| 210 | Ga0395905_0048881 | 3300037471 | Bacteria | 3962 |
| 211 | Ga0395905_0146807 | 3300037471 | Bacteria | 2219 |
| 212 | Ga0395905_0153810 | 3300037471 | Bacteria | 2163 |
| 213 | Ga0395905_0249987 | 3300037471 | Bacteria | 1656 |
| 214 | Ga0395905_0342299 | 3300037471 | Bacteria | 1387 |
| 215 | Ga0395905_0668160 | 3300037471 | Bacteria | 941 |
| 216 | Ga0395905_1031704 | 3300037471 | Bacteria | 726 |
| 217 | Ga0395901_0000574 | 3300038443 | Bacteria | 42766 |
| 218 | Ga0395901_0002565 | 3300038443 | Bacteria | 18411 |
| 219 | Ga0395901_0007658 | 3300038443 | Bacteria | 10896 |
| 220 | Ga0395901_0008153 | 3300038443 | Bacteria | 10581 |
| 221 | Ga0395901_0135267 | 3300038443 | Bacteria | 2591 |
| 222 | Ga0395901_0200577 | 3300038443 | Bacteria | 2091 |
| 223 | Ga0395901_0437880 | 3300038443 | Bacteria | 1338 |
| 224 | Ga0395901_1542236 | 3300038443 | Bacteria | 619 |
| 225 | Ga0436361_0034381 | 3300039447 | Unclassified | 655 |
| 226 | Ga0436361_0234826 | 3300039447 | Bacteria | 1717 |
| 227 | Ga0439465_0162881 | 3300041413 | Bacteria | 801 |
| 228 | Ga0451797_0898951 | 3300041453 | Bacteria | 690 |
| 229 | Ga0439433_0124244 | 3300041999 | Bacteria | 652 |
| 230 | Ga0439448_0002210 | 3300042005 | Bacteria | 5260 |
| 231 | Ga0439449_0145472 | 3300042007 | Bacteria | 883 |
| 232 | Ga0439450_010137 | 3300042008 | Bacteria | 1809 |
| 233 | Ga0439450_021049 | 3300042008 | Bacteria | 1397 |
| 234 | Ga0439455_0041268 | 3300042012 | Bacteria | 1182 |
| 235 | Ga0439458_0044384 | 3300042157 | Bacteria | 1085 |
| 236 | Ga0450893_0090685 | 3300042532 | Bacteria | 613 |
| 237 | Ga0466969_0082535 | 3300044656 | Bacteria | 1531 |
| 238 | Ga0466972_0008843 | 3300044658 | Bacteria | 5053 |
| 239 | Ga0466972_0010972 | 3300044658 | Bacteria | 4548 |
| 240 | Ga0466965_0000300 | 3300044683 | Bacteria | 16400 |
| 241 | Ga0466965_0020707 | 3300044683 | Bacteria | 3164 |
| 242 | Ga0466965_0068460 | 3300044683 | Bacteria | 1782 |
| 243 | Ga0466965_0118837 | 3300044683 | Bacteria | 1363 |
| 244 | Ga0466965_0299943 | 3300044683 | Bacteria | 871 |
| 245 | Ga0466966_0001847 | 3300044684 | Bacteria | 13727 |
| 246 | Ga0466966_0028396 | 3300044684 | Bacteria | 3644 |
| 247 | Ga0466966_0131325 | 3300044684 | Bacteria | 1533 |
| 248 | Ga0466966_0151271 | 3300044684 | Bacteria | 1415 |
| 249 | Ga0466966_0214220 | 3300044684 | Bacteria | 1163 |
| 250 | Ga0466966_0263991 | 3300044684 | Bacteria | 1036 |
| 251 | Ga0466966_0287985 | 3300044684 | Bacteria | 987 |
| 252 | Ga0466961_0530630 | 3300044693 | Bacteria | 709 |
| 253 | Ga0466961_0734775 | 3300044693 | Bacteria | 590 |
| 254 | Ga0466963_1016549 | 3300044694 | Bacteria | 584 |
| 255 | Ga0466964_0001905 | 3300044706 | Bacteria | 7292 |
| 256 | Ga0466964_0002005 | 3300044706 | Bacteria | 7159 |
| 257 | Ga0466964_0143648 | 3300044706 | Bacteria | 1099 |
| 258 | Ga0466964_0763822 | 3300044706 | Bacteria | 544 |
| 259 | Ga0466971_0055217 | 3300044719 | Bacteria | 1790 |
| 260 | Ga0466968_0003533 | 3300044735 | Bacteria | 5784 |
| 261 | Ga0466968_0068736 | 3300044735 | Bacteria | 1538 |
| 262 | Ga0466968_0127106 | 3300044735 | Bacteria | 1157 |
| 263 | Ga0466970_0083422 | 3300044765 | Bacteria | 1729 |
| 264 | Ga0466970_0262012 | 3300044765 | Bacteria | 970 |
| 265 | Ga0466970_0295324 | 3300044765 | Bacteria | 913 |
| 266 | Ga0466970_0366956 | 3300044765 | Bacteria | 818 |
| 267 | Ga0466957_0000018 | 3300044842 | Bacteria | 64818 |
| 268 | Ga0466957_0009127 | 3300044842 | Bacteria | 5656 |
| 269 | Ga0466957_0077957 | 3300044842 | Bacteria | 2059 |
| 270 | Ga0466957_0232738 | 3300044842 | Bacteria | 1220 |
| 271 | Ga0466957_0545654 | 3300044842 | Bacteria | 807 |
| 272 | Ga0466957_0545748 | 3300044842 | Bacteria | 807 |
| 273 | Ga0466960_0085094 | 3300044901 | Bacteria | 1601 |
| 274 | Ga0466960_0459356 | 3300044901 | Bacteria | 741 |
| 275 | Ga0466960_0898372 | 3300044901 | Bacteria | 540 |
| 276 | Ga0466959_0019022 | 3300045049 | Bacteria | 5048 |
| 277 | Ga0466959_0203561 | 3300045049 | Bacteria | 1377 |
| 278 | Ga0466959_0679828 | 3300045049 | Bacteria | 690 |
| 279 | Ga0466959_0731712 | 3300045049 | Bacteria | 662 |
| 280 | Ga0466958_0133420 | 3300045836 | Bacteria | 1560 |
| 281 | Ga0466958_0186176 | 3300045836 | Bacteria | 1318 |
| 282 | Ga0466958_0211977 | 3300045836 | Bacteria | 1234 |
| 283 | Ga0466958_0749854 | 3300045836 | Bacteria | 636 |
| 284 | Ga0466967_0007401 | 3300045976 | Bacteria | 7916 |
| 285 | Ga0466967_0009956 | 3300045976 | Bacteria | 7095 |
| 286 | Ga0466967_0125566 | 3300045976 | Bacteria | 2376 |
| 287 | Ga0466967_0685495 | 3300045976 | Bacteria | 1014 |
| 288 | Ga0495617_001267 | 3300046452 | Bacteria | 11292 |
| 289 | Ga0495617_170867 | 3300046452 | Bacteria | 687 |
| 290 | Ga0495627_005503 | 3300046453 | Bacteria | 5092 |
| 291 | Ga0495603_0122714 | 3300046455 | Bacteria | 1513 |
| 292 | Ga0495603_0150794 | 3300046455 | Bacteria | 1350 |
| 293 | Ga0495590_0013283 | 3300046457 | Bacteria | 3032 |
| 294 | Ga0495590_0016068 | 3300046457 | Bacteria | 2706 |
| 295 | Ga0495590_0032822 | 3300046457 | Bacteria | 1816 |
| 296 | Ga0495591_011667 | 3300046458 | Bacteria | 3311 |
| 297 | Ga0495629_0074581 | 3300046459 | Bacteria | 2368 |
| 298 | Ga0495638_0002770 | 3300046460 | Bacteria | 14090 |
| 299 | Ga0495638_0021376 | 3300046460 | Bacteria | 4266 |
| 300 | Ga0495638_0021841 | 3300046460 | Bacteria | 4207 |
| 301 | Ga0495638_0070609 | 3300046460 | Bacteria | 2138 |
| 302 | Ga0495638_0463791 | 3300046460 | Bacteria | 644 |
| 303 | Ga0495653_0047143 | 3300046463 | Bacteria | 3334 |
| 304 | Ga0495653_0114226 | 3300046463 | Bacteria | 1935 |
| 305 | Ga0495650_0020521 | 3300046471 | Bacteria | 3219 |
| 306 | Ga0495650_0143760 | 3300046471 | Bacteria | 861 |
| 307 | Ga0495582_0130159 | 3300046473 | Bacteria | 1421 |
| 308 | Ga0495605_0000399 | 3300046474 | Bacteria | 39905 |
| 309 | Ga0495605_0000400 | 3300046474 | Bacteria | 39776 |
| 310 | Ga0495605_0008907 | 3300046474 | Bacteria | 5657 |
| 311 | Ga0495605_0017334 | 3300046474 | Bacteria | 3881 |
| 312 | Ga0495605_0018421 | 3300046474 | Bacteria | 3742 |
| 313 | Ga0495605_0020374 | 3300046474 | Bacteria | 3525 |
| 314 | Ga0495605_0098596 | 3300046474 | Bacteria | 1346 |
| 315 | Ga0495605_0106367 | 3300046474 | Bacteria | 1284 |
| 316 | Ga0495605_0118256 | 3300046474 | Bacteria | 1203 |
| 317 | Ga0495605_0151273 | 3300046474 | Bacteria | 1035 |
| 318 | Ga0495584_0000004 | 3300046491 | Bacteria | 314714 |
| 319 | Ga0495584_0000177 | 3300046491 | Bacteria | 45004 |
| 320 | Ga0495584_0001006 | 3300046491 | Bacteria | 17636 |
| 321 | Ga0495584_0003403 | 3300046491 | Bacteria | 8775 |
| 322 | Ga0495584_0005287 | 3300046491 | Bacteria | 6838 |
| 323 | Ga0495584_0012304 | 3300046491 | Bacteria | 4370 |
| 324 | Ga0495584_0020894 | 3300046491 | Bacteria | 3323 |
| 325 | Ga0495584_0025324 | 3300046491 | Bacteria | 3008 |
| 326 | Ga0495584_0033832 | 3300046491 | Bacteria | 2586 |
| 327 | Ga0495584_0068895 | 3300046491 | Bacteria | 1777 |
| 328 | Ga0495584_0173052 | 3300046491 | Bacteria | 1097 |
| 329 | Ga0495584_0459406 | 3300046491 | Bacteria | 648 |
| 330 | Ga0495585_0000050 | 3300046492 | Bacteria | 119283 |
| 331 | Ga0495585_0000624 | 3300046492 | Bacteria | 32878 |
| 332 | Ga0495585_0004780 | 3300046492 | Bacteria | 8714 |
| 333 | Ga0495585_0006144 | 3300046492 | Bacteria | 7493 |
| 334 | Ga0495585_0014189 | 3300046492 | Bacteria | 4648 |
| 335 | Ga0495585_0018506 | 3300046492 | Bacteria | 4017 |
| 336 | Ga0495585_0020150 | 3300046492 | Bacteria | 3837 |
| 337 | Ga0495585_0038005 | 3300046492 | Bacteria | 2710 |
| 338 | Ga0495585_0043901 | 3300046492 | Bacteria | 2498 |
| 339 | Ga0495585_0060112 | 3300046492 | Bacteria | 2092 |
| 340 | Ga0495585_0072443 | 3300046492 | Bacteria | 1877 |
| 341 | Ga0495585_0146814 | 3300046492 | Bacteria | 1232 |
| 342 | Ga0495585_0370525 | 3300046492 | Bacteria | 693 |
| 343 | Ga0495585_0392083 | 3300046492 | Bacteria | 669 |
| 344 | Ga0495594_0026192 | 3300046499 | Bacteria | 3136 |
| 345 | Ga0495594_0318787 | 3300046499 | Bacteria | 885 |
| 346 | Ga0495596_0000606 | 3300046500 | Bacteria | 22493 |
| 347 | Ga0495596_0001967 | 3300046500 | Bacteria | 11339 |
| 348 | Ga0495596_0003014 | 3300046500 | Bacteria | 8726 |
| 349 | Ga0495596_0018074 | 3300046500 | Bacteria | 2909 |
| 350 | Ga0495596_0022029 | 3300046500 | Bacteria | 2596 |
| 351 | Ga0495596_0026272 | 3300046500 | Bacteria | 2347 |
| 352 | Ga0495596_0052844 | 3300046500 | Bacteria | 1590 |
| 353 | Ga0495596_0067195 | 3300046500 | Bacteria | 1393 |
| 354 | Ga0495596_0079696 | 3300046500 | Bacteria | 1271 |
| 355 | Ga0495596_0152515 | 3300046500 | Bacteria | 897 |
| 356 | Ga0495596_0277094 | 3300046500 | Bacteria | 651 |
| 357 | Ga0495607_0000638 | 3300046501 | Bacteria | 34024 |
| 358 | Ga0495607_0003256 | 3300046501 | Bacteria | 12490 |
| 359 | Ga0495607_0008425 | 3300046501 | Bacteria | 7047 |
| 360 | Ga0495607_0016300 | 3300046501 | Bacteria | 4797 |
| 361 | Ga0495607_0024611 | 3300046501 | Bacteria | 3750 |
| 362 | Ga0495607_0047826 | 3300046501 | Bacteria | 2503 |
| 363 | Ga0495607_0055945 | 3300046501 | Bacteria | 2266 |
| 364 | Ga0495607_0056187 | 3300046501 | Bacteria | 2260 |
| 365 | Ga0495607_0144237 | 3300046501 | Bacteria | 1225 |
| 366 | Ga0495583_0000862 | 3300046506 | Bacteria | 36867 |
| 367 | Ga0495583_0000926 | 3300046506 | Bacteria | 34454 |
| 368 | Ga0495583_0001605 | 3300046506 | Bacteria | 22200 |
| 369 | Ga0495583_0001771 | 3300046506 | Bacteria | 20584 |
| 370 | Ga0495583_0002720 | 3300046506 | Bacteria | 14640 |
| 371 | Ga0495583_0010647 | 3300046506 | Bacteria | 5346 |
| 372 | Ga0495583_0025456 | 3300046506 | Bacteria | 2955 |
| 373 | Ga0495583_0034508 | 3300046506 | Bacteria | 2422 |
| 374 | Ga0495583_0048406 | 3300046506 | Bacteria | 1951 |
| 375 | Ga0495583_0050073 | 3300046506 | Bacteria | 1910 |
| 376 | Ga0495583_0143188 | 3300046506 | Bacteria | 994 |
| 377 | Ga0495606_0000101 | 3300046507 | Bacteria | 146752 |
| 378 | Ga0495606_0000201 | 3300046507 | Bacteria | 103926 |
| 379 | Ga0495606_0018476 | 3300046507 | Bacteria | 5224 |
| 380 | Ga0495606_0019789 | 3300046507 | Bacteria | 4988 |
| 381 | Ga0495606_0045476 | 3300046507 | Bacteria | 2909 |
| 382 | Ga0495606_0080067 | 3300046507 | Bacteria | 2033 |
| 383 | Ga0495606_0153848 | 3300046507 | Bacteria | 1347 |
| 384 | Ga0495606_0259313 | 3300046507 | Bacteria | 960 |
| 385 | Ga0495610_0000293 | 3300046512 | Bacteria | 52547 |
| 386 | Ga0495610_0000381 | 3300046512 | Bacteria | 45780 |
| 387 | Ga0495610_0001648 | 3300046512 | Bacteria | 19631 |
| 388 | Ga0495610_0116281 | 3300046512 | Bacteria | 1178 |
| 389 | Ga0495616_0000092 | 3300046513 | Bacteria | 76353 |
| 390 | Ga0495616_0000313 | 3300046513 | Bacteria | 38775 |
| 391 | Ga0495616_0000349 | 3300046513 | Bacteria | 36367 |
| 392 | Ga0495616_0003361 | 3300046513 | Bacteria | 10266 |
| 393 | Ga0495616_0008094 | 3300046513 | Bacteria | 6259 |
| 394 | Ga0495616_0017601 | 3300046513 | Bacteria | 3939 |
| 395 | Ga0495616_0020341 | 3300046513 | Bacteria | 3613 |
| 396 | Ga0495616_0023487 | 3300046513 | Bacteria | 3316 |
| 397 | Ga0495616_0027599 | 3300046513 | Bacteria | 3011 |
| 398 | Ga0495616_0037584 | 3300046513 | Bacteria | 2490 |
| 399 | Ga0495616_0071349 | 3300046513 | Bacteria | 1679 |
| 400 | Ga0495616_0086101 | 3300046513 | Bacteria | 1495 |
| 401 | Ga0495616_0125879 | 3300046513 | Bacteria | 1178 |
| 402 | Ga0495616_0233464 | 3300046513 | Bacteria | 796 |
| 403 | Ga0495616_0248290 | 3300046513 | Bacteria | 765 |
| 404 | Ga0495620_0037229 | 3300046515 | Bacteria | 2169 |
| 405 | Ga0495620_0057513 | 3300046515 | Bacteria | 1631 |
| 406 | Ga0495631_0000261 | 3300046518 | Bacteria | 36733 |
| 407 | Ga0495631_0008223 | 3300046518 | Bacteria | 5260 |
| 408 | Ga0495631_0009478 | 3300046518 | Bacteria | 4863 |
| 409 | Ga0495631_0020737 | 3300046518 | Bacteria | 3067 |
| 410 | Ga0495631_0034179 | 3300046518 | Bacteria | 2280 |
| 411 | Ga0495631_0035539 | 3300046518 | Bacteria | 2228 |
| 412 | Ga0495631_0040683 | 3300046518 | Bacteria | 2058 |
| 413 | Ga0495631_0044016 | 3300046518 | Bacteria | 1968 |
| 414 | Ga0495631_0046183 | 3300046518 | Bacteria | 1915 |
| 415 | Ga0495631_0054985 | 3300046518 | Bacteria | 1734 |
| 416 | Ga0495632_0000447 | 3300046519 | Bacteria | 39298 |
| 417 | Ga0495632_0000523 | 3300046519 | Bacteria | 36220 |
| 418 | Ga0495632_0000632 | 3300046519 | Bacteria | 32427 |
| 419 | Ga0495632_0020996 | 3300046519 | Bacteria | 3526 |
| 420 | Ga0495632_0057086 | 3300046519 | Bacteria | 1906 |
| 421 | Ga0495632_0058304 | 3300046519 | Bacteria | 1882 |
| 422 | Ga0495632_0319397 | 3300046519 | Bacteria | 686 |
| 423 | Ga0495632_0320837 | 3300046519 | Bacteria | 684 |
| 424 | Ga0495637_0041303 | 3300046520 | Bacteria | 1979 |
| 425 | Ga0495637_0101438 | 3300046520 | Bacteria | 1124 |
| 426 | Ga0495637_0127036 | 3300046520 | Bacteria | 976 |
| 427 | Ga0495643_0000235 | 3300046522 | Bacteria | 83550 |
| 428 | Ga0495643_0000827 | 3300046522 | Bacteria | 33751 |
| 429 | Ga0495643_0000871 | 3300046522 | Bacteria | 32222 |
| 430 | Ga0495643_0020883 | 3300046522 | Bacteria | 3767 |
| 431 | Ga0495643_0078284 | 3300046522 | Bacteria | 1726 |
| 432 | Ga0495643_0108145 | 3300046522 | Bacteria | 1416 |
| 433 | Ga0495643_0121216 | 3300046522 | Bacteria | 1321 |
| 434 | Ga0495643_0194102 | 3300046522 | Bacteria | 979 |
| 435 | Ga0495643_0258188 | 3300046522 | Bacteria | 810 |
| 436 | Ga0495643_0275168 | 3300046522 | Bacteria | 776 |
| 437 | Ga0495643_0292408 | 3300046522 | Bacteria | 745 |
| 438 | Ga0495643_0388175 | 3300046522 | Bacteria | 618 |
| 439 | Ga0495644_0000986 | 3300046523 | Bacteria | 11826 |
| 440 | Ga0495644_0012447 | 3300046523 | Bacteria | 3270 |
| 441 | Ga0495644_0024528 | 3300046523 | Bacteria | 2294 |
| 442 | Ga0495644_0027101 | 3300046523 | Bacteria | 2172 |
| 443 | Ga0495644_0091661 | 3300046523 | Bacteria | 1147 |
| 444 | Ga0495644_0095930 | 3300046523 | Bacteria | 1120 |
| 445 | Ga0495644_0104572 | 3300046523 | Bacteria | 1072 |
| 446 | Ga0495644_0121304 | 3300046523 | Bacteria | 994 |
| 447 | Ga0495644_0132431 | 3300046523 | Bacteria | 950 |
| 448 | Ga0495644_0324144 | 3300046523 | Bacteria | 605 |
| 449 | Ga0495648_0000451 | 3300046524 | Bacteria | 44465 |
| 450 | Ga0495648_0000716 | 3300046524 | Bacteria | 35380 |
| 451 | Ga0495648_0009701 | 3300046524 | Bacteria | 7419 |
| 452 | Ga0495648_0015684 | 3300046524 | Bacteria | 5488 |
| 453 | Ga0495648_0019629 | 3300046524 | Bacteria | 4743 |
| 454 | Ga0495648_0019659 | 3300046524 | Bacteria | 4737 |
| 455 | Ga0495648_0040229 | 3300046524 | Bacteria | 2966 |
| 456 | Ga0495648_0074505 | 3300046524 | Bacteria | 1955 |
| 457 | Ga0495648_0142603 | 3300046524 | Bacteria | 1259 |
| 458 | Ga0495648_0309641 | 3300046524 | Bacteria | 736 |
| 459 | Ga0495663_0010651 | 3300046525 | Bacteria | 2558 |
| 460 | Ga0495663_0028856 | 3300046525 | Bacteria | 1635 |
| 461 | Ga0495666_0006421 | 3300046526 | Bacteria | 5919 |
| 462 | Ga0495642_0000197 | 3300046528 | Bacteria | 35507 |
| 463 | Ga0495642_0007624 | 3300046528 | Bacteria | 4149 |
| 464 | Ga0495642_0012535 | 3300046528 | Bacteria | 3267 |
| 465 | Ga0495642_0017075 | 3300046528 | Bacteria | 2833 |
| 466 | Ga0495642_0017615 | 3300046528 | Bacteria | 2791 |
| 467 | Ga0495642_0019749 | 3300046528 | Bacteria | 2641 |
| 468 | Ga0495642_0025094 | 3300046528 | Bacteria | 2361 |
| 469 | Ga0495642_0040971 | 3300046528 | Bacteria | 1883 |
| 470 | Ga0495642_0089378 | 3300046528 | Bacteria | 1303 |
| 471 | Ga0495642_0129083 | 3300046528 | Bacteria | 1087 |
| 472 | Ga0495642_0192695 | 3300046528 | Bacteria | 888 |
| 473 | Ga0495654_0002707 | 3300046530 | Bacteria | 11206 |
| 474 | Ga0495654_0017559 | 3300046530 | Bacteria | 3758 |
| 475 | Ga0495654_0018742 | 3300046530 | Bacteria | 3623 |
| 476 | Ga0495654_0065573 | 3300046530 | Bacteria | 1733 |
| 477 | Ga0495654_0134268 | 3300046530 | Bacteria | 1108 |
| 478 | Ga0495654_0225601 | 3300046530 | Bacteria | 790 |
| 479 | Ga0495640_0052185 | 3300046533 | Bacteria | 2809 |
| 480 | Ga0495640_0239659 | 3300046533 | Bacteria | 1139 |
| 481 | Ga0495586_0017239 | 3300046535 | Bacteria | 3838 |
| 482 | Ga0495609_0000117 | 3300046538 | Bacteria | 92147 |
| 483 | Ga0495609_0000127 | 3300046538 | Bacteria | 82467 |
| 484 | Ga0495609_0002244 | 3300046538 | Bacteria | 12070 |
| 485 | Ga0495609_0006373 | 3300046538 | Bacteria | 6022 |
| 486 | Ga0495609_0006764 | 3300046538 | Bacteria | 5804 |
| 487 | Ga0495609_0041431 | 3300046538 | Bacteria | 2070 |
| 488 | Ga0495609_0049554 | 3300046538 | Bacteria | 1874 |
| 489 | Ga0495609_0067780 | 3300046538 | Bacteria | 1571 |
| 490 | Ga0495609_0120868 | 3300046538 | Bacteria | 1126 |
| 491 | Ga0495609_0122424 | 3300046538 | Bacteria | 1117 |
| 492 | Ga0495609_0132448 | 3300046538 | Bacteria | 1067 |
| 493 | Ga0495597_0000247 | 3300046542 | Bacteria | 49379 |
| 494 | Ga0495597_0032022 | 3300046542 | Bacteria | 2388 |
| 495 | Ga0495597_0041944 | 3300046542 | Bacteria | 2042 |
| 496 | Ga0495597_0053433 | 3300046542 | Bacteria | 1776 |
| 497 | Ga0495597_0054148 | 3300046542 | Bacteria | 1763 |
| 498 | Ga0495597_0061364 | 3300046542 | Bacteria | 1637 |
| 499 | Ga0495597_0096799 | 3300046542 | Bacteria | 1247 |
| 500 | Ga0495597_0123705 | 3300046542 | Bacteria | 1077 |
| 501 | Ga0495597_0125439 | 3300046542 | Bacteria | 1067 |
| 502 | Ga0495597_0135742 | 3300046542 | Bacteria | 1017 |
| 503 | Ga0495597_0219060 | 3300046542 | Bacteria | 756 |
| 504 | Ga0495645_0303555 | 3300046543 | Bacteria | 1042 |
| 505 | Ga0495622_0037077 | 3300046557 | Bacteria | 2271 |
| 506 | Ga0495622_0050355 | 3300046557 | Bacteria | 1932 |
| 507 | Ga0495633_0000489 | 3300046558 | Bacteria | 39984 |
| 508 | Ga0495633_0011259 | 3300046558 | Bacteria | 4832 |
| 509 | Ga0495633_0016567 | 3300046558 | Bacteria | 3796 |
| 510 | Ga0495633_0023451 | 3300046558 | Bacteria | 3058 |
| 511 | Ga0495633_0024724 | 3300046558 | Bacteria | 2964 |
| 512 | Ga0495633_0056896 | 3300046558 | Bacteria | 1837 |
| 513 | Ga0495633_0068647 | 3300046558 | Bacteria | 1654 |
| 514 | Ga0495633_0103316 | 3300046558 | Bacteria | 1322 |
| 515 | Ga0495633_0111865 | 3300046558 | Bacteria | 1266 |
| 516 | Ga0495633_0119923 | 3300046558 | Bacteria | 1218 |
| 517 | Ga0495633_0129086 | 3300046558 | Bacteria | 1170 |
| 518 | Ga0495633_0302573 | 3300046558 | Bacteria | 726 |
| 519 | Ga0495633_0385164 | 3300046558 | Bacteria | 634 |
| 520 | Ga0495633_0403986 | 3300046558 | Bacteria | 618 |
| 521 | Ga0495656_0014757 | 3300046615 | Bacteria | 2936 |
| 522 | Ga0495656_0052263 | 3300046615 | Bacteria | 1751 |
| 523 | Ga0495656_0059896 | 3300046615 | Bacteria | 1658 |
| 524 | Ga0495656_0295007 | 3300046615 | Bacteria | 830 |
| 525 | Ga0495668_0000066 | 3300046616 | Bacteria | 178533 |
| 526 | Ga0495668_0000398 | 3300046616 | Bacteria | 57103 |
| 527 | Ga0495668_0000496 | 3300046616 | Bacteria | 49112 |
| 528 | Ga0495668_0000712 | 3300046616 | Bacteria | 40090 |
| 529 | Ga0495668_0001137 | 3300046616 | Bacteria | 27257 |
| 530 | Ga0495668_0001559 | 3300046616 | Bacteria | 21734 |
| 531 | Ga0495668_0007882 | 3300046616 | Bacteria | 6731 |
| 532 | Ga0495668_0018125 | 3300046616 | Bacteria | 4072 |
| 533 | Ga0495668_0037166 | 3300046616 | Bacteria | 2725 |
| 534 | Ga0495668_0041724 | 3300046616 | Bacteria | 2555 |
| 535 | Ga0495668_0053645 | 3300046616 | Bacteria | 2228 |
| 536 | Ga0495668_0079045 | 3300046616 | Bacteria | 1805 |
| 537 | Ga0495668_0081023 | 3300046616 | Bacteria | 1781 |
| 538 | Ga0495668_0083277 | 3300046616 | Bacteria | 1754 |
| 539 | Ga0495668_0243583 | 3300046616 | Bacteria | 984 |
| 540 | Ga0495668_0266701 | 3300046616 | Bacteria | 937 |
| 541 | Ga0495668_0482556 | 3300046616 | Bacteria | 683 |
| 542 | Ga0495634_0704683 | 3300046642 | Bacteria | 580 |
| 543 | Ga0495611_0001606 | 3300046648 | Bacteria | 11014 |
| 544 | Ga0495611_0031448 | 3300046648 | Bacteria | 2336 |
| 545 | Ga0495611_0049201 | 3300046648 | Bacteria | 1896 |
| 546 | Ga0495611_0083225 | 3300046648 | Bacteria | 1473 |
| 547 | Ga0495611_0134078 | 3300046648 | Bacteria | 1156 |
| 548 | Ga0495611_0214885 | 3300046648 | Bacteria | 895 |
| 549 | Ga0495625_0000824 | 3300046660 | Bacteria | 42730 |
| 550 | Ga0495625_0004198 | 3300046660 | Bacteria | 13728 |
| 551 | Ga0495625_0134800 | 3300046660 | Bacteria | 1670 |
| 552 | Ga0495625_0160737 | 3300046660 | Bacteria | 1505 |
| 553 | Ga0495625_0189730 | 3300046660 | Bacteria | 1362 |
| 554 | Ga0495625_0535161 | 3300046660 | Bacteria | 711 |
| 555 | Ga0495635_0016821 | 3300046663 | Bacteria | 5108 |
| 556 | Ga0495635_0210206 | 3300046663 | Bacteria | 1318 |
| 557 | Ga0495659_0000093 | 3300046664 | Bacteria | 39219 |
| 558 | Ga0495659_0000963 | 3300046664 | Bacteria | 10138 |
| 559 | Ga0495659_0032037 | 3300046664 | Bacteria | 1837 |
| 560 | Ga0495661_0000454 | 3300046665 | Bacteria | 43387 |
| 561 | Ga0495661_0000650 | 3300046665 | Bacteria | 35187 |
| 562 | Ga0495661_0001854 | 3300046665 | Bacteria | 16896 |
| 563 | Ga0495661_0004436 | 3300046665 | Bacteria | 10127 |
| 564 | Ga0495661_0006398 | 3300046665 | Bacteria | 8283 |
| 565 | Ga0495661_0011498 | 3300046665 | Bacteria | 6005 |
| 566 | Ga0495661_0017051 | 3300046665 | Bacteria | 4798 |
| 567 | Ga0495661_0034911 | 3300046665 | Bacteria | 3160 |
| 568 | Ga0495661_0038123 | 3300046665 | Bacteria | 2996 |
| 569 | Ga0495661_0045335 | 3300046665 | Bacteria | 2690 |
| 570 | Ga0495661_0049360 | 3300046665 | Bacteria | 2552 |
| 571 | Ga0495661_0058061 | 3300046665 | Bacteria | 2307 |
| 572 | Ga0495661_0059025 | 3300046665 | Bacteria | 2285 |
| 573 | Ga0495661_0079140 | 3300046665 | Bacteria | 1899 |
| 574 | Ga0495661_0148743 | 3300046665 | Bacteria | 1267 |
| 575 | Ga0495661_0186521 | 3300046665 | Bacteria | 1095 |
| 576 | Ga0495661_0195876 | 3300046665 | Bacteria | 1061 |
| 577 | Ga0495661_0218479 | 3300046665 | Bacteria | 989 |
| 578 | Ga0495661_0288577 | 3300046665 | Bacteria | 825 |
| 579 | Ga0495661_0395692 | 3300046665 | Bacteria | 672 |
| 580 | Ga0495661_0520359 | 3300046665 | Bacteria | 565 |
| 581 | Ga0495588_0000094 | 3300046674 | Bacteria | 176169 |
| 582 | Ga0495588_0016064 | 3300046674 | Bacteria | 3612 |
| 583 | Ga0495588_0053901 | 3300046674 | Bacteria | 2074 |
| 584 | Ga0495588_0071924 | 3300046674 | Bacteria | 1799 |
| 585 | Ga0495588_0076595 | 3300046674 | Bacteria | 1743 |
| 586 | Ga0495588_0106729 | 3300046674 | Bacteria | 1474 |
| 587 | Ga0495588_0163180 | 3300046674 | Bacteria | 1178 |
| 588 | Ga0495588_0230400 | 3300046674 | Bacteria | 977 |
| 589 | Ga0495623_0097257 | 3300046679 | Bacteria | 1798 |
| 590 | Ga0495669_0000015 | 3300046684 | Bacteria | 140309 |
| 591 | Ga0495669_0001098 | 3300046684 | Bacteria | 11198 |
| 592 | Ga0495669_0007277 | 3300046684 | Bacteria | 4635 |
| 593 | Ga0495669_0028184 | 3300046684 | Bacteria | 2458 |
| 594 | Ga0495669_0099226 | 3300046684 | Bacteria | 1351 |
| 595 | Ga0495669_0133312 | 3300046684 | Bacteria | 1170 |
| 596 | Ga0495669_0464820 | 3300046684 | Bacteria | 614 |
| 597 | Ga0495613_0236089 | 3300046689 | Bacteria | 1279 |
| 598 | Ga0495670_0000314 | 3300046691 | Bacteria | 23002 |
| 599 | Ga0495670_0008998 | 3300046691 | Bacteria | 4912 |
| 600 | Ga0495670_0014316 | 3300046691 | Bacteria | 3900 |
| 601 | Ga0495670_0037183 | 3300046691 | Bacteria | 2426 |
| 602 | Ga0495670_0062801 | 3300046691 | Bacteria | 1869 |
| 603 | Ga0495670_0075984 | 3300046691 | Bacteria | 1706 |
| 604 | Ga0495670_0120529 | 3300046691 | Bacteria | 1362 |
| 605 | Ga0495670_0221512 | 3300046691 | Bacteria | 1005 |
| 606 | Ga0495671_0000301 | 3300046692 | Bacteria | 41678 |
| 607 | Ga0495671_0000407 | 3300046692 | Bacteria | 34599 |
| 608 | Ga0495671_0003196 | 3300046692 | Bacteria | 10176 |
| 609 | Ga0495671_0024721 | 3300046692 | Bacteria | 3125 |
| 610 | Ga0495671_0027174 | 3300046692 | Bacteria | 2957 |
| 611 | Ga0495671_0029764 | 3300046692 | Bacteria | 2801 |
| 612 | Ga0495671_0039208 | 3300046692 | Bacteria | 2393 |
| 613 | Ga0495649_0000268 | 3300046694 | Bacteria | 46424 |
| 614 | Ga0495649_0001236 | 3300046694 | Bacteria | 19664 |
| 615 | Ga0495649_0003559 | 3300046694 | Bacteria | 10462 |
| 616 | Ga0495649_0021678 | 3300046694 | Bacteria | 3599 |
| 617 | Ga0495649_0028314 | 3300046694 | Bacteria | 3105 |
| 618 | Ga0495649_0029827 | 3300046694 | Bacteria | 3014 |
| 619 | Ga0495649_0041174 | 3300046694 | Bacteria | 2527 |
| 620 | Ga0495649_0091730 | 3300046694 | Bacteria | 1618 |
| 621 | Ga0495589_0000096 | 3300046794 | Bacteria | 84521 |
| 622 | Ga0495589_0000351 | 3300046794 | Bacteria | 35944 |
| 623 | Ga0495589_0000994 | 3300046794 | Bacteria | 17205 |
| 624 | Ga0495589_0023862 | 3300046794 | Bacteria | 3112 |
| 625 | Ga0495589_0031852 | 3300046794 | Bacteria | 2653 |
| 626 | Ga0495589_0045477 | 3300046794 | Bacteria | 2180 |
| 627 | Ga0495589_0130267 | 3300046794 | Bacteria | 1208 |
| 628 | Ga0495589_0248463 | 3300046794 | Bacteria | 831 |
| 629 | Ga0495660_0016503 | 3300046810 | Bacteria | 4257 |
| 630 | Ga0495660_0020360 | 3300046810 | Bacteria | 3802 |
| 631 | Ga0495660_0022525 | 3300046810 | Bacteria | 3596 |
| 632 | Ga0495660_0024239 | 3300046810 | Bacteria | 3456 |
| 633 | Ga0495660_0047107 | 3300046810 | Bacteria | 2362 |
| 634 | Ga0495660_0101078 | 3300046810 | Bacteria | 1484 |
| 635 | Ga0495660_0141335 | 3300046810 | Bacteria | 1197 |
| 636 | Ga0495660_0221696 | 3300046810 | Bacteria | 891 |
| 637 | Ga0495660_0247933 | 3300046810 | Bacteria | 827 |
| 638 | Ga0495581_0086607 | 3300047315 | Bacteria | 1816 |
| 639 | Ga0495604_0013961 | 3300047317 | Bacteria | 6406 |
| 640 | Ga0495636_0000919 | 3300047318 | Bacteria | 10946 |
| 641 | Ga0495636_0218629 | 3300047318 | Bacteria | 874 |
| 642 | Ga0495672_0000026 | 3300047320 | Bacteria | 340319 |
| 643 | Ga0495672_0000376 | 3300047320 | Bacteria | 55334 |
| 644 | Ga0495672_0000391 | 3300047320 | Bacteria | 53759 |
| 645 | Ga0495672_0005133 | 3300047320 | Bacteria | 10448 |
| 646 | Ga0495672_0023707 | 3300047320 | Bacteria | 3966 |
| 647 | Ga0495672_0116035 | 3300047320 | Bacteria | 1430 |
| 648 | Ga0495676_0000281 | 3300047321 | Bacteria | 41181 |
| 649 | Ga0495683_0000061 | 3300047323 | Bacteria | 114589 |
| 650 | Ga0495683_0010017 | 3300047323 | Bacteria | 5027 |
| 651 | Ga0495683_0016660 | 3300047323 | Bacteria | 3813 |
| 652 | Ga0495683_0025705 | 3300047323 | Bacteria | 3016 |
| 653 | Ga0495683_0048091 | 3300047323 | Bacteria | 2139 |
| 654 | Ga0495683_0111498 | 3300047323 | Bacteria | 1305 |
| 655 | Ga0495683_0125284 | 3300047323 | Bacteria | 1216 |
| 656 | Ga0495683_0133357 | 3300047323 | Bacteria | 1169 |
| 657 | Ga0495683_0241121 | 3300047323 | Bacteria | 797 |
| 658 | Ga0495687_000110 | 3300047443 | Bacteria | 125363 |
| 659 | Ga0495687_000117 | 3300047443 | Bacteria | 122591 |
| 660 | Ga0495687_000203 | 3300047443 | Bacteria | 84774 |
| 661 | Ga0495687_000522 | 3300047443 | Bacteria | 46048 |
| 662 | Ga0495687_000772 | 3300047443 | Bacteria | 34667 |
| 663 | Ga0495687_001354 | 3300047443 | Bacteria | 22750 |
| 664 | Ga0495687_009685 | 3300047443 | Bacteria | 5358 |
| 665 | Ga0495687_010025 | 3300047443 | Bacteria | 5234 |
| 666 | Ga0495687_121503 | 3300047443 | Bacteria | 941 |
| 667 | Ga0495687_127958 | 3300047443 | Bacteria | 904 |
| 668 | Ga0495687_141689 | 3300047443 | Bacteria | 835 |
| 669 | Ga0495687_175752 | 3300047443 | Bacteria | 704 |
| 670 | Ga0495675_0046141 | 3300047444 | Bacteria | 2774 |
| 671 | Ga0495677_0000036 | 3300047445 | Bacteria | 81332 |
| 672 | Ga0495677_0001259 | 3300047445 | Bacteria | 10146 |
| 673 | Ga0495677_0001886 | 3300047445 | Bacteria | 8373 |
| 674 | Ga0495677_0006702 | 3300047445 | Bacteria | 4335 |
| 675 | Ga0495677_0015614 | 3300047445 | Bacteria | 2758 |
| 676 | Ga0495677_0018995 | 3300047445 | Bacteria | 2492 |
| 677 | Ga0495677_0027277 | 3300047445 | Bacteria | 2072 |
| 678 | Ga0495677_0041034 | 3300047445 | Bacteria | 1692 |
| 679 | Ga0495677_0047660 | 3300047445 | Bacteria | 1573 |
| 680 | Ga0495677_0080758 | 3300047445 | Bacteria | 1218 |
| 681 | Ga0495677_0106158 | 3300047445 | Bacteria | 1065 |
| 682 | Ga0495677_0141452 | 3300047445 | Bacteria | 924 |
| 683 | Ga0495677_0188436 | 3300047445 | Bacteria | 800 |
| 684 | Ga0495677_0235938 | 3300047445 | Bacteria | 714 |
| 685 | Ga0495679_004255 | 3300047446 | Bacteria | 6643 |
| 686 | Ga0495679_006300 | 3300047446 | Bacteria | 5131 |
| 687 | Ga0495679_029236 | 3300047446 | Bacteria | 1799 |
| 688 | Ga0495679_036789 | 3300047446 | Bacteria | 1544 |
| 689 | Ga0495685_003627 | 3300047447 | Bacteria | 4938 |
| 690 | Ga0495685_018911 | 3300047447 | Bacteria | 2365 |
| 691 | Ga0495685_021265 | 3300047447 | Bacteria | 2232 |
| 692 | Ga0495685_042936 | 3300047447 | Bacteria | 1543 |
| 693 | Ga0495685_094709 | 3300047447 | Bacteria | 988 |
| 694 | Ga0495685_124463 | 3300047447 | Bacteria | 845 |
| 695 | Ga0495685_193170 | 3300047447 | Bacteria | 654 |
| 696 | Ga0495673_0345550 | 3300047469 | Bacteria | 526 |
| 697 | Ga0495681_0000429 | 3300047470 | Bacteria | 32218 |
| 698 | Ga0495681_0003418 | 3300047470 | Bacteria | 11053 |
| 699 | Ga0495681_0009302 | 3300047470 | Bacteria | 6068 |
| 700 | Ga0495681_0019882 | 3300047470 | Bacteria | 3654 |
| 701 | Ga0495681_0031941 | 3300047470 | Bacteria | 2656 |
| 702 | Ga0495681_0039807 | 3300047470 | Bacteria | 2292 |
| 703 | Ga0495681_0058725 | 3300047470 | Bacteria | 1781 |
| 704 | Ga0495681_0061906 | 3300047470 | Bacteria | 1722 |
| 705 | Ga0495681_0070940 | 3300047470 | Bacteria | 1578 |
| 706 | Ga0495681_0155398 | 3300047470 | Bacteria | 956 |
| 707 | Ga0495681_0366085 | 3300047470 | Bacteria | 545 |
| 708 | Ga0495686_0000211 | 3300047472 | Bacteria | 107517 |
| 709 | Ga0495686_0002384 | 3300047472 | Bacteria | 17849 |
| 710 | Ga0495686_0057055 | 3300047472 | Bacteria | 2438 |
| 711 | Ga0495686_0061325 | 3300047472 | Bacteria | 2336 |
| 712 | Ga0495593_0002604 | 3300047673 | Bacteria | 10842 |
| 713 | Ga0495614_0009594 | 3300048089 | Bacteria | 4277 |
| 714 | Ga0495626_0000248 | 3300048091 | Bacteria | 62661 |
| 715 | Ga0495626_0001446 | 3300048091 | Bacteria | 18813 |
| 716 | Ga0495626_0002372 | 3300048091 | Bacteria | 13178 |
| 717 | Ga0495626_0004585 | 3300048091 | Bacteria | 8428 |
| 718 | Ga0495626_0005118 | 3300048091 | Bacteria | 7805 |
| 719 | Ga0495626_0006270 | 3300048091 | Bacteria | 6790 |
| 720 | Ga0495626_0017566 | 3300048091 | Bacteria | 3609 |
| 721 | Ga0495626_0027387 | 3300048091 | Bacteria | 2772 |
| 722 | Ga0495626_0046796 | 3300048091 | Bacteria | 2013 |
| 723 | Ga0495626_0056788 | 3300048091 | Bacteria | 1791 |
| 724 | Ga0495626_0085523 | 3300048091 | Bacteria | 1394 |
| 725 | Ga0495626_0110556 | 3300048091 | Bacteria | 1190 |
| 726 | Ga0495626_0114896 | 3300048091 | Bacteria | 1162 |
| 727 | Ga0495626_0115021 | 3300048091 | Bacteria | 1161 |
| 728 | Ga0495626_0115540 | 3300048091 | Bacteria | 1158 |
| 729 | Ga0495626_0135356 | 3300048091 | Bacteria | 1048 |
| 730 | Ga0495626_0140406 | 3300048091 | Bacteria | 1025 |
| 731 | Ga0496100_0714392 | 3300048903 | Bacteria | 782 |
| 732 | Ga0496100_1215346 | 3300048903 | Bacteria | 595 |
| 733 | Ga0496101_0021234 | 3300048904 | Bacteria | 4458 |
| 734 | Ga0496102_0008289 | 3300048905 | Bacteria | 8901 |
| 735 | Ga0496102_0054742 | 3300048905 | Bacteria | 3638 |
| 736 | Ga0496102_0150931 | 3300048905 | Bacteria | 2183 |
| 737 | Ga0496102_0493515 | 3300048905 | Bacteria | 1146 |
| 738 | Ga0496102_0631732 | 3300048905 | Bacteria | 994 |
| 739 | Ga0496103_0001512 | 3300048906 | Bacteria | 15549 |
| 740 | Ga0496103_0033458 | 3300048906 | Bacteria | 3141 |
| 741 | Ga0496103_0057760 | 3300048906 | Bacteria | 2409 |
| 742 | Ga0496103_1027602 | 3300048906 | Bacteria | 512 |
| 743 | Ga0496104_0505181 | 3300048907 | Bacteria | 1120 |
| 744 | Ga0496105_0569837 | 3300048908 | Bacteria | 882 |
| 745 | Ga0496105_1165559 | 3300048908 | Bacteria | 569 |
| 746 | Ga0496106_0029179 | 3300048909 | Bacteria | 4110 |
| 747 | Ga0496107_0210111 | 3300048910 | Bacteria | 1447 |
| 748 | Ga0496107_0226753 | 3300048910 | Bacteria | 1390 |
| 749 | Ga0496107_0967220 | 3300048910 | Bacteria | 619 |
| 750 | Ga0496109_0034046 | 3300048912 | Bacteria | 4585 |
| 751 | Ga0496109_1382763 | 3300048912 | Bacteria | 639 |
| 752 | Ga0496110_0024137 | 3300048913 | Bacteria | 5179 |
| 753 | Ga0496110_0046293 | 3300048913 | Bacteria | 3805 |
| 754 | Ga0496110_0908218 | 3300048913 | Bacteria | 787 |
| 755 | Ga0496113_0023269 | 3300048916 | Bacteria | 4393 |
| 756 | Ga0496113_0539660 | 3300048916 | Bacteria | 936 |
| 757 | Ga0496115_0090683 | 3300048918 | Bacteria | 2497 |
| 758 | Ga0496115_0109859 | 3300048918 | Bacteria | 2265 |
| 759 | Ga0496115_0846957 | 3300048918 | Bacteria | 708 |
| 760 | Ga0496116_0005927 | 3300048919 | Bacteria | 11208 |
| 761 | Ga0496116_0036002 | 3300048919 | Bacteria | 3471 |
| 762 | Ga0496116_0126546 | 3300048919 | Bacteria | 1466 |
| 763 | Ga0496117_0139491 | 3300048920 | Bacteria | 1455 |
| 764 | Ga0496117_0179810 | 3300048920 | Bacteria | 1217 |
| 765 | Ga0496117_0450837 | 3300048920 | Bacteria | 636 |
| 766 | Ga0496119_0024995 | 3300048922 | Bacteria | 4181 |
| 767 | Ga0496120_0145180 | 3300048923 | Bacteria | 1199 |
| 768 | Ga0496121_0000444 | 3300048924 | Bacteria | 81596 |
| 769 | Ga0496121_0009535 | 3300048924 | Bacteria | 11122 |
| 770 | Ga0496121_0200202 | 3300048924 | Bacteria | 1424 |
| 771 | Ga0496122_0000232 | 3300048925 | Bacteria | 125326 |
| 772 | Ga0496122_0000483 | 3300048925 | Bacteria | 82763 |
| 773 | Ga0496122_0007785 | 3300048925 | Bacteria | 11783 |
| 774 | Ga0496122_0102463 | 3300048925 | Bacteria | 1908 |
| 775 | Ga0496122_0344466 | 3300048925 | Bacteria | 781 |
| 776 | Ga0496123_0000194 | 3300048926 | Bacteria | 123528 |
| 777 | Ga0496123_0000904 | 3300048926 | Bacteria | 46774 |
| 778 | Ga0496123_0032504 | 3300048926 | Bacteria | 3776 |
| 779 | Ga0496123_0053931 | 3300048926 | Bacteria | 2652 |
| 780 | Ga0496123_0257506 | 3300048926 | Bacteria | 857 |
| 781 | Ga0496124_0000013 | 3300048927 | Bacteria | 484884 |
| 782 | Ga0496124_0016891 | 3300048927 | Bacteria | 6916 |
| 783 | Ga0496124_0042724 | 3300048927 | Bacteria | 3901 |
| 784 | Ga0496124_0047118 | 3300048927 | Bacteria | 3689 |
| 785 | Ga0496124_0052033 | 3300048927 | Bacteria | 3481 |
| 786 | Ga0496124_0097148 | 3300048927 | Bacteria | 2392 |
| 787 | Ga0496124_0134627 | 3300048927 | Bacteria | 1958 |
| 788 | Ga0496124_0180582 | 3300048927 | Bacteria | 1624 |
| 789 | Ga0496124_0202292 | 3300048927 | Bacteria | 1509 |
| 790 | Ga0496124_0340456 | 3300048927 | Bacteria | 1065 |
| 791 | Ga0496125_0000051 | 3300048928 | Bacteria | 285754 |
| 792 | Ga0496125_0003465 | 3300048928 | Bacteria | 19100 |
| 793 | Ga0496125_0015724 | 3300048928 | Bacteria | 7296 |
| 794 | Ga0496125_0038720 | 3300048928 | Bacteria | 4119 |
| 795 | Ga0496125_0106503 | 3300048928 | Bacteria | 2046 |
| 796 | Ga0496126_0025984 | 3300048929 | Bacteria | 5622 |
| 797 | Ga0496126_0115238 | 3300048929 | Bacteria | 2337 |
| 798 | Ga0495678_000227 | 3300049459 | Bacteria | 64986 |
| 799 | Ga0495678_001769 | 3300049459 | Bacteria | 16004 |
| 800 | Ga0495678_010629 | 3300049459 | Bacteria | 4459 |
| 801 | Ga0495678_018448 | 3300049459 | Bacteria | 3136 |
| 802 | Ga0495678_076415 | 3300049459 | Bacteria | 1213 |
| 803 | Ga0495678_104071 | 3300049459 | Bacteria | 979 |
| 804 | Ga0495678_135087 | 3300049459 | Bacteria | 813 |
| 805 | Ga0495682_0000286 | 3300049460 | Bacteria | 39332 |
| 806 | Ga0495682_0008933 | 3300049460 | Bacteria | 3930 |
| 807 | Ga0495682_0041954 | 3300049460 | Bacteria | 1677 |
| 808 | Ga0495682_0112128 | 3300049460 | Bacteria | 977 |
| 809 | Ga0501301_003617 | 3300049524 | Bacteria | 1069 |
| 810 | Ga0501034_0169641 | 3300049571 | Bacteria | 2150 |
| 811 | Ga0501036_0337557 | 3300049572 | Bacteria | 1259 |
| 812 | Ga0501043_0303681 | 3300049579 | Bacteria | 1219 |
| 813 | Ga0501047_0006177 | 3300049581 | Bacteria | 11265 |
| 814 | Ga0501207_060443 | 3300049654 | Bacteria | 693 |
| 815 | Ga0501211_003298 | 3300049658 | Bacteria | 1667 |
| 816 | Ga0501214_002716 | 3300049659 | Bacteria | 1513 |
| 817 | Ga0501222_004483 | 3300049662 | Bacteria | 1897 |
| 818 | Ga0501227_009878 | 3300049665 | Bacteria | 2063 |
| 819 | Ga0501227_110127 | 3300049665 | Bacteria | 737 |
| 820 | Ga0501240_015555 | 3300049673 | Bacteria | 1083 |
| 821 | Ga0501248_042668 | 3300049678 | Bacteria | 560 |
| 822 | Ga0501249_001865 | 3300049679 | Bacteria | 4298 |
| 823 | Ga0501221_085329 | 3300049704 | Bacteria | 765 |
| 824 | Ga0501241_043556 | 3300049758 | Bacteria | 874 |
| 825 | Ga0501263_002382 | 3300049760 | Bacteria | 1908 |
| 826 | Ga0501269_000016 | 3300049766 | Bacteria | 58863 |
| 827 | Ga0501279_000214 | 3300049775 | Bacteria | 8080 |
| 828 | Ga0501279_002528 | 3300049775 | Bacteria | 2398 |
| 829 | Ga0501279_009397 | 3300049775 | Bacteria | 1309 |
| 830 | Ga0501035_0006115 | 3300049822 | Bacteria | 11332 |
| 831 | Ga0501035_0012618 | 3300049822 | Bacteria | 7808 |
| 832 | Ga0501035_0024919 | 3300049822 | Bacteria | 5486 |
| 833 | Ga0501035_1466863 | 3300049822 | Bacteria | 521 |
| 834 | Ga0501044_0001216 | 3300049823 | Bacteria | 30550 |
| 835 | Ga0501044_1143230 | 3300049823 | Bacteria | 647 |
| 836 | Ga0501226_026593 | 3300049853 | Bacteria | 650 |
| 837 | nmdc:mga03683_160500_c1 | 3300050489 | Bacteria | 1018 |
| 838 | nmdc:mga00v17_128193_c1 | 3300050491 | Bacteria | 1620 |
| 839 | nmdc:mga00v17_142480_c1 | 3300050491 | Bacteria | 1537 |
| 840 | nmdc:mga00v17_16534_c1 | 3300050491 | Bacteria | 4157 |
| 841 | Ga0500618_008302 | 3300053125 | Bacteria | 2905 |
| 842 | Ga0500634_0077778 | 3300053161 | Bacteria | 1718 |
| 843 | Ga0587083_0080394 | 3300059505 | Bacteria | 775 |
| 844 | Ga0466962_0049428 | 3300061719 | Bacteria | 2010 |
| 845 | 2599902743 | 2599185292 | Bacteria | 6290804 |
| 846 | 2643790062 | 2643221554 | Bacteria | 6603920 |
| 847 | 2643801900 | 2643221556 | Bacteria | 7251154 |
| 848 | 2643861581 | 2643221569 | Bacteria | 6064337 |
| 849 | 2643979999 | 2643221594 | Bacteria | 5811388 |
| 850 | 2644123653 | 2643221621 | Bacteria | 6212786 |
| 851 | 2644217083 | 2643221638 | Bacteria | 6579467 |
| 852 | 2644250699 | 2643221645 | Bacteria | 7207331 |
| 853 | 2644474306 | 2643221684 | Bacteria | 7145183 |
| 854 | 2738738559 | 2738541280 | Bacteria | 6630198 |
| 855 | 2738842639 | 2738541300 | Bacteria | 6675882 |
| 856 | 2739273386 | 2738543018 | Bacteria | 6718814 |
| 857 | 2739342430 | 2738543030 | Bacteria | 6719714 |
| 858 | 2739610054 | 2739367655 | Bacteria | 4051151 |
| 859 | 2809033082 | 2808606395 | Bacteria | 6020352 |
| 860 | 2855732867 | 2855730933 | Bacteria | 7047938 |
| 861 | 2855771619 | 2855767633 | Bacteria | 7049357 |
| 862 | 2857541621 | 2857537821 | Bacteria | 5248181 |
| 863 | 2857543325 | 2857542790 | Bacteria | 5326616 |
| 864 | 2858952247 | 2858950400 | Bacteria | 6783797 |
| 865 | 2881415660 | 2881412998 | Bacteria | 6492157 |
| 866 | 2895517995 | 2895511927 | Bacteria | 6802080 |
| 867 | 2904428195 | 2904424332 | Bacteria | 7633521 |
| 868 | 2941482676 | |||
| 869 | 8047674495 | 8047673197 | Bacteria | 7395230 |
| 870 | 8055228489 | 8055225921 | Bacteria | 3341787 |
| 871 | JGI25151J46595_10000121 | |||
| 872 | JGI25158J39367_1014859 | |||
| 873 | JGI25152J39213_1000167 | |||
| 874 | JGI25150J39212_1003873 | |||
| 875 | JGI25159J45721_1001390 | |||
| 876 | JGI25159J45721_1025954 | |||
| 877 | JGI25159J45721_1025965 | |||
| 878 | JGI25153J46596_10007800 | |||
| 879 | rootL2_10271811 | |||
| 880 | JGI25160J50197_1043176 | |||
| 881 | JGI25160J50197_1043192 | |||
| 882 | JGI25161J50226_1001036 | |||
| 883 | JGI25161J50226_1011032 | |||
| 884 | JGI25161J50226_1016535 | |||
| 885 | Ga0055525_1000023 | |||
| 886 | Ga0055542_1020354 | |||
| 887 | Ga0055529_1004675 | |||
| 888 | Ga0055526_1023986 | |||
| 889 | Ga0055537_1019145 | |||
| 890 | Ga0055524_1000038 | |||
| 891 | Ga0055524_1000608 | |||
| 892 | Ga0055524_1023971 | |||
| 893 | Ga0055524_1049207 | |||
| 894 | Ga0055536_1039444 | |||
| 895 | Ga0055534_1011502 | |||
| 896 | Ga0055534_1024600 | |||
| 897 | Ga0055528_1008217 | |||
| 898 | Ga0055530_10008998 | |||
| 899 | Ga0055530_10014933 | |||
| 900 | Ga0055531_10006255 | |||
| 901 | Ga0055531_10009487 | |||
| 902 | Ga0055543_1004210 | |||
| 903 | Ga0055543_1025449 | |||
| 904 | Ga0065165_1000495 | |||
| 905 | Ga0065165_1012767 | |||
| 906 | Ga0065165_1059071 | |||
| 907 | Ga0065715_10050641 | |||
| 908 | Ga0070658_10405392 | |||
| 909 | Ga0070658_10428996 | |||
| 910 | Ga0070658_10755289 | |||
| 911 | Ga0070680_100069973 | |||
| 912 | Ga0070682_100166225 | |||
| 913 | Ga0070660_100515437 | |||
| 914 | Ga0070661_100051185 | |||
| 915 | Ga0070659_100015332 | |||
| 916 | Ga0070659_100183538 | |||
| 917 | Ga0070667_100001997 | |||
| 918 | Ga0070663_100505741 | |||
| 919 | Ga0070663_101283141 | |||
| 920 | Ga0070662_100119361 | |||
| 921 | Ga0070662_100614532 | |||
| 922 | Ga0068853_100137258 | |||
| 923 | Ga0068853_101156634 | |||
| 924 | Ga0070665_100121741 | |||
| 925 | Ga0068855_100132767 | |||
| 926 | Ga0068855_100239212 | |||
| 927 | Ga0070664_100507058 | |||
| 928 | Ga0068852_100729038 | |||
| 929 | Ga0075364_10007806 | |||
| 930 | Ga0075364_10082872 | |||
| 931 | Ga0075364_10161940 | |||
| 932 | Ga0075362_10168836 | |||
| 933 | Ga0097621_100990574 | |||
| 934 | Ga0068871_100677623 | |||
| 935 | Ga0099826_10000008 | |||
| 936 | Ga0099826_10353032 | |||
| 937 | Ga0105244_10003553 | |||
| 938 | Ga0105244_10038011 | |||
| 939 | Ga0105244_10041854 | |||
| 940 | Ga0105240_10001254 | |||
| 941 | Ga0105240_11706671 | |||
| 942 | Ga0105245_10026281 | |||
| 943 | Ga0105245_10429914 | |||
| 944 | Ga0105245_10846549 | |||
| 945 | Ga0105243_10074704 | |||
| 946 | Ga0105241_10024835 | |||
| 947 | Ga0105242_10000856 | |||
| 948 | Ga0105242_10406341 | |||
| 949 | Ga0105237_10194228 | |||
| 950 | Ga0105238_10271302 | |||
| 951 | Ga0105239_10294628 | |||
| 952 | Ga0157373_10073814 | |||
| 953 | Ga0157371_10289658 | |||
| 954 | Ga0157370_10448132 | |||
| 955 | Ga0157370_10479810 | |||
| 956 | Ga0157374_10104660 | |||
| 957 | Ga0157374_10324838 | |||
| 958 | Ga0157372_10349370 | |||
| 959 | Ga0157372_10697570 | |||
| 960 | Ga0157372_10726086 | |||
| 961 | Ga0157376_11112608 | |||
| 962 | Ga0182006_1085358 | |||
| 963 | Ga0182007_10046502 | |||
| 964 | Ga0209436_100040 | |||
| 965 | Ga0209436_117835 | |||
| 966 | Ga0209436_117836 | |||
| 967 | Ga0209672_102913 | |||
| 968 | Ga0209563_100011 | |||
| 969 | Ga0209258_105110 | |||
| 970 | Ga0207425_1000009 | |||
| 971 | Ga0207425_1000257 | |||
| 972 | Ga0207425_1009042 | |||
| 973 | Ga0207425_1036925 | |||
| 974 | Ga0209677_105405 | |||
| 975 | Ga0209148_1000580 | |||
| 976 | Ga0209129_1000051 | |||
| 977 | Ga0209129_1006067 | |||
| 978 | Ga0209565_1001480 | |||
| 979 | Ga0209565_1002538 | |||
| 980 | Ga0209565_1004936 | |||
| 981 | Ga0209565_1005910 | |||
| 982 | Ga0209565_1029299 | |||
| 983 | Ga0209565_1031673 | |||
| 984 | Ga0209565_1032621 | |||
| 985 | Ga0209455_1003081 | |||
| 986 | Ga0209673_1021734 | |||
| 987 | Ga0209130_1000217 | |||
| 988 | Ga0209130_1006188 | |||
| 989 | Ga0209675_1001533 | |||
| 990 | Ga0209675_1020283 | |||
| 991 | Ga0209675_1040020 | |||
| 992 | Ga0209676_1005251 | |||
| 993 | Ga0209025_1000019 | |||
| 994 | Ga0209025_1026873 | |||
| 995 | Ga0209564_1004433 | |||
| 996 | Ga0209564_1005893 | |||
| 997 | Ga0209564_1031656 | |||
| 998 | Ga0209564_1050090 | |||
| 999 | Ga0209758_1000054 | |||
| 1000 | Ga0209758_1000379 | |||
| 1001 | Ga0209050_1000040 | |||
| 1002 | Ga0209050_1001052 | |||
| 1003 | Ga0209050_1006080 | |||
| 1004 | Ga0209256_1000018 | |||
| 1005 | Ga0209256_1000307 | |||
| 1006 | Ga0209256_1003794 | |||
| 1007 | Ga0209256_1006054 | |||
| 1008 | Ga0209256_1111938 | |||
| 1009 | Ga0207426_1012456 | |||
| 1010 | Ga0209051_1033870 | |||
| 1011 | Ga0209051_1034706 | |||
| 1012 | Ga0209257_1000054 | |||
| 1013 | Ga0209257_1002267 | |||
| 1014 | Ga0207655_1003797 | |||
| 1015 | Ga0207655_1019168 | |||
| 1016 | Ga0207655_1038594 | |||
| 1017 | Ga0207705_10017793 | |||
| 1018 | Ga0207705_10908233 | |||
| 1019 | Ga0207695_10075242 | |||
| 1020 | Ga0207671_10055267 | |||
| 1021 | Ga0207660_10057463 | |||
| 1022 | Ga0207657_10005222 | |||
| 1023 | Ga0207657_10076231 | |||
| 1024 | Ga0207649_10029886 | |||
| 1025 | Ga0207649_11112317 | |||
| 1026 | Ga0207694_10399624 | |||
| 1027 | Ga0207690_10018849 | |||
| 1028 | Ga0207706_10076717 | |||
| 1029 | Ga0207686_10000388 | |||
| 1030 | Ga0207709_10010359 | |||
| 1031 | Ga0207704_10067996 | |||
| 1032 | Ga0207689_10574443 | |||
| 1033 | Ga0207667_10001574 | |||
| 1034 | Ga0207667_10105606 | |||
| 1035 | Ga0207640_10114022 | |||
| 1036 | Ga0207658_10024757 | |||
| 1037 | Ga0207639_10691664 | |||
| 1038 | Ga0207678_10075104 | |||
| 1039 | Ga0207678_10196412 | |||
| 1040 | Ga0207678_10693728 | |||
| 1041 | Ga0207648_10522445 | |||
| 1042 | Ga0207674_10046745 | |||
| 1043 | Ga0209371_1019009 | |||
| 1044 | Ga0209371_1044808 | |||
| 1045 | Ga0209282_1000005 | |||
| 1046 | Ga0268266_10095208 | |||
| 1047 | Ga0268256_1011399 | |||
| 1048 | Ga0268256_1050650 | |||
| 1049 | Ga0316181_1270997 | |||
| 1050 | Ga0307408_100000281 | |||
| 1051 | Ga0307408_100000347 | |||
| 1052 | Ga0307408_100000747 | |||
| 1053 | Ga0307408_100000803 | |||
| 1054 | Ga0307408_100081507 | |||
| 1055 | Ga0307408_100935997 | |||
| 1056 | Ga0307412_10000109 | |||
| 1057 | Ga0307416_100004731 | |||
| 1058 | Ga0395899_0000492 | |||
| 1059 | Ga0395899_0001821 | |||
| 1060 | Ga0395899_0005599 | |||
| 1061 | Ga0395899_0019791 | |||
| 1062 | Ga0395899_0096207 | |||
| 1063 | Ga0395899_0200356 | |||
| 1064 | Ga0395900_0001043 | |||
| 1065 | Ga0395900_0001113 | |||
| 1066 | Ga0395900_0001615 | |||
| 1067 | Ga0395900_0111926 | |||
| 1068 | Ga0395900_0181484 | |||
| 1069 | Ga0395900_0211437 | |||
| 1070 | Ga0395900_0228915 | |||
| 1071 | Ga0395900_0294867 | |||
| 1072 | Ga0395900_0315102 | |||
| 1073 | Ga0395900_0653861 | |||
| 1074 | Ga0395900_0773455 | |||
| 1075 | Ga0395900_1370422 | |||
| 1076 | Ga0395898_0256797 | |||
| 1077 | Ga0395898_0373227 | |||
| 1078 | Ga0395898_0702172 | |||
| 1079 | Ga0395898_0894135 | |||
| 1080 | Ga0395905_0048881 | |||
| 1081 | Ga0395905_0146807 | |||
| 1082 | Ga0395905_0153810 | |||
| 1083 | Ga0395905_0249987 | |||
| 1084 | Ga0395905_0342299 | |||
| 1085 | Ga0395905_0668160 | |||
| 1086 | Ga0395905_1031704 | |||
| 1087 | Ga0395901_0000574 | |||
| 1088 | Ga0395901_0002565 | |||
| 1089 | Ga0395901_0007658 | |||
| 1090 | Ga0395901_0008153 | |||
| 1091 | Ga0395901_0135267 | |||
| 1092 | Ga0395901_0200577 | |||
| 1093 | Ga0395901_0437880 | |||
| 1094 | Ga0395901_1542236 | |||
| 1095 | Ga0436361_0034381 | |||
| 1096 | Ga0436361_0234826 | |||
| 1097 | Ga0439465_0162881 | |||
| 1098 | Ga0451797_0898951 | |||
| 1099 | Ga0439433_0124244 | |||
| 1100 | Ga0439448_0002210 | |||
| 1101 | Ga0439449_0145472 | |||
| 1102 | Ga0439450_010137 | |||
| 1103 | Ga0439450_021049 | |||
| 1104 | Ga0439455_0041268 | |||
| 1105 | Ga0439458_0044384 | |||
| 1106 | Ga0450893_0090685 | |||
| 1107 | Ga0466969_0082535 | |||
| 1108 | Ga0466972_0008843 | |||
| 1109 | Ga0466972_0010972 | |||
| 1110 | Ga0466965_0000300 | |||
| 1111 | Ga0466965_0020707 | |||
| 1112 | Ga0466965_0068460 | |||
| 1113 | Ga0466965_0118837 | |||
| 1114 | Ga0466965_0299943 | |||
| 1115 | Ga0466966_0001847 | |||
| 1116 | Ga0466966_0028396 | |||
| 1117 | Ga0466966_0131325 | |||
| 1118 | Ga0466966_0151271 | |||
| 1119 | Ga0466966_0214220 | |||
| 1120 | Ga0466966_0263991 | |||
| 1121 | Ga0466966_0287985 | |||
| 1122 | Ga0466961_0530630 | |||
| 1123 | Ga0466961_0734775 | |||
| 1124 | Ga0466963_1016549 | |||
| 1125 | Ga0466964_0001905 | |||
| 1126 | Ga0466964_0002005 | |||
| 1127 | Ga0466964_0143648 | |||
| 1128 | Ga0466964_0763822 | |||
| 1129 | Ga0466971_0055217 | |||
| 1130 | Ga0466968_0003533 | |||
| 1131 | Ga0466968_0068736 | |||
| 1132 | Ga0466968_0127106 | |||
| 1133 | Ga0466970_0083422 | |||
| 1134 | Ga0466970_0262012 | |||
| 1135 | Ga0466970_0295324 | |||
| 1136 | Ga0466970_0366956 | |||
| 1137 | Ga0466957_0000018 | |||
| 1138 | Ga0466957_0009127 | |||
| 1139 | Ga0466957_0077957 | |||
| 1140 | Ga0466957_0232738 | |||
| 1141 | Ga0466957_0545654 | |||
| 1142 | Ga0466957_0545748 | |||
| 1143 | Ga0466960_0085094 | |||
| 1144 | Ga0466960_0459356 | |||
| 1145 | Ga0466960_0898372 | |||
| 1146 | Ga0466959_0019022 | |||
| 1147 | Ga0466959_0203561 | |||
| 1148 | Ga0466959_0679828 | |||
| 1149 | Ga0466959_0731712 | |||
| 1150 | Ga0466958_0133420 | |||
| 1151 | Ga0466958_0186176 | |||
| 1152 | Ga0466958_0211977 | |||
| 1153 | Ga0466958_0749854 | |||
| 1154 | Ga0466967_0007401 | |||
| 1155 | Ga0466967_0009956 | |||
| 1156 | Ga0466967_0125566 | |||
| 1157 | Ga0466967_0685495 | |||
| 1158 | Ga0495617_001267 | |||
| 1159 | Ga0495617_170867 | |||
| 1160 | Ga0495627_005503 | |||
| 1161 | Ga0495603_0122714 | |||
| 1162 | Ga0495603_0150794 | |||
| 1163 | Ga0495590_0013283 | |||
| 1164 | Ga0495590_0016068 | |||
| 1165 | Ga0495590_0032822 | |||
| 1166 | Ga0495591_011667 | |||
| 1167 | Ga0495629_0074581 | |||
| 1168 | Ga0495638_0002770 | |||
| 1169 | Ga0495638_0021376 | |||
| 1170 | Ga0495638_0021841 | |||
| 1171 | Ga0495638_0070609 | |||
| 1172 | Ga0495638_0463791 | |||
| 1173 | Ga0495653_0047143 | |||
| 1174 | Ga0495653_0114226 | |||
| 1175 | Ga0495650_0020521 | |||
| 1176 | Ga0495650_0143760 | |||
| 1177 | Ga0495582_0130159 | |||
| 1178 | Ga0495605_0000399 | |||
| 1179 | Ga0495605_0000400 | |||
| 1180 | Ga0495605_0008907 | |||
| 1181 | Ga0495605_0017334 | |||
| 1182 | Ga0495605_0018421 | |||
| 1183 | Ga0495605_0020374 | |||
| 1184 | Ga0495605_0098596 | |||
| 1185 | Ga0495605_0106367 | |||
| 1186 | Ga0495605_0118256 | |||
| 1187 | Ga0495605_0151273 | |||
| 1188 | Ga0495584_0000004 | |||
| 1189 | Ga0495584_0000177 | |||
| 1190 | Ga0495584_0001006 | |||
| 1191 | Ga0495584_0003403 | |||
| 1192 | Ga0495584_0005287 | |||
| 1193 | Ga0495584_0012304 | |||
| 1194 | Ga0495584_0020894 | |||
| 1195 | Ga0495584_0025324 | |||
| 1196 | Ga0495584_0033832 | |||
| 1197 | Ga0495584_0068895 | |||
| 1198 | Ga0495584_0173052 | |||
| 1199 | Ga0495584_0459406 | |||
| 1200 | Ga0495585_0000050 | |||
| 1201 | Ga0495585_0000624 | |||
| 1202 | Ga0495585_0004780 | |||
| 1203 | Ga0495585_0006144 | |||
| 1204 | Ga0495585_0014189 | |||
| 1205 | Ga0495585_0018506 | |||
| 1206 | Ga0495585_0020150 | |||
| 1207 | Ga0495585_0038005 | |||
| 1208 | Ga0495585_0043901 | |||
| 1209 | Ga0495585_0060112 | |||
| 1210 | Ga0495585_0072443 | |||
| 1211 | Ga0495585_0146814 | |||
| 1212 | Ga0495585_0370525 | |||
| 1213 | Ga0495585_0392083 | |||
| 1214 | Ga0495594_0026192 | |||
| 1215 | Ga0495594_0318787 | |||
| 1216 | Ga0495596_0000606 | |||
| 1217 | Ga0495596_0001967 | |||
| 1218 | Ga0495596_0003014 | |||
| 1219 | Ga0495596_0018074 | |||
| 1220 | Ga0495596_0022029 | |||
| 1221 | Ga0495596_0026272 | |||
| 1222 | Ga0495596_0052844 | |||
| 1223 | Ga0495596_0067195 | |||
| 1224 | Ga0495596_0079696 | |||
| 1225 | Ga0495596_0152515 | |||
| 1226 | Ga0495596_0277094 | |||
| 1227 | Ga0495607_0000638 | |||
| 1228 | Ga0495607_0003256 | |||
| 1229 | Ga0495607_0008425 | |||
| 1230 | Ga0495607_0016300 | |||
| 1231 | Ga0495607_0024611 | |||
| 1232 | Ga0495607_0047826 | |||
| 1233 | Ga0495607_0055945 | |||
| 1234 | Ga0495607_0056187 | |||
| 1235 | Ga0495607_0144237 | |||
| 1236 | Ga0495583_0000862 | |||
| 1237 | Ga0495583_0000926 | |||
| 1238 | Ga0495583_0001605 | |||
| 1239 | Ga0495583_0001771 | |||
| 1240 | Ga0495583_0002720 | |||
| 1241 | Ga0495583_0010647 | |||
| 1242 | Ga0495583_0025456 | |||
| 1243 | Ga0495583_0034508 | |||
| 1244 | Ga0495583_0048406 | |||
| 1245 | Ga0495583_0050073 | |||
| 1246 | Ga0495583_0143188 | |||
| 1247 | Ga0495606_0000101 | |||
| 1248 | Ga0495606_0000201 | |||
| 1249 | Ga0495606_0018476 | |||
| 1250 | Ga0495606_0019789 | |||
| 1251 | Ga0495606_0045476 | |||
| 1252 | Ga0495606_0080067 | |||
| 1253 | Ga0495606_0153848 | |||
| 1254 | Ga0495606_0259313 | |||
| 1255 | Ga0495610_0000293 | |||
| 1256 | Ga0495610_0000381 | |||
| 1257 | Ga0495610_0001648 | |||
| 1258 | Ga0495610_0116281 | |||
| 1259 | Ga0495616_0000092 | |||
| 1260 | Ga0495616_0000313 | |||
| 1261 | Ga0495616_0000349 | |||
| 1262 | Ga0495616_0003361 | |||
| 1263 | Ga0495616_0008094 | |||
| 1264 | Ga0495616_0017601 | |||
| 1265 | Ga0495616_0020341 | |||
| 1266 | Ga0495616_0023487 | |||
| 1267 | Ga0495616_0027599 | |||
| 1268 | Ga0495616_0037584 | |||
| 1269 | Ga0495616_0071349 | |||
| 1270 | Ga0495616_0086101 | |||
| 1271 | Ga0495616_0125879 | |||
| 1272 | Ga0495616_0233464 | |||
| 1273 | Ga0495616_0248290 | |||
| 1274 | Ga0495620_0037229 | |||
| 1275 | Ga0495620_0057513 | |||
| 1276 | Ga0495631_0000261 | |||
| 1277 | Ga0495631_0008223 | |||
| 1278 | Ga0495631_0009478 | |||
| 1279 | Ga0495631_0020737 | |||
| 1280 | Ga0495631_0034179 | |||
| 1281 | Ga0495631_0035539 | |||
| 1282 | Ga0495631_0040683 | |||
| 1283 | Ga0495631_0044016 | |||
| 1284 | Ga0495631_0046183 | |||
| 1285 | Ga0495631_0054985 | |||
| 1286 | Ga0495632_0000447 | |||
| 1287 | Ga0495632_0000523 | |||
| 1288 | Ga0495632_0000632 | |||
| 1289 | Ga0495632_0020996 | |||
| 1290 | Ga0495632_0057086 | |||
| 1291 | Ga0495632_0058304 | |||
| 1292 | Ga0495632_0319397 | |||
| 1293 | Ga0495632_0320837 | |||
| 1294 | Ga0495637_0041303 | |||
| 1295 | Ga0495637_0101438 | |||
| 1296 | Ga0495637_0127036 | |||
| 1297 | Ga0495643_0000235 | |||
| 1298 | Ga0495643_0000827 | |||
| 1299 | Ga0495643_0000871 | |||
| 1300 | Ga0495643_0020883 | |||
| 1301 | Ga0495643_0078284 | |||
| 1302 | Ga0495643_0108145 | |||
| 1303 | Ga0495643_0121216 | |||
| 1304 | Ga0495643_0194102 | |||
| 1305 | Ga0495643_0258188 | |||
| 1306 | Ga0495643_0275168 | |||
| 1307 | Ga0495643_0292408 | |||
| 1308 | Ga0495643_0388175 | |||
| 1309 | Ga0495644_0000986 | |||
| 1310 | Ga0495644_0012447 | |||
| 1311 | Ga0495644_0024528 | |||
| 1312 | Ga0495644_0027101 | |||
| 1313 | Ga0495644_0091661 | |||
| 1314 | Ga0495644_0095930 | |||
| 1315 | Ga0495644_0104572 | |||
| 1316 | Ga0495644_0121304 | |||
| 1317 | Ga0495644_0132431 | |||
| 1318 | Ga0495644_0324144 | |||
| 1319 | Ga0495648_0000451 | |||
| 1320 | Ga0495648_0000716 | |||
| 1321 | Ga0495648_0009701 | |||
| 1322 | Ga0495648_0015684 | |||
| 1323 | Ga0495648_0019629 | |||
| 1324 | Ga0495648_0019659 | |||
| 1325 | Ga0495648_0040229 | |||
| 1326 | Ga0495648_0074505 | |||
| 1327 | Ga0495648_0142603 | |||
| 1328 | Ga0495648_0309641 | |||
| 1329 | Ga0495663_0010651 | |||
| 1330 | Ga0495663_0028856 | |||
| 1331 | Ga0495666_0006421 | |||
| 1332 | Ga0495642_0000197 | |||
| 1333 | Ga0495642_0007624 | |||
| 1334 | Ga0495642_0012535 | |||
| 1335 | Ga0495642_0017075 | |||
| 1336 | Ga0495642_0017615 | |||
| 1337 | Ga0495642_0019749 | |||
| 1338 | Ga0495642_0025094 | |||
| 1339 | Ga0495642_0040971 | |||
| 1340 | Ga0495642_0089378 | |||
| 1341 | Ga0495642_0129083 | |||
| 1342 | Ga0495642_0192695 | |||
| 1343 | Ga0495654_0002707 | |||
| 1344 | Ga0495654_0017559 | |||
| 1345 | Ga0495654_0018742 | |||
| 1346 | Ga0495654_0065573 | |||
| 1347 | Ga0495654_0134268 | |||
| 1348 | Ga0495654_0225601 | |||
| 1349 | Ga0495640_0052185 | |||
| 1350 | Ga0495640_0239659 | |||
| 1351 | Ga0495586_0017239 | |||
| 1352 | Ga0495609_0000117 | |||
| 1353 | Ga0495609_0000127 | |||
| 1354 | Ga0495609_0002244 | |||
| 1355 | Ga0495609_0006373 | |||
| 1356 | Ga0495609_0006764 | |||
| 1357 | Ga0495609_0041431 | |||
| 1358 | Ga0495609_0049554 | |||
| 1359 | Ga0495609_0067780 | |||
| 1360 | Ga0495609_0120868 | |||
| 1361 | Ga0495609_0122424 | |||
| 1362 | Ga0495609_0132448 | |||
| 1363 | Ga0495597_0000247 | |||
| 1364 | Ga0495597_0032022 | |||
| 1365 | Ga0495597_0041944 | |||
| 1366 | Ga0495597_0053433 | |||
| 1367 | Ga0495597_0054148 | |||
| 1368 | Ga0495597_0061364 | |||
| 1369 | Ga0495597_0096799 | |||
| 1370 | Ga0495597_0123705 | |||
| 1371 | Ga0495597_0125439 | |||
| 1372 | Ga0495597_0135742 | |||
| 1373 | Ga0495597_0219060 | |||
| 1374 | Ga0495645_0303555 | |||
| 1375 | Ga0495622_0037077 | |||
| 1376 | Ga0495622_0050355 | |||
| 1377 | Ga0495633_0000489 | |||
| 1378 | Ga0495633_0011259 | |||
| 1379 | Ga0495633_0016567 | |||
| 1380 | Ga0495633_0023451 | |||
| 1381 | Ga0495633_0024724 | |||
| 1382 | Ga0495633_0056896 | |||
| 1383 | Ga0495633_0068647 | |||
| 1384 | Ga0495633_0103316 | |||
| 1385 | Ga0495633_0111865 | |||
| 1386 | Ga0495633_0119923 | |||
| 1387 | Ga0495633_0129086 | |||
| 1388 | Ga0495633_0302573 | |||
| 1389 | Ga0495633_0385164 | |||
| 1390 | Ga0495633_0403986 | |||
| 1391 | Ga0495656_0014757 | |||
| 1392 | Ga0495656_0052263 | |||
| 1393 | Ga0495656_0059896 | |||
| 1394 | Ga0495656_0295007 | |||
| 1395 | Ga0495668_0000066 | |||
| 1396 | Ga0495668_0000398 | |||
| 1397 | Ga0495668_0000496 | |||
| 1398 | Ga0495668_0000712 | |||
| 1399 | Ga0495668_0001137 | |||
| 1400 | Ga0495668_0001559 | |||
| 1401 | Ga0495668_0007882 | |||
| 1402 | Ga0495668_0018125 | |||
| 1403 | Ga0495668_0037166 | |||
| 1404 | Ga0495668_0041724 | |||
| 1405 | Ga0495668_0053645 | |||
| 1406 | Ga0495668_0079045 | |||
| 1407 | Ga0495668_0081023 | |||
| 1408 | Ga0495668_0083277 | |||
| 1409 | Ga0495668_0243583 | |||
| 1410 | Ga0495668_0266701 | |||
| 1411 | Ga0495668_0482556 | |||
| 1412 | Ga0495634_0704683 | |||
| 1413 | Ga0495611_0001606 | |||
| 1414 | Ga0495611_0031448 | |||
| 1415 | Ga0495611_0049201 | |||
| 1416 | Ga0495611_0083225 | |||
| 1417 | Ga0495611_0134078 | |||
| 1418 | Ga0495611_0214885 | |||
| 1419 | Ga0495625_0000824 | |||
| 1420 | Ga0495625_0004198 | |||
| 1421 | Ga0495625_0134800 | |||
| 1422 | Ga0495625_0160737 | |||
| 1423 | Ga0495625_0189730 | |||
| 1424 | Ga0495625_0535161 | |||
| 1425 | Ga0495635_0016821 | |||
| 1426 | Ga0495635_0210206 | |||
| 1427 | Ga0495659_0000093 | |||
| 1428 | Ga0495659_0000963 | |||
| 1429 | Ga0495659_0032037 | |||
| 1430 | Ga0495661_0000454 | |||
| 1431 | Ga0495661_0000650 | |||
| 1432 | Ga0495661_0001854 | |||
| 1433 | Ga0495661_0004436 | |||
| 1434 | Ga0495661_0006398 | |||
| 1435 | Ga0495661_0011498 | |||
| 1436 | Ga0495661_0017051 | |||
| 1437 | Ga0495661_0034911 | |||
| 1438 | Ga0495661_0038123 | |||
| 1439 | Ga0495661_0045335 | |||
| 1440 | Ga0495661_0049360 | |||
| 1441 | Ga0495661_0058061 | |||
| 1442 | Ga0495661_0059025 | |||
| 1443 | Ga0495661_0079140 | |||
| 1444 | Ga0495661_0148743 | |||
| 1445 | Ga0495661_0186521 | |||
| 1446 | Ga0495661_0195876 | |||
| 1447 | Ga0495661_0218479 | |||
| 1448 | Ga0495661_0288577 | |||
| 1449 | Ga0495661_0395692 | |||
| 1450 | Ga0495661_0520359 | |||
| 1451 | Ga0495588_0000094 | |||
| 1452 | Ga0495588_0016064 | |||
| 1453 | Ga0495588_0053901 | |||
| 1454 | Ga0495588_0071924 | |||
| 1455 | Ga0495588_0076595 | |||
| 1456 | Ga0495588_0106729 | |||
| 1457 | Ga0495588_0163180 | |||
| 1458 | Ga0495588_0230400 | |||
| 1459 | Ga0495623_0097257 | |||
| 1460 | Ga0495669_0000015 | |||
| 1461 | Ga0495669_0001098 | |||
| 1462 | Ga0495669_0007277 | |||
| 1463 | Ga0495669_0028184 | |||
| 1464 | Ga0495669_0099226 | |||
| 1465 | Ga0495669_0133312 | |||
| 1466 | Ga0495669_0464820 | |||
| 1467 | Ga0495613_0236089 | |||
| 1468 | Ga0495670_0000314 | |||
| 1469 | Ga0495670_0008998 | |||
| 1470 | Ga0495670_0014316 | |||
| 1471 | Ga0495670_0037183 | |||
| 1472 | Ga0495670_0062801 | |||
| 1473 | Ga0495670_0075984 | |||
| 1474 | Ga0495670_0120529 | |||
| 1475 | Ga0495670_0221512 | |||
| 1476 | Ga0495671_0000301 | |||
| 1477 | Ga0495671_0000407 | |||
| 1478 | Ga0495671_0003196 | |||
| 1479 | Ga0495671_0024721 | |||
| 1480 | Ga0495671_0027174 | |||
| 1481 | Ga0495671_0029764 | |||
| 1482 | Ga0495671_0039208 | |||
| 1483 | Ga0495649_0000268 | |||
| 1484 | Ga0495649_0001236 | |||
| 1485 | Ga0495649_0003559 | |||
| 1486 | Ga0495649_0021678 | |||
| 1487 | Ga0495649_0028314 | |||
| 1488 | Ga0495649_0029827 | |||
| 1489 | Ga0495649_0041174 | |||
| 1490 | Ga0495649_0091730 | |||
| 1491 | Ga0495589_0000096 | |||
| 1492 | Ga0495589_0000351 | |||
| 1493 | Ga0495589_0000994 | |||
| 1494 | Ga0495589_0023862 | |||
| 1495 | Ga0495589_0031852 | |||
| 1496 | Ga0495589_0045477 | |||
| 1497 | Ga0495589_0130267 | |||
| 1498 | Ga0495589_0248463 | |||
| 1499 | Ga0495660_0016503 | |||
| 1500 | Ga0495660_0020360 | |||
| 1501 | Ga0495660_0022525 | |||
| 1502 | Ga0495660_0024239 | |||
| 1503 | Ga0495660_0047107 | |||
| 1504 | Ga0495660_0101078 | |||
| 1505 | Ga0495660_0141335 | |||
| 1506 | Ga0495660_0221696 | |||
| 1507 | Ga0495660_0247933 | |||
| 1508 | Ga0495581_0086607 | |||
| 1509 | Ga0495604_0013961 | |||
| 1510 | Ga0495636_0000919 | |||
| 1511 | Ga0495636_0218629 | |||
| 1512 | Ga0495672_0000026 | |||
| 1513 | Ga0495672_0000376 | |||
| 1514 | Ga0495672_0000391 | |||
| 1515 | Ga0495672_0005133 | |||
| 1516 | Ga0495672_0023707 | |||
| 1517 | Ga0495672_0116035 | |||
| 1518 | Ga0495676_0000281 | |||
| 1519 | Ga0495683_0000061 | |||
| 1520 | Ga0495683_0010017 | |||
| 1521 | Ga0495683_0016660 | |||
| 1522 | Ga0495683_0025705 | |||
| 1523 | Ga0495683_0048091 | |||
| 1524 | Ga0495683_0111498 | |||
| 1525 | Ga0495683_0125284 | |||
| 1526 | Ga0495683_0133357 | |||
| 1527 | Ga0495683_0241121 | |||
| 1528 | Ga0495687_000110 | |||
| 1529 | Ga0495687_000117 | |||
| 1530 | Ga0495687_000203 | |||
| 1531 | Ga0495687_000522 | |||
| 1532 | Ga0495687_000772 | |||
| 1533 | Ga0495687_001354 | |||
| 1534 | Ga0495687_009685 | |||
| 1535 | Ga0495687_010025 | |||
| 1536 | Ga0495687_121503 | |||
| 1537 | Ga0495687_127958 | |||
| 1538 | Ga0495687_141689 | |||
| 1539 | Ga0495687_175752 | |||
| 1540 | Ga0495675_0046141 | |||
| 1541 | Ga0495677_0000036 | |||
| 1542 | Ga0495677_0001259 | |||
| 1543 | Ga0495677_0001886 | |||
| 1544 | Ga0495677_0006702 | |||
| 1545 | Ga0495677_0015614 | |||
| 1546 | Ga0495677_0018995 | |||
| 1547 | Ga0495677_0027277 | |||
| 1548 | Ga0495677_0041034 | |||
| 1549 | Ga0495677_0047660 | |||
| 1550 | Ga0495677_0080758 | |||
| 1551 | Ga0495677_0106158 | |||
| 1552 | Ga0495677_0141452 | |||
| 1553 | Ga0495677_0188436 | |||
| 1554 | Ga0495677_0235938 | |||
| 1555 | Ga0495679_004255 | |||
| 1556 | Ga0495679_006300 | |||
| 1557 | Ga0495679_029236 | |||
| 1558 | Ga0495679_036789 | |||
| 1559 | Ga0495685_003627 | |||
| 1560 | Ga0495685_018911 | |||
| 1561 | Ga0495685_021265 | |||
| 1562 | Ga0495685_042936 | |||
| 1563 | Ga0495685_094709 | |||
| 1564 | Ga0495685_124463 | |||
| 1565 | Ga0495685_193170 | |||
| 1566 | Ga0495673_0345550 | |||
| 1567 | Ga0495681_0000429 | |||
| 1568 | Ga0495681_0003418 | |||
| 1569 | Ga0495681_0009302 | |||
| 1570 | Ga0495681_0019882 | |||
| 1571 | Ga0495681_0031941 | |||
| 1572 | Ga0495681_0039807 | |||
| 1573 | Ga0495681_0058725 | |||
| 1574 | Ga0495681_0061906 | |||
| 1575 | Ga0495681_0070940 | |||
| 1576 | Ga0495681_0155398 | |||
| 1577 | Ga0495681_0366085 | |||
| 1578 | Ga0495686_0000211 | |||
| 1579 | Ga0495686_0002384 | |||
| 1580 | Ga0495686_0057055 | |||
| 1581 | Ga0495686_0061325 | |||
| 1582 | Ga0495593_0002604 | |||
| 1583 | Ga0495614_0009594 | |||
| 1584 | Ga0495626_0000248 | |||
| 1585 | Ga0495626_0001446 | |||
| 1586 | Ga0495626_0002372 | |||
| 1587 | Ga0495626_0004585 | |||
| 1588 | Ga0495626_0005118 | |||
| 1589 | Ga0495626_0006270 | |||
| 1590 | Ga0495626_0017566 | |||
| 1591 | Ga0495626_0027387 | |||
| 1592 | Ga0495626_0046796 | |||
| 1593 | Ga0495626_0056788 | |||
| 1594 | Ga0495626_0085523 | |||
| 1595 | Ga0495626_0110556 | |||
| 1596 | Ga0495626_0114896 | |||
| 1597 | Ga0495626_0115021 | |||
| 1598 | Ga0495626_0115540 | |||
| 1599 | Ga0495626_0135356 | |||
| 1600 | Ga0495626_0140406 | |||
| 1601 | Ga0496100_0714392 | |||
| 1602 | Ga0496100_1215346 | |||
| 1603 | Ga0496101_0021234 | |||
| 1604 | Ga0496102_0008289 | |||
| 1605 | Ga0496102_0054742 | |||
| 1606 | Ga0496102_0150931 | |||
| 1607 | Ga0496102_0493515 | |||
| 1608 | Ga0496102_0631732 | |||
| 1609 | Ga0496103_0001512 | |||
| 1610 | Ga0496103_0033458 | |||
| 1611 | Ga0496103_0057760 | |||
| 1612 | Ga0496103_1027602 | |||
| 1613 | Ga0496104_0505181 | |||
| 1614 | Ga0496105_0569837 | |||
| 1615 | Ga0496105_1165559 | |||
| 1616 | Ga0496106_0029179 | |||
| 1617 | Ga0496107_0210111 | |||
| 1618 | Ga0496107_0226753 | |||
| 1619 | Ga0496107_0967220 | |||
| 1620 | Ga0496109_0034046 | |||
| 1621 | Ga0496109_1382763 | |||
| 1622 | Ga0496110_0024137 | |||
| 1623 | Ga0496110_0046293 | |||
| 1624 | Ga0496110_0908218 | |||
| 1625 | Ga0496113_0023269 | |||
| 1626 | Ga0496113_0539660 | |||
| 1627 | Ga0496115_0090683 | |||
| 1628 | Ga0496115_0109859 | |||
| 1629 | Ga0496115_0846957 | |||
| 1630 | Ga0496116_0005927 | |||
| 1631 | Ga0496116_0036002 | |||
| 1632 | Ga0496116_0126546 | |||
| 1633 | Ga0496117_0139491 | |||
| 1634 | Ga0496117_0179810 | |||
| 1635 | Ga0496117_0450837 | |||
| 1636 | Ga0496119_0024995 | |||
| 1637 | Ga0496120_0145180 | |||
| 1638 | Ga0496121_0000444 | |||
| 1639 | Ga0496121_0009535 | |||
| 1640 | Ga0496121_0200202 | |||
| 1641 | Ga0496122_0000232 | |||
| 1642 | Ga0496122_0000483 | |||
| 1643 | Ga0496122_0007785 | |||
| 1644 | Ga0496122_0102463 | |||
| 1645 | Ga0496122_0344466 | |||
| 1646 | Ga0496123_0000194 | |||
| 1647 | Ga0496123_0000904 | |||
| 1648 | Ga0496123_0032504 | |||
| 1649 | Ga0496123_0053931 | |||
| 1650 | Ga0496123_0257506 | |||
| 1651 | Ga0496124_0000013 | |||
| 1652 | Ga0496124_0016891 | |||
| 1653 | Ga0496124_0042724 | |||
| 1654 | Ga0496124_0047118 | |||
| 1655 | Ga0496124_0052033 | |||
| 1656 | Ga0496124_0097148 | |||
| 1657 | Ga0496124_0134627 | |||
| 1658 | Ga0496124_0180582 | |||
| 1659 | Ga0496124_0202292 | |||
| 1660 | Ga0496124_0340456 | |||
| 1661 | Ga0496125_0000051 | |||
| 1662 | Ga0496125_0003465 | |||
| 1663 | Ga0496125_0015724 | |||
| 1664 | Ga0496125_0038720 | |||
| 1665 | Ga0496125_0106503 | |||
| 1666 | Ga0496126_0025984 | |||
| 1667 | Ga0496126_0115238 | |||
| 1668 | Ga0495678_000227 | |||
| 1669 | Ga0495678_001769 | |||
| 1670 | Ga0495678_010629 | |||
| 1671 | Ga0495678_018448 | |||
| 1672 | Ga0495678_076415 | |||
| 1673 | Ga0495678_104071 | |||
| 1674 | Ga0495678_135087 | |||
| 1675 | Ga0495682_0000286 | |||
| 1676 | Ga0495682_0008933 | |||
| 1677 | Ga0495682_0041954 | |||
| 1678 | Ga0495682_0112128 | |||
| 1679 | Ga0501301_003617 | |||
| 1680 | Ga0501034_0169641 | |||
| 1681 | Ga0501036_0337557 | |||
| 1682 | Ga0501043_0303681 | |||
| 1683 | Ga0501047_0006177 | |||
| 1684 | Ga0501207_060443 | |||
| 1685 | Ga0501211_003298 | |||
| 1686 | Ga0501214_002716 | |||
| 1687 | Ga0501222_004483 | |||
| 1688 | Ga0501227_009878 | |||
| 1689 | Ga0501227_110127 | |||
| 1690 | Ga0501240_015555 | |||
| 1691 | Ga0501248_042668 | |||
| 1692 | Ga0501249_001865 | |||
| 1693 | Ga0501221_085329 | |||
| 1694 | Ga0501241_043556 | |||
| 1695 | Ga0501263_002382 | |||
| 1696 | Ga0501269_000016 | |||
| 1697 | Ga0501279_000214 | |||
| 1698 | Ga0501279_002528 | |||
| 1699 | Ga0501279_009397 | |||
| 1700 | Ga0501035_0006115 | |||
| 1701 | Ga0501035_0012618 | |||
| 1702 | Ga0501035_0024919 | |||
| 1703 | Ga0501035_1466863 | |||
| 1704 | Ga0501044_0001216 | |||
| 1705 | Ga0501044_1143230 | |||
| 1706 | Ga0501226_026593 | |||
| 1707 | nmdc:mga03683_160500_c1 | |||
| 1708 | nmdc:mga00v17_128193_c1 | |||
| 1709 | nmdc:mga00v17_142480_c1 | |||
| 1710 | nmdc:mga00v17_16534_c1 | |||
| 1711 | Ga0500618_008302 | |||
| 1712 | Ga0500634_0077778 | |||
| 1713 | Ga0587083_0080394 | |||
| 1714 | Ga0466962_0049428 | |||
| 1715 | 2599902743 | |||
| 1716 | 2643790062 | |||
| 1717 | 2643801900 | |||
| 1718 | 2643861581 | |||
| 1719 | 2643979999 | |||
| 1720 | 2644123653 | |||
| 1721 | 2644217083 | |||
| 1722 | 2644250699 | |||
| 1723 | 2644474306 | |||
| 1724 | 2738738559 | |||
| 1725 | 2738842639 | |||
| 1726 | 2739273386 | |||
| 1727 | 2739342430 | |||
| 1728 | 2739610054 | |||
| 1729 | 2809033082 | |||
| 1730 | 2855732867 | |||
| 1731 | 2855771619 | |||
| 1732 | 2857541621 | |||
| 1733 | 2857543325 | |||
| 1734 | 2858952247 | |||
| 1735 | 2881415660 | |||
| 1736 | 2895517995 | |||
| 1737 | 2904428195 | |||
| 1738 | 2941482676 | |||
| 1739 | 8047674495 | |||
| 1740 | 8055228489 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2nyx-assembly1.cif.gz_A | crystal structure of rv1404 from mycobacterium tuberculosis | 0.9256 | 2 | 46 |
| 2fxa-assembly3.cif.gz_A | structure of the protease production regulatory protein hpr from bacillus subtilis. | 0.9199 | 2 | 47 |
| 5hsm-assembly1.cif.gz_A-2 | crystal structure of mycobacterium tuberculosis marr family protein rv2887 | 0.919 | 3 | 47 |
| 4rgx-assembly1.cif.gz_B-2 | crystal structure of putative marr family transcriptional regulator hcar from acinetobacter sp. adp complexed with 3,4-dihydroxy bezoic acid | 0.9181 | 9 | 47 |
| 4kmf-assembly1.cif.gz_A-2 | crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna | 0.9133 | 5 | 47 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2cfxF01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9752 | 1 | 49 | 1.10.10.10 |
| 2p5vF01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9727 | 4 | 55 | 1.10.10.10 |
| 2p6sE01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9724 | 4 | 55 | 1.10.10.10 |
| 2cfxE01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9724 | 1 | 49 | 1.10.10.10 |
| 2p5vE01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9724 | 4 | 55 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Z0NS97-F1-model_v4 | Lrp/AsnC family transcriptional regulator | 0.8274 | 1 | 140 |
GO:0005829
GO:0043200 GO:0043565 |
| AF-A0A0M4CE35-F1-model_v4 | HTH asnC-type domain-containing protein | 0.8216 | 1 | 140 |
GO:0005829
GO:0043200 GO:0043565 |
| AF-A0A7W9D4X9-F1-model_v4 | DNA-binding Lrp family transcriptional regulator | 0.8207 | 3 | 140 |
GO:0005829
GO:0006524 GO:0043201 GO:0043565 |
| AF-A0A7W5V8X9-F1-model_v4 | DNA-binding Lrp family transcriptional regulator | 0.8175 | 3 | 140 |
GO:0005829
GO:0043200 GO:0043565 |
| AF-A0A2A3F290-F1-model_v4 | deleted | 0.8166 | 3 | 140 |
|