F484153

General Info

Members Datasets Scaffolds Average Seq Length
870 358 1740 88

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0801827|Ga0316574_0801827_192_515
Length 97
Sequence MGGEKSEKGAPARVLGFQFPCRYEIKAMGRHSMRFEALVHAIVSRHIGREDLLASKQRFSRNRRYLSVTCIIRASSRQQLDEIYADLRGCPEVLAAL

Samples

Sample ID Description Type Environment
1 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003397 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM Metagenome Rhizosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
190 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
191 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
192 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
193 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
194 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
195 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
196 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
197 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
198 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
199 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
200 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
201 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
203 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
205 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
206 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
207 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
208 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
209 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
210 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
211 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
212 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
213 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
214 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
215 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
216 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
217 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
218 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
222 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
223 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
226 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
227 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
228 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
229 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
230 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
231 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
232 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
233 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
234 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
235 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
236 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
237 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
238 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
239 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
240 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
241 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
242 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
243 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
244 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
245 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
246 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
247 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
248 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
249 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
252 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
253 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
254 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
255 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
256 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
257 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
258 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
259 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
260 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
261 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
262 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
263 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
264 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
265 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
266 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
267 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
268 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
269 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
270 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
271 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
272 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
273 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
274 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
275 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
276 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
277 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
278 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
279 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
280 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
281 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
282 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
283 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
284 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
285 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
286 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
287 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
288 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
289 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
290 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
291 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
292 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
293 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
294 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
295 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
299 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
300 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
301 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
302 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
308 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
309 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
310 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
311 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
312 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
326 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
327 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
328 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
329 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
330 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
331 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
332 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
333 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
334 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
335 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
336 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
337 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
338 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
339 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
340 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
341 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
343 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
346 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
347 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
348 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
349 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
350 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
351 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
352 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
353 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
354 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
355 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
356 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
357 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
358 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0
Rhizoplane 0.57
Rhizosphere 98.16
Stem 0
Stem Tuber 0
Unclassified 6.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316574_0801827 3300035398 Bacteria 573
2 JGI25406J46586_10035649 3300003203 Bacteria 1814
3 rootL2_10010637 3300003322 Bacteria 7774
4 rootH1_10178713 3300003323 Bacteria 1563
5 JGI26133J50247_101018 3300003397 Bacteria 838
6 Ga0055529_1000015 3300003763 Bacteria 366950
7 Ga0058860_11658417 3300004801 Bacteria 1390
8 Ga0058862_10871056 3300004803 Bacteria 635
9 Ga0065712_10380110 3300005290 Unclassified 753
10 Ga0065707_10028465 3300005295 Bacteria 1790
11 Ga0070676_10759131 3300005328 Bacteria 713
12 Ga0070683_100228472 3300005329 Bacteria 1769
13 Ga0070683_101622413 3300005329 Bacteria 622
14 Ga0070690_100000197 3300005330 Bacteria 31360
15 Ga0070690_100664488 3300005330 Bacteria 797
16 Ga0070690_101016336 3300005330 Bacteria 654
17 Ga0070690_101091112 3300005330 Bacteria 633
18 Ga0070670_100290586 3300005331 Unclassified 1428
19 Ga0070670_100899990 3300005331 Bacteria 802
20 Ga0070670_101506574 3300005331 Unclassified 618
21 Ga0068869_100000214 3300005334 Bacteria 30165
22 Ga0068869_100063874 3300005334 Bacteria 2707
23 Ga0068869_100229020 3300005334 Bacteria 1476
24 Ga0070666_10263580 3300005335 Bacteria 1222
25 Ga0070680_100005842 3300005336 Bacteria 9338
26 Ga0070680_100061318 3300005336 Bacteria 3078
27 Ga0070680_100189194 3300005336 Bacteria 1734
28 Ga0070682_100003738 3300005337 Bacteria 8463
29 Ga0068868_100000375 3300005338 Bacteria 30466
30 Ga0068868_101098168 3300005338 Bacteria 732
31 Ga0068868_101890732 3300005338 Bacteria 565
32 Ga0070689_100000107 3300005340 Bacteria 48084
33 Ga0070689_100065511 3300005340 Bacteria 2829
34 Ga0070689_100214699 3300005340 Bacteria 1576
35 Ga0070689_100357767 3300005340 Bacteria 1226
36 Ga0070689_100727136 3300005340 Bacteria 868
37 Ga0070689_100840768 3300005340 Bacteria 809
38 Ga0070689_101641949 3300005340 Unclassified 584
39 Ga0070691_10000220 3300005341 Bacteria 19309
40 Ga0070691_10219666 3300005341 Bacteria 1006
41 Ga0070691_10860537 3300005341 Bacteria 556
42 Ga0070687_100000669 3300005343 Bacteria 11428
43 Ga0070687_100128970 3300005343 Bacteria 1457
44 Ga0070687_100159616 3300005343 Bacteria 1332
45 Ga0070687_100253395 3300005343 Bacteria 1095
46 Ga0070687_100673294 3300005343 Bacteria 720
47 Ga0070692_10005331 3300005345 Bacteria 5469
48 Ga0070692_10779827 3300005345 Bacteria 651
49 Ga0070669_101040733 3300005353 Bacteria 703
50 Ga0070675_100345976 3300005354 Bacteria 1318
51 Ga0070675_100705968 3300005354 Bacteria 919
52 Ga0070675_101221138 3300005354 Bacteria 692
53 Ga0070674_100664544 3300005356 Bacteria 887
54 Ga0070673_100266246 3300005364 Bacteria 1499
55 Ga0070673_100467413 3300005364 Bacteria 1137
56 Ga0070673_100765611 3300005364 Bacteria 890
57 Ga0070673_100892420 3300005364 Bacteria 824
58 Ga0070688_100033844 3300005365 Bacteria 3091
59 Ga0070688_101569673 3300005365 Bacteria 537
60 Ga0070659_100519794 3300005366 Bacteria 1016
61 Ga0070703_10004630 3300005406 Bacteria 3852
62 Ga0070703_10142223 3300005406 Bacteria 893
63 Ga0070709_10519574 3300005434 Bacteria 907
64 Ga0070714_100011982 3300005435 Bacteria 6898
65 Ga0070713_100399710 3300005436 Bacteria 1283
66 Ga0070713_102422813 3300005436 Bacteria 507
67 Ga0070710_10437408 3300005437 Bacteria 884
68 Ga0070701_10000396 3300005438 Bacteria 14677
69 Ga0070701_10130788 3300005438 Bacteria 1426
70 Ga0070711_101262697 3300005439 Unclassified 640
71 Ga0070705_100027892 3300005440 Bacteria 3087
72 Ga0070705_100075566 3300005440 Bacteria 2051
73 Ga0070705_100721539 3300005440 Bacteria 785
74 Ga0070705_101319470 3300005440 Bacteria 599
75 Ga0070700_100000633 3300005441 Bacteria 17458
76 Ga0070700_100103026 3300005441 Bacteria 1884
77 Ga0070700_100111705 3300005441 Bacteria 1818
78 Ga0070700_100216498 3300005441 Bacteria 1354
79 Ga0070700_100263736 3300005441 Bacteria 1241
80 Ga0070700_100360890 3300005441 Unclassified 1080
81 Ga0070700_100721722 3300005441 Bacteria 795
82 Ga0070694_100000126 3300005444 Bacteria 37932
83 Ga0070694_100017277 3300005444 Bacteria 4556
84 Ga0070694_100057979 3300005444 Bacteria 2633
85 Ga0070694_100077882 3300005444 Bacteria 2298
86 Ga0070694_100266507 3300005444 Bacteria 1301
87 Ga0070694_100391685 3300005444 Bacteria 1086
88 Ga0070694_100563404 3300005444 Bacteria 914
89 Ga0070694_101758613 3300005444 Bacteria 528
90 Ga0070708_100319275 3300005445 Bacteria 1463
91 Ga0070708_101109277 3300005445 Bacteria 741
92 Ga0070708_101631857 3300005445 Bacteria 600
93 Ga0070678_100030611 3300005456 Bacteria 3702
94 Ga0070681_10000399 3300005458 Bacteria 35221
95 Ga0070681_10338742 3300005458 Bacteria 1414
96 Ga0070681_10414874 3300005458 Bacteria 1258
97 Ga0070681_10912559 3300005458 Bacteria 797
98 Ga0068867_100000032 3300005459 Bacteria 84727
99 Ga0068867_100846461 3300005459 Bacteria 819
100 Ga0070707_100726748 3300005468 Bacteria 956
101 Ga0070707_100753833 3300005468 Bacteria 937
102 Ga0070707_100798163 3300005468 Bacteria 908
103 Ga0070707_101083333 3300005468 Bacteria 767
104 Ga0070698_100162623 3300005471 Bacteria 2176
105 Ga0070698_101948042 3300005471 Bacteria 541
106 Ga0070699_100015187 3300005518 Bacteria 6617
107 Ga0070699_100102761 3300005518 Bacteria 2506
108 Ga0070699_100998981 3300005518 Bacteria 767
109 Ga0070679_100108511 3300005530 Bacteria 2762
110 Ga0070679_101063904 3300005530 Bacteria 753
111 Ga0070684_100874045 3300005535 Unclassified 842
112 Ga0070684_101303839 3300005535 Unclassified 683
113 Ga0070697_100000648 3300005536 Bacteria 26304
114 Ga0070697_100249725 3300005536 Bacteria 1517
115 Ga0070697_100663479 3300005536 Bacteria 919
116 Ga0070697_101303123 3300005536 Bacteria 648
117 Ga0068853_100191540 3300005539 Bacteria 1858
118 Ga0070672_100786395 3300005543 Bacteria 837
119 Ga0070686_100000253 3300005544 Bacteria 36736
120 Ga0070686_100227621 3300005544 Bacteria 1351
121 Ga0070686_100533516 3300005544 Bacteria 915
122 Ga0070686_100625088 3300005544 Bacteria 851
123 Ga0070686_100886077 3300005544 Bacteria 725
124 Ga0070686_100969123 3300005544 Bacteria 696
125 Ga0070695_100000197 3300005545 Bacteria 29394
126 Ga0070695_100000362 3300005545 Bacteria 23307
127 Ga0070695_100045316 3300005545 Bacteria 2803
128 Ga0070695_100164586 3300005545 Bacteria 1560
129 Ga0070695_100246385 3300005545 Bacteria 1299
130 Ga0070695_100293197 3300005545 Bacteria 1200
131 Ga0070695_100831223 3300005545 Bacteria 742
132 Ga0070695_101127588 3300005545 Unclassified 643
133 Ga0070695_101443105 3300005545 Unclassified 571
134 Ga0070695_101616568 3300005545 Bacteria 541
135 Ga0070696_100000089 3300005546 Bacteria 44686
136 Ga0070696_100000482 3300005546 Bacteria 25020
137 Ga0070696_100002485 3300005546 Bacteria 12219
138 Ga0070696_100166322 3300005546 Bacteria 1628
139 Ga0070696_100471717 3300005546 Bacteria 994
140 Ga0070696_100603027 3300005546 Bacteria 885
141 Ga0070696_100717106 3300005546 Bacteria 816
142 Ga0070693_100000400 3300005547 Bacteria 19703
143 Ga0070693_100168146 3300005547 Bacteria 1402
144 Ga0070704_100000017 3300005549 Bacteria 57626
145 Ga0070704_100009024 3300005549 Bacteria 6011
146 Ga0070704_100025353 3300005549 Bacteria 3903
147 Ga0070704_100421993 3300005549 Bacteria 1142
148 Ga0070704_100623839 3300005549 Bacteria 949
149 Ga0070704_100791533 3300005549 Bacteria 847
150 Ga0068855_100002377 3300005563 Bacteria 23195
151 Ga0068855_101574544 3300005563 Bacteria 673
152 Ga0068857_100997366 3300005577 Bacteria 806
153 Ga0068857_102182359 3300005577 Bacteria 544
154 Ga0068854_100022368 3300005578 Bacteria 4306
155 Ga0068854_102014307 3300005578 Bacteria 532
156 Ga0068856_100142277 3300005614 Bacteria 2406
157 Ga0070702_100000001 3300005615 Bacteria 87224
158 Ga0070702_100018216 3300005615 Bacteria 3639
159 Ga0070702_100239864 3300005615 Bacteria 1223
160 Ga0068859_100000149 3300005617 Bacteria 66296
161 Ga0068859_100249647 3300005617 Bacteria 1865
162 Ga0068859_101059047 3300005617 Bacteria 892
163 Ga0068859_101070061 3300005617 Bacteria 887
164 Ga0068864_100009007 3300005618 Bacteria 8230
165 Ga0068864_100082993 3300005618 Bacteria 2813
166 Ga0068864_102069581 3300005618 Bacteria 575
167 Ga0068866_10000326 3300005718 Bacteria 22539
168 Ga0068861_100000428 3300005719 Bacteria 24436
169 Ga0068861_100128148 3300005719 Bacteria 2056
170 Ga0068861_100326403 3300005719 Bacteria 1338
171 Ga0068870_10492096 3300005840 Bacteria 816
172 Ga0068863_100262007 3300005841 Bacteria 1672
173 Ga0068863_100283339 3300005841 Bacteria 1606
174 Ga0068863_100299836 3300005841 Bacteria 1559
175 Ga0068863_102046408 3300005841 Bacteria 583
176 Ga0068858_100002902 3300005842 Bacteria 17243
177 Ga0068858_100615355 3300005842 Bacteria 1054
178 Ga0068858_101160466 3300005842 Bacteria 759
179 Ga0068860_100001090 3300005843 Bacteria 29921
180 Ga0068860_100894234 3300005843 Bacteria 904
181 Ga0068862_100000409 3300005844 Bacteria 46422
182 Ga0081538_10152692 3300005981 Bacteria 1042
183 Ga0081539_10000686 3300005985 Bacteria 67858
184 Ga0070715_10229490 3300006163 Bacteria 959
185 Ga0070716_100101869 3300006173 Bacteria 1762
186 Ga0070716_100445383 3300006173 Bacteria 943
187 Ga0075367_10815908 3300006178 Bacteria 594
188 Ga0097621_100000928 3300006237 Bacteria 20529
189 Ga0068871_100011561 3300006358 Bacteria 6476
190 Ga0068871_101248038 3300006358 Bacteria 698
191 Ga0068871_101409027 3300006358 Bacteria 657
192 Ga0068871_101459461 3300006358 Bacteria 646
193 Ga0075428_100000083 3300006844 Bacteria 78689
194 Ga0075428_100040406 3300006844 Bacteria 5132
195 Ga0075428_100214190 3300006844 Bacteria 2081
196 Ga0075428_100456878 3300006844 Bacteria 1368
197 Ga0075430_100000550 3300006846 Bacteria 28484
198 Ga0075430_100007696 3300006846 Bacteria 9098
199 Ga0075430_100189368 3300006846 Bacteria 1710
200 Ga0075430_100341025 3300006846 Unclassified 1238
201 Ga0075430_100438589 3300006846 Bacteria 1078
202 Ga0075430_100483458 3300006846 Bacteria 1022
203 Ga0075430_100537999 3300006846 Bacteria 963
204 Ga0075430_100776711 3300006846 Bacteria 789
205 Ga0075430_100852917 3300006846 Bacteria 751
206 Ga0075431_100016437 3300006847 Bacteria 7510
207 Ga0075431_100123948 3300006847 Bacteria 2666
208 Ga0075431_100353925 3300006847 Bacteria 1476
209 Ga0075431_100397211 3300006847 Bacteria 1380
210 Ga0075431_100443596 3300006847 Bacteria 1294
211 Ga0075431_100522127 3300006847 Bacteria 1177
212 Ga0075431_100656026 3300006847 Bacteria 1029
213 Ga0075433_10033239 3300006852 Bacteria 4420
214 Ga0075433_10164444 3300006852 Bacteria 1975
215 Ga0075433_11086754 3300006852 Bacteria 696
216 Ga0075434_100000011 3300006871 Bacteria 86261
217 Ga0075434_100005363 3300006871 Bacteria 11665
218 Ga0075434_100007734 3300006871 Bacteria 9953
219 Ga0075434_100266698 3300006871 Bacteria 1731
220 Ga0075434_101385976 3300006871 Bacteria 713
221 Ga0075429_100000480 3300006880 Bacteria 29845
222 Ga0075429_100069548 3300006880 Bacteria 3065
223 Ga0075429_100072951 3300006880 Bacteria 2989
224 Ga0075429_100226541 3300006880 Unclassified 1637
225 Ga0075429_100254048 3300006880 Bacteria 1539
226 Ga0075429_101078498 3300006880 Bacteria 702
227 Ga0075429_101344870 3300006880 Bacteria 623
228 Ga0068865_100000059 3300006881 Bacteria 58856
229 Ga0075436_100003220 3300006914 Bacteria 11194
230 Ga0075436_100004494 3300006914 Bacteria 9572
231 Ga0075436_100014323 3300006914 Bacteria 5429
232 Ga0075436_100042934 3300006914 Bacteria 3117
233 Ga0075436_100164546 3300006914 Bacteria 1565
234 Ga0075436_100166596 3300006914 Bacteria 1555
235 Ga0075436_100504715 3300006914 Bacteria 885
236 Ga0075436_100606801 3300006914 Bacteria 806
237 Ga0097620_100000149 3300006931 Bacteria 66296
238 Ga0097620_100249643 3300006931 Bacteria 1865
239 Ga0097620_101059077 3300006931 Bacteria 892
240 Ga0097620_101070087 3300006931 Bacteria 887
241 Ga0075435_100000388 3300007076 Bacteria 26867
242 Ga0075435_100029181 3300007076 Bacteria 4328
243 Ga0075435_100060020 3300007076 Bacteria 3083
244 Ga0075435_100129605 3300007076 Bacteria 2110
245 Ga0075435_100663288 3300007076 Bacteria 906
246 Ga0075435_100723078 3300007076 Bacteria 866
247 Ga0075435_100772429 3300007076 Bacteria 836
248 Ga0099794_10015782 3300007265 Bacteria 3340
249 Ga0099794_10022481 3300007265 Bacteria 2875
250 Ga0099794_10415968 3300007265 Bacteria 703
251 Ga0099794_10421351 3300007265 Bacteria 698
252 Ga0105251_10643320 3300009011 Bacteria 506
253 Ga0105244_10492227 3300009036 Bacteria 564
254 Ga0105240_10540267 3300009093 Bacteria 1291
255 Ga0111539_10016381 3300009094 Bacteria 9192
256 Ga0111539_10026004 3300009094 Bacteria 7163
257 Ga0111539_10038453 3300009094 Bacteria 5771
258 Ga0111539_10039269 3300009094 Bacteria 5706
259 Ga0111539_10070916 3300009094 Bacteria 4112
260 Ga0111539_10150838 3300009094 Bacteria 2721
261 Ga0111539_10693456 3300009094 Bacteria 1185
262 Ga0111539_10958092 3300009094 Unclassified 995
263 Ga0111539_11783976 3300009094 Bacteria 713
264 Ga0111539_13494213 3300009094 Bacteria 504
265 Ga0105245_10000075 3300009098 Bacteria 103550
266 Ga0105245_11176772 3300009098 Bacteria 814
267 Ga0114129_10000210 3300009147 Bacteria 65476
268 Ga0114129_10634184 3300009147 Unclassified 1381
269 Ga0114129_10961706 3300009147 Bacteria 1078
270 Ga0114129_11130110 3300009147 Bacteria 979
271 Ga0114129_11193197 3300009147 Bacteria 948
272 Ga0114129_11433701 3300009147 Bacteria 851
273 Ga0114129_11444908 3300009147 Unclassified 847
274 Ga0114129_11946484 3300009147 Bacteria 712
275 Ga0114129_12507585 3300009147 Bacteria 616
276 Ga0114129_12724503 3300009147 Bacteria 589
277 Ga0105243_10000622 3300009148 Bacteria 35310
278 Ga0105243_10010536 3300009148 Bacteria 7020
279 Ga0105243_12273446 3300009148 Bacteria 579
280 Ga0105241_10084412 3300009174 Bacteria 2493
281 Ga0105242_10000407 3300009176 Bacteria 34281
282 Ga0105242_10372148 3300009176 Bacteria 1325
283 Ga0105242_12061126 3300009176 Bacteria 614
284 Ga0105248_10217743 3300009177 Bacteria 2150
285 Ga0105248_10414506 3300009177 Bacteria 1517
286 Ga0105248_10838385 3300009177 Bacteria 1038
287 Ga0105249_10002440 3300009553 Bacteria 16141
288 Ga0105249_10004477 3300009553 Bacteria 12079
289 Ga0105249_12614768 3300009553 Unclassified 577
290 Ga0105239_10111905 3300010375 Bacteria 3027
291 Ga0105246_12265558 3300011119 Bacteria 530
292 Ga0157335_1035026 3300012492 Bacteria 543
293 Ga0157378_10000074 3300013297 Bacteria 90608
294 Ga0157378_12532270 3300013297 Bacteria 565
295 Ga0163162_10757695 3300013306 Bacteria 1090
296 Ga0163162_13341312 3300013306 Unclassified 513
297 Ga0157372_10357574 3300013307 Bacteria 1701
298 Ga0157375_11045777 3300013308 Bacteria 954
299 Ga0157375_11079065 3300013308 Bacteria 939
300 Ga0157380_10001505 3300014326 Bacteria 15283
301 Ga0157380_10103645 3300014326 Bacteria 2374
302 Ga0157380_10907627 3300014326 Bacteria 907
303 Ga0157377_10065103 3300014745 Bacteria 2093
304 Ga0157377_11447566 3300014745 Bacteria 544
305 Ga0157379_10879275 3300014968 Bacteria 849
306 Ga0157376_10021663 3300014969 Bacteria 4994
307 Ga0163161_10691716 3300017792 Bacteria 848
308 Ga0209437_119409 3300025233 Bacteria 855
309 Ga0209455_1000031 3300025272 Bacteria 519952
310 Ga0207653_10004464 3300025885 Bacteria 4387
311 Ga0207692_10248029 3300025898 Bacteria 1066
312 Ga0207642_10004209 3300025899 Bacteria 4629
313 Ga0207688_10030324 3300025901 Bacteria 2981
314 Ga0207688_10059207 3300025901 Bacteria 2157
315 Ga0207688_10740502 3300025901 Bacteria 622
316 Ga0207680_10244047 3300025903 Bacteria 1239
317 Ga0207647_10657704 3300025904 Unclassified 574
318 Ga0207685_10496850 3300025905 Bacteria 641
319 Ga0207645_10263795 3300025907 Bacteria 1141
320 Ga0207645_10270574 3300025907 Bacteria 1126
321 Ga0207643_10428606 3300025908 Bacteria 839
322 Ga0207654_10022847 3300025911 Bacteria 3342
323 Ga0207707_10003163 3300025912 Bacteria 14617
324 Ga0207707_10210452 3300025912 Bacteria 1694
325 Ga0207707_10440915 3300025912 Bacteria 1115
326 Ga0207707_10651865 3300025912 Bacteria 887
327 Ga0207695_11243277 3300025913 Bacteria 625
328 Ga0207663_10251923 3300025916 Bacteria 1300
329 Ga0207663_10448430 3300025916 Bacteria 995
330 Ga0207663_10511958 3300025916 Bacteria 934
331 Ga0207660_10078664 3300025917 Bacteria 2417
332 Ga0207660_10626293 3300025917 Bacteria 877
333 Ga0207660_10720685 3300025917 Unclassified 814
334 Ga0207660_10863670 3300025917 Bacteria 738
335 Ga0207662_10000315 3300025918 Bacteria 22055
336 Ga0207662_10129249 3300025918 Bacteria 1591
337 Ga0207662_10171434 3300025918 Bacteria 1392
338 Ga0207662_10173077 3300025918 Bacteria 1385
339 Ga0207662_10283799 3300025918 Bacteria 1096
340 Ga0207662_10543112 3300025918 Bacteria 804
341 Ga0207649_11439209 3300025920 Unclassified 545
342 Ga0207646_10404443 3300025922 Bacteria 1233
343 Ga0207646_10663526 3300025922 Bacteria 934
344 Ga0207681_10248018 3300025923 Bacteria 1389
345 Ga0207650_11534089 3300025925 Unclassified 566
346 Ga0207659_10068577 3300025926 Bacteria 2580
347 Ga0207659_11884448 3300025926 Bacteria 507
348 Ga0207687_10001426 3300025927 Bacteria 16345
349 Ga0207687_11552174 3300025927 Bacteria 568
350 Ga0207700_10760973 3300025928 Bacteria 866
351 Ga0207700_11624483 3300025928 Bacteria 571
352 Ga0207664_10398785 3300025929 Bacteria 1223
353 Ga0207644_10029941 3300025931 Bacteria 3780
354 Ga0207686_10000243 3300025934 Bacteria 41698
355 Ga0207686_10753542 3300025934 Bacteria 777
356 Ga0207709_10001387 3300025935 Bacteria 16961
357 Ga0207670_10001067 3300025936 Bacteria 14456
358 Ga0207670_10108375 3300025936 Bacteria 1996
359 Ga0207670_10127750 3300025936 Bacteria 1857
360 Ga0207670_10334710 3300025936 Bacteria 1195
361 Ga0207670_10352382 3300025936 Bacteria 1166
362 Ga0207670_11394570 3300025936 Unclassified 595
363 Ga0207669_10659205 3300025937 Bacteria 857
364 Ga0207704_10018253 3300025938 Bacteria 3658
365 Ga0207704_11779416 3300025938 Bacteria 530
366 Ga0207665_10132548 3300025939 Bacteria 1771
367 Ga0207665_10144714 3300025939 Bacteria 1698
368 Ga0207665_10317248 3300025939 Bacteria 1169
369 Ga0207711_10618201 3300025941 Bacteria 1011
370 Ga0207711_11811618 3300025941 Bacteria 553
371 Ga0207689_10000007 3300025942 Bacteria 132362
372 Ga0207689_10097695 3300025942 Bacteria 2412
373 Ga0207689_10259174 3300025942 Bacteria 1438
374 Ga0207689_10562218 3300025942 Bacteria 958
375 Ga0207661_10116956 3300025944 Bacteria 2264
376 Ga0207661_11151068 3300025944 Bacteria 714
377 Ga0207667_10077643 3300025949 Bacteria 3443
378 Ga0207667_11302905 3300025949 Bacteria 703
379 Ga0207651_10195881 3300025960 Bacteria 1615
380 Ga0207651_10251540 3300025960 Bacteria 1446
381 Ga0207651_11099234 3300025960 Unclassified 712
382 Ga0207712_10002821 3300025961 Bacteria 11132
383 Ga0207668_11245685 3300025972 Bacteria 669
384 Ga0207640_10015170 3300025981 Bacteria 4454
385 Ga0207677_10000823 3300026023 Bacteria 17732
386 Ga0207677_10335847 3300026023 Bacteria 1261
387 Ga0207677_10919033 3300026023 Bacteria 790
388 Ga0207703_10102600 3300026035 Bacteria 2427
389 Ga0207703_10345945 3300026035 Bacteria 1368
390 Ga0207639_10520357 3300026041 Bacteria 1089
391 Ga0207708_10000086 3300026075 Bacteria 73314
392 Ga0207708_10113450 3300026075 Bacteria 2106
393 Ga0207708_10202555 3300026075 Bacteria 1584
394 Ga0207708_10251397 3300026075 Bacteria 1424
395 Ga0207708_10354104 3300026075 Bacteria 1205
396 Ga0207708_10561004 3300026075 Bacteria 964
397 Ga0207708_11288530 3300026075 Bacteria 640
398 Ga0207708_11522484 3300026075 Unclassified 588
399 Ga0207708_11779641 3300026075 Bacteria 541
400 Ga0207702_10145265 3300026078 Bacteria 2152
401 Ga0207641_10161054 3300026088 Bacteria 2040
402 Ga0207641_10225916 3300026088 Bacteria 1738
403 Ga0207641_10312390 3300026088 Bacteria 1488
404 Ga0207641_10423615 3300026088 Bacteria 1282
405 Ga0207648_10000079 3300026089 Bacteria 92044
406 Ga0207648_10377073 3300026089 Bacteria 1282
407 Ga0207648_11126314 3300026089 Bacteria 736
408 Ga0207648_12189534 3300026089 Bacteria 514
409 Ga0207676_10037278 3300026095 Bacteria 3704
410 Ga0207676_10321696 3300026095 Bacteria 1420
411 Ga0207674_10159116 3300026116 Bacteria 2213
412 Ga0207675_100000093 3300026118 Bacteria 70343
413 Ga0207675_100144068 3300026118 Bacteria 2265
414 Ga0207675_100654318 3300026118 Bacteria 1057
415 Ga0207675_100829724 3300026118 Bacteria 939
416 Ga0207683_10327647 3300026121 Bacteria 1403
417 Ga0209969_1000430 3300027360 Bacteria 5605
418 Ga0209969_1001086 3300027360 Bacteria 3731
419 Ga0209969_1003617 3300027360 Bacteria 2142
420 Ga0209969_1016600 3300027360 Bacteria 1081
421 Ga0209967_1000417 3300027364 Bacteria 5603
422 Ga0209967_1001327 3300027364 Bacteria 3170
423 Ga0209967_1003025 3300027364 Bacteria 2207
424 Ga0209981_1001444 3300027378 Bacteria 3001
425 Ga0209981_1001566 3300027378 Bacteria 2895
426 Ga0209981_1010103 3300027378 Bacteria 1293
427 Ga0209981_1021781 3300027378 Bacteria 918
428 Ga0209996_1026728 3300027395 Bacteria 828
429 Ga0209996_1060653 3300027395 Bacteria 581
430 Ga0210000_1000446 3300027462 Bacteria 5675
431 Ga0210000_1001892 3300027462 Bacteria 2958
432 Ga0210000_1002212 3300027462 Bacteria 2757
433 Ga0210000_1042787 3300027462 Unclassified 720
434 Ga0209995_1000255 3300027471 Bacteria 8527
435 Ga0209995_1001597 3300027471 Bacteria 3511
436 Ga0209995_1007282 3300027471 Bacteria 1784
437 Ga0209995_1028014 3300027471 Bacteria 940
438 Ga0209968_1002375 3300027526 Bacteria 2843
439 Ga0209968_1003221 3300027526 Bacteria 2445
440 Ga0209968_1018430 3300027526 Bacteria 1118
441 Ga0209968_1065309 3300027526 Unclassified 644
442 Ga0209999_1000334 3300027543 Bacteria 7086
443 Ga0209999_1007955 3300027543 Bacteria 1906
444 Ga0209999_1032187 3300027543 Bacteria 974
445 Ga0209999_1042378 3300027543 Bacteria 854
446 Ga0209983_1052129 3300027665 Bacteria 896
447 Ga0209588_1045166 3300027671 Bacteria 1425
448 Ga0209588_1259659 3300027671 Bacteria 529
449 Ga0209971_1007609 3300027682 Bacteria 2572
450 Ga0209971_1010313 3300027682 Bacteria 2212
451 Ga0209966_1005660 3300027695 Bacteria 2148
452 Ga0209966_1016285 3300027695 Bacteria 1405
453 Ga0209998_10031398 3300027717 Bacteria 1177
454 Ga0209974_10001421 3300027876 Bacteria 8660
455 Ga0209974_10009715 3300027876 Bacteria 3264
456 Ga0209974_10032169 3300027876 Bacteria 1738
457 Ga0209974_10169376 3300027876 Bacteria 796
458 Ga0207428_10000321 3300027907 Bacteria 62664
459 Ga0207428_10024838 3300027907 Bacteria 5027
460 Ga0207428_10062422 3300027907 Bacteria 2946
461 Ga0207428_10142297 3300027907 Bacteria 1829
462 Ga0207428_10214049 3300027907 Bacteria 1447
463 Ga0207428_10534253 3300027907 Bacteria 849
464 Ga0268265_10003346 3300028380 Bacteria 11597
465 Ga0268265_10551255 3300028380 Bacteria 1094
466 Ga0268264_10001077 3300028381 Bacteria 27026
467 Ga0268264_10231781 3300028381 Bacteria 1706
468 Ga0268264_11229884 3300028381 Bacteria 759
469 Ga0307408_100164000 3300031548 Unclassified 1768
470 Ga0307408_100481287 3300031548 Bacteria 1083
471 Ga0307408_100759153 3300031548 Bacteria 877
472 Ga0307408_101274824 3300031548 Bacteria 688
473 Ga0307408_101627004 3300031548 Bacteria 614
474 Ga0307408_101637079 3300031548 Bacteria 612
475 Ga0307405_10174146 3300031731 Unclassified 1538
476 Ga0307410_11808088 3300031852 Bacteria 543
477 Ga0307406_10641146 3300031901 Bacteria 881
478 Ga0307407_10873038 3300031903 Bacteria 689
479 Ga0307412_10106667 3300031911 Bacteria 1992
480 Ga0307412_10197098 3300031911 Bacteria 1527
481 Ga0307412_10733636 3300031911 Bacteria 851
482 Ga0307412_10972524 3300031911 Bacteria 748
483 Ga0307409_102277653 3300031995 Bacteria 571
484 Ga0307416_100183675 3300032002 Bacteria 1963
485 Ga0307416_100343938 3300032002 Unclassified 1506
486 Ga0307416_100474965 3300032002 Bacteria 1309
487 Ga0307416_101611686 3300032002 Bacteria 754
488 Ga0307416_101652519 3300032002 Bacteria 745
489 Ga0307411_10349598 3300032005 Bacteria 1205
490 Ga0307411_10466326 3300032005 Bacteria 1060
491 Ga0307411_10887640 3300032005 Bacteria 791
492 Ga0307411_11016350 3300032005 Bacteria 743
493 Ga0307411_11147741 3300032005 Unclassified 702
494 Ga0307411_11583439 3300032005 Bacteria 604
495 Ga0307411_11747277 3300032005 Bacteria 576
496 Ga0316583_10124335 3300032133 Unclassified 899
497 Ga0373948_0043427 3300034817 Bacteria 947
498 Ga0373938_0077990 3300034957 Bacteria 802
499 Ga0373926_0037450 3300035083 Bacteria 1725
500 Ga0373928_0001275 3300035084 Bacteria 4964
501 Ga0373928_0033048 3300035084 Bacteria 1156
502 Ga0373928_0176903 3300035084 Bacteria 604
503 Ga0373929_0110196 3300035085 Bacteria 703
504 Ga0373929_0154870 3300035085 Bacteria 617
505 Ga0373929_0234115 3300035085 Bacteria 527
506 Ga0373934_0018623 3300035086 Bacteria 2658
507 Ga0373934_0327756 3300035086 Bacteria 636
508 Ga0373940_0069540 3300035088 Bacteria 1022
509 Ga0373940_0242819 3300035088 Bacteria 605
510 Ga0373944_0007607 3300035089 Bacteria 2908
511 Ga0373944_0032245 3300035089 Bacteria 1581
512 Ga0373949_0135679 3300035090 Bacteria 701
513 Ga0373949_0241556 3300035090 Bacteria 556
514 Ga0373951_0082723 3300035091 Bacteria 833
515 Ga0373951_0187381 3300035091 Bacteria 597
516 Ga0373952_0001950 3300035092 Bacteria 3737
517 Ga0373952_0163933 3300035092 Bacteria 631
518 Ga0373952_0171573 3300035092 Unclassified 620
519 Ga0373923_0079537 3300035111 Bacteria 1420
520 Ga0373923_0303738 3300035111 Bacteria 755
521 Ga0373932_0002438 3300035112 Bacteria 4717
522 Ga0373932_0133532 3300035112 Bacteria 838
523 Ga0373932_0231573 3300035112 Bacteria 668
524 Ga0373936_0029588 3300035113 Bacteria 2156
525 Ga0373936_0252223 3300035113 Bacteria 788
526 Ga0373936_0348296 3300035113 Bacteria 674
527 Ga0373939_0002522 3300035114 Bacteria 4308
528 Ga0373939_0136570 3300035114 Bacteria 880
529 Ga0373941_0031727 3300035115 Bacteria 1576
530 Ga0373941_0113920 3300035115 Bacteria 956
531 Ga0373941_0300139 3300035115 Bacteria 641
532 Ga0373945_0001661 3300035116 Bacteria 6831
533 Ga0373953_0002608 3300035117 Bacteria 5457
534 Ga0373954_0000002 3300035118 Bacteria 147478
535 Ga0373954_0204650 3300035118 Bacteria 970
536 Ga0373956_0156368 3300035119 Bacteria 1073
537 Ga0373956_0173831 3300035119 Bacteria 1017
538 Ga0373957_0023276 3300035120 Bacteria 2214
539 Ga0373960_0015187 3300035121 Bacteria 1961
540 Ga0373960_0169062 3300035121 Bacteria 757
541 Ga0373960_0221428 3300035121 Bacteria 677
542 Ga0373943_0010824 3300035170 Bacteria 4094
543 Ga0373943_0097712 3300035170 Bacteria 1530
544 Ga0373943_0885911 3300035170 Bacteria 533
545 Ga0373946_0005645 3300035171 Bacteria 4519
546 Ga0373946_0041970 3300035171 Bacteria 1878
547 Ga0373955_0038672 3300035172 Bacteria 2543
548 Ga0373955_0083592 3300035172 Bacteria 1809
549 Ga0373955_0299717 3300035172 Bacteria 969
550 Ga0373955_0824571 3300035172 Unclassified 570
551 Ga0373942_0006452 3300035207 Bacteria 2710
552 Ga0373942_0098176 3300035207 Bacteria 891
553 Ga0373961_0025476 3300035241 Bacteria 1608
554 Ga0373961_0050216 3300035241 Bacteria 1235
555 Ga0373962_0011183 3300035242 Bacteria 2246
556 Ga0373962_0063589 3300035242 Bacteria 1089
557 Ga0373924_0069540 3300035410 Bacteria 1483
558 Ga0373924_0084250 3300035410 Bacteria 1355
559 Ga0373924_0203820 3300035410 Bacteria 873
560 Ga0373924_0221463 3300035410 Bacteria 836
561 Ga0373931_0000265 3300035691 Bacteria 22203
562 Ga0373931_0008664 3300035691 Bacteria 4835
563 Ga0373931_0034304 3300035691 Bacteria 2633
564 Ga0373931_0120090 3300035691 Bacteria 1501
565 Ga0373931_0441787 3300035691 Bacteria 831
566 Ga0373935_0029727 3300035692 Bacteria 3382
567 Ga0373935_0033469 3300035692 Bacteria 3198
568 Ga0373935_0324545 3300035692 Bacteria 1093
569 Ga0373927_0078223 3300035695 Bacteria 2142
570 Ga0373927_0114908 3300035695 Bacteria 1754
571 Ga0373933_0000657 3300035724 Bacteria 21450
572 Ga0373933_0015090 3300035724 Bacteria 4305
573 Ga0373933_0202219 3300035724 Bacteria 1271
574 Ga0373947_0009354 3300035725 Bacteria 5630
575 Ga0373947_0036354 3300035725 Bacteria 2920
576 Ga0373947_1037173 3300035725 Unclassified 559
577 Ga0373937_0000358 3300036401 Bacteria 42468
578 Ga0373937_0006046 3300036401 Bacteria 10424
579 Ga0373937_0193976 3300036401 Bacteria 1909
580 Ga0373937_0218547 3300036401 Bacteria 1793
581 Ga0373925_0002889 3300037068 Bacteria 13571
582 Ga0373925_0040234 3300037068 Bacteria 3460
583 Ga0373925_0110612 3300037068 Bacteria 2122
584 Ga0373925_0777110 3300037068 Bacteria 790
585 Ga0373925_1153276 3300037068 Bacteria 637
586 Ga0373925_1193750 3300037068 Bacteria 625
587 Ga0373925_1537367 3300037068 Bacteria 544
588 Ga0439461_0002213 3300041410 Bacteria 3086
589 Ga0451839_1400463 3300041496 Bacteria 1248
590 Ga0451845_0711978 3300041501 Bacteria 647
591 Ga0439441_002685 3300042001 Bacteria 2529
592 Ga0439441_013676 3300042001 Bacteria 1412
593 Ga0439443_012970 3300042003 Bacteria 1240
594 Ga0439454_015792 3300042011 Bacteria 1061
595 Ga0439456_014934 3300042013 Bacteria 1620
596 Ga0439463_145298 3300042016 Bacteria 615
597 Ga0450888_080082 3300042126 Unclassified 501
598 Ga0450910_040851 3300042147 Bacteria 749
599 Ga0439446_0000176 3300042156 Bacteria 11244
600 Ga0439446_0181296 3300042156 Unclassified 704
601 Ga0439434_0001633 3300042435 Bacteria 6483
602 Ga0439434_0063431 3300042435 Bacteria 1158
603 Ga0439435_0000026 3300042436 Bacteria 16073
604 Ga0439444_0003007 3300042437 Bacteria 2352
605 Ga0439464_0069306 3300042439 Bacteria 1042
606 Ga0439460_0044333 3300042461 Bacteria 1316
607 Ga0450918_100795 3300042531 Bacteria 565
608 Ga0451577_0050315 3300042876 Bacteria 3720
609 Ga0451577_0470068 3300042876 Bacteria 1142
610 Ga0466965_0165682 3300044683 Bacteria 1160
611 Ga0466963_0049527 3300044694 Bacteria 2779
612 Ga0466964_0004501 3300044706 Bacteria 5145
613 Ga0466964_0339405 3300044706 Bacteria 769
614 Ga0453684_0319001 3300044712 Bacteria 1761
615 Ga0453684_1389708 3300044712 Bacteria 729
616 Ga0451576_0001306 3300045051 Bacteria 43171
617 Ga0451576_0035821 3300045051 Bacteria 5262
618 Ga0451576_0146167 3300045051 Bacteria 2465
619 Ga0451576_0193274 3300045051 Bacteria 2125
620 Ga0451576_0311617 3300045051 Bacteria 1646
621 Ga0451576_0510906 3300045051 Bacteria 1262
622 Ga0451576_0679899 3300045051 Bacteria 1081
623 Ga0451576_0701437 3300045051 Bacteria 1063
624 Ga0451576_2583611 3300045051 Unclassified 518
625 Ga0466958_0145560 3300045836 Bacteria 1493
626 Ga0466967_0020049 3300045976 Bacteria 5393
627 Ga0495592_0003821 3300046454 Bacteria 10887
628 Ga0495592_0551946 3300046454 Bacteria 708
629 Ga0495603_0013943 3300046455 Bacteria 4860
630 Ga0495603_0607940 3300046455 Unclassified 626
631 Ga0495641_0235955 3300046461 Bacteria 821
632 Ga0495651_0279044 3300046462 Bacteria 1130
633 Ga0495651_0287408 3300046462 Bacteria 1108
634 Ga0495651_0343714 3300046462 Bacteria 988
635 Ga0495653_0132467 3300046463 Bacteria 1763
636 Ga0495653_0586168 3300046463 Unclassified 687
637 Ga0495580_0033208 3300046472 Bacteria 3719
638 Ga0495582_0018968 3300046473 Bacteria 3764
639 Ga0495639_0022242 3300046475 Bacteria 2781
640 Ga0495639_0058813 3300046475 Bacteria 1759
641 Ga0495662_0008976 3300046476 Bacteria 4910
642 Ga0495664_0258423 3300046477 Bacteria 1053
643 Ga0495584_0072974 3300046491 Bacteria 1725
644 Ga0495594_0264567 3300046499 Bacteria 979
645 Ga0495608_0002044 3300046511 Bacteria 14501
646 Ga0495608_0418106 3300046511 Bacteria 818
647 Ga0495618_0022560 3300046514 Bacteria 3888
648 Ga0495628_0016487 3300046516 Bacteria 6161
649 Ga0495628_0453205 3300046516 Bacteria 931
650 Ga0495630_0001185 3300046517 Bacteria 17975
651 Ga0495630_0039270 3300046517 Bacteria 3540
652 Ga0495630_0622469 3300046517 Bacteria 827
653 Ga0495666_0003317 3300046526 Bacteria 8133
654 Ga0495642_0199025 3300046528 Bacteria 873
655 Ga0495642_0257853 3300046528 Bacteria 762
656 Ga0495652_0033401 3300046529 Bacteria 4491
657 Ga0495652_0180923 3300046529 Bacteria 1618
658 Ga0495665_0309752 3300046531 Bacteria 807
659 Ga0495640_0000808 3300046533 Bacteria 23777
660 Ga0495640_0004665 3300046533 Bacteria 10928
661 Ga0495640_0582423 3300046533 Unclassified 677
662 Ga0495586_0000440 3300046535 Bacteria 24985
663 Ga0495586_0009939 3300046535 Bacteria 5068
664 Ga0495586_0028778 3300046535 Bacteria 2973
665 Ga0495598_0037970 3300046537 Bacteria 1392
666 Ga0495598_0103180 3300046537 Bacteria 946
667 Ga0495598_0163324 3300046537 Bacteria 785
668 Ga0495598_0295255 3300046537 Bacteria 612
669 Ga0495621_0029158 3300046539 Bacteria 1880
670 Ga0495621_0058828 3300046539 Bacteria 1391
671 Ga0495645_0274616 3300046543 Bacteria 1111
672 Ga0495622_0300432 3300046557 Bacteria 700
673 Ga0495633_0375027 3300046558 Bacteria 644
674 Ga0495667_0001153 3300046559 Bacteria 17225
675 Ga0495667_0192726 3300046559 Bacteria 1306
676 Ga0495667_0230699 3300046559 Bacteria 1180
677 Ga0495656_0225811 3300046615 Bacteria 938
678 Ga0495634_0002587 3300046642 Bacteria 14917
679 Ga0495634_0091842 3300046642 Bacteria 1970
680 Ga0495635_0097799 3300046663 Bacteria 2006
681 Ga0495635_0132240 3300046663 Bacteria 1701
682 Ga0495659_0051963 3300046664 Bacteria 1494
683 Ga0495588_0078511 3300046674 Bacteria 1722
684 Ga0495657_0302645 3300046675 Bacteria 953
685 Ga0495657_0825119 3300046675 Bacteria 529
686 Ga0495599_0007763 3300046678 Bacteria 6512
687 Ga0495647_0049604 3300046681 Bacteria 1626
688 Ga0495647_0419253 3300046681 Bacteria 617
689 Ga0495658_0004220 3300046683 Bacteria 7071
690 Ga0495658_0172434 3300046683 Bacteria 1339
691 Ga0495669_0004311 3300046684 Bacteria 5870
692 Ga0495613_0025295 3300046689 Bacteria 4423
693 Ga0495624_0034028 3300046690 Bacteria 3299
694 Ga0495624_0199350 3300046690 Bacteria 1216
695 Ga0495600_0008016 3300046809 Bacteria 6473
696 Ga0495581_0175427 3300047315 Bacteria 1253
697 Ga0495604_0002447 3300047317 Bacteria 14851
698 Ga0495604_0100700 3300047317 Bacteria 2124
699 Ga0495604_0134414 3300047317 Bacteria 1774
700 Ga0495636_0133687 3300047318 Bacteria 1104
701 Ga0495636_0312728 3300047318 Bacteria 736
702 Ga0495636_0609051 3300047318 Unclassified 534
703 Ga0495636_0699755 3300047318 Bacteria 500
704 Ga0495674_0123030 3300047319 Bacteria 2191
705 Ga0495674_0285677 3300047319 Bacteria 1351
706 Ga0495676_0019304 3300047321 Bacteria 5998
707 Ga0495680_0001572 3300047322 Bacteria 24459
708 Ga0495680_0296405 3300047322 Bacteria 1136
709 Ga0495675_0319881 3300047444 Bacteria 918
710 Ga0495675_0528769 3300047444 Bacteria 674
711 Ga0495677_0263386 3300047445 Bacteria 675
712 Ga0495684_0018458 3300047471 Bacteria 5374
713 Ga0495614_0339553 3300048089 Bacteria 699
714 Ga0495614_0425781 3300048089 Unclassified 626
715 Ga0496100_0285861 3300048903 Unclassified 1231
716 Ga0496101_0367531 3300048904 Unclassified 1131
717 Ga0496104_0797108 3300048907 Bacteria 851
718 Ga0496106_0074134 3300048909 Bacteria 2605
719 Ga0496114_0093146 3300048917 Bacteria 2561
720 Ga0501291_091408 3300049514 Bacteria 622
721 Ga0501292_036836 3300049515 Bacteria 836
722 Ga0501296_013948 3300049519 Bacteria 982
723 Ga0501296_045493 3300049519 Bacteria 630
724 Ga0501298_014855 3300049521 Bacteria 1396
725 Ga0501299_005994 3300049522 Bacteria 1892
726 Ga0501299_021606 3300049522 Bacteria 1181
727 Ga0501299_172976 3300049522 Bacteria 559
728 Ga0501031_0283837 3300049568 Bacteria 1074
729 Ga0501031_0837714 3300049568 Bacteria 589
730 Ga0501032_0400987 3300049569 Bacteria 881
731 Ga0501036_0518807 3300049572 Bacteria 991
732 Ga0501036_1198192 3300049572 Bacteria 619
733 Ga0501037_0481448 3300049573 Bacteria 844
734 Ga0501038_0427688 3300049574 Bacteria 1021
735 Ga0501038_0746776 3300049574 Bacteria 730
736 Ga0501039_0085414 3300049575 Bacteria 2458
737 Ga0501039_0174792 3300049575 Bacteria 1689
738 Ga0501039_0344457 3300049575 Bacteria 1171
739 Ga0501040_0016065 3300049576 Bacteria 4951
740 Ga0501040_0263815 3300049576 Bacteria 1229
741 Ga0501040_0541392 3300049576 Bacteria 840
742 Ga0501040_1325192 3300049576 Bacteria 522
743 Ga0501041_0441151 3300049577 Bacteria 826
744 Ga0501041_0767380 3300049577 Bacteria 618
745 Ga0501042_0341249 3300049578 Bacteria 1083
746 Ga0501042_0444854 3300049578 Bacteria 940
747 Ga0501042_1199542 3300049578 Bacteria 553
748 Ga0501042_1367739 3300049578 Bacteria 516
749 Ga0501043_0238284 3300049579 Bacteria 1404
750 Ga0501046_0484505 3300049580 Bacteria 887
751 Ga0501047_0875526 3300049581 Bacteria 712
752 Ga0501048_0171493 3300049582 Bacteria 1537
753 Ga0501048_0762931 3300049582 Unclassified 695
754 Ga0501048_1266525 3300049582 Unclassified 530
755 Ga0501048_1283986 3300049582 Unclassified 526
756 Ga0501068_0258697 3300049584 Bacteria 1110
757 Ga0501068_1186248 3300049584 Bacteria 506
758 Ga0501069_0086665 3300049585 Bacteria 1768
759 Ga0501069_0106646 3300049585 Bacteria 1593
760 Ga0501069_0890123 3300049585 Bacteria 541
761 Ga0501071_0264776 3300049587 Bacteria 1299
762 Ga0501071_0574110 3300049587 Bacteria 866
763 Ga0501071_0667808 3300049587 Bacteria 800
764 Ga0501071_1107370 3300049587 Bacteria 612
765 Ga0501071_1191915 3300049587 Bacteria 588
766 Ga0501071_1448855 3300049587 Bacteria 530
767 Ga0501072_0060734 3300049588 Bacteria 2980
768 Ga0501072_0189057 3300049588 Bacteria 1642
769 Ga0501072_0328206 3300049588 Bacteria 1216
770 Ga0501072_0953160 3300049588 Bacteria 669
771 Ga0501072_1019118 3300049588 Bacteria 645
772 Ga0501073_1257108 3300049589 Bacteria 508
773 Ga0501074_0981525 3300049590 Bacteria 594
774 Ga0501074_0983563 3300049590 Bacteria 593
775 Ga0501075_0161351 3300049591 Bacteria 1710
776 Ga0501075_0172967 3300049591 Bacteria 1648
777 Ga0501076_0224034 3300049592 Unclassified 1537
778 Ga0501076_0980119 3300049592 Bacteria 696
779 Ga0501077_0312874 3300049593 Bacteria 1001
780 Ga0501216_057812 3300049660 Bacteria 776
781 Ga0501217_212610 3300049661 Bacteria 608
782 Ga0501233_018696 3300049668 Bacteria 1460
783 Ga0501257_132602 3300049686 Bacteria 675
784 Ga0501080_0465462 3300049742 Bacteria 1132
785 Ga0501080_1221096 3300049742 Unclassified 646
786 Ga0501081_0186035 3300049743 Bacteria 1503
787 Ga0501081_1124917 3300049743 Bacteria 594
788 Ga0501283_012493 3300049779 Bacteria 1277
789 Ga0501035_0344705 3300049822 Bacteria 1248
790 Ga0501045_0245273 3300049824 Bacteria 1333
791 Ga0501045_0611365 3300049824 Bacteria 807
792 Ga0501045_0765153 3300049824 Bacteria 711
793 Ga0501045_1167805 3300049824 Bacteria 562
794 Ga0501045_1238818 3300049824 Bacteria 544
795 Ga0501045_1278336 3300049824 Bacteria 534
796 nmdc:mga06z11_390846_c1 3300050494 Bacteria 836
797 nmdc:mga05p37_1264825_c1 3300050507 Unclassified 756
798 nmdc:mga05p37_1668226_c1 3300050507 Bacteria 623
799 nmdc:mga05p37_1692350_c1 3300050507 Bacteria 617
800 nmdc:mga05p37_1796511_c1 3300050507 Bacteria 592
801 nmdc:mga05p37_1807699_c1 3300050507 Bacteria 589
802 nmdc:mga05p37_320641_c1 3300050507 Bacteria 1834
803 nmdc:mga05p37_3367_c1 3300050507 Bacteria 18658
804 nmdc:mga09592_103435_c1 3300050508 Bacteria 2440
805 nmdc:mga09592_106007_c1 3300050508 Bacteria 2410
806 nmdc:mga09592_1741425_c1 3300050508 Bacteria 502
807 nmdc:mga09592_235628_c1 3300050508 Bacteria 1586
808 nmdc:mga09592_646_c1 3300050508 Bacteria 26554
809 nmdc:mga09592_81062_c1 3300050508 Bacteria 2765
810 nmdc:mga0qj67_207274_c1 3300050509 Bacteria 1592
811 nmdc:mga0qj67_248854_c1 3300050509 Bacteria 1442
812 nmdc:mga0qj67_271612_c1 3300050509 Bacteria 1375
813 nmdc:mga0qj67_408212_c1 3300050509 Unclassified 1096
814 nmdc:mga0qj67_512293_c1 3300050509 Bacteria 964
815 nmdc:mga0qj67_52148_c1 3300050509 Bacteria 3237
816 nmdc:mga0qj67_623_c1 3300050509 Bacteria 24285
817 nmdc:mga06r32_133999_c1 3300050510 Bacteria 2452
818 nmdc:mga06r32_1401902_c1 3300050510 Bacteria 641
819 nmdc:mga06r32_1679372_c1 3300050510 Bacteria 572
820 nmdc:mga06r32_301273_c1 3300050510 Bacteria 1589
821 nmdc:mga06r32_513920_c1 3300050510 Bacteria 1174
822 nmdc:mga06r32_58630_c1 3300050510 Bacteria 3700
823 nmdc:mga06r32_7083_c1 3300050510 Bacteria 10092
824 nmdc:mga08y16_115323_c1 3300050511 Bacteria 2797
825 nmdc:mga08y16_117352_c1 3300050511 Bacteria 2770
826 nmdc:mga08y16_1209_c1 3300050511 Bacteria 25503
827 nmdc:mga08y16_124404_c1 3300050511 Bacteria 2683
828 nmdc:mga08y16_1301843_c1 3300050511 Bacteria 693
829 nmdc:mga08y16_1772955_c1 3300050511 Unclassified 571
830 nmdc:mga08y16_26333_c1 3300050511 Bacteria 6132
831 nmdc:mga08y16_27053_c1 3300050511 Bacteria 6045
832 nmdc:mga08y16_36047_c1 3300050511 Bacteria 5194
833 nmdc:mga08y16_419359_c1 3300050511 Bacteria 1368
834 nmdc:mga0n895_1176724_c1 3300050512 Bacteria 741
835 nmdc:mga0n895_1336_c1 3300050512 Bacteria 18273
836 nmdc:mga0n895_1563_c1 3300050512 Bacteria 17209
837 nmdc:mga0n895_1572399_c1 3300050512 Bacteria 622
838 nmdc:mga0n895_4259_c1 3300050512 Bacteria 11704
839 nmdc:mga0n895_6387_c1 3300050512 Bacteria 10005
840 nmdc:mga0rr50_1001979_c1 3300050513 Unclassified 712
841 nmdc:mga0rr50_11005_c1 3300050513 Bacteria 5769
842 nmdc:mga0rr50_1230403_c1 3300050513 Bacteria 636
843 nmdc:mga0rr50_1308241_c1 3300050513 Bacteria 615
844 nmdc:mga0rr50_170783_c1 3300050513 Bacteria 1772
845 nmdc:mga0rr50_258537_c1 3300050513 Bacteria 1448
846 nmdc:mga0rr50_35369_c1 3300050513 Bacteria 3587
847 nmdc:mga0rr50_569532_c1 3300050513 Bacteria 965
848 nmdc:mga08x19_142786_c1 3300050514 Bacteria 1618
849 nmdc:mga08x19_22439_c1 3300050514 Bacteria 3909
850 nmdc:mga08x19_23150_c1 3300050514 Bacteria 3853
851 nmdc:mga08x19_263437_c1 3300050514 Bacteria 1192
852 nmdc:mga08x19_2829_c1 3300050514 Bacteria 10472
853 nmdc:mga08x19_513020_c1 3300050514 Bacteria 847
854 nmdc:mga08x19_55_c1 3300050514 Bacteria 120851
855 nmdc:mga08x19_670353_c1 3300050514 Bacteria 736
856 nmdc:mga0a205_283089_c1 3300050515 Bacteria 1533
857 nmdc:mga0a205_38464_c1 3300050515 Bacteria 4603
858 nmdc:mga0a205_589984_c1 3300050515 Bacteria 965
859 nmdc:mga0a205_935_c1 3300050515 Bacteria 24102
860 Ga0495601_0005497 3300053077 Bacteria 7389
861 Ga0495601_0083732 3300053077 Bacteria 2049
862 Ga0495601_0630251 3300053077 Bacteria 687
863 Ga0495595_0520309 3300053084 Unclassified 607
864 Ga0500566_0122685 3300053094 Bacteria 1399
865 Ga0501084_0616219 3300054114 Bacteria 917
866 Ga0501084_1292809 3300054114 Bacteria 611
867 Ga0590077_050692 3300059426 Bacteria 931
868 Ga0501082_0336784 3300060353 Bacteria 1315
869 Ga0501082_0920350 3300060353 Bacteria 765
870 Ga0501082_1618964 3300060353 Bacteria 565
871 Ga0316574_0801827
872 JGI25406J46586_10035649
873 rootL2_10010637
874 rootH1_10178713
875 JGI26133J50247_101018
876 Ga0055529_1000015
877 Ga0058860_11658417
878 Ga0058862_10871056
879 Ga0065712_10380110
880 Ga0065707_10028465
881 Ga0070676_10759131
882 Ga0070683_100228472
883 Ga0070683_101622413
884 Ga0070690_100000197
885 Ga0070690_100664488
886 Ga0070690_101016336
887 Ga0070690_101091112
888 Ga0070670_100290586
889 Ga0070670_100899990
890 Ga0070670_101506574
891 Ga0068869_100000214
892 Ga0068869_100063874
893 Ga0068869_100229020
894 Ga0070666_10263580
895 Ga0070680_100005842
896 Ga0070680_100061318
897 Ga0070680_100189194
898 Ga0070682_100003738
899 Ga0068868_100000375
900 Ga0068868_101098168
901 Ga0068868_101890732
902 Ga0070689_100000107
903 Ga0070689_100065511
904 Ga0070689_100214699
905 Ga0070689_100357767
906 Ga0070689_100727136
907 Ga0070689_100840768
908 Ga0070689_101641949
909 Ga0070691_10000220
910 Ga0070691_10219666
911 Ga0070691_10860537
912 Ga0070687_100000669
913 Ga0070687_100128970
914 Ga0070687_100159616
915 Ga0070687_100253395
916 Ga0070687_100673294
917 Ga0070692_10005331
918 Ga0070692_10779827
919 Ga0070669_101040733
920 Ga0070675_100345976
921 Ga0070675_100705968
922 Ga0070675_101221138
923 Ga0070674_100664544
924 Ga0070673_100266246
925 Ga0070673_100467413
926 Ga0070673_100765611
927 Ga0070673_100892420
928 Ga0070688_100033844
929 Ga0070688_101569673
930 Ga0070659_100519794
931 Ga0070703_10004630
932 Ga0070703_10142223
933 Ga0070709_10519574
934 Ga0070714_100011982
935 Ga0070713_100399710
936 Ga0070713_102422813
937 Ga0070710_10437408
938 Ga0070701_10000396
939 Ga0070701_10130788
940 Ga0070711_101262697
941 Ga0070705_100027892
942 Ga0070705_100075566
943 Ga0070705_100721539
944 Ga0070705_101319470
945 Ga0070700_100000633
946 Ga0070700_100103026
947 Ga0070700_100111705
948 Ga0070700_100216498
949 Ga0070700_100263736
950 Ga0070700_100360890
951 Ga0070700_100721722
952 Ga0070694_100000126
953 Ga0070694_100017277
954 Ga0070694_100057979
955 Ga0070694_100077882
956 Ga0070694_100266507
957 Ga0070694_100391685
958 Ga0070694_100563404
959 Ga0070694_101758613
960 Ga0070708_100319275
961 Ga0070708_101109277
962 Ga0070708_101631857
963 Ga0070678_100030611
964 Ga0070681_10000399
965 Ga0070681_10338742
966 Ga0070681_10414874
967 Ga0070681_10912559
968 Ga0068867_100000032
969 Ga0068867_100846461
970 Ga0070707_100726748
971 Ga0070707_100753833
972 Ga0070707_100798163
973 Ga0070707_101083333
974 Ga0070698_100162623
975 Ga0070698_101948042
976 Ga0070699_100015187
977 Ga0070699_100102761
978 Ga0070699_100998981
979 Ga0070679_100108511
980 Ga0070679_101063904
981 Ga0070684_100874045
982 Ga0070684_101303839
983 Ga0070697_100000648
984 Ga0070697_100249725
985 Ga0070697_100663479
986 Ga0070697_101303123
987 Ga0068853_100191540
988 Ga0070672_100786395
989 Ga0070686_100000253
990 Ga0070686_100227621
991 Ga0070686_100533516
992 Ga0070686_100625088
993 Ga0070686_100886077
994 Ga0070686_100969123
995 Ga0070695_100000197
996 Ga0070695_100000362
997 Ga0070695_100045316
998 Ga0070695_100164586
999 Ga0070695_100246385
1000 Ga0070695_100293197
1001 Ga0070695_100831223
1002 Ga0070695_101127588
1003 Ga0070695_101443105
1004 Ga0070695_101616568
1005 Ga0070696_100000089
1006 Ga0070696_100000482
1007 Ga0070696_100002485
1008 Ga0070696_100166322
1009 Ga0070696_100471717
1010 Ga0070696_100603027
1011 Ga0070696_100717106
1012 Ga0070693_100000400
1013 Ga0070693_100168146
1014 Ga0070704_100000017
1015 Ga0070704_100009024
1016 Ga0070704_100025353
1017 Ga0070704_100421993
1018 Ga0070704_100623839
1019 Ga0070704_100791533
1020 Ga0068855_100002377
1021 Ga0068855_101574544
1022 Ga0068857_100997366
1023 Ga0068857_102182359
1024 Ga0068854_100022368
1025 Ga0068854_102014307
1026 Ga0068856_100142277
1027 Ga0070702_100000001
1028 Ga0070702_100018216
1029 Ga0070702_100239864
1030 Ga0068859_100000149
1031 Ga0068859_100249647
1032 Ga0068859_101059047
1033 Ga0068859_101070061
1034 Ga0068864_100009007
1035 Ga0068864_100082993
1036 Ga0068864_102069581
1037 Ga0068866_10000326
1038 Ga0068861_100000428
1039 Ga0068861_100128148
1040 Ga0068861_100326403
1041 Ga0068870_10492096
1042 Ga0068863_100262007
1043 Ga0068863_100283339
1044 Ga0068863_100299836
1045 Ga0068863_102046408
1046 Ga0068858_100002902
1047 Ga0068858_100615355
1048 Ga0068858_101160466
1049 Ga0068860_100001090
1050 Ga0068860_100894234
1051 Ga0068862_100000409
1052 Ga0081538_10152692
1053 Ga0081539_10000686
1054 Ga0070715_10229490
1055 Ga0070716_100101869
1056 Ga0070716_100445383
1057 Ga0075367_10815908
1058 Ga0097621_100000928
1059 Ga0068871_100011561
1060 Ga0068871_101248038
1061 Ga0068871_101409027
1062 Ga0068871_101459461
1063 Ga0075428_100000083
1064 Ga0075428_100040406
1065 Ga0075428_100214190
1066 Ga0075428_100456878
1067 Ga0075430_100000550
1068 Ga0075430_100007696
1069 Ga0075430_100189368
1070 Ga0075430_100341025
1071 Ga0075430_100438589
1072 Ga0075430_100483458
1073 Ga0075430_100537999
1074 Ga0075430_100776711
1075 Ga0075430_100852917
1076 Ga0075431_100016437
1077 Ga0075431_100123948
1078 Ga0075431_100353925
1079 Ga0075431_100397211
1080 Ga0075431_100443596
1081 Ga0075431_100522127
1082 Ga0075431_100656026
1083 Ga0075433_10033239
1084 Ga0075433_10164444
1085 Ga0075433_11086754
1086 Ga0075434_100000011
1087 Ga0075434_100005363
1088 Ga0075434_100007734
1089 Ga0075434_100266698
1090 Ga0075434_101385976
1091 Ga0075429_100000480
1092 Ga0075429_100069548
1093 Ga0075429_100072951
1094 Ga0075429_100226541
1095 Ga0075429_100254048
1096 Ga0075429_101078498
1097 Ga0075429_101344870
1098 Ga0068865_100000059
1099 Ga0075436_100003220
1100 Ga0075436_100004494
1101 Ga0075436_100014323
1102 Ga0075436_100042934
1103 Ga0075436_100164546
1104 Ga0075436_100166596
1105 Ga0075436_100504715
1106 Ga0075436_100606801
1107 Ga0097620_100000149
1108 Ga0097620_100249643
1109 Ga0097620_101059077
1110 Ga0097620_101070087
1111 Ga0075435_100000388
1112 Ga0075435_100029181
1113 Ga0075435_100060020
1114 Ga0075435_100129605
1115 Ga0075435_100663288
1116 Ga0075435_100723078
1117 Ga0075435_100772429
1118 Ga0099794_10015782
1119 Ga0099794_10022481
1120 Ga0099794_10415968
1121 Ga0099794_10421351
1122 Ga0105251_10643320
1123 Ga0105244_10492227
1124 Ga0105240_10540267
1125 Ga0111539_10016381
1126 Ga0111539_10026004
1127 Ga0111539_10038453
1128 Ga0111539_10039269
1129 Ga0111539_10070916
1130 Ga0111539_10150838
1131 Ga0111539_10693456
1132 Ga0111539_10958092
1133 Ga0111539_11783976
1134 Ga0111539_13494213
1135 Ga0105245_10000075
1136 Ga0105245_11176772
1137 Ga0114129_10000210
1138 Ga0114129_10634184
1139 Ga0114129_10961706
1140 Ga0114129_11130110
1141 Ga0114129_11193197
1142 Ga0114129_11433701
1143 Ga0114129_11444908
1144 Ga0114129_11946484
1145 Ga0114129_12507585
1146 Ga0114129_12724503
1147 Ga0105243_10000622
1148 Ga0105243_10010536
1149 Ga0105243_12273446
1150 Ga0105241_10084412
1151 Ga0105242_10000407
1152 Ga0105242_10372148
1153 Ga0105242_12061126
1154 Ga0105248_10217743
1155 Ga0105248_10414506
1156 Ga0105248_10838385
1157 Ga0105249_10002440
1158 Ga0105249_10004477
1159 Ga0105249_12614768
1160 Ga0105239_10111905
1161 Ga0105246_12265558
1162 Ga0157335_1035026
1163 Ga0157378_10000074
1164 Ga0157378_12532270
1165 Ga0163162_10757695
1166 Ga0163162_13341312
1167 Ga0157372_10357574
1168 Ga0157375_11045777
1169 Ga0157375_11079065
1170 Ga0157380_10001505
1171 Ga0157380_10103645
1172 Ga0157380_10907627
1173 Ga0157377_10065103
1174 Ga0157377_11447566
1175 Ga0157379_10879275
1176 Ga0157376_10021663
1177 Ga0163161_10691716
1178 Ga0209437_119409
1179 Ga0209455_1000031
1180 Ga0207653_10004464
1181 Ga0207692_10248029
1182 Ga0207642_10004209
1183 Ga0207688_10030324
1184 Ga0207688_10059207
1185 Ga0207688_10740502
1186 Ga0207680_10244047
1187 Ga0207647_10657704
1188 Ga0207685_10496850
1189 Ga0207645_10263795
1190 Ga0207645_10270574
1191 Ga0207643_10428606
1192 Ga0207654_10022847
1193 Ga0207707_10003163
1194 Ga0207707_10210452
1195 Ga0207707_10440915
1196 Ga0207707_10651865
1197 Ga0207695_11243277
1198 Ga0207663_10251923
1199 Ga0207663_10448430
1200 Ga0207663_10511958
1201 Ga0207660_10078664
1202 Ga0207660_10626293
1203 Ga0207660_10720685
1204 Ga0207660_10863670
1205 Ga0207662_10000315
1206 Ga0207662_10129249
1207 Ga0207662_10171434
1208 Ga0207662_10173077
1209 Ga0207662_10283799
1210 Ga0207662_10543112
1211 Ga0207649_11439209
1212 Ga0207646_10404443
1213 Ga0207646_10663526
1214 Ga0207681_10248018
1215 Ga0207650_11534089
1216 Ga0207659_10068577
1217 Ga0207659_11884448
1218 Ga0207687_10001426
1219 Ga0207687_11552174
1220 Ga0207700_10760973
1221 Ga0207700_11624483
1222 Ga0207664_10398785
1223 Ga0207644_10029941
1224 Ga0207686_10000243
1225 Ga0207686_10753542
1226 Ga0207709_10001387
1227 Ga0207670_10001067
1228 Ga0207670_10108375
1229 Ga0207670_10127750
1230 Ga0207670_10334710
1231 Ga0207670_10352382
1232 Ga0207670_11394570
1233 Ga0207669_10659205
1234 Ga0207704_10018253
1235 Ga0207704_11779416
1236 Ga0207665_10132548
1237 Ga0207665_10144714
1238 Ga0207665_10317248
1239 Ga0207711_10618201
1240 Ga0207711_11811618
1241 Ga0207689_10000007
1242 Ga0207689_10097695
1243 Ga0207689_10259174
1244 Ga0207689_10562218
1245 Ga0207661_10116956
1246 Ga0207661_11151068
1247 Ga0207667_10077643
1248 Ga0207667_11302905
1249 Ga0207651_10195881
1250 Ga0207651_10251540
1251 Ga0207651_11099234
1252 Ga0207712_10002821
1253 Ga0207668_11245685
1254 Ga0207640_10015170
1255 Ga0207677_10000823
1256 Ga0207677_10335847
1257 Ga0207677_10919033
1258 Ga0207703_10102600
1259 Ga0207703_10345945
1260 Ga0207639_10520357
1261 Ga0207708_10000086
1262 Ga0207708_10113450
1263 Ga0207708_10202555
1264 Ga0207708_10251397
1265 Ga0207708_10354104
1266 Ga0207708_10561004
1267 Ga0207708_11288530
1268 Ga0207708_11522484
1269 Ga0207708_11779641
1270 Ga0207702_10145265
1271 Ga0207641_10161054
1272 Ga0207641_10225916
1273 Ga0207641_10312390
1274 Ga0207641_10423615
1275 Ga0207648_10000079
1276 Ga0207648_10377073
1277 Ga0207648_11126314
1278 Ga0207648_12189534
1279 Ga0207676_10037278
1280 Ga0207676_10321696
1281 Ga0207674_10159116
1282 Ga0207675_100000093
1283 Ga0207675_100144068
1284 Ga0207675_100654318
1285 Ga0207675_100829724
1286 Ga0207683_10327647
1287 Ga0209969_1000430
1288 Ga0209969_1001086
1289 Ga0209969_1003617
1290 Ga0209969_1016600
1291 Ga0209967_1000417
1292 Ga0209967_1001327
1293 Ga0209967_1003025
1294 Ga0209981_1001444
1295 Ga0209981_1001566
1296 Ga0209981_1010103
1297 Ga0209981_1021781
1298 Ga0209996_1026728
1299 Ga0209996_1060653
1300 Ga0210000_1000446
1301 Ga0210000_1001892
1302 Ga0210000_1002212
1303 Ga0210000_1042787
1304 Ga0209995_1000255
1305 Ga0209995_1001597
1306 Ga0209995_1007282
1307 Ga0209995_1028014
1308 Ga0209968_1002375
1309 Ga0209968_1003221
1310 Ga0209968_1018430
1311 Ga0209968_1065309
1312 Ga0209999_1000334
1313 Ga0209999_1007955
1314 Ga0209999_1032187
1315 Ga0209999_1042378
1316 Ga0209983_1052129
1317 Ga0209588_1045166
1318 Ga0209588_1259659
1319 Ga0209971_1007609
1320 Ga0209971_1010313
1321 Ga0209966_1005660
1322 Ga0209966_1016285
1323 Ga0209998_10031398
1324 Ga0209974_10001421
1325 Ga0209974_10009715
1326 Ga0209974_10032169
1327 Ga0209974_10169376
1328 Ga0207428_10000321
1329 Ga0207428_10024838
1330 Ga0207428_10062422
1331 Ga0207428_10142297
1332 Ga0207428_10214049
1333 Ga0207428_10534253
1334 Ga0268265_10003346
1335 Ga0268265_10551255
1336 Ga0268264_10001077
1337 Ga0268264_10231781
1338 Ga0268264_11229884
1339 Ga0307408_100164000
1340 Ga0307408_100481287
1341 Ga0307408_100759153
1342 Ga0307408_101274824
1343 Ga0307408_101627004
1344 Ga0307408_101637079
1345 Ga0307405_10174146
1346 Ga0307410_11808088
1347 Ga0307406_10641146
1348 Ga0307407_10873038
1349 Ga0307412_10106667
1350 Ga0307412_10197098
1351 Ga0307412_10733636
1352 Ga0307412_10972524
1353 Ga0307409_102277653
1354 Ga0307416_100183675
1355 Ga0307416_100343938
1356 Ga0307416_100474965
1357 Ga0307416_101611686
1358 Ga0307416_101652519
1359 Ga0307411_10349598
1360 Ga0307411_10466326
1361 Ga0307411_10887640
1362 Ga0307411_11016350
1363 Ga0307411_11147741
1364 Ga0307411_11583439
1365 Ga0307411_11747277
1366 Ga0316583_10124335
1367 Ga0373948_0043427
1368 Ga0373938_0077990
1369 Ga0373926_0037450
1370 Ga0373928_0001275
1371 Ga0373928_0033048
1372 Ga0373928_0176903
1373 Ga0373929_0110196
1374 Ga0373929_0154870
1375 Ga0373929_0234115
1376 Ga0373934_0018623
1377 Ga0373934_0327756
1378 Ga0373940_0069540
1379 Ga0373940_0242819
1380 Ga0373944_0007607
1381 Ga0373944_0032245
1382 Ga0373949_0135679
1383 Ga0373949_0241556
1384 Ga0373951_0082723
1385 Ga0373951_0187381
1386 Ga0373952_0001950
1387 Ga0373952_0163933
1388 Ga0373952_0171573
1389 Ga0373923_0079537
1390 Ga0373923_0303738
1391 Ga0373932_0002438
1392 Ga0373932_0133532
1393 Ga0373932_0231573
1394 Ga0373936_0029588
1395 Ga0373936_0252223
1396 Ga0373936_0348296
1397 Ga0373939_0002522
1398 Ga0373939_0136570
1399 Ga0373941_0031727
1400 Ga0373941_0113920
1401 Ga0373941_0300139
1402 Ga0373945_0001661
1403 Ga0373953_0002608
1404 Ga0373954_0000002
1405 Ga0373954_0204650
1406 Ga0373956_0156368
1407 Ga0373956_0173831
1408 Ga0373957_0023276
1409 Ga0373960_0015187
1410 Ga0373960_0169062
1411 Ga0373960_0221428
1412 Ga0373943_0010824
1413 Ga0373943_0097712
1414 Ga0373943_0885911
1415 Ga0373946_0005645
1416 Ga0373946_0041970
1417 Ga0373955_0038672
1418 Ga0373955_0083592
1419 Ga0373955_0299717
1420 Ga0373955_0824571
1421 Ga0373942_0006452
1422 Ga0373942_0098176
1423 Ga0373961_0025476
1424 Ga0373961_0050216
1425 Ga0373962_0011183
1426 Ga0373962_0063589
1427 Ga0373924_0069540
1428 Ga0373924_0084250
1429 Ga0373924_0203820
1430 Ga0373924_0221463
1431 Ga0373931_0000265
1432 Ga0373931_0008664
1433 Ga0373931_0034304
1434 Ga0373931_0120090
1435 Ga0373931_0441787
1436 Ga0373935_0029727
1437 Ga0373935_0033469
1438 Ga0373935_0324545
1439 Ga0373927_0078223
1440 Ga0373927_0114908
1441 Ga0373933_0000657
1442 Ga0373933_0015090
1443 Ga0373933_0202219
1444 Ga0373947_0009354
1445 Ga0373947_0036354
1446 Ga0373947_1037173
1447 Ga0373937_0000358
1448 Ga0373937_0006046
1449 Ga0373937_0193976
1450 Ga0373937_0218547
1451 Ga0373925_0002889
1452 Ga0373925_0040234
1453 Ga0373925_0110612
1454 Ga0373925_0777110
1455 Ga0373925_1153276
1456 Ga0373925_1193750
1457 Ga0373925_1537367
1458 Ga0439461_0002213
1459 Ga0451839_1400463
1460 Ga0451845_0711978
1461 Ga0439441_002685
1462 Ga0439441_013676
1463 Ga0439443_012970
1464 Ga0439454_015792
1465 Ga0439456_014934
1466 Ga0439463_145298
1467 Ga0450888_080082
1468 Ga0450910_040851
1469 Ga0439446_0000176
1470 Ga0439446_0181296
1471 Ga0439434_0001633
1472 Ga0439434_0063431
1473 Ga0439435_0000026
1474 Ga0439444_0003007
1475 Ga0439464_0069306
1476 Ga0439460_0044333
1477 Ga0450918_100795
1478 Ga0451577_0050315
1479 Ga0451577_0470068
1480 Ga0466965_0165682
1481 Ga0466963_0049527
1482 Ga0466964_0004501
1483 Ga0466964_0339405
1484 Ga0453684_0319001
1485 Ga0453684_1389708
1486 Ga0451576_0001306
1487 Ga0451576_0035821
1488 Ga0451576_0146167
1489 Ga0451576_0193274
1490 Ga0451576_0311617
1491 Ga0451576_0510906
1492 Ga0451576_0679899
1493 Ga0451576_0701437
1494 Ga0451576_2583611
1495 Ga0466958_0145560
1496 Ga0466967_0020049
1497 Ga0495592_0003821
1498 Ga0495592_0551946
1499 Ga0495603_0013943
1500 Ga0495603_0607940
1501 Ga0495641_0235955
1502 Ga0495651_0279044
1503 Ga0495651_0287408
1504 Ga0495651_0343714
1505 Ga0495653_0132467
1506 Ga0495653_0586168
1507 Ga0495580_0033208
1508 Ga0495582_0018968
1509 Ga0495639_0022242
1510 Ga0495639_0058813
1511 Ga0495662_0008976
1512 Ga0495664_0258423
1513 Ga0495584_0072974
1514 Ga0495594_0264567
1515 Ga0495608_0002044
1516 Ga0495608_0418106
1517 Ga0495618_0022560
1518 Ga0495628_0016487
1519 Ga0495628_0453205
1520 Ga0495630_0001185
1521 Ga0495630_0039270
1522 Ga0495630_0622469
1523 Ga0495666_0003317
1524 Ga0495642_0199025
1525 Ga0495642_0257853
1526 Ga0495652_0033401
1527 Ga0495652_0180923
1528 Ga0495665_0309752
1529 Ga0495640_0000808
1530 Ga0495640_0004665
1531 Ga0495640_0582423
1532 Ga0495586_0000440
1533 Ga0495586_0009939
1534 Ga0495586_0028778
1535 Ga0495598_0037970
1536 Ga0495598_0103180
1537 Ga0495598_0163324
1538 Ga0495598_0295255
1539 Ga0495621_0029158
1540 Ga0495621_0058828
1541 Ga0495645_0274616
1542 Ga0495622_0300432
1543 Ga0495633_0375027
1544 Ga0495667_0001153
1545 Ga0495667_0192726
1546 Ga0495667_0230699
1547 Ga0495656_0225811
1548 Ga0495634_0002587
1549 Ga0495634_0091842
1550 Ga0495635_0097799
1551 Ga0495635_0132240
1552 Ga0495659_0051963
1553 Ga0495588_0078511
1554 Ga0495657_0302645
1555 Ga0495657_0825119
1556 Ga0495599_0007763
1557 Ga0495647_0049604
1558 Ga0495647_0419253
1559 Ga0495658_0004220
1560 Ga0495658_0172434
1561 Ga0495669_0004311
1562 Ga0495613_0025295
1563 Ga0495624_0034028
1564 Ga0495624_0199350
1565 Ga0495600_0008016
1566 Ga0495581_0175427
1567 Ga0495604_0002447
1568 Ga0495604_0100700
1569 Ga0495604_0134414
1570 Ga0495636_0133687
1571 Ga0495636_0312728
1572 Ga0495636_0609051
1573 Ga0495636_0699755
1574 Ga0495674_0123030
1575 Ga0495674_0285677
1576 Ga0495676_0019304
1577 Ga0495680_0001572
1578 Ga0495680_0296405
1579 Ga0495675_0319881
1580 Ga0495675_0528769
1581 Ga0495677_0263386
1582 Ga0495684_0018458
1583 Ga0495614_0339553
1584 Ga0495614_0425781
1585 Ga0496100_0285861
1586 Ga0496101_0367531
1587 Ga0496104_0797108
1588 Ga0496106_0074134
1589 Ga0496114_0093146
1590 Ga0501291_091408
1591 Ga0501292_036836
1592 Ga0501296_013948
1593 Ga0501296_045493
1594 Ga0501298_014855
1595 Ga0501299_005994
1596 Ga0501299_021606
1597 Ga0501299_172976
1598 Ga0501031_0283837
1599 Ga0501031_0837714
1600 Ga0501032_0400987
1601 Ga0501036_0518807
1602 Ga0501036_1198192
1603 Ga0501037_0481448
1604 Ga0501038_0427688
1605 Ga0501038_0746776
1606 Ga0501039_0085414
1607 Ga0501039_0174792
1608 Ga0501039_0344457
1609 Ga0501040_0016065
1610 Ga0501040_0263815
1611 Ga0501040_0541392
1612 Ga0501040_1325192
1613 Ga0501041_0441151
1614 Ga0501041_0767380
1615 Ga0501042_0341249
1616 Ga0501042_0444854
1617 Ga0501042_1199542
1618 Ga0501042_1367739
1619 Ga0501043_0238284
1620 Ga0501046_0484505
1621 Ga0501047_0875526
1622 Ga0501048_0171493
1623 Ga0501048_0762931
1624 Ga0501048_1266525
1625 Ga0501048_1283986
1626 Ga0501068_0258697
1627 Ga0501068_1186248
1628 Ga0501069_0086665
1629 Ga0501069_0106646
1630 Ga0501069_0890123
1631 Ga0501071_0264776
1632 Ga0501071_0574110
1633 Ga0501071_0667808
1634 Ga0501071_1107370
1635 Ga0501071_1191915
1636 Ga0501071_1448855
1637 Ga0501072_0060734
1638 Ga0501072_0189057
1639 Ga0501072_0328206
1640 Ga0501072_0953160
1641 Ga0501072_1019118
1642 Ga0501073_1257108
1643 Ga0501074_0981525
1644 Ga0501074_0983563
1645 Ga0501075_0161351
1646 Ga0501075_0172967
1647 Ga0501076_0224034
1648 Ga0501076_0980119
1649 Ga0501077_0312874
1650 Ga0501216_057812
1651 Ga0501217_212610
1652 Ga0501233_018696
1653 Ga0501257_132602
1654 Ga0501080_0465462
1655 Ga0501080_1221096
1656 Ga0501081_0186035
1657 Ga0501081_1124917
1658 Ga0501283_012493
1659 Ga0501035_0344705
1660 Ga0501045_0245273
1661 Ga0501045_0611365
1662 Ga0501045_0765153
1663 Ga0501045_1167805
1664 Ga0501045_1238818
1665 Ga0501045_1278336
1666 nmdc:mga06z11_390846_c1
1667 nmdc:mga05p37_1264825_c1
1668 nmdc:mga05p37_1668226_c1
1669 nmdc:mga05p37_1692350_c1
1670 nmdc:mga05p37_1796511_c1
1671 nmdc:mga05p37_1807699_c1
1672 nmdc:mga05p37_320641_c1
1673 nmdc:mga05p37_3367_c1
1674 nmdc:mga09592_103435_c1
1675 nmdc:mga09592_106007_c1
1676 nmdc:mga09592_1741425_c1
1677 nmdc:mga09592_235628_c1
1678 nmdc:mga09592_646_c1
1679 nmdc:mga09592_81062_c1
1680 nmdc:mga0qj67_207274_c1
1681 nmdc:mga0qj67_248854_c1
1682 nmdc:mga0qj67_271612_c1
1683 nmdc:mga0qj67_408212_c1
1684 nmdc:mga0qj67_512293_c1
1685 nmdc:mga0qj67_52148_c1
1686 nmdc:mga0qj67_623_c1
1687 nmdc:mga06r32_133999_c1
1688 nmdc:mga06r32_1401902_c1
1689 nmdc:mga06r32_1679372_c1
1690 nmdc:mga06r32_301273_c1
1691 nmdc:mga06r32_513920_c1
1692 nmdc:mga06r32_58630_c1
1693 nmdc:mga06r32_7083_c1
1694 nmdc:mga08y16_115323_c1
1695 nmdc:mga08y16_117352_c1
1696 nmdc:mga08y16_1209_c1
1697 nmdc:mga08y16_124404_c1
1698 nmdc:mga08y16_1301843_c1
1699 nmdc:mga08y16_1772955_c1
1700 nmdc:mga08y16_26333_c1
1701 nmdc:mga08y16_27053_c1
1702 nmdc:mga08y16_36047_c1
1703 nmdc:mga08y16_419359_c1
1704 nmdc:mga0n895_1176724_c1
1705 nmdc:mga0n895_1336_c1
1706 nmdc:mga0n895_1563_c1
1707 nmdc:mga0n895_1572399_c1
1708 nmdc:mga0n895_4259_c1
1709 nmdc:mga0n895_6387_c1
1710 nmdc:mga0rr50_1001979_c1
1711 nmdc:mga0rr50_11005_c1
1712 nmdc:mga0rr50_1230403_c1
1713 nmdc:mga0rr50_1308241_c1
1714 nmdc:mga0rr50_170783_c1
1715 nmdc:mga0rr50_258537_c1
1716 nmdc:mga0rr50_35369_c1
1717 nmdc:mga0rr50_569532_c1
1718 nmdc:mga08x19_142786_c1
1719 nmdc:mga08x19_22439_c1
1720 nmdc:mga08x19_23150_c1
1721 nmdc:mga08x19_263437_c1
1722 nmdc:mga08x19_2829_c1
1723 nmdc:mga08x19_513020_c1
1724 nmdc:mga08x19_55_c1
1725 nmdc:mga08x19_670353_c1
1726 nmdc:mga0a205_283089_c1
1727 nmdc:mga0a205_38464_c1
1728 nmdc:mga0a205_589984_c1
1729 nmdc:mga0a205_935_c1
1730 Ga0495601_0005497
1731 Ga0495601_0083732
1732 Ga0495601_0630251
1733 Ga0495595_0520309
1734 Ga0500566_0122685
1735 Ga0501084_0616219
1736 Ga0501084_1292809
1737 Ga0590077_050692
1738 Ga0501082_0336784
1739 Ga0501082_0920350
1740 Ga0501082_1618964

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04359

DUF493

Protein of unknown function (DUF493)

16

97

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wo1-assembly1.cif.gz_B hybrid acetohydroxyacid synthase complex structure with cryptococcus neoformans ahas catalytic subunit and saccharomyces cerevisiae ahas regulatory subunit 0.8812 14 90
6lxg-assembly1.cif.gz_B nmr solution structure of regulatory act domain of the mycobacterium tuberculosis rel protein 0.8741 14 90
5iqr-assembly1.cif.gz_8 error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8718 15 90
2pc6-assembly1.cif.gz_A crystal structure of putative acetolactate synthase- small subunit from nitrosomonas europaea 0.869 14 90
6u9h-assembly1.cif.gz_G arabidopsis thaliana acetohydroxyacid synthase complex 0.8664 15 90
ID Description Score Start End Superfamily
af_P0AG20_664_743_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9014 14 90 3.30.70.260
af_C6TJY5_99_186_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8993 12 90 3.30.70.260
af_Q2FXU1_650_729_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8985 14 90 3.30.70.260
af_Q2FWK5_1_78_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8947 14 90 3.30.70.260
af_P0AG24_623_702_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8929 14 90 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A521Z5A2-F1-model_v4 DUF493 domain-containing protein 1.001 22 90 GO:0005829
AF-A0A3N5WDV4-F1-model_v4 UPF0250 protein EHM16_10515 0.9919 10 90 GO:0005829
AF-I3CC02-F1-model_v4 UPF0250 protein BegalDRAFT_0223 0.9908 12 90 GO:0005829
AF-A0A7Y3JXD7-F1-model_v4 UPF0250 protein HKM01_02850 0.9903 12 90 GO:0005829
AF-A0A351MCM8-F1-model_v4 DUF493 domain-containing protein 0.9896 12 90 GO:0005829

Map