F484158
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 870 | 378 | 1740 | 312 |
Family's Representative Sequence
| Representative Sequence | 3300046692|Ga0495671_0039670|Ga0495671_0039670_510_1454 |
| Length | 314 |
| Sequence | MADSAFFCTLSHEGVLAVRGSDAGKFLQGQLTCNLNYVNDHTATLGARCTQKGRMQSSFRLLLEGDGCLLAMARELVEPQLADLKKYAVFSKSKLTDESAAWVRFGLSQGDTALAGLGLDLPQDVNAVARANGLIAVRVSPGRAELWAPADQASALQSSLNAQLAEGDLSAWLLGQVRAGIGQVMAQTRELFIPQMLNLQAVGGVSFKKGCYTGQEIVARMQYLGKLKRRQYRLELTGSELPEPGTPVFSPIHASAIGEVVLAAASAADRIELLAVLQAEAVEHGILHLGSLEGARVTLLDLPYELDRDREIQR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 21 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 22 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 23 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 24 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 25 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 26 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 34 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 41 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 42 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 43 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 44 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 55 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 57 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 59 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 71 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 72 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 73 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 74 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 75 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 76 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 77 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 78 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 79 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 80 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 81 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 82 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 83 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 84 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 85 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 86 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 87 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 88 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 89 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 90 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 91 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 92 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 93 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 94 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 95 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 96 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 97 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 98 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 99 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 100 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 101 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 102 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 103 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 104 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 105 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 183 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 184 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 185 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 186 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 187 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 188 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 189 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 190 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 191 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 192 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 193 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 194 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 195 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 196 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 197 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 200 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 201 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 202 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 203 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 204 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 205 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 206 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 207 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 208 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 209 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 210 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 211 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 212 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 213 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 214 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 215 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 216 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 217 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 218 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 219 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 220 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 221 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 222 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 223 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 224 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 225 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 226 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 227 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 228 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 229 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 230 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 231 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 232 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 233 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 234 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 235 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 236 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 237 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 238 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 239 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 240 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 241 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 242 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 243 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 244 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 245 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 246 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 247 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 248 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 249 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 250 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 251 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 252 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 253 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 254 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 255 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 256 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 257 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 258 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 259 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 260 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 261 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 262 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 263 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 264 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 265 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 266 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 267 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 268 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 269 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 270 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 271 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 272 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 273 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 274 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 275 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 276 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 277 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 278 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 279 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 280 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 281 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 282 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 283 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 284 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 285 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 286 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 287 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 288 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 289 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 290 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 291 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 292 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 293 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 294 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 295 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 296 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 297 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 298 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 299 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 300 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 301 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 302 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 303 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 304 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 305 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 306 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 307 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 308 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 309 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 310 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 311 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 312 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 313 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 314 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 315 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 316 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 317 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 318 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 319 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 320 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 321 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 322 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 323 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 324 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 325 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 326 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 327 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 328 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 329 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 330 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 331 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 332 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 333 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 334 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 335 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 336 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 337 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 338 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 339 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 340 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 341 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 342 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 343 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 344 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 345 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 346 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 347 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 348 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 349 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 350 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 351 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 352 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 353 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 354 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 355 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 356 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 357 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 358 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 359 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 360 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 361 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 362 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 363 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 364 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 365 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 366 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 367 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 368 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 369 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 370 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 371 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 372 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 373 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 374 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 375 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 376 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 377 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 378 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.54 |
| Metatranscriptomes | 0 |
| Isolates | 20.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.44 |
| Nodule | 2.64 |
| Rhizoplane | 7.13 |
| Rhizosphere | 73.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495671_0039670 | 3300046692 | Bacteria | 2377 |
| 2 | MRS2a_Contig_27 | 2124908027 | Bacteria | 53155 |
| 3 | MRS2a_Contig_6918 | 2124908027 | Bacteria | 2960 |
| 4 | MRS2a_Contig_8388 | 2124908027 | Bacteria | 2204 |
| 5 | JGI25162J39368_1000054 | 3300002737 | Bacteria | 147779 |
| 6 | JGI25163J39215_1000844 | 3300002771 | Bacteria | 7315 |
| 7 | JGI25163J39215_1000977 | 3300002771 | Bacteria | 6347 |
| 8 | JGI25164J39214_1000029 | 3300002772 | Bacteria | 147779 |
| 9 | JGI25164J39214_1000106 | 3300002772 | Bacteria | 80803 |
| 10 | JGI25165J46597_1000111 | 3300003214 | Bacteria | 147779 |
| 11 | JGI25165J46597_1000217 | 3300003214 | Bacteria | 80803 |
| 12 | Ga0055539_1000147 | 3300003752 | Bacteria | 70627 |
| 13 | Ga0055533_1000151 | 3300003756 | Bacteria | 70627 |
| 14 | Ga0055532_1000108 | 3300003758 | Bacteria | 88720 |
| 15 | Ga0055525_1000199 | 3300003759 | Bacteria | 70627 |
| 16 | Ga0055536_1000043 | 3300003781 | Bacteria | 124663 |
| 17 | Ga0055530_10000031 | 3300003791 | Bacteria | 122117 |
| 18 | Ga0055530_10000701 | 3300003791 | Bacteria | 28278 |
| 19 | Ga0055530_10002189 | 3300003791 | Bacteria | 12927 |
| 20 | Ga0055540_1000415 | 3300003792 | Bacteria | 34269 |
| 21 | Ga0055540_1000503 | 3300003792 | Bacteria | 29794 |
| 22 | Ga0055540_1000542 | 3300003792 | Bacteria | 28278 |
| 23 | Ga0055531_10000283 | 3300003794 | Bacteria | 51426 |
| 24 | Ga0055541_1000099 | 3300003841 | Bacteria | 70627 |
| 25 | Ga0065714_10003068 | 3300005288 | Bacteria | 8972 |
| 26 | Ga0065714_10004204 | 3300005288 | Bacteria | 5686 |
| 27 | Ga0065712_10004475 | 3300005290 | Bacteria | 3370 |
| 28 | Ga0065715_10022496 | 3300005293 | Bacteria | 2298 |
| 29 | Ga0070669_100015823 | 3300005353 | Bacteria | 5379 |
| 30 | Ga0075364_10158465 | 3300006051 | Bacteria | 1527 |
| 31 | Ga0075432_10001832 | 3300006058 | Bacteria | 7006 |
| 32 | Ga0075432_10013045 | 3300006058 | Bacteria | 2825 |
| 33 | Ga0075362_10056685 | 3300006177 | Bacteria | 1764 |
| 34 | Ga0075362_10104725 | 3300006177 | Bacteria | 1326 |
| 35 | Ga0075436_100020363 | 3300006914 | Bacteria | 4553 |
| 36 | Ga0079104_1000090 | 3300006946 | Bacteria | 132824 |
| 37 | Ga0079104_1000134 | 3300006946 | Bacteria | 103774 |
| 38 | Ga0099826_10003760 | 3300006948 | Bacteria | 10433 |
| 39 | Ga0105251_10000004 | 3300009011 | Bacteria | 285212 |
| 40 | Ga0105251_10001609 | 3300009011 | Bacteria | 19193 |
| 41 | Ga0105251_10012530 | 3300009011 | Bacteria | 4793 |
| 42 | Ga0105251_10021638 | 3300009011 | Bacteria | 3353 |
| 43 | Ga0105251_10049420 | 3300009011 | Bacteria | 2013 |
| 44 | Ga0105244_10006961 | 3300009036 | Bacteria | 7240 |
| 45 | Ga0105244_10012584 | 3300009036 | Bacteria | 4991 |
| 46 | Ga0105244_10018996 | 3300009036 | Bacteria | 3847 |
| 47 | Ga0105244_10043686 | 3300009036 | Bacteria | 2310 |
| 48 | Ga0105244_10051369 | 3300009036 | Bacteria | 2101 |
| 49 | Ga0105250_10003140 | 3300009092 | Bacteria | 7936 |
| 50 | Ga0105250_10007114 | 3300009092 | Bacteria | 4831 |
| 51 | Ga0105250_10025066 | 3300009092 | Bacteria | 2404 |
| 52 | Ga0105250_10090966 | 3300009092 | Bacteria | 1241 |
| 53 | Ga0105250_10114794 | 3300009092 | Bacteria | 1104 |
| 54 | Ga0105243_10000144 | 3300009148 | Bacteria | 81484 |
| 55 | Ga0105243_10000218 | 3300009148 | Bacteria | 67019 |
| 56 | Ga0105243_10018270 | 3300009148 | Bacteria | 5309 |
| 57 | Ga0105243_10063489 | 3300009148 | Bacteria | 2960 |
| 58 | Ga0105243_10138450 | 3300009148 | Bacteria | 2074 |
| 59 | Ga0105242_10098447 | 3300009176 | Bacteria | 2474 |
| 60 | Ga0105249_10190333 | 3300009553 | Bacteria | 2002 |
| 61 | Ga0105246_10000228 | 3300011119 | Bacteria | 28707 |
| 62 | Ga0105246_10013274 | 3300011119 | Bacteria | 5162 |
| 63 | Ga0105246_10046460 | 3300011119 | Bacteria | 2962 |
| 64 | Ga0157345_1000028 | 3300012498 | Bacteria | 37231 |
| 65 | Ga0157373_10003627 | 3300013100 | Bacteria | 11659 |
| 66 | Ga0157373_10021164 | 3300013100 | Bacteria | 4721 |
| 67 | Ga0157373_10026485 | 3300013100 | Bacteria | 4188 |
| 68 | Ga0157371_10000230 | 3300013102 | Bacteria | 80303 |
| 69 | Ga0157371_10002163 | 3300013102 | Bacteria | 19129 |
| 70 | Ga0157371_10013816 | 3300013102 | Bacteria | 6117 |
| 71 | Ga0157370_10185227 | 3300013104 | Bacteria | 1933 |
| 72 | Ga0157370_10299394 | 3300013104 | Bacteria | 1485 |
| 73 | Ga0157370_10581416 | 3300013104 | Bacteria | 1026 |
| 74 | Ga0157369_10007762 | 3300013105 | Bacteria | 12342 |
| 75 | Ga0163162_10027149 | 3300013306 | Bacteria | 5661 |
| 76 | Ga0157372_10007104 | 3300013307 | Bacteria | 11934 |
| 77 | Ga0182008_10000783 | 3300014497 | Bacteria | 22244 |
| 78 | Ga0182008_10009438 | 3300014497 | Bacteria | 5264 |
| 79 | Ga0182008_10009976 | 3300014497 | Bacteria | 5102 |
| 80 | Ga0182008_10013208 | 3300014497 | Bacteria | 4343 |
| 81 | Ga0182008_10044468 | 3300014497 | Bacteria | 2209 |
| 82 | Ga0182008_10045368 | 3300014497 | Bacteria | 2185 |
| 83 | Ga0182006_1001311 | 3300015261 | Bacteria | 15281 |
| 84 | Ga0182006_1001590 | 3300015261 | Bacteria | 13458 |
| 85 | Ga0182006_1005933 | 3300015261 | Bacteria | 5742 |
| 86 | Ga0182006_1006304 | 3300015261 | Bacteria | 5528 |
| 87 | Ga0182006_1021756 | 3300015261 | Bacteria | 2670 |
| 88 | Ga0182006_1073939 | 3300015261 | Bacteria | 1257 |
| 89 | Ga0182007_10001309 | 3300015262 | Bacteria | 13468 |
| 90 | Ga0182005_1001728 | 3300015265 | Bacteria | 8436 |
| 91 | Ga0182005_1070986 | 3300015265 | Bacteria | 957 |
| 92 | Ga0163161_10003944 | 3300017792 | Bacteria | 10410 |
| 93 | Ga0163161_10009858 | 3300017792 | Bacteria | 6617 |
| 94 | Ga0163161_10015005 | 3300017792 | Bacteria | 5397 |
| 95 | Ga0163161_10059859 | 3300017792 | Bacteria | 2770 |
| 96 | Ga0209760_100015 | 3300025207 | Bacteria | 176281 |
| 97 | Ga0209760_100047 | 3300025207 | Bacteria | 107520 |
| 98 | Ga0209784_100015 | 3300025224 | Bacteria | 482117 |
| 99 | Ga0209566_100012 | 3300025225 | Bacteria | 482281 |
| 100 | Ga0209674_100027 | 3300025226 | Bacteria | 482281 |
| 101 | Ga0209147_100019 | 3300025229 | Bacteria | 482139 |
| 102 | Ga0209563_100031 | 3300025230 | Bacteria | 482281 |
| 103 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 104 | Ga0207427_100029 | 3300025231 | Bacteria | 376678 |
| 105 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 106 | Ga0209437_100009 | 3300025233 | Bacteria | 915954 |
| 107 | Ga0209258_100364 | 3300025242 | Bacteria | 60333 |
| 108 | Ga0209646_1000199 | 3300025246 | Bacteria | 71982 |
| 109 | Ga0209677_100016 | 3300025253 | Bacteria | 482117 |
| 110 | Ga0209759_1006450 | 3300025256 | Bacteria | 3937 |
| 111 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 112 | Ga0209233_1000032 | 3300025261 | Bacteria | 623596 |
| 113 | Ga0209675_1011935 | 3300025291 | Bacteria | 2837 |
| 114 | Ga0209676_1000016 | 3300025292 | Bacteria | 655561 |
| 115 | Ga0209676_1000033 | 3300025292 | Bacteria | 463236 |
| 116 | Ga0209676_1000080 | 3300025292 | Bacteria | 287400 |
| 117 | Ga0209676_1001858 | 3300025292 | Bacteria | 17373 |
| 118 | Ga0209676_1003397 | 3300025292 | Bacteria | 9864 |
| 119 | Ga0209050_1000009 | 3300025298 | Bacteria | 1047265 |
| 120 | Ga0209050_1000036 | 3300025298 | Bacteria | 423070 |
| 121 | Ga0209050_1000117 | 3300025298 | Bacteria | 202979 |
| 122 | Ga0209050_1001816 | 3300025298 | Bacteria | 20822 |
| 123 | Ga0209051_1000053 | 3300025303 | Bacteria | 281564 |
| 124 | Ga0209051_1000077 | 3300025303 | Bacteria | 202959 |
| 125 | Ga0209051_1000094 | 3300025303 | Bacteria | 168538 |
| 126 | Ga0209051_1028897 | 3300025303 | Bacteria | 2181 |
| 127 | Ga0209257_1000173 | 3300025304 | Bacteria | 166678 |
| 128 | Ga0209257_1010389 | 3300025304 | Bacteria | 4720 |
| 129 | Ga0207696_1000044 | 3300025711 | Bacteria | 300953 |
| 130 | Ga0207696_1000083 | 3300025711 | Bacteria | 197352 |
| 131 | Ga0207696_1012583 | 3300025711 | Bacteria | 2985 |
| 132 | Ga0207696_1034035 | 3300025711 | Bacteria | 1525 |
| 133 | Ga0207655_1000005 | 3300025728 | Bacteria | 917277 |
| 134 | Ga0207655_1000015 | 3300025728 | Bacteria | 600662 |
| 135 | Ga0207655_1000193 | 3300025728 | Bacteria | 107789 |
| 136 | Ga0207655_1001511 | 3300025728 | Bacteria | 21214 |
| 137 | Ga0207655_1002564 | 3300025728 | Bacteria | 14532 |
| 138 | Ga0207655_1004205 | 3300025728 | Bacteria | 10321 |
| 139 | Ga0207655_1009831 | 3300025728 | Bacteria | 5891 |
| 140 | Ga0207655_1010304 | 3300025728 | Bacteria | 5677 |
| 141 | Ga0207655_1042588 | 3300025728 | Bacteria | 1931 |
| 142 | Ga0207713_1000013 | 3300025735 | Bacteria | 475751 |
| 143 | Ga0207713_1000933 | 3300025735 | Bacteria | 26222 |
| 144 | Ga0207713_1000977 | 3300025735 | Bacteria | 25286 |
| 145 | Ga0207713_1003442 | 3300025735 | Bacteria | 10774 |
| 146 | Ga0207713_1006328 | 3300025735 | Bacteria | 7227 |
| 147 | Ga0207713_1008305 | 3300025735 | Bacteria | 5996 |
| 148 | Ga0207713_1016990 | 3300025735 | Bacteria | 3672 |
| 149 | Ga0207713_1047848 | 3300025735 | Bacteria | 1727 |
| 150 | Ga0207681_10006317 | 3300025923 | Bacteria | 7274 |
| 151 | Ga0207706_10087349 | 3300025933 | Bacteria | 2742 |
| 152 | Ga0207709_10000036 | 3300025935 | Bacteria | 292568 |
| 153 | Ga0207709_10000250 | 3300025935 | Bacteria | 65488 |
| 154 | Ga0207709_10038253 | 3300025935 | Bacteria | 2855 |
| 155 | Ga0207712_10091085 | 3300025961 | Bacteria | 2245 |
| 156 | Ga0209281_1000013 | 3300027111 | Bacteria | 653449 |
| 157 | Ga0209281_1000172 | 3300027111 | Bacteria | 151766 |
| 158 | Ga0209281_1012052 | 3300027111 | Bacteria | 1913 |
| 159 | Ga0207428_10026789 | 3300027907 | Bacteria | 4804 |
| 160 | Ga0207428_10032474 | 3300027907 | Bacteria | 4294 |
| 161 | Ga0207428_10070618 | 3300027907 | Bacteria | 2745 |
| 162 | Ga0207428_10071502 | 3300027907 | Bacteria | 2725 |
| 163 | Ga0316178_1048493 | 3300030735 | Bacteria | 14555 |
| 164 | Ga0307408_100010934 | 3300031548 | Bacteria | 5990 |
| 165 | Ga0307408_100091925 | 3300031548 | Bacteria | 2292 |
| 166 | Ga0307408_100190297 | 3300031548 | Bacteria | 1652 |
| 167 | Ga0307516_10195252 | 3300031730 | Bacteria | 1747 |
| 168 | Ga0307405_10007758 | 3300031731 | Bacteria | 5396 |
| 169 | Ga0307412_10003255 | 3300031911 | Bacteria | 9024 |
| 170 | Ga0307412_10034711 | 3300031911 | Bacteria | 3216 |
| 171 | Ga0307412_10050066 | 3300031911 | Bacteria | 2755 |
| 172 | Ga0307416_100109692 | 3300032002 | Bacteria | 2428 |
| 173 | Ga0307414_10011270 | 3300032004 | Bacteria | 5234 |
| 174 | Ga0307411_10008164 | 3300032005 | Bacteria | 5402 |
| 175 | Ga0307510_10054802 | 3300033180 | Bacteria | 4171 |
| 176 | Ga0237819_00586 | 3300038705 | Bacteria | 12170 |
| 177 | Ga0439438_000992 | 3300041405 | Bacteria | 12681 |
| 178 | Ga0439438_002440 | 3300041405 | Bacteria | 7920 |
| 179 | Ga0439438_003854 | 3300041405 | Bacteria | 5915 |
| 180 | Ga0439438_004148 | 3300041405 | Bacteria | 5650 |
| 181 | Ga0439438_010720 | 3300041405 | Bacteria | 2885 |
| 182 | Ga0439447_001814 | 3300041407 | Bacteria | 7823 |
| 183 | Ga0439447_002323 | 3300041407 | Bacteria | 6951 |
| 184 | Ga0439447_006517 | 3300041407 | Bacteria | 3782 |
| 185 | Ga0439447_011254 | 3300041407 | Bacteria | 2620 |
| 186 | Ga0439466_0006472 | 3300041411 | Bacteria | 4451 |
| 187 | Ga0439466_0007459 | 3300041411 | Bacteria | 4142 |
| 188 | Ga0439466_0024748 | 3300041411 | Bacteria | 2101 |
| 189 | Ga0439466_0037897 | 3300041411 | Bacteria | 1621 |
| 190 | Ga0439465_0041190 | 3300041413 | Bacteria | 1494 |
| 191 | Ga0439432_009021 | 3300042006 | Bacteria | 3485 |
| 192 | Ga0439432_019659 | 3300042006 | Bacteria | 2248 |
| 193 | Ga0439432_021951 | 3300042006 | Bacteria | 2111 |
| 194 | Ga0439432_050079 | 3300042006 | Bacteria | 1304 |
| 195 | Ga0439451_001403 | 3300042009 | Bacteria | 4763 |
| 196 | Ga0439452_000135 | 3300042010 | Bacteria | 55807 |
| 197 | Ga0439452_000233 | 3300042010 | Bacteria | 38666 |
| 198 | Ga0439452_000500 | 3300042010 | Bacteria | 21349 |
| 199 | Ga0439456_005538 | 3300042013 | Bacteria | 2564 |
| 200 | Ga0439456_016095 | 3300042013 | Bacteria | 1563 |
| 201 | Ga0439456_033031 | 3300042013 | Bacteria | 1112 |
| 202 | Ga0439463_000242 | 3300042016 | Bacteria | 15106 |
| 203 | Ga0439463_001060 | 3300042016 | Bacteria | 7426 |
| 204 | Ga0439463_006107 | 3300042016 | Bacteria | 2989 |
| 205 | Ga0439463_031584 | 3300042016 | Bacteria | 1337 |
| 206 | Ga0450911_000292 | 3300042115 | Bacteria | 18338 |
| 207 | Ga0450911_002178 | 3300042115 | Bacteria | 3973 |
| 208 | Ga0450911_003370 | 3300042115 | Bacteria | 2839 |
| 209 | Ga0450919_001307 | 3300042121 | Bacteria | 3254 |
| 210 | Ga0450920_002749 | 3300042122 | Bacteria | 3021 |
| 211 | Ga0450922_003684 | 3300042124 | Bacteria | 1408 |
| 212 | Ga0450890_000719 | 3300042127 | Bacteria | 4808 |
| 213 | Ga0450900_000487 | 3300042136 | Bacteria | 3173 |
| 214 | Ga0450903_001649 | 3300042138 | Bacteria | 4143 |
| 215 | Ga0450904_002515 | 3300042139 | Bacteria | 2163 |
| 216 | Ga0450906_000157 | 3300042145 | Bacteria | 12663 |
| 217 | Ga0450906_000365 | 3300042145 | Bacteria | 9171 |
| 218 | Ga0450906_006822 | 3300042145 | Bacteria | 2285 |
| 219 | Ga0450907_002004 | 3300042146 | Bacteria | 4080 |
| 220 | Ga0450907_004429 | 3300042146 | Bacteria | 2424 |
| 221 | Ga0450910_002158 | 3300042147 | Bacteria | 2571 |
| 222 | Ga0450910_002608 | 3300042147 | Bacteria | 2372 |
| 223 | Ga0450908_003379 | 3300042184 | Bacteria | 3099 |
| 224 | Ga0450909_000555 | 3300042185 | Bacteria | 4924 |
| 225 | Ga0439460_0000244 | 3300042461 | Bacteria | 11102 |
| 226 | Ga0439460_0007680 | 3300042461 | Bacteria | 2703 |
| 227 | Ga0495617_000917 | 3300046452 | Bacteria | 13718 |
| 228 | Ga0495617_006320 | 3300046452 | Bacteria | 4161 |
| 229 | Ga0495617_011885 | 3300046452 | Bacteria | 2969 |
| 230 | Ga0495617_015738 | 3300046452 | Bacteria | 2559 |
| 231 | Ga0495617_073141 | 3300046452 | Bacteria | 1126 |
| 232 | Ga0495627_000021 | 3300046453 | Bacteria | 282454 |
| 233 | Ga0495627_000279 | 3300046453 | Bacteria | 51531 |
| 234 | Ga0495627_001683 | 3300046453 | Bacteria | 12175 |
| 235 | Ga0495627_002401 | 3300046453 | Bacteria | 9080 |
| 236 | Ga0495627_023988 | 3300046453 | Bacteria | 1992 |
| 237 | Ga0495627_046182 | 3300046453 | Bacteria | 1324 |
| 238 | Ga0495603_0025417 | 3300046455 | Bacteria | 3581 |
| 239 | Ga0495603_0092374 | 3300046455 | Bacteria | 1768 |
| 240 | Ga0495590_0000904 | 3300046457 | Bacteria | 13261 |
| 241 | Ga0495590_0002563 | 3300046457 | Bacteria | 7514 |
| 242 | Ga0495591_000015 | 3300046458 | Bacteria | 252107 |
| 243 | Ga0495591_000157 | 3300046458 | Bacteria | 72549 |
| 244 | Ga0495591_002294 | 3300046458 | Bacteria | 10847 |
| 245 | Ga0495591_003678 | 3300046458 | Bacteria | 7795 |
| 246 | Ga0495591_007656 | 3300046458 | Bacteria | 4553 |
| 247 | Ga0495591_009294 | 3300046458 | Bacteria | 3920 |
| 248 | Ga0495591_011451 | 3300046458 | Bacteria | 3359 |
| 249 | Ga0495591_012092 | 3300046458 | Bacteria | 3231 |
| 250 | Ga0495591_023300 | 3300046458 | Bacteria | 1987 |
| 251 | Ga0495591_034463 | 3300046458 | Bacteria | 1490 |
| 252 | Ga0495629_0112860 | 3300046459 | Bacteria | 1894 |
| 253 | Ga0495638_0006497 | 3300046460 | Bacteria | 8501 |
| 254 | Ga0495638_0007291 | 3300046460 | Bacteria | 7947 |
| 255 | Ga0495638_0008166 | 3300046460 | Bacteria | 7442 |
| 256 | Ga0495638_0014786 | 3300046460 | Bacteria | 5263 |
| 257 | Ga0495638_0017490 | 3300046460 | Bacteria | 4776 |
| 258 | Ga0495638_0060203 | 3300046460 | Bacteria | 2349 |
| 259 | Ga0495638_0071415 | 3300046460 | Bacteria | 2123 |
| 260 | Ga0495638_0194092 | 3300046460 | Bacteria | 1150 |
| 261 | Ga0495638_0210562 | 3300046460 | Bacteria | 1092 |
| 262 | Ga0495653_0001346 | 3300046463 | Bacteria | 19072 |
| 263 | Ga0495653_0023818 | 3300046463 | Bacteria | 4941 |
| 264 | Ga0495653_0028429 | 3300046463 | Bacteria | 4469 |
| 265 | Ga0495653_0038780 | 3300046463 | Bacteria | 3737 |
| 266 | Ga0495650_0001786 | 3300046471 | Bacteria | 19471 |
| 267 | Ga0495650_0004276 | 3300046471 | Bacteria | 9862 |
| 268 | Ga0495650_0007982 | 3300046471 | Bacteria | 6260 |
| 269 | Ga0495650_0008452 | 3300046471 | Bacteria | 6008 |
| 270 | Ga0495650_0012856 | 3300046471 | Bacteria | 4471 |
| 271 | Ga0495650_0059585 | 3300046471 | Bacteria | 1537 |
| 272 | Ga0495650_0078913 | 3300046471 | Bacteria | 1273 |
| 273 | Ga0495582_0037036 | 3300046473 | Bacteria | 2683 |
| 274 | Ga0495605_0000016 | 3300046474 | Bacteria | 289508 |
| 275 | Ga0495605_0000031 | 3300046474 | Bacteria | 213242 |
| 276 | Ga0495605_0000558 | 3300046474 | Bacteria | 30460 |
| 277 | Ga0495605_0000917 | 3300046474 | Bacteria | 20251 |
| 278 | Ga0495605_0003396 | 3300046474 | Bacteria | 9496 |
| 279 | Ga0495605_0005904 | 3300046474 | Bacteria | 7077 |
| 280 | Ga0495605_0013182 | 3300046474 | Bacteria | 4566 |
| 281 | Ga0495605_0014901 | 3300046474 | Bacteria | 4241 |
| 282 | Ga0495605_0017011 | 3300046474 | Bacteria | 3927 |
| 283 | Ga0495605_0020247 | 3300046474 | Bacteria | 3538 |
| 284 | Ga0495605_0036050 | 3300046474 | Bacteria | 2496 |
| 285 | Ga0495605_0051168 | 3300046474 | Bacteria | 2012 |
| 286 | Ga0495605_0052758 | 3300046474 | Bacteria | 1974 |
| 287 | Ga0495639_0000505 | 3300046475 | Bacteria | 18424 |
| 288 | Ga0495639_0004261 | 3300046475 | Bacteria | 6136 |
| 289 | Ga0495639_0135310 | 3300046475 | Bacteria | 1182 |
| 290 | Ga0495584_0003601 | 3300046491 | Bacteria | 8449 |
| 291 | Ga0495584_0004653 | 3300046491 | Bacteria | 7354 |
| 292 | Ga0495584_0005548 | 3300046491 | Bacteria | 6678 |
| 293 | Ga0495584_0012803 | 3300046491 | Bacteria | 4280 |
| 294 | Ga0495584_0016800 | 3300046491 | Bacteria | 3730 |
| 295 | Ga0495584_0019248 | 3300046491 | Bacteria | 3467 |
| 296 | Ga0495584_0022955 | 3300046491 | Bacteria | 3165 |
| 297 | Ga0495584_0030567 | 3300046491 | Bacteria | 2727 |
| 298 | Ga0495584_0167310 | 3300046491 | Bacteria | 1117 |
| 299 | Ga0495585_0000559 | 3300046492 | Bacteria | 35171 |
| 300 | Ga0495585_0003008 | 3300046492 | Bacteria | 11630 |
| 301 | Ga0495585_0008243 | 3300046492 | Bacteria | 6326 |
| 302 | Ga0495585_0020410 | 3300046492 | Bacteria | 3811 |
| 303 | Ga0495585_0105694 | 3300046492 | Bacteria | 1501 |
| 304 | Ga0495594_0002203 | 3300046499 | Bacteria | 10130 |
| 305 | Ga0495594_0026505 | 3300046499 | Bacteria | 3119 |
| 306 | Ga0495596_0000073 | 3300046500 | Bacteria | 74267 |
| 307 | Ga0495607_0000162 | 3300046501 | Bacteria | 71325 |
| 308 | Ga0495607_0000166 | 3300046501 | Bacteria | 70056 |
| 309 | Ga0495607_0001224 | 3300046501 | Bacteria | 23039 |
| 310 | Ga0495607_0001547 | 3300046501 | Bacteria | 20147 |
| 311 | Ga0495607_0004193 | 3300046501 | Bacteria | 10702 |
| 312 | Ga0495607_0009369 | 3300046501 | Bacteria | 6629 |
| 313 | Ga0495607_0010940 | 3300046501 | Bacteria | 6068 |
| 314 | Ga0495607_0014937 | 3300046501 | Bacteria | 5048 |
| 315 | Ga0495607_0016615 | 3300046501 | Bacteria | 4748 |
| 316 | Ga0495607_0022185 | 3300046501 | Bacteria | 3991 |
| 317 | Ga0495607_0050089 | 3300046501 | Bacteria | 2433 |
| 318 | Ga0495607_0057695 | 3300046501 | Bacteria | 2223 |
| 319 | Ga0495607_0088393 | 3300046501 | Bacteria | 1684 |
| 320 | Ga0495583_0000041 | 3300046506 | Bacteria | 234707 |
| 321 | Ga0495583_0000578 | 3300046506 | Bacteria | 50328 |
| 322 | Ga0495583_0001999 | 3300046506 | Bacteria | 18668 |
| 323 | Ga0495583_0002465 | 3300046506 | Bacteria | 15782 |
| 324 | Ga0495583_0004895 | 3300046506 | Bacteria | 9323 |
| 325 | Ga0495583_0005316 | 3300046506 | Bacteria | 8792 |
| 326 | Ga0495583_0008381 | 3300046506 | Bacteria | 6328 |
| 327 | Ga0495583_0009302 | 3300046506 | Bacteria | 5884 |
| 328 | Ga0495583_0019989 | 3300046506 | Bacteria | 3481 |
| 329 | Ga0495606_0000055 | 3300046507 | Bacteria | 199348 |
| 330 | Ga0495606_0003469 | 3300046507 | Bacteria | 16721 |
| 331 | Ga0495606_0005454 | 3300046507 | Bacteria | 12178 |
| 332 | Ga0495606_0007059 | 3300046507 | Bacteria | 10170 |
| 333 | Ga0495606_0007319 | 3300046507 | Bacteria | 9929 |
| 334 | Ga0495606_0007485 | 3300046507 | Bacteria | 9753 |
| 335 | Ga0495606_0010262 | 3300046507 | Bacteria | 7802 |
| 336 | Ga0495606_0064861 | 3300046507 | Bacteria | 2322 |
| 337 | Ga0495606_0131933 | 3300046507 | Bacteria | 1484 |
| 338 | Ga0495606_0195005 | 3300046507 | Bacteria | 1158 |
| 339 | Ga0495610_0004118 | 3300046512 | Bacteria | 10880 |
| 340 | Ga0495610_0005910 | 3300046512 | Bacteria | 8572 |
| 341 | Ga0495610_0010229 | 3300046512 | Bacteria | 5849 |
| 342 | Ga0495610_0011436 | 3300046512 | Bacteria | 5427 |
| 343 | Ga0495610_0012062 | 3300046512 | Bacteria | 5229 |
| 344 | Ga0495610_0015222 | 3300046512 | Bacteria | 4479 |
| 345 | Ga0495610_0022584 | 3300046512 | Bacteria | 3436 |
| 346 | Ga0495610_0102106 | 3300046512 | Bacteria | 1283 |
| 347 | Ga0495610_0136352 | 3300046512 | Bacteria | 1060 |
| 348 | Ga0495616_0001130 | 3300046513 | Bacteria | 18916 |
| 349 | Ga0495616_0001777 | 3300046513 | Bacteria | 14670 |
| 350 | Ga0495616_0003265 | 3300046513 | Bacteria | 10427 |
| 351 | Ga0495616_0003757 | 3300046513 | Bacteria | 9685 |
| 352 | Ga0495620_0000015 | 3300046515 | Bacteria | 154625 |
| 353 | Ga0495620_0000506 | 3300046515 | Bacteria | 25295 |
| 354 | Ga0495620_0000863 | 3300046515 | Bacteria | 18767 |
| 355 | Ga0495620_0004849 | 3300046515 | Bacteria | 7550 |
| 356 | Ga0495620_0009210 | 3300046515 | Bacteria | 5260 |
| 357 | Ga0495620_0010499 | 3300046515 | Bacteria | 4885 |
| 358 | Ga0495620_0015063 | 3300046515 | Bacteria | 3912 |
| 359 | Ga0495620_0018661 | 3300046515 | Bacteria | 3431 |
| 360 | Ga0495620_0019786 | 3300046515 | Bacteria | 3301 |
| 361 | Ga0495620_0132259 | 3300046515 | Bacteria | 978 |
| 362 | Ga0495628_0164159 | 3300046516 | Bacteria | 1687 |
| 363 | Ga0495630_0280260 | 3300046517 | Bacteria | 1273 |
| 364 | Ga0495631_0001850 | 3300046518 | Bacteria | 12495 |
| 365 | Ga0495631_0005616 | 3300046518 | Bacteria | 6549 |
| 366 | Ga0495631_0007239 | 3300046518 | Bacteria | 5657 |
| 367 | Ga0495631_0040186 | 3300046518 | Bacteria | 2073 |
| 368 | Ga0495631_0051083 | 3300046518 | Bacteria | 1807 |
| 369 | Ga0495632_0001435 | 3300046519 | Bacteria | 19869 |
| 370 | Ga0495632_0001837 | 3300046519 | Bacteria | 17116 |
| 371 | Ga0495632_0002733 | 3300046519 | Bacteria | 13104 |
| 372 | Ga0495632_0006118 | 3300046519 | Bacteria | 7800 |
| 373 | Ga0495632_0011414 | 3300046519 | Bacteria | 5183 |
| 374 | Ga0495632_0011955 | 3300046519 | Bacteria | 5035 |
| 375 | Ga0495632_0015158 | 3300046519 | Bacteria | 4333 |
| 376 | Ga0495632_0018221 | 3300046519 | Bacteria | 3857 |
| 377 | Ga0495632_0025573 | 3300046519 | Bacteria | 3120 |
| 378 | Ga0495632_0034409 | 3300046519 | Bacteria | 2593 |
| 379 | Ga0495632_0048073 | 3300046519 | Bacteria | 2113 |
| 380 | Ga0495632_0060280 | 3300046519 | Bacteria | 1844 |
| 381 | Ga0495632_0095859 | 3300046519 | Bacteria | 1401 |
| 382 | Ga0495637_0000381 | 3300046520 | Bacteria | 33258 |
| 383 | Ga0495637_0001350 | 3300046520 | Bacteria | 14739 |
| 384 | Ga0495637_0001569 | 3300046520 | Bacteria | 13303 |
| 385 | Ga0495637_0003858 | 3300046520 | Bacteria | 7865 |
| 386 | Ga0495637_0008406 | 3300046520 | Bacteria | 5075 |
| 387 | Ga0495637_0011449 | 3300046520 | Bacteria | 4264 |
| 388 | Ga0495637_0011853 | 3300046520 | Bacteria | 4177 |
| 389 | Ga0495637_0012799 | 3300046520 | Bacteria | 4003 |
| 390 | Ga0495637_0019606 | 3300046520 | Bacteria | 3124 |
| 391 | Ga0495637_0030411 | 3300046520 | Bacteria | 2396 |
| 392 | Ga0495637_0031167 | 3300046520 | Bacteria | 2360 |
| 393 | Ga0495643_0047455 | 3300046522 | Bacteria | 2325 |
| 394 | Ga0495644_0001206 | 3300046523 | Bacteria | 10575 |
| 395 | Ga0495644_0002017 | 3300046523 | Bacteria | 8166 |
| 396 | Ga0495644_0004657 | 3300046523 | Bacteria | 5390 |
| 397 | Ga0495644_0006147 | 3300046523 | Bacteria | 4666 |
| 398 | Ga0495648_0003497 | 3300046524 | Bacteria | 13777 |
| 399 | Ga0495648_0006371 | 3300046524 | Bacteria | 9647 |
| 400 | Ga0495648_0007480 | 3300046524 | Bacteria | 8736 |
| 401 | Ga0495648_0017358 | 3300046524 | Bacteria | 5147 |
| 402 | Ga0495648_0022434 | 3300046524 | Bacteria | 4345 |
| 403 | Ga0495648_0030875 | 3300046524 | Bacteria | 3535 |
| 404 | Ga0495648_0036886 | 3300046524 | Bacteria | 3146 |
| 405 | Ga0495648_0119466 | 3300046524 | Bacteria | 1419 |
| 406 | Ga0495648_0169502 | 3300046524 | Bacteria | 1120 |
| 407 | Ga0495648_0176170 | 3300046524 | Bacteria | 1091 |
| 408 | Ga0495648_0189135 | 3300046524 | Bacteria | 1040 |
| 409 | Ga0495666_0006013 | 3300046526 | Bacteria | 6113 |
| 410 | Ga0495666_0006053 | 3300046526 | Bacteria | 6092 |
| 411 | Ga0495666_0006365 | 3300046526 | Bacteria | 5944 |
| 412 | Ga0495666_0103725 | 3300046526 | Bacteria | 1339 |
| 413 | Ga0495642_0000097 | 3300046528 | Bacteria | 49030 |
| 414 | Ga0495642_0000978 | 3300046528 | Bacteria | 13305 |
| 415 | Ga0495652_0063533 | 3300046529 | Bacteria | 3108 |
| 416 | Ga0495654_0001879 | 3300046530 | Bacteria | 13957 |
| 417 | Ga0495654_0002407 | 3300046530 | Bacteria | 12063 |
| 418 | Ga0495654_0005990 | 3300046530 | Bacteria | 6984 |
| 419 | Ga0495654_0012413 | 3300046530 | Bacteria | 4576 |
| 420 | Ga0495654_0015539 | 3300046530 | Bacteria | 4040 |
| 421 | Ga0495654_0022689 | 3300046530 | Bacteria | 3256 |
| 422 | Ga0495654_0025549 | 3300046530 | Bacteria | 3042 |
| 423 | Ga0495654_0027708 | 3300046530 | Bacteria | 2901 |
| 424 | Ga0495654_0029401 | 3300046530 | Bacteria | 2803 |
| 425 | Ga0495654_0053226 | 3300046530 | Bacteria | 1968 |
| 426 | Ga0495654_0082401 | 3300046530 | Bacteria | 1505 |
| 427 | Ga0495654_0122691 | 3300046530 | Bacteria | 1174 |
| 428 | Ga0495654_0131052 | 3300046530 | Bacteria | 1125 |
| 429 | Ga0495586_0005952 | 3300046535 | Bacteria | 6527 |
| 430 | Ga0495587_0009349 | 3300046536 | Bacteria | 6284 |
| 431 | Ga0495587_0015180 | 3300046536 | Bacteria | 4813 |
| 432 | Ga0495609_0000015 | 3300046538 | Bacteria | 322474 |
| 433 | Ga0495609_0000066 | 3300046538 | Bacteria | 131202 |
| 434 | Ga0495609_0000070 | 3300046538 | Bacteria | 128181 |
| 435 | Ga0495609_0002544 | 3300046538 | Bacteria | 11157 |
| 436 | Ga0495609_0003946 | 3300046538 | Bacteria | 8308 |
| 437 | Ga0495609_0017661 | 3300046538 | Bacteria | 3312 |
| 438 | Ga0495609_0019551 | 3300046538 | Bacteria | 3132 |
| 439 | Ga0495597_0000005 | 3300046542 | Bacteria | 286580 |
| 440 | Ga0495597_0002158 | 3300046542 | Bacteria | 12930 |
| 441 | Ga0495597_0003828 | 3300046542 | Bacteria | 8549 |
| 442 | Ga0495597_0007453 | 3300046542 | Bacteria | 5554 |
| 443 | Ga0495597_0009105 | 3300046542 | Bacteria | 4930 |
| 444 | Ga0495597_0009234 | 3300046542 | Bacteria | 4885 |
| 445 | Ga0495597_0012797 | 3300046542 | Bacteria | 4038 |
| 446 | Ga0495597_0018160 | 3300046542 | Bacteria | 3303 |
| 447 | Ga0495597_0082911 | 3300046542 | Bacteria | 1369 |
| 448 | Ga0495597_0084591 | 3300046542 | Bacteria | 1352 |
| 449 | Ga0495645_0037181 | 3300046543 | Bacteria | 3548 |
| 450 | Ga0495622_0000912 | 3300046557 | Bacteria | 16032 |
| 451 | Ga0495622_0002180 | 3300046557 | Bacteria | 9554 |
| 452 | Ga0495622_0003574 | 3300046557 | Bacteria | 7305 |
| 453 | Ga0495622_0008229 | 3300046557 | Bacteria | 4830 |
| 454 | Ga0495622_0028587 | 3300046557 | Bacteria | 2603 |
| 455 | Ga0495622_0132142 | 3300046557 | Bacteria | 1136 |
| 456 | Ga0495622_0138018 | 3300046557 | Bacteria | 1108 |
| 457 | Ga0495633_0000060 | 3300046558 | Bacteria | 144561 |
| 458 | Ga0495633_0028641 | 3300046558 | Bacteria | 2712 |
| 459 | Ga0495656_0000903 | 3300046615 | Bacteria | 9586 |
| 460 | Ga0495656_0089496 | 3300046615 | Bacteria | 1405 |
| 461 | Ga0495668_0000770 | 3300046616 | Bacteria | 37419 |
| 462 | Ga0495668_0004101 | 3300046616 | Bacteria | 10556 |
| 463 | Ga0495668_0009526 | 3300046616 | Bacteria | 5954 |
| 464 | Ga0495668_0026100 | 3300046616 | Bacteria | 3317 |
| 465 | Ga0495634_0001715 | 3300046642 | Bacteria | 19024 |
| 466 | Ga0495611_0000934 | 3300046648 | Bacteria | 15695 |
| 467 | Ga0495611_0002054 | 3300046648 | Bacteria | 9485 |
| 468 | Ga0495611_0003737 | 3300046648 | Bacteria | 6643 |
| 469 | Ga0495611_0021855 | 3300046648 | Bacteria | 2765 |
| 470 | Ga0495625_0001491 | 3300046660 | Bacteria | 28149 |
| 471 | Ga0495625_0005089 | 3300046660 | Bacteria | 12165 |
| 472 | Ga0495625_0007191 | 3300046660 | Bacteria | 9751 |
| 473 | Ga0495625_0009109 | 3300046660 | Bacteria | 8369 |
| 474 | Ga0495625_0062760 | 3300046660 | Bacteria | 2625 |
| 475 | Ga0495625_0088126 | 3300046660 | Bacteria | 2150 |
| 476 | Ga0495625_0124923 | 3300046660 | Bacteria | 1747 |
| 477 | Ga0495635_0005430 | 3300046663 | Bacteria | 8866 |
| 478 | Ga0495635_0018843 | 3300046663 | Bacteria | 4817 |
| 479 | Ga0495659_0000584 | 3300046664 | Bacteria | 13423 |
| 480 | Ga0495661_0000110 | 3300046665 | Bacteria | 97854 |
| 481 | Ga0495661_0000139 | 3300046665 | Bacteria | 85160 |
| 482 | Ga0495661_0000194 | 3300046665 | Bacteria | 70173 |
| 483 | Ga0495661_0003093 | 3300046665 | Bacteria | 12493 |
| 484 | Ga0495661_0003941 | 3300046665 | Bacteria | 10840 |
| 485 | Ga0495661_0185047 | 3300046665 | Bacteria | 1101 |
| 486 | Ga0495588_0014890 | 3300046674 | Bacteria | 3732 |
| 487 | Ga0495588_0028774 | 3300046674 | Bacteria | 2783 |
| 488 | Ga0495588_0110514 | 3300046674 | Bacteria | 1448 |
| 489 | Ga0495588_0174513 | 3300046674 | Bacteria | 1136 |
| 490 | Ga0495623_0041019 | 3300046679 | Bacteria | 2953 |
| 491 | Ga0495623_0205065 | 3300046679 | Bacteria | 1131 |
| 492 | Ga0495646_0006481 | 3300046680 | Bacteria | 7426 |
| 493 | Ga0495669_0000936 | 3300046684 | Bacteria | 12211 |
| 494 | Ga0495669_0117603 | 3300046684 | Bacteria | 1244 |
| 495 | Ga0495613_0012205 | 3300046689 | Bacteria | 6384 |
| 496 | Ga0495624_0000167 | 3300046690 | Bacteria | 48623 |
| 497 | Ga0495670_0005189 | 3300046691 | Bacteria | 6407 |
| 498 | Ga0495670_0006573 | 3300046691 | Bacteria | 5715 |
| 499 | Ga0495670_0007739 | 3300046691 | Bacteria | 5283 |
| 500 | Ga0495670_0040081 | 3300046691 | Bacteria | 2336 |
| 501 | Ga0495670_0063553 | 3300046691 | Bacteria | 1858 |
| 502 | Ga0495670_0235294 | 3300046691 | Bacteria | 974 |
| 503 | Ga0495671_0000168 | 3300046692 | Bacteria | 57864 |
| 504 | Ga0495671_0002259 | 3300046692 | Bacteria | 12245 |
| 505 | Ga0495671_0014576 | 3300046692 | Bacteria | 4225 |
| 506 | Ga0495671_0015419 | 3300046692 | Bacteria | 4092 |
| 507 | Ga0495671_0028124 | 3300046692 | Bacteria | 2898 |
| 508 | Ga0495671_0044437 | 3300046692 | Bacteria | 2227 |
| 509 | Ga0495671_0076793 | 3300046692 | Bacteria | 1637 |
| 510 | Ga0495671_0131019 | 3300046692 | Bacteria | 1223 |
| 511 | Ga0495671_0139727 | 3300046692 | Bacteria | 1180 |
| 512 | Ga0495649_0001678 | 3300046694 | Bacteria | 16441 |
| 513 | Ga0495649_0006007 | 3300046694 | Bacteria | 7602 |
| 514 | Ga0495649_0009516 | 3300046694 | Bacteria | 5766 |
| 515 | Ga0495649_0016282 | 3300046694 | Bacteria | 4214 |
| 516 | Ga0495649_0017462 | 3300046694 | Bacteria | 4046 |
| 517 | Ga0495649_0017528 | 3300046694 | Bacteria | 4039 |
| 518 | Ga0495649_0025308 | 3300046694 | Bacteria | 3305 |
| 519 | Ga0495649_0070192 | 3300046694 | Bacteria | 1878 |
| 520 | Ga0495649_0121109 | 3300046694 | Bacteria | 1383 |
| 521 | Ga0495589_0000305 | 3300046794 | Bacteria | 39215 |
| 522 | Ga0495589_0001305 | 3300046794 | Bacteria | 14643 |
| 523 | Ga0495589_0001652 | 3300046794 | Bacteria | 12768 |
| 524 | Ga0495589_0005876 | 3300046794 | Bacteria | 6481 |
| 525 | Ga0495589_0005958 | 3300046794 | Bacteria | 6435 |
| 526 | Ga0495589_0042974 | 3300046794 | Bacteria | 2251 |
| 527 | Ga0495589_0095452 | 3300046794 | Bacteria | 1442 |
| 528 | Ga0495589_0098549 | 3300046794 | Bacteria | 1415 |
| 529 | Ga0495589_0122542 | 3300046794 | Bacteria | 1251 |
| 530 | Ga0495600_0002016 | 3300046809 | Bacteria | 11424 |
| 531 | Ga0495600_0047743 | 3300046809 | Bacteria | 2793 |
| 532 | Ga0495660_0000469 | 3300046810 | Bacteria | 33478 |
| 533 | Ga0495660_0009946 | 3300046810 | Bacteria | 5535 |
| 534 | Ga0495660_0013051 | 3300046810 | Bacteria | 4816 |
| 535 | Ga0495660_0014187 | 3300046810 | Bacteria | 4614 |
| 536 | Ga0495660_0028687 | 3300046810 | Bacteria | 3141 |
| 537 | Ga0495660_0044679 | 3300046810 | Bacteria | 2435 |
| 538 | Ga0495660_0094535 | 3300046810 | Bacteria | 1547 |
| 539 | Ga0495660_0116719 | 3300046810 | Bacteria | 1355 |
| 540 | Ga0495660_0128535 | 3300046810 | Bacteria | 1273 |
| 541 | Ga0495660_0128874 | 3300046810 | Bacteria | 1271 |
| 542 | Ga0495660_0148528 | 3300046810 | Bacteria | 1159 |
| 543 | Ga0495660_0164279 | 3300046810 | Bacteria | 1086 |
| 544 | Ga0495581_0012130 | 3300047315 | Bacteria | 4988 |
| 545 | Ga0495604_0004080 | 3300047317 | Bacteria | 11613 |
| 546 | Ga0495636_0000726 | 3300047318 | Bacteria | 12084 |
| 547 | Ga0495674_0099450 | 3300047319 | Bacteria | 2476 |
| 548 | Ga0495672_0000985 | 3300047320 | Bacteria | 29464 |
| 549 | Ga0495672_0003371 | 3300047320 | Bacteria | 13732 |
| 550 | Ga0495672_0003898 | 3300047320 | Bacteria | 12520 |
| 551 | Ga0495672_0008359 | 3300047320 | Bacteria | 7654 |
| 552 | Ga0495672_0009540 | 3300047320 | Bacteria | 7018 |
| 553 | Ga0495672_0011490 | 3300047320 | Bacteria | 6246 |
| 554 | Ga0495672_0015367 | 3300047320 | Bacteria | 5200 |
| 555 | Ga0495672_0015376 | 3300047320 | Bacteria | 5198 |
| 556 | Ga0495672_0016049 | 3300047320 | Bacteria | 5064 |
| 557 | Ga0495672_0020133 | 3300047320 | Bacteria | 4380 |
| 558 | Ga0495672_0044268 | 3300047320 | Bacteria | 2671 |
| 559 | Ga0495672_0065702 | 3300047320 | Bacteria | 2072 |
| 560 | Ga0495672_0069794 | 3300047320 | Bacteria | 1993 |
| 561 | Ga0495672_0087653 | 3300047320 | Bacteria | 1718 |
| 562 | Ga0495672_0091914 | 3300047320 | Bacteria | 1664 |
| 563 | Ga0495672_0093309 | 3300047320 | Bacteria | 1648 |
| 564 | Ga0495672_0110709 | 3300047320 | Bacteria | 1474 |
| 565 | Ga0495676_0000013 | 3300047321 | Bacteria | 213031 |
| 566 | Ga0495676_0003992 | 3300047321 | Bacteria | 13429 |
| 567 | Ga0495680_0000389 | 3300047322 | Bacteria | 49112 |
| 568 | Ga0495680_0041706 | 3300047322 | Bacteria | 3647 |
| 569 | Ga0495680_0094236 | 3300047322 | Bacteria | 2240 |
| 570 | Ga0495683_0000027 | 3300047323 | Bacteria | 153730 |
| 571 | Ga0495683_0005600 | 3300047323 | Bacteria | 6961 |
| 572 | Ga0495683_0009915 | 3300047323 | Bacteria | 5058 |
| 573 | Ga0495683_0029319 | 3300047323 | Bacteria | 2812 |
| 574 | Ga0495683_0125882 | 3300047323 | Bacteria | 1212 |
| 575 | Ga0495687_007564 | 3300047443 | Bacteria | 6374 |
| 576 | Ga0495687_008858 | 3300047443 | Bacteria | 5701 |
| 577 | Ga0495687_008882 | 3300047443 | Bacteria | 5690 |
| 578 | Ga0495675_0001992 | 3300047444 | Bacteria | 12194 |
| 579 | Ga0495675_0045221 | 3300047444 | Bacteria | 2803 |
| 580 | Ga0495677_0001311 | 3300047445 | Bacteria | 9948 |
| 581 | Ga0495679_000206 | 3300047446 | Bacteria | 51518 |
| 582 | Ga0495679_004106 | 3300047446 | Bacteria | 6808 |
| 583 | Ga0495679_022410 | 3300047446 | Bacteria | 2161 |
| 584 | Ga0495679_031224 | 3300047446 | Bacteria | 1720 |
| 585 | Ga0495673_0001678 | 3300047469 | Bacteria | 17025 |
| 586 | Ga0495673_0001942 | 3300047469 | Bacteria | 15338 |
| 587 | Ga0495673_0002278 | 3300047469 | Bacteria | 13760 |
| 588 | Ga0495673_0002436 | 3300047469 | Bacteria | 13101 |
| 589 | Ga0495673_0004202 | 3300047469 | Bacteria | 9086 |
| 590 | Ga0495673_0004241 | 3300047469 | Bacteria | 9048 |
| 591 | Ga0495673_0005184 | 3300047469 | Bacteria | 7932 |
| 592 | Ga0495673_0006975 | 3300047469 | Bacteria | 6574 |
| 593 | Ga0495673_0007619 | 3300047469 | Bacteria | 6194 |
| 594 | Ga0495673_0007789 | 3300047469 | Bacteria | 6103 |
| 595 | Ga0495673_0009540 | 3300047469 | Bacteria | 5368 |
| 596 | Ga0495673_0011297 | 3300047469 | Bacteria | 4813 |
| 597 | Ga0495673_0021108 | 3300047469 | Bacteria | 3224 |
| 598 | Ga0495673_0065426 | 3300047469 | Bacteria | 1543 |
| 599 | Ga0495673_0073357 | 3300047469 | Bacteria | 1434 |
| 600 | Ga0495673_0088256 | 3300047469 | Bacteria | 1271 |
| 601 | Ga0495681_0000933 | 3300047470 | Bacteria | 22521 |
| 602 | Ga0495681_0001629 | 3300047470 | Bacteria | 16673 |
| 603 | Ga0495681_0002441 | 3300047470 | Bacteria | 13265 |
| 604 | Ga0495681_0002802 | 3300047470 | Bacteria | 12338 |
| 605 | Ga0495681_0004033 | 3300047470 | Bacteria | 10105 |
| 606 | Ga0495681_0004844 | 3300047470 | Bacteria | 9106 |
| 607 | Ga0495681_0004905 | 3300047470 | Bacteria | 9041 |
| 608 | Ga0495681_0005072 | 3300047470 | Bacteria | 8878 |
| 609 | Ga0495681_0006663 | 3300047470 | Bacteria | 7544 |
| 610 | Ga0495681_0015083 | 3300047470 | Bacteria | 4387 |
| 611 | Ga0495681_0018035 | 3300047470 | Bacteria | 3901 |
| 612 | Ga0495681_0119135 | 3300047470 | Bacteria | 1134 |
| 613 | Ga0495686_0004515 | 3300047472 | Bacteria | 11407 |
| 614 | Ga0495686_0014938 | 3300047472 | Bacteria | 5325 |
| 615 | Ga0495686_0024698 | 3300047472 | Bacteria | 3945 |
| 616 | Ga0495686_0095571 | 3300047472 | Bacteria | 1799 |
| 617 | Ga0495593_0042390 | 3300047673 | Bacteria | 2442 |
| 618 | Ga0495593_0098135 | 3300047673 | Bacteria | 1504 |
| 619 | Ga0495626_0000056 | 3300048091 | Bacteria | 150654 |
| 620 | Ga0495626_0001227 | 3300048091 | Bacteria | 21100 |
| 621 | Ga0495626_0002338 | 3300048091 | Bacteria | 13369 |
| 622 | Ga0495626_0002462 | 3300048091 | Bacteria | 12817 |
| 623 | Ga0495626_0003814 | 3300048091 | Bacteria | 9461 |
| 624 | Ga0495626_0012513 | 3300048091 | Bacteria | 4444 |
| 625 | Ga0495626_0018151 | 3300048091 | Bacteria | 3539 |
| 626 | Ga0495626_0026890 | 3300048091 | Bacteria | 2799 |
| 627 | Ga0495626_0040080 | 3300048091 | Bacteria | 2213 |
| 628 | Ga0495626_0045239 | 3300048091 | Bacteria | 2056 |
| 629 | Ga0496102_0000242 | 3300048905 | Bacteria | 71504 |
| 630 | Ga0496102_0027924 | 3300048905 | Bacteria | 5042 |
| 631 | Ga0496103_0011686 | 3300048906 | Bacteria | 5207 |
| 632 | Ga0496110_0076973 | 3300048913 | Bacteria | 2967 |
| 633 | Ga0496112_0087855 | 3300048915 | Bacteria | 3076 |
| 634 | Ga0496112_0198917 | 3300048915 | Bacteria | 1964 |
| 635 | Ga0496116_0000126 | 3300048919 | Bacteria | 160425 |
| 636 | Ga0496116_0001433 | 3300048919 | Bacteria | 26786 |
| 637 | Ga0496116_0002028 | 3300048919 | Bacteria | 21733 |
| 638 | Ga0496116_0031666 | 3300048919 | Bacteria | 3781 |
| 639 | Ga0496116_0034437 | 3300048919 | Bacteria | 3573 |
| 640 | Ga0496116_0163919 | 3300048919 | Bacteria | 1215 |
| 641 | Ga0496117_0003126 | 3300048920 | Bacteria | 19758 |
| 642 | Ga0496117_0009272 | 3300048920 | Bacteria | 9197 |
| 643 | Ga0496117_0023967 | 3300048920 | Bacteria | 4844 |
| 644 | Ga0496117_0056171 | 3300048920 | Bacteria | 2744 |
| 645 | Ga0496118_0031684 | 3300048921 | Bacteria | 4376 |
| 646 | Ga0496118_0038526 | 3300048921 | Bacteria | 3829 |
| 647 | Ga0496118_0055917 | 3300048921 | Bacteria | 2971 |
| 648 | Ga0496118_0058136 | 3300048921 | Bacteria | 2892 |
| 649 | Ga0496119_0090465 | 3300048922 | Bacteria | 1740 |
| 650 | Ga0496120_0010283 | 3300048923 | Bacteria | 6545 |
| 651 | Ga0496121_0003009 | 3300048924 | Bacteria | 24478 |
| 652 | Ga0496121_0003989 | 3300048924 | Bacteria | 20359 |
| 653 | Ga0496121_0031977 | 3300048924 | Bacteria | 4795 |
| 654 | Ga0496121_0043290 | 3300048924 | Bacteria | 3901 |
| 655 | Ga0496122_0000122 | 3300048925 | Bacteria | 181491 |
| 656 | Ga0496122_0009715 | 3300048925 | Bacteria | 10055 |
| 657 | Ga0496122_0011118 | 3300048925 | Bacteria | 9171 |
| 658 | Ga0496122_0012431 | 3300048925 | Bacteria | 8475 |
| 659 | Ga0496123_0001340 | 3300048926 | Bacteria | 34830 |
| 660 | Ga0496123_0007328 | 3300048926 | Bacteria | 10451 |
| 661 | Ga0496123_0014734 | 3300048926 | Bacteria | 6459 |
| 662 | Ga0496123_0023907 | 3300048926 | Bacteria | 4663 |
| 663 | Ga0496123_0070804 | 3300048926 | Bacteria | 2179 |
| 664 | Ga0496124_0000222 | 3300048927 | Bacteria | 110854 |
| 665 | Ga0496124_0001779 | 3300048927 | Bacteria | 29980 |
| 666 | Ga0496124_0009865 | 3300048927 | Bacteria | 9765 |
| 667 | Ga0496124_0010893 | 3300048927 | Bacteria | 9149 |
| 668 | Ga0496124_0023016 | 3300048927 | Bacteria | 5699 |
| 669 | Ga0496124_0033211 | 3300048927 | Bacteria | 4541 |
| 670 | Ga0496124_0146380 | 3300048927 | Bacteria | 1858 |
| 671 | Ga0496124_0235483 | 3300048927 | Bacteria | 1365 |
| 672 | Ga0496125_0010865 | 3300048928 | Bacteria | 9163 |
| 673 | Ga0496126_0187884 | 3300048929 | Bacteria | 1751 |
| 674 | Ga0495678_000039 | 3300049459 | Bacteria | 191665 |
| 675 | Ga0495678_009205 | 3300049459 | Bacteria | 4912 |
| 676 | Ga0495678_011056 | 3300049459 | Bacteria | 4340 |
| 677 | Ga0495678_012322 | 3300049459 | Bacteria | 4057 |
| 678 | Ga0495678_012401 | 3300049459 | Bacteria | 4044 |
| 679 | Ga0495678_015646 | 3300049459 | Bacteria | 3485 |
| 680 | Ga0495678_015647 | 3300049459 | Bacteria | 3485 |
| 681 | Ga0495678_021493 | 3300049459 | Bacteria | 2840 |
| 682 | Ga0495678_033742 | 3300049459 | Bacteria | 2111 |
| 683 | Ga0495678_039609 | 3300049459 | Bacteria | 1899 |
| 684 | Ga0495682_0000078 | 3300049460 | Bacteria | 85448 |
| 685 | Ga0495682_0000860 | 3300049460 | Bacteria | 18879 |
| 686 | Ga0495682_0001344 | 3300049460 | Bacteria | 13589 |
| 687 | Ga0495682_0011856 | 3300049460 | Bacteria | 3350 |
| 688 | Ga0495682_0029581 | 3300049460 | Bacteria | 2029 |
| 689 | Ga0495682_0036893 | 3300049460 | Bacteria | 1798 |
| 690 | Ga0495682_0041365 | 3300049460 | Bacteria | 1689 |
| 691 | nmdc:mga00v17_272728_c1 | 3300050491 | Bacteria | 1098 |
| 692 | Ga0500572_001262 | 3300053111 | Bacteria | 7126 |
| 693 | 2511254424 | 2511231004 | Bacteria | 6669789 |
| 694 | 2511267874 | 2511231006 | Bacteria | 6794709 |
| 695 | 2511274281 | 2511231007 | Bacteria | 6306603 |
| 696 | 2511291885 | 2511231010 | Bacteria | 6373152 |
| 697 | 2511294983 | 2511231011 | Bacteria | 6149768 |
| 698 | 2511304402 | 2511231012 | Bacteria | 6738011 |
| 699 | 2511312889 | 2511231014 | Bacteria | 6462302 |
| 700 | 2511319164 | 2511231015 | Bacteria | 6598026 |
| 701 | 2511329307 | 2511231016 | Bacteria | 6704427 |
| 702 | 2511333081 | 2511231017 | Bacteria | 6503007 |
| 703 | 2511341255 | 2511231018 | Bacteria | 6436256 |
| 704 | 2511341798 | 2511231019 | Bacteria | 6520662 |
| 705 | 2511350897 | 2511231020 | Bacteria | 6115223 |
| 706 | 2511354631 | 2511231021 | Bacteria | 7302637 |
| 707 | 2511364933 | 2511231022 | Bacteria | 6719296 |
| 708 | 2511366925 | 2511231023 | Bacteria | 6808468 |
| 709 | 2511412248 | 2511231031 | Bacteria | 6558529 |
| 710 | 2511823397 | 2511231156 | Bacteria | 6845832 |
| 711 | 2512328997 | 2512047018 | Bacteria | 6663241 |
| 712 | 2555244587 | 2554235231 | Bacteria | 5215788 |
| 713 | 2555668422 | 2554235341 | Bacteria | 6867980 |
| 714 | 2583790632 | 2582580891 | Bacteria | 6800976 |
| 715 | 2597856605 | 2597489887 | Bacteria | 6666321 |
| 716 | 2597862706 | 2597489888 | Bacteria | 6179543 |
| 717 | 2599330086 | 2599185155 | Bacteria | 5827168 |
| 718 | 2599355422 | 2599185160 | Bacteria | 6844013 |
| 719 | 2599360759 | 2599185161 | Bacteria | 6960462 |
| 720 | 2599367081 | 2599185162 | Bacteria | 6957254 |
| 721 | 2599373871 | 2599185163 | Bacteria | 6995158 |
| 722 | 2599380528 | 2599185164 | Bacteria | 6841688 |
| 723 | 2599386975 | 2599185165 | Bacteria | 6843250 |
| 724 | 2599392729 | 2599185166 | Bacteria | 6959206 |
| 725 | 2599404496 | 2599185168 | Bacteria | 6997636 |
| 726 | 2599462256 | 2599185181 | Bacteria | 6844519 |
| 727 | 2599466702 | 2599185182 | Bacteria | 6883168 |
| 728 | 2599483145 | 2599185185 | Bacteria | 6652270 |
| 729 | 2599490652 | 2599185186 | Bacteria | 6831633 |
| 730 | 2599615488 | 2599185212 | Bacteria | 6765997 |
| 731 | 2599772792 | 2599185248 | Bacteria | 6696816 |
| 732 | 2599805046 | 2599185257 | Bacteria | 6492581 |
| 733 | 2599889288 | 2599185289 | Bacteria | 6778765 |
| 734 | 2599896610 | 2599185291 | Bacteria | 6775623 |
| 735 | 2599931852 | 2599185300 | Bacteria | 6062622 |
| 736 | 2599945503 | 2599185302 | Bacteria | 5954930 |
| 737 | 2599956621 | 2599185304 | Bacteria | 5951361 |
| 738 | 2599962559 | 2599185305 | Bacteria | 6748700 |
| 739 | 2599968371 | 2599185306 | Bacteria | 6637356 |
| 740 | 2599974095 | 2599185307 | Bacteria | 6194719 |
| 741 | 2599979558 | 2599185308 | Bacteria | 6621546 |
| 742 | 2599985457 | 2599185309 | Bacteria | 5969593 |
| 743 | 2599991792 | 2599185310 | Bacteria | 6014457 |
| 744 | 2599996620 | 2599185311 | Bacteria | 6354990 |
| 745 | 2600002411 | 2599185312 | Bacteria | 5912071 |
| 746 | 2600006822 | 2599185313 | Bacteria | 6658188 |
| 747 | 2600013370 | 2599185314 | Bacteria | 6621749 |
| 748 | 2600020083 | 2599185315 | Bacteria | 6771107 |
| 749 | 2600026086 | 2599185316 | Bacteria | 6320029 |
| 750 | 2600031730 | 2599185317 | Bacteria | 6435722 |
| 751 | 2600036373 | 2599185318 | Bacteria | 6961590 |
| 752 | 2600043672 | 2599185319 | Bacteria | 6637840 |
| 753 | 2600049944 | 2599185320 | Bacteria | 5963263 |
| 754 | 2600053460 | 2599185321 | Bacteria | 6764560 |
| 755 | 2600061888 | 2599185322 | Bacteria | 6763055 |
| 756 | 2600067114 | 2599185323 | Bacteria | 6688755 |
| 757 | 2600070454 | 2599185324 | Bacteria | 6590677 |
| 758 | 2600080064 | 2599185325 | Bacteria | 6324919 |
| 759 | 2600214878 | 2599185356 | Bacteria | 6843884 |
| 760 | 2600361499 | 2600254930 | Bacteria | 6431253 |
| 761 | 2600363759 | 2600254931 | Bacteria | 6734225 |
| 762 | 2601625745 | 2600255283 | Bacteria | 6061572 |
| 763 | 2601691277 | 2600255296 | Bacteria | 5784754 |
| 764 | 2601774417 | 2600255313 | Bacteria | 6842543 |
| 765 | 2601799907 | 2600255318 | Bacteria | 6383414 |
| 766 | 2606074294 | 2603880185 | Bacteria | 6379190 |
| 767 | 2606127157 | 2603880199 | Bacteria | 6377649 |
| 768 | 2621301163 | 2619619299 | Bacteria | 6649820 |
| 769 | 2624479190 | 2623620443 | Bacteria | 6427864 |
| 770 | 2624493809 | 2623620446 | Bacteria | 6500345 |
| 771 | 2643845207 | 2643221565 | Bacteria | 6216018 |
| 772 | 2643873071 | 2643221571 | Bacteria | 6228673 |
| 773 | 2643951971 | 2643221589 | Bacteria | 6250934 |
| 774 | 2644024270 | 2643221602 | Bacteria | 6249926 |
| 775 | 2644283570 | 2643221650 | Bacteria | 7029547 |
| 776 | 2652547983 | 2651869719 | Bacteria | 6047974 |
| 777 | 2671090485 | 2667528170 | Bacteria | 6786960 |
| 778 | 2671098024 | 2667528171 | Bacteria | 6900659 |
| 779 | 2671127783 | 2667528176 | Bacteria | 6724917 |
| 780 | 2671768220 | 2671180172 | Bacteria | 6495783 |
| 781 | 2678262323 | 2675903515 | Bacteria | 6580491 |
| 782 | 2715751726 | 2713897148 | Bacteria | 5883533 |
| 783 | 2715759721 | 2713897149 | Bacteria | 6506249 |
| 784 | 2723247577 | 2721755607 | Bacteria | 5841722 |
| 785 | 2738691563 | 2738541271 | Bacteria | 5657310 |
| 786 | 2739198707 | 2738543004 | Bacteria | 6381073 |
| 787 | 2739256529 | 2738543015 | Bacteria | 6750701 |
| 788 | 2739267338 | 2738543016 | Bacteria | 5657564 |
| 789 | 2739314345 | 2738543025 | Bacteria | 6600348 |
| 790 | 2743736029 | 2740892503 | Bacteria | 6855563 |
| 791 | 2745008670 | 2744054620 | Bacteria | 6551379 |
| 792 | 2774121403 | 2773857670 | Bacteria | 6407454 |
| 793 | 2774136037 | 2773857673 | Bacteria | 6513460 |
| 794 | 2784260106 | 2784132063 | Bacteria | 6262788 |
| 795 | 2784315709 | 2784132072 | Bacteria | 6596533 |
| 796 | 2794596121 | 2791355520 | Bacteria | 5948615 |
| 797 | 2807406879 | 2806310737 | Bacteria | 5751088 |
| 798 | 2807455211 | 2806310745 | Bacteria | 5742165 |
| 799 | 2808856804 | 2808606361 | Bacteria | 6136259 |
| 800 | 2808924085 | 2808606376 | Bacteria | 6248667 |
| 801 | 2808936747 | 2808606378 | Bacteria | 6177535 |
| 802 | 2808946026 | 2808606380 | Bacteria | 6248705 |
| 803 | 2808965191 | 2808606383 | Bacteria | 6138645 |
| 804 | 2809000083 | 2808606389 | Bacteria | 6138126 |
| 805 | 2809216142 | 2808606445 | Bacteria | 6057339 |
| 806 | 2819654595 | 2818991456 | Bacteria | 6123676 |
| 807 | 2819703109 | 2818991464 | Bacteria | 6907494 |
| 808 | 2825653322 | 2825651385 | Bacteria | 6715909 |
| 809 | 2826585724 | 2826581358 | Bacteria | 5963467 |
| 810 | 2842818594 | 2842815866 | Bacteria | 5947510 |
| 811 | 2842830208 | 2842826826 | Bacteria | 5974129 |
| 812 | 2842832989 | 2842832357 | Bacteria | 5959113 |
| 813 | 2842839978 | 2842837860 | Bacteria | 6066181 |
| 814 | 2842848395 | 2842843487 | Bacteria | 6004777 |
| 815 | 2842853816 | 2842849001 | Bacteria | 5924277 |
| 816 | 2842858931 | 2842854478 | Bacteria | 6143501 |
| 817 | 2844668936 | 2844665904 | Bacteria | 6817974 |
| 818 | 2852658663 | 2852657418 | Bacteria | 6472974 |
| 819 | 2860340303 | 2860339153 | Bacteria | 6846989 |
| 820 | 2878031150 | 2878029506 | Bacteria | 6418441 |
| 821 | 2880232048 | 2880230671 | Bacteria | 6140320 |
| 822 | 2904522417 | 2904518522 | Bacteria | 6068986 |
| 823 | 2904551560 | 2904550169 | Bacteria | 6221258 |
| 824 | 2913038298 | 2913036834 | Bacteria | 6704877 |
| 825 | 2917072190 | 2917070673 | Bacteria | 6868303 |
| 826 | 2919064334 | 2919063839 | Bacteria | 6302690 |
| 827 | 2919386176 | 2919385768 | Bacteria | 5897293 |
| 828 | 2919481567 | 2919481497 | Bacteria | 6907839 |
| 829 | 2919491742 | 2919487758 | Bacteria | 5929766 |
| 830 | 2919700285 | 2919697872 | Bacteria | 6553725 |
| 831 | 2923155039 | 2923153595 | Bacteria | 6870622 |
| 832 | 2923587585 | 2923586266 | Bacteria | 6565975 |
| 833 | 2929145739 | 2929144301 | Bacteria | 6622272 |
| 834 | 2931370924 | 2931369376 | Bacteria | 6847892 |
| 835 | 2931399791 | 2931396565 | Bacteria | 7251677 |
| 836 | 2935354361 | 2935353572 | Unclassified | 6955622 |
| 837 | 2939637740 | 2939636861 | Bacteria | 6297853 |
| 838 | 2945961675 | 2945961074 | Bacteria | 7342064 |
| 839 | 2947236220 | 2947233263 | Bacteria | 6439278 |
| 840 | 2969305977 | 2969304461 | Bacteria | 6601805 |
| 841 | 2974292437 | 2974289157 | Bacteria | 6080362 |
| 842 | 2984291001 | 2984286254 | Bacteria | 6702062 |
| 843 | 2988733278 | 2988728565 | Bacteria | 6124362 |
| 844 | 2998141384 | 2998139840 | Bacteria | 6073514 |
| 845 | 3007420834 | 3007419365 | Bacteria | 7026924 |
| 846 | 3007512763 | 3007511990 | Bacteria | 6481491 |
| 847 | 3007616228 | 3007614139 | Bacteria | 6053559 |
| 848 | 3007620461 | 3007619802 | Bacteria | 6411688 |
| 849 | 3007723037 | 3007718800 | Bacteria | 5971527 |
| 850 | 3007855978 | 3007855910 | Bacteria | 5637581 |
| 851 | 3007863384 | 3007861166 | Bacteria | 6045338 |
| 852 | 3007867930 | 3007866637 | Bacteria | 5899198 |
| 853 | 3007875714 | 3007872151 | Bacteria | 5268868 |
| 854 | 637318784 | 637000220 | Bacteria | 7074893 |
| 855 | 8015689261 | 8015687852 | Bacteria | 6613826 |
| 856 | 8019776940 | 8019775933 | Bacteria | 6858656 |
| 857 | 8029999366 | 8029995093 | Bacteria | 5990776 |
| 858 | 8054351836 | 8054347763 | Bacteria | 5901107 |
| 859 | 8055772377 | 8055770955 | Bacteria | 6827675 |
| 860 | 8056117426 | 8056115690 | Bacteria | 5527654 |
| 861 | 8056124885 | 8056120720 | Bacteria | 5758328 |
| 862 | 8056127425 | 8056125926 | Bacteria | 6228218 |
| 863 | 8056138564 | 8056137416 | Bacteria | 6147080 |
| 864 | 8056147537 | 8056143049 | Bacteria | 6307666 |
| 865 | 8056149575 | 8056148874 | Bacteria | 6479865 |
| 866 | 8056159384 | 8056155041 | Bacteria | 6486948 |
| 867 | 8056169676 | 8056166840 | Bacteria | 5820959 |
| 868 | 8056175785 | 8056172158 | Bacteria | 6133900 |
| 869 | 8056180234 | 8056177738 | Bacteria | 6748268 |
| 870 | 8056570046 | 8056569372 | Bacteria | 5997322 |
| 871 | Ga0495671_0039670 | |||
| 872 | MRS2a_Contig_27 | |||
| 873 | MRS2a_Contig_6918 | |||
| 874 | MRS2a_Contig_8388 | |||
| 875 | JGI25162J39368_1000054 | |||
| 876 | JGI25163J39215_1000844 | |||
| 877 | JGI25163J39215_1000977 | |||
| 878 | JGI25164J39214_1000029 | |||
| 879 | JGI25164J39214_1000106 | |||
| 880 | JGI25165J46597_1000111 | |||
| 881 | JGI25165J46597_1000217 | |||
| 882 | Ga0055539_1000147 | |||
| 883 | Ga0055533_1000151 | |||
| 884 | Ga0055532_1000108 | |||
| 885 | Ga0055525_1000199 | |||
| 886 | Ga0055536_1000043 | |||
| 887 | Ga0055530_10000031 | |||
| 888 | Ga0055530_10000701 | |||
| 889 | Ga0055530_10002189 | |||
| 890 | Ga0055540_1000415 | |||
| 891 | Ga0055540_1000503 | |||
| 892 | Ga0055540_1000542 | |||
| 893 | Ga0055531_10000283 | |||
| 894 | Ga0055541_1000099 | |||
| 895 | Ga0065714_10003068 | |||
| 896 | Ga0065714_10004204 | |||
| 897 | Ga0065712_10004475 | |||
| 898 | Ga0065715_10022496 | |||
| 899 | Ga0070669_100015823 | |||
| 900 | Ga0075364_10158465 | |||
| 901 | Ga0075432_10001832 | |||
| 902 | Ga0075432_10013045 | |||
| 903 | Ga0075362_10056685 | |||
| 904 | Ga0075362_10104725 | |||
| 905 | Ga0075436_100020363 | |||
| 906 | Ga0079104_1000090 | |||
| 907 | Ga0079104_1000134 | |||
| 908 | Ga0099826_10003760 | |||
| 909 | Ga0105251_10000004 | |||
| 910 | Ga0105251_10001609 | |||
| 911 | Ga0105251_10012530 | |||
| 912 | Ga0105251_10021638 | |||
| 913 | Ga0105251_10049420 | |||
| 914 | Ga0105244_10006961 | |||
| 915 | Ga0105244_10012584 | |||
| 916 | Ga0105244_10018996 | |||
| 917 | Ga0105244_10043686 | |||
| 918 | Ga0105244_10051369 | |||
| 919 | Ga0105250_10003140 | |||
| 920 | Ga0105250_10007114 | |||
| 921 | Ga0105250_10025066 | |||
| 922 | Ga0105250_10090966 | |||
| 923 | Ga0105250_10114794 | |||
| 924 | Ga0105243_10000144 | |||
| 925 | Ga0105243_10000218 | |||
| 926 | Ga0105243_10018270 | |||
| 927 | Ga0105243_10063489 | |||
| 928 | Ga0105243_10138450 | |||
| 929 | Ga0105242_10098447 | |||
| 930 | Ga0105249_10190333 | |||
| 931 | Ga0105246_10000228 | |||
| 932 | Ga0105246_10013274 | |||
| 933 | Ga0105246_10046460 | |||
| 934 | Ga0157345_1000028 | |||
| 935 | Ga0157373_10003627 | |||
| 936 | Ga0157373_10021164 | |||
| 937 | Ga0157373_10026485 | |||
| 938 | Ga0157371_10000230 | |||
| 939 | Ga0157371_10002163 | |||
| 940 | Ga0157371_10013816 | |||
| 941 | Ga0157370_10185227 | |||
| 942 | Ga0157370_10299394 | |||
| 943 | Ga0157370_10581416 | |||
| 944 | Ga0157369_10007762 | |||
| 945 | Ga0163162_10027149 | |||
| 946 | Ga0157372_10007104 | |||
| 947 | Ga0182008_10000783 | |||
| 948 | Ga0182008_10009438 | |||
| 949 | Ga0182008_10009976 | |||
| 950 | Ga0182008_10013208 | |||
| 951 | Ga0182008_10044468 | |||
| 952 | Ga0182008_10045368 | |||
| 953 | Ga0182006_1001311 | |||
| 954 | Ga0182006_1001590 | |||
| 955 | Ga0182006_1005933 | |||
| 956 | Ga0182006_1006304 | |||
| 957 | Ga0182006_1021756 | |||
| 958 | Ga0182006_1073939 | |||
| 959 | Ga0182007_10001309 | |||
| 960 | Ga0182005_1001728 | |||
| 961 | Ga0182005_1070986 | |||
| 962 | Ga0163161_10003944 | |||
| 963 | Ga0163161_10009858 | |||
| 964 | Ga0163161_10015005 | |||
| 965 | Ga0163161_10059859 | |||
| 966 | Ga0209760_100015 | |||
| 967 | Ga0209760_100047 | |||
| 968 | Ga0209784_100015 | |||
| 969 | Ga0209566_100012 | |||
| 970 | Ga0209674_100027 | |||
| 971 | Ga0209147_100019 | |||
| 972 | Ga0209563_100031 | |||
| 973 | Ga0207427_100001 | |||
| 974 | Ga0207427_100029 | |||
| 975 | Ga0209437_100003 | |||
| 976 | Ga0209437_100009 | |||
| 977 | Ga0209258_100364 | |||
| 978 | Ga0209646_1000199 | |||
| 979 | Ga0209677_100016 | |||
| 980 | Ga0209759_1006450 | |||
| 981 | Ga0209233_1000007 | |||
| 982 | Ga0209233_1000032 | |||
| 983 | Ga0209675_1011935 | |||
| 984 | Ga0209676_1000016 | |||
| 985 | Ga0209676_1000033 | |||
| 986 | Ga0209676_1000080 | |||
| 987 | Ga0209676_1001858 | |||
| 988 | Ga0209676_1003397 | |||
| 989 | Ga0209050_1000009 | |||
| 990 | Ga0209050_1000036 | |||
| 991 | Ga0209050_1000117 | |||
| 992 | Ga0209050_1001816 | |||
| 993 | Ga0209051_1000053 | |||
| 994 | Ga0209051_1000077 | |||
| 995 | Ga0209051_1000094 | |||
| 996 | Ga0209051_1028897 | |||
| 997 | Ga0209257_1000173 | |||
| 998 | Ga0209257_1010389 | |||
| 999 | Ga0207696_1000044 | |||
| 1000 | Ga0207696_1000083 | |||
| 1001 | Ga0207696_1012583 | |||
| 1002 | Ga0207696_1034035 | |||
| 1003 | Ga0207655_1000005 | |||
| 1004 | Ga0207655_1000015 | |||
| 1005 | Ga0207655_1000193 | |||
| 1006 | Ga0207655_1001511 | |||
| 1007 | Ga0207655_1002564 | |||
| 1008 | Ga0207655_1004205 | |||
| 1009 | Ga0207655_1009831 | |||
| 1010 | Ga0207655_1010304 | |||
| 1011 | Ga0207655_1042588 | |||
| 1012 | Ga0207713_1000013 | |||
| 1013 | Ga0207713_1000933 | |||
| 1014 | Ga0207713_1000977 | |||
| 1015 | Ga0207713_1003442 | |||
| 1016 | Ga0207713_1006328 | |||
| 1017 | Ga0207713_1008305 | |||
| 1018 | Ga0207713_1016990 | |||
| 1019 | Ga0207713_1047848 | |||
| 1020 | Ga0207681_10006317 | |||
| 1021 | Ga0207706_10087349 | |||
| 1022 | Ga0207709_10000036 | |||
| 1023 | Ga0207709_10000250 | |||
| 1024 | Ga0207709_10038253 | |||
| 1025 | Ga0207712_10091085 | |||
| 1026 | Ga0209281_1000013 | |||
| 1027 | Ga0209281_1000172 | |||
| 1028 | Ga0209281_1012052 | |||
| 1029 | Ga0207428_10026789 | |||
| 1030 | Ga0207428_10032474 | |||
| 1031 | Ga0207428_10070618 | |||
| 1032 | Ga0207428_10071502 | |||
| 1033 | Ga0316178_1048493 | |||
| 1034 | Ga0307408_100010934 | |||
| 1035 | Ga0307408_100091925 | |||
| 1036 | Ga0307408_100190297 | |||
| 1037 | Ga0307516_10195252 | |||
| 1038 | Ga0307405_10007758 | |||
| 1039 | Ga0307412_10003255 | |||
| 1040 | Ga0307412_10034711 | |||
| 1041 | Ga0307412_10050066 | |||
| 1042 | Ga0307416_100109692 | |||
| 1043 | Ga0307414_10011270 | |||
| 1044 | Ga0307411_10008164 | |||
| 1045 | Ga0307510_10054802 | |||
| 1046 | Ga0237819_00586 | |||
| 1047 | Ga0439438_000992 | |||
| 1048 | Ga0439438_002440 | |||
| 1049 | Ga0439438_003854 | |||
| 1050 | Ga0439438_004148 | |||
| 1051 | Ga0439438_010720 | |||
| 1052 | Ga0439447_001814 | |||
| 1053 | Ga0439447_002323 | |||
| 1054 | Ga0439447_006517 | |||
| 1055 | Ga0439447_011254 | |||
| 1056 | Ga0439466_0006472 | |||
| 1057 | Ga0439466_0007459 | |||
| 1058 | Ga0439466_0024748 | |||
| 1059 | Ga0439466_0037897 | |||
| 1060 | Ga0439465_0041190 | |||
| 1061 | Ga0439432_009021 | |||
| 1062 | Ga0439432_019659 | |||
| 1063 | Ga0439432_021951 | |||
| 1064 | Ga0439432_050079 | |||
| 1065 | Ga0439451_001403 | |||
| 1066 | Ga0439452_000135 | |||
| 1067 | Ga0439452_000233 | |||
| 1068 | Ga0439452_000500 | |||
| 1069 | Ga0439456_005538 | |||
| 1070 | Ga0439456_016095 | |||
| 1071 | Ga0439456_033031 | |||
| 1072 | Ga0439463_000242 | |||
| 1073 | Ga0439463_001060 | |||
| 1074 | Ga0439463_006107 | |||
| 1075 | Ga0439463_031584 | |||
| 1076 | Ga0450911_000292 | |||
| 1077 | Ga0450911_002178 | |||
| 1078 | Ga0450911_003370 | |||
| 1079 | Ga0450919_001307 | |||
| 1080 | Ga0450920_002749 | |||
| 1081 | Ga0450922_003684 | |||
| 1082 | Ga0450890_000719 | |||
| 1083 | Ga0450900_000487 | |||
| 1084 | Ga0450903_001649 | |||
| 1085 | Ga0450904_002515 | |||
| 1086 | Ga0450906_000157 | |||
| 1087 | Ga0450906_000365 | |||
| 1088 | Ga0450906_006822 | |||
| 1089 | Ga0450907_002004 | |||
| 1090 | Ga0450907_004429 | |||
| 1091 | Ga0450910_002158 | |||
| 1092 | Ga0450910_002608 | |||
| 1093 | Ga0450908_003379 | |||
| 1094 | Ga0450909_000555 | |||
| 1095 | Ga0439460_0000244 | |||
| 1096 | Ga0439460_0007680 | |||
| 1097 | Ga0495617_000917 | |||
| 1098 | Ga0495617_006320 | |||
| 1099 | Ga0495617_011885 | |||
| 1100 | Ga0495617_015738 | |||
| 1101 | Ga0495617_073141 | |||
| 1102 | Ga0495627_000021 | |||
| 1103 | Ga0495627_000279 | |||
| 1104 | Ga0495627_001683 | |||
| 1105 | Ga0495627_002401 | |||
| 1106 | Ga0495627_023988 | |||
| 1107 | Ga0495627_046182 | |||
| 1108 | Ga0495603_0025417 | |||
| 1109 | Ga0495603_0092374 | |||
| 1110 | Ga0495590_0000904 | |||
| 1111 | Ga0495590_0002563 | |||
| 1112 | Ga0495591_000015 | |||
| 1113 | Ga0495591_000157 | |||
| 1114 | Ga0495591_002294 | |||
| 1115 | Ga0495591_003678 | |||
| 1116 | Ga0495591_007656 | |||
| 1117 | Ga0495591_009294 | |||
| 1118 | Ga0495591_011451 | |||
| 1119 | Ga0495591_012092 | |||
| 1120 | Ga0495591_023300 | |||
| 1121 | Ga0495591_034463 | |||
| 1122 | Ga0495629_0112860 | |||
| 1123 | Ga0495638_0006497 | |||
| 1124 | Ga0495638_0007291 | |||
| 1125 | Ga0495638_0008166 | |||
| 1126 | Ga0495638_0014786 | |||
| 1127 | Ga0495638_0017490 | |||
| 1128 | Ga0495638_0060203 | |||
| 1129 | Ga0495638_0071415 | |||
| 1130 | Ga0495638_0194092 | |||
| 1131 | Ga0495638_0210562 | |||
| 1132 | Ga0495653_0001346 | |||
| 1133 | Ga0495653_0023818 | |||
| 1134 | Ga0495653_0028429 | |||
| 1135 | Ga0495653_0038780 | |||
| 1136 | Ga0495650_0001786 | |||
| 1137 | Ga0495650_0004276 | |||
| 1138 | Ga0495650_0007982 | |||
| 1139 | Ga0495650_0008452 | |||
| 1140 | Ga0495650_0012856 | |||
| 1141 | Ga0495650_0059585 | |||
| 1142 | Ga0495650_0078913 | |||
| 1143 | Ga0495582_0037036 | |||
| 1144 | Ga0495605_0000016 | |||
| 1145 | Ga0495605_0000031 | |||
| 1146 | Ga0495605_0000558 | |||
| 1147 | Ga0495605_0000917 | |||
| 1148 | Ga0495605_0003396 | |||
| 1149 | Ga0495605_0005904 | |||
| 1150 | Ga0495605_0013182 | |||
| 1151 | Ga0495605_0014901 | |||
| 1152 | Ga0495605_0017011 | |||
| 1153 | Ga0495605_0020247 | |||
| 1154 | Ga0495605_0036050 | |||
| 1155 | Ga0495605_0051168 | |||
| 1156 | Ga0495605_0052758 | |||
| 1157 | Ga0495639_0000505 | |||
| 1158 | Ga0495639_0004261 | |||
| 1159 | Ga0495639_0135310 | |||
| 1160 | Ga0495584_0003601 | |||
| 1161 | Ga0495584_0004653 | |||
| 1162 | Ga0495584_0005548 | |||
| 1163 | Ga0495584_0012803 | |||
| 1164 | Ga0495584_0016800 | |||
| 1165 | Ga0495584_0019248 | |||
| 1166 | Ga0495584_0022955 | |||
| 1167 | Ga0495584_0030567 | |||
| 1168 | Ga0495584_0167310 | |||
| 1169 | Ga0495585_0000559 | |||
| 1170 | Ga0495585_0003008 | |||
| 1171 | Ga0495585_0008243 | |||
| 1172 | Ga0495585_0020410 | |||
| 1173 | Ga0495585_0105694 | |||
| 1174 | Ga0495594_0002203 | |||
| 1175 | Ga0495594_0026505 | |||
| 1176 | Ga0495596_0000073 | |||
| 1177 | Ga0495607_0000162 | |||
| 1178 | Ga0495607_0000166 | |||
| 1179 | Ga0495607_0001224 | |||
| 1180 | Ga0495607_0001547 | |||
| 1181 | Ga0495607_0004193 | |||
| 1182 | Ga0495607_0009369 | |||
| 1183 | Ga0495607_0010940 | |||
| 1184 | Ga0495607_0014937 | |||
| 1185 | Ga0495607_0016615 | |||
| 1186 | Ga0495607_0022185 | |||
| 1187 | Ga0495607_0050089 | |||
| 1188 | Ga0495607_0057695 | |||
| 1189 | Ga0495607_0088393 | |||
| 1190 | Ga0495583_0000041 | |||
| 1191 | Ga0495583_0000578 | |||
| 1192 | Ga0495583_0001999 | |||
| 1193 | Ga0495583_0002465 | |||
| 1194 | Ga0495583_0004895 | |||
| 1195 | Ga0495583_0005316 | |||
| 1196 | Ga0495583_0008381 | |||
| 1197 | Ga0495583_0009302 | |||
| 1198 | Ga0495583_0019989 | |||
| 1199 | Ga0495606_0000055 | |||
| 1200 | Ga0495606_0003469 | |||
| 1201 | Ga0495606_0005454 | |||
| 1202 | Ga0495606_0007059 | |||
| 1203 | Ga0495606_0007319 | |||
| 1204 | Ga0495606_0007485 | |||
| 1205 | Ga0495606_0010262 | |||
| 1206 | Ga0495606_0064861 | |||
| 1207 | Ga0495606_0131933 | |||
| 1208 | Ga0495606_0195005 | |||
| 1209 | Ga0495610_0004118 | |||
| 1210 | Ga0495610_0005910 | |||
| 1211 | Ga0495610_0010229 | |||
| 1212 | Ga0495610_0011436 | |||
| 1213 | Ga0495610_0012062 | |||
| 1214 | Ga0495610_0015222 | |||
| 1215 | Ga0495610_0022584 | |||
| 1216 | Ga0495610_0102106 | |||
| 1217 | Ga0495610_0136352 | |||
| 1218 | Ga0495616_0001130 | |||
| 1219 | Ga0495616_0001777 | |||
| 1220 | Ga0495616_0003265 | |||
| 1221 | Ga0495616_0003757 | |||
| 1222 | Ga0495620_0000015 | |||
| 1223 | Ga0495620_0000506 | |||
| 1224 | Ga0495620_0000863 | |||
| 1225 | Ga0495620_0004849 | |||
| 1226 | Ga0495620_0009210 | |||
| 1227 | Ga0495620_0010499 | |||
| 1228 | Ga0495620_0015063 | |||
| 1229 | Ga0495620_0018661 | |||
| 1230 | Ga0495620_0019786 | |||
| 1231 | Ga0495620_0132259 | |||
| 1232 | Ga0495628_0164159 | |||
| 1233 | Ga0495630_0280260 | |||
| 1234 | Ga0495631_0001850 | |||
| 1235 | Ga0495631_0005616 | |||
| 1236 | Ga0495631_0007239 | |||
| 1237 | Ga0495631_0040186 | |||
| 1238 | Ga0495631_0051083 | |||
| 1239 | Ga0495632_0001435 | |||
| 1240 | Ga0495632_0001837 | |||
| 1241 | Ga0495632_0002733 | |||
| 1242 | Ga0495632_0006118 | |||
| 1243 | Ga0495632_0011414 | |||
| 1244 | Ga0495632_0011955 | |||
| 1245 | Ga0495632_0015158 | |||
| 1246 | Ga0495632_0018221 | |||
| 1247 | Ga0495632_0025573 | |||
| 1248 | Ga0495632_0034409 | |||
| 1249 | Ga0495632_0048073 | |||
| 1250 | Ga0495632_0060280 | |||
| 1251 | Ga0495632_0095859 | |||
| 1252 | Ga0495637_0000381 | |||
| 1253 | Ga0495637_0001350 | |||
| 1254 | Ga0495637_0001569 | |||
| 1255 | Ga0495637_0003858 | |||
| 1256 | Ga0495637_0008406 | |||
| 1257 | Ga0495637_0011449 | |||
| 1258 | Ga0495637_0011853 | |||
| 1259 | Ga0495637_0012799 | |||
| 1260 | Ga0495637_0019606 | |||
| 1261 | Ga0495637_0030411 | |||
| 1262 | Ga0495637_0031167 | |||
| 1263 | Ga0495643_0047455 | |||
| 1264 | Ga0495644_0001206 | |||
| 1265 | Ga0495644_0002017 | |||
| 1266 | Ga0495644_0004657 | |||
| 1267 | Ga0495644_0006147 | |||
| 1268 | Ga0495648_0003497 | |||
| 1269 | Ga0495648_0006371 | |||
| 1270 | Ga0495648_0007480 | |||
| 1271 | Ga0495648_0017358 | |||
| 1272 | Ga0495648_0022434 | |||
| 1273 | Ga0495648_0030875 | |||
| 1274 | Ga0495648_0036886 | |||
| 1275 | Ga0495648_0119466 | |||
| 1276 | Ga0495648_0169502 | |||
| 1277 | Ga0495648_0176170 | |||
| 1278 | Ga0495648_0189135 | |||
| 1279 | Ga0495666_0006013 | |||
| 1280 | Ga0495666_0006053 | |||
| 1281 | Ga0495666_0006365 | |||
| 1282 | Ga0495666_0103725 | |||
| 1283 | Ga0495642_0000097 | |||
| 1284 | Ga0495642_0000978 | |||
| 1285 | Ga0495652_0063533 | |||
| 1286 | Ga0495654_0001879 | |||
| 1287 | Ga0495654_0002407 | |||
| 1288 | Ga0495654_0005990 | |||
| 1289 | Ga0495654_0012413 | |||
| 1290 | Ga0495654_0015539 | |||
| 1291 | Ga0495654_0022689 | |||
| 1292 | Ga0495654_0025549 | |||
| 1293 | Ga0495654_0027708 | |||
| 1294 | Ga0495654_0029401 | |||
| 1295 | Ga0495654_0053226 | |||
| 1296 | Ga0495654_0082401 | |||
| 1297 | Ga0495654_0122691 | |||
| 1298 | Ga0495654_0131052 | |||
| 1299 | Ga0495586_0005952 | |||
| 1300 | Ga0495587_0009349 | |||
| 1301 | Ga0495587_0015180 | |||
| 1302 | Ga0495609_0000015 | |||
| 1303 | Ga0495609_0000066 | |||
| 1304 | Ga0495609_0000070 | |||
| 1305 | Ga0495609_0002544 | |||
| 1306 | Ga0495609_0003946 | |||
| 1307 | Ga0495609_0017661 | |||
| 1308 | Ga0495609_0019551 | |||
| 1309 | Ga0495597_0000005 | |||
| 1310 | Ga0495597_0002158 | |||
| 1311 | Ga0495597_0003828 | |||
| 1312 | Ga0495597_0007453 | |||
| 1313 | Ga0495597_0009105 | |||
| 1314 | Ga0495597_0009234 | |||
| 1315 | Ga0495597_0012797 | |||
| 1316 | Ga0495597_0018160 | |||
| 1317 | Ga0495597_0082911 | |||
| 1318 | Ga0495597_0084591 | |||
| 1319 | Ga0495645_0037181 | |||
| 1320 | Ga0495622_0000912 | |||
| 1321 | Ga0495622_0002180 | |||
| 1322 | Ga0495622_0003574 | |||
| 1323 | Ga0495622_0008229 | |||
| 1324 | Ga0495622_0028587 | |||
| 1325 | Ga0495622_0132142 | |||
| 1326 | Ga0495622_0138018 | |||
| 1327 | Ga0495633_0000060 | |||
| 1328 | Ga0495633_0028641 | |||
| 1329 | Ga0495656_0000903 | |||
| 1330 | Ga0495656_0089496 | |||
| 1331 | Ga0495668_0000770 | |||
| 1332 | Ga0495668_0004101 | |||
| 1333 | Ga0495668_0009526 | |||
| 1334 | Ga0495668_0026100 | |||
| 1335 | Ga0495634_0001715 | |||
| 1336 | Ga0495611_0000934 | |||
| 1337 | Ga0495611_0002054 | |||
| 1338 | Ga0495611_0003737 | |||
| 1339 | Ga0495611_0021855 | |||
| 1340 | Ga0495625_0001491 | |||
| 1341 | Ga0495625_0005089 | |||
| 1342 | Ga0495625_0007191 | |||
| 1343 | Ga0495625_0009109 | |||
| 1344 | Ga0495625_0062760 | |||
| 1345 | Ga0495625_0088126 | |||
| 1346 | Ga0495625_0124923 | |||
| 1347 | Ga0495635_0005430 | |||
| 1348 | Ga0495635_0018843 | |||
| 1349 | Ga0495659_0000584 | |||
| 1350 | Ga0495661_0000110 | |||
| 1351 | Ga0495661_0000139 | |||
| 1352 | Ga0495661_0000194 | |||
| 1353 | Ga0495661_0003093 | |||
| 1354 | Ga0495661_0003941 | |||
| 1355 | Ga0495661_0185047 | |||
| 1356 | Ga0495588_0014890 | |||
| 1357 | Ga0495588_0028774 | |||
| 1358 | Ga0495588_0110514 | |||
| 1359 | Ga0495588_0174513 | |||
| 1360 | Ga0495623_0041019 | |||
| 1361 | Ga0495623_0205065 | |||
| 1362 | Ga0495646_0006481 | |||
| 1363 | Ga0495669_0000936 | |||
| 1364 | Ga0495669_0117603 | |||
| 1365 | Ga0495613_0012205 | |||
| 1366 | Ga0495624_0000167 | |||
| 1367 | Ga0495670_0005189 | |||
| 1368 | Ga0495670_0006573 | |||
| 1369 | Ga0495670_0007739 | |||
| 1370 | Ga0495670_0040081 | |||
| 1371 | Ga0495670_0063553 | |||
| 1372 | Ga0495670_0235294 | |||
| 1373 | Ga0495671_0000168 | |||
| 1374 | Ga0495671_0002259 | |||
| 1375 | Ga0495671_0014576 | |||
| 1376 | Ga0495671_0015419 | |||
| 1377 | Ga0495671_0028124 | |||
| 1378 | Ga0495671_0044437 | |||
| 1379 | Ga0495671_0076793 | |||
| 1380 | Ga0495671_0131019 | |||
| 1381 | Ga0495671_0139727 | |||
| 1382 | Ga0495649_0001678 | |||
| 1383 | Ga0495649_0006007 | |||
| 1384 | Ga0495649_0009516 | |||
| 1385 | Ga0495649_0016282 | |||
| 1386 | Ga0495649_0017462 | |||
| 1387 | Ga0495649_0017528 | |||
| 1388 | Ga0495649_0025308 | |||
| 1389 | Ga0495649_0070192 | |||
| 1390 | Ga0495649_0121109 | |||
| 1391 | Ga0495589_0000305 | |||
| 1392 | Ga0495589_0001305 | |||
| 1393 | Ga0495589_0001652 | |||
| 1394 | Ga0495589_0005876 | |||
| 1395 | Ga0495589_0005958 | |||
| 1396 | Ga0495589_0042974 | |||
| 1397 | Ga0495589_0095452 | |||
| 1398 | Ga0495589_0098549 | |||
| 1399 | Ga0495589_0122542 | |||
| 1400 | Ga0495600_0002016 | |||
| 1401 | Ga0495600_0047743 | |||
| 1402 | Ga0495660_0000469 | |||
| 1403 | Ga0495660_0009946 | |||
| 1404 | Ga0495660_0013051 | |||
| 1405 | Ga0495660_0014187 | |||
| 1406 | Ga0495660_0028687 | |||
| 1407 | Ga0495660_0044679 | |||
| 1408 | Ga0495660_0094535 | |||
| 1409 | Ga0495660_0116719 | |||
| 1410 | Ga0495660_0128535 | |||
| 1411 | Ga0495660_0128874 | |||
| 1412 | Ga0495660_0148528 | |||
| 1413 | Ga0495660_0164279 | |||
| 1414 | Ga0495581_0012130 | |||
| 1415 | Ga0495604_0004080 | |||
| 1416 | Ga0495636_0000726 | |||
| 1417 | Ga0495674_0099450 | |||
| 1418 | Ga0495672_0000985 | |||
| 1419 | Ga0495672_0003371 | |||
| 1420 | Ga0495672_0003898 | |||
| 1421 | Ga0495672_0008359 | |||
| 1422 | Ga0495672_0009540 | |||
| 1423 | Ga0495672_0011490 | |||
| 1424 | Ga0495672_0015367 | |||
| 1425 | Ga0495672_0015376 | |||
| 1426 | Ga0495672_0016049 | |||
| 1427 | Ga0495672_0020133 | |||
| 1428 | Ga0495672_0044268 | |||
| 1429 | Ga0495672_0065702 | |||
| 1430 | Ga0495672_0069794 | |||
| 1431 | Ga0495672_0087653 | |||
| 1432 | Ga0495672_0091914 | |||
| 1433 | Ga0495672_0093309 | |||
| 1434 | Ga0495672_0110709 | |||
| 1435 | Ga0495676_0000013 | |||
| 1436 | Ga0495676_0003992 | |||
| 1437 | Ga0495680_0000389 | |||
| 1438 | Ga0495680_0041706 | |||
| 1439 | Ga0495680_0094236 | |||
| 1440 | Ga0495683_0000027 | |||
| 1441 | Ga0495683_0005600 | |||
| 1442 | Ga0495683_0009915 | |||
| 1443 | Ga0495683_0029319 | |||
| 1444 | Ga0495683_0125882 | |||
| 1445 | Ga0495687_007564 | |||
| 1446 | Ga0495687_008858 | |||
| 1447 | Ga0495687_008882 | |||
| 1448 | Ga0495675_0001992 | |||
| 1449 | Ga0495675_0045221 | |||
| 1450 | Ga0495677_0001311 | |||
| 1451 | Ga0495679_000206 | |||
| 1452 | Ga0495679_004106 | |||
| 1453 | Ga0495679_022410 | |||
| 1454 | Ga0495679_031224 | |||
| 1455 | Ga0495673_0001678 | |||
| 1456 | Ga0495673_0001942 | |||
| 1457 | Ga0495673_0002278 | |||
| 1458 | Ga0495673_0002436 | |||
| 1459 | Ga0495673_0004202 | |||
| 1460 | Ga0495673_0004241 | |||
| 1461 | Ga0495673_0005184 | |||
| 1462 | Ga0495673_0006975 | |||
| 1463 | Ga0495673_0007619 | |||
| 1464 | Ga0495673_0007789 | |||
| 1465 | Ga0495673_0009540 | |||
| 1466 | Ga0495673_0011297 | |||
| 1467 | Ga0495673_0021108 | |||
| 1468 | Ga0495673_0065426 | |||
| 1469 | Ga0495673_0073357 | |||
| 1470 | Ga0495673_0088256 | |||
| 1471 | Ga0495681_0000933 | |||
| 1472 | Ga0495681_0001629 | |||
| 1473 | Ga0495681_0002441 | |||
| 1474 | Ga0495681_0002802 | |||
| 1475 | Ga0495681_0004033 | |||
| 1476 | Ga0495681_0004844 | |||
| 1477 | Ga0495681_0004905 | |||
| 1478 | Ga0495681_0005072 | |||
| 1479 | Ga0495681_0006663 | |||
| 1480 | Ga0495681_0015083 | |||
| 1481 | Ga0495681_0018035 | |||
| 1482 | Ga0495681_0119135 | |||
| 1483 | Ga0495686_0004515 | |||
| 1484 | Ga0495686_0014938 | |||
| 1485 | Ga0495686_0024698 | |||
| 1486 | Ga0495686_0095571 | |||
| 1487 | Ga0495593_0042390 | |||
| 1488 | Ga0495593_0098135 | |||
| 1489 | Ga0495626_0000056 | |||
| 1490 | Ga0495626_0001227 | |||
| 1491 | Ga0495626_0002338 | |||
| 1492 | Ga0495626_0002462 | |||
| 1493 | Ga0495626_0003814 | |||
| 1494 | Ga0495626_0012513 | |||
| 1495 | Ga0495626_0018151 | |||
| 1496 | Ga0495626_0026890 | |||
| 1497 | Ga0495626_0040080 | |||
| 1498 | Ga0495626_0045239 | |||
| 1499 | Ga0496102_0000242 | |||
| 1500 | Ga0496102_0027924 | |||
| 1501 | Ga0496103_0011686 | |||
| 1502 | Ga0496110_0076973 | |||
| 1503 | Ga0496112_0087855 | |||
| 1504 | Ga0496112_0198917 | |||
| 1505 | Ga0496116_0000126 | |||
| 1506 | Ga0496116_0001433 | |||
| 1507 | Ga0496116_0002028 | |||
| 1508 | Ga0496116_0031666 | |||
| 1509 | Ga0496116_0034437 | |||
| 1510 | Ga0496116_0163919 | |||
| 1511 | Ga0496117_0003126 | |||
| 1512 | Ga0496117_0009272 | |||
| 1513 | Ga0496117_0023967 | |||
| 1514 | Ga0496117_0056171 | |||
| 1515 | Ga0496118_0031684 | |||
| 1516 | Ga0496118_0038526 | |||
| 1517 | Ga0496118_0055917 | |||
| 1518 | Ga0496118_0058136 | |||
| 1519 | Ga0496119_0090465 | |||
| 1520 | Ga0496120_0010283 | |||
| 1521 | Ga0496121_0003009 | |||
| 1522 | Ga0496121_0003989 | |||
| 1523 | Ga0496121_0031977 | |||
| 1524 | Ga0496121_0043290 | |||
| 1525 | Ga0496122_0000122 | |||
| 1526 | Ga0496122_0009715 | |||
| 1527 | Ga0496122_0011118 | |||
| 1528 | Ga0496122_0012431 | |||
| 1529 | Ga0496123_0001340 | |||
| 1530 | Ga0496123_0007328 | |||
| 1531 | Ga0496123_0014734 | |||
| 1532 | Ga0496123_0023907 | |||
| 1533 | Ga0496123_0070804 | |||
| 1534 | Ga0496124_0000222 | |||
| 1535 | Ga0496124_0001779 | |||
| 1536 | Ga0496124_0009865 | |||
| 1537 | Ga0496124_0010893 | |||
| 1538 | Ga0496124_0023016 | |||
| 1539 | Ga0496124_0033211 | |||
| 1540 | Ga0496124_0146380 | |||
| 1541 | Ga0496124_0235483 | |||
| 1542 | Ga0496125_0010865 | |||
| 1543 | Ga0496126_0187884 | |||
| 1544 | Ga0495678_000039 | |||
| 1545 | Ga0495678_009205 | |||
| 1546 | Ga0495678_011056 | |||
| 1547 | Ga0495678_012322 | |||
| 1548 | Ga0495678_012401 | |||
| 1549 | Ga0495678_015646 | |||
| 1550 | Ga0495678_015647 | |||
| 1551 | Ga0495678_021493 | |||
| 1552 | Ga0495678_033742 | |||
| 1553 | Ga0495678_039609 | |||
| 1554 | Ga0495682_0000078 | |||
| 1555 | Ga0495682_0000860 | |||
| 1556 | Ga0495682_0001344 | |||
| 1557 | Ga0495682_0011856 | |||
| 1558 | Ga0495682_0029581 | |||
| 1559 | Ga0495682_0036893 | |||
| 1560 | Ga0495682_0041365 | |||
| 1561 | nmdc:mga00v17_272728_c1 | |||
| 1562 | Ga0500572_001262 | |||
| 1563 | 2511254424 | |||
| 1564 | 2511267874 | |||
| 1565 | 2511274281 | |||
| 1566 | 2511291885 | |||
| 1567 | 2511294983 | |||
| 1568 | 2511304402 | |||
| 1569 | 2511312889 | |||
| 1570 | 2511319164 | |||
| 1571 | 2511329307 | |||
| 1572 | 2511333081 | |||
| 1573 | 2511341255 | |||
| 1574 | 2511341798 | |||
| 1575 | 2511350897 | |||
| 1576 | 2511354631 | |||
| 1577 | 2511364933 | |||
| 1578 | 2511366925 | |||
| 1579 | 2511412248 | |||
| 1580 | 2511823397 | |||
| 1581 | 2512328997 | |||
| 1582 | 2555244587 | |||
| 1583 | 2555668422 | |||
| 1584 | 2583790632 | |||
| 1585 | 2597856605 | |||
| 1586 | 2597862706 | |||
| 1587 | 2599330086 | |||
| 1588 | 2599355422 | |||
| 1589 | 2599360759 | |||
| 1590 | 2599367081 | |||
| 1591 | 2599373871 | |||
| 1592 | 2599380528 | |||
| 1593 | 2599386975 | |||
| 1594 | 2599392729 | |||
| 1595 | 2599404496 | |||
| 1596 | 2599462256 | |||
| 1597 | 2599466702 | |||
| 1598 | 2599483145 | |||
| 1599 | 2599490652 | |||
| 1600 | 2599615488 | |||
| 1601 | 2599772792 | |||
| 1602 | 2599805046 | |||
| 1603 | 2599889288 | |||
| 1604 | 2599896610 | |||
| 1605 | 2599931852 | |||
| 1606 | 2599945503 | |||
| 1607 | 2599956621 | |||
| 1608 | 2599962559 | |||
| 1609 | 2599968371 | |||
| 1610 | 2599974095 | |||
| 1611 | 2599979558 | |||
| 1612 | 2599985457 | |||
| 1613 | 2599991792 | |||
| 1614 | 2599996620 | |||
| 1615 | 2600002411 | |||
| 1616 | 2600006822 | |||
| 1617 | 2600013370 | |||
| 1618 | 2600020083 | |||
| 1619 | 2600026086 | |||
| 1620 | 2600031730 | |||
| 1621 | 2600036373 | |||
| 1622 | 2600043672 | |||
| 1623 | 2600049944 | |||
| 1624 | 2600053460 | |||
| 1625 | 2600061888 | |||
| 1626 | 2600067114 | |||
| 1627 | 2600070454 | |||
| 1628 | 2600080064 | |||
| 1629 | 2600214878 | |||
| 1630 | 2600361499 | |||
| 1631 | 2600363759 | |||
| 1632 | 2601625745 | |||
| 1633 | 2601691277 | |||
| 1634 | 2601774417 | |||
| 1635 | 2601799907 | |||
| 1636 | 2606074294 | |||
| 1637 | 2606127157 | |||
| 1638 | 2621301163 | |||
| 1639 | 2624479190 | |||
| 1640 | 2624493809 | |||
| 1641 | 2643845207 | |||
| 1642 | 2643873071 | |||
| 1643 | 2643951971 | |||
| 1644 | 2644024270 | |||
| 1645 | 2644283570 | |||
| 1646 | 2652547983 | |||
| 1647 | 2671090485 | |||
| 1648 | 2671098024 | |||
| 1649 | 2671127783 | |||
| 1650 | 2671768220 | |||
| 1651 | 2678262323 | |||
| 1652 | 2715751726 | |||
| 1653 | 2715759721 | |||
| 1654 | 2723247577 | |||
| 1655 | 2738691563 | |||
| 1656 | 2739198707 | |||
| 1657 | 2739256529 | |||
| 1658 | 2739267338 | |||
| 1659 | 2739314345 | |||
| 1660 | 2743736029 | |||
| 1661 | 2745008670 | |||
| 1662 | 2774121403 | |||
| 1663 | 2774136037 | |||
| 1664 | 2784260106 | |||
| 1665 | 2784315709 | |||
| 1666 | 2794596121 | |||
| 1667 | 2807406879 | |||
| 1668 | 2807455211 | |||
| 1669 | 2808856804 | |||
| 1670 | 2808924085 | |||
| 1671 | 2808936747 | |||
| 1672 | 2808946026 | |||
| 1673 | 2808965191 | |||
| 1674 | 2809000083 | |||
| 1675 | 2809216142 | |||
| 1676 | 2819654595 | |||
| 1677 | 2819703109 | |||
| 1678 | 2825653322 | |||
| 1679 | 2826585724 | |||
| 1680 | 2842818594 | |||
| 1681 | 2842830208 | |||
| 1682 | 2842832989 | |||
| 1683 | 2842839978 | |||
| 1684 | 2842848395 | |||
| 1685 | 2842853816 | |||
| 1686 | 2842858931 | |||
| 1687 | 2844668936 | |||
| 1688 | 2852658663 | |||
| 1689 | 2860340303 | |||
| 1690 | 2878031150 | |||
| 1691 | 2880232048 | |||
| 1692 | 2904522417 | |||
| 1693 | 2904551560 | |||
| 1694 | 2913038298 | |||
| 1695 | 2917072190 | |||
| 1696 | 2919064334 | |||
| 1697 | 2919386176 | |||
| 1698 | 2919481567 | |||
| 1699 | 2919491742 | |||
| 1700 | 2919700285 | |||
| 1701 | 2923155039 | |||
| 1702 | 2923587585 | |||
| 1703 | 2929145739 | |||
| 1704 | 2931370924 | |||
| 1705 | 2931399791 | |||
| 1706 | 2935354361 | |||
| 1707 | 2939637740 | |||
| 1708 | 2945961675 | |||
| 1709 | 2947236220 | |||
| 1710 | 2969305977 | |||
| 1711 | 2974292437 | |||
| 1712 | 2984291001 | |||
| 1713 | 2988733278 | |||
| 1714 | 2998141384 | |||
| 1715 | 3007420834 | |||
| 1716 | 3007512763 | |||
| 1717 | 3007616228 | |||
| 1718 | 3007620461 | |||
| 1719 | 3007723037 | |||
| 1720 | 3007855978 | |||
| 1721 | 3007863384 | |||
| 1722 | 3007867930 | |||
| 1723 | 3007875714 | |||
| 1724 | 637318784 | |||
| 1725 | 8015689261 | |||
| 1726 | 8019776940 | |||
| 1727 | 8029999366 | |||
| 1728 | 8054351836 | |||
| 1729 | 8055772377 | |||
| 1730 | 8056117426 | |||
| 1731 | 8056124885 | |||
| 1732 | 8056127425 | |||
| 1733 | 8056138564 | |||
| 1734 | 8056147537 | |||
| 1735 | 8056149575 | |||
| 1736 | 8056159384 | |||
| 1737 | 8056169676 | |||
| 1738 | 8056175785 | |||
| 1739 | 8056180234 | |||
| 1740 | 8056570046 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vly-assembly1.cif.gz_A | crystal structure of a putative aminomethyltransferase (ygfz) from escherichia coli at 1.30 a resolution | 0.8853 | 4 | 306 |
| 1vly-assembly1.cif.gz_A | crystal structure of a putative aminomethyltransferase (ygfz) from escherichia coli at 1.30 a resolution | 0.8562 | 4 | 306 |
| 3ttg-assembly1.cif.gz_A | crystal structure of putative aminomethyltransferase from leptospirillum rubarum | 0.8432 | 4 | 302 |
| 1yx2-assembly1.cif.gz_A | crystal structure of the probable aminomethyltransferase from bacillus subtilis | 0.814 | 4 | 302 |
| 4pab-assembly2.cif.gz_B | crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate | 0.8113 | 4 | 302 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vlyA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains | 0.9554 | 14 | 98 | 3.30.70.1400 |
| af_E9AH81_4_151_3.30.70.1400 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains | 0.924 | 5 | 107 | 3.30.70.1400 |
| 1vlyA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains | 0.923 | 14 | 98 | 3.30.70.1400 |
| af_P9WN51_56_141_3.30.1360.120 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Probable tRNA modification gtpase trme; domain 1 | 0.9036 | 12 | 97 | 3.30.1360.120 |
| 1wosA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains | 0.9009 | 12 | 97 | 3.30.70.1400 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N1WIL3-F1-model_v4 | deleted | 0.9748 | 1 | 213 |
|
| AF-A0A2N1WIL3-F1-model_v4 | deleted | 0.9703 | 1 | 213 |
|
| AF-A0A359D7N8-F1-model_v4 | Folate-binding protein YgfZ | 0.965 | 30 | 214 |
GO:0016226
|
| AF-A0A436RI30-F1-model_v4 | Folate-binding protein | 0.9559 | 7 | 98 |
GO:0016226
|
| AF-A0A359D7N8-F1-model_v4 | Folate-binding protein YgfZ | 0.9549 | 30 | 214 |
GO:0016226
|