F484166
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 870 | 389 | 1741 | 172 |
Family's Representative Sequence
| Representative Sequence | 3300053125|Ga0500618_001616|Ga0500618_001616_7842_8438 |
| Length | 198 |
| Sequence | MKAQMMVRTTLEKTMIAGAVAAIALASSAAFAAPLKVDAAKSTVGATFKQLNVPVDAKLKKFSAVIDFDAAKPESSKASVDIDVASFDLGDAEYNKEVQKKEWFNAAQFPKATFVTSSIKPSAGAAAGTKYDVAGKLTIKGKSTDVSFPLTVKKEGATQVFDGTLPIKRLTYNIGEGEWKDTSMVADEVSIKFHFVAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 16 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 36 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 71 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 94 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 97 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 98 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 110 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 111 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 113 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 164 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 165 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 166 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 167 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 168 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 169 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 170 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 171 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 172 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 173 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 174 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 175 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 176 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 177 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 178 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 179 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 180 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 181 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 182 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 183 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 184 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 185 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 186 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 187 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 188 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 189 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 190 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 191 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 192 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 193 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 194 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 195 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 196 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 290 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 291 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 292 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 294 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 295 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 296 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 297 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 298 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 299 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 300 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 301 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 302 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 303 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 304 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 305 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 306 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 307 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 308 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 312 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049657 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought | Metagenome | Rhizosphere |
| 314 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 315 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 316 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 319 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 320 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 321 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 322 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 323 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300060247 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 343 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 344 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 345 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 346 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 347 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 348 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 349 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 350 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 351 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 352 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 353 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 354 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 355 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 356 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 357 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 358 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 359 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 360 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 361 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 362 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 363 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 364 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 365 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 366 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 367 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 368 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 369 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 370 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 371 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 372 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 373 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 374 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 375 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 376 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 377 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 378 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 379 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 380 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 381 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 382 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 383 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 384 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 385 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 386 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 387 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 388 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 389 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.8 |
| Metatranscriptomes | 3.68 |
| Isolates | 5.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.95 |
| Nodule | 0.57 |
| Rhizoplane | 2.76 |
| Rhizosphere | 75.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500618_001616 | 3300053125 | Bacteria | 9759 |
| 2 | JGI25155J39150_1000142 | 3300002704 | Bacteria | 33693 |
| 3 | JGI25155J39150_1000219 | 3300002704 | Bacteria | 22984 |
| 4 | JGI25156J39149_1000497 | 3300002705 | Bacteria | 23452 |
| 5 | JGI25156J39149_1003054 | 3300002705 | Bacteria | 5671 |
| 6 | JGI25162J39368_1000025 | 3300002737 | Bacteria | 228879 |
| 7 | JGI25162J39368_1005347 | 3300002737 | Bacteria | 2559 |
| 8 | JGI25154J39366_1000423 | 3300002738 | Bacteria | 22650 |
| 9 | JGI25154J39366_1000432 | 3300002738 | Bacteria | 22245 |
| 10 | JGI25157J39369_1000158 | 3300002741 | Bacteria | 56328 |
| 11 | JGI25157J39369_1000203 | 3300002741 | Bacteria | 49480 |
| 12 | JGI25150J39212_1001267 | 3300002774 | Bacteria | 7274 |
| 13 | JGI25150J39212_1035054 | 3300002774 | Bacteria | 672 |
| 14 | JGI25159J45721_1011470 | 3300002987 | Bacteria | 2169 |
| 15 | JGI25159J45721_1035208 | 3300002987 | Bacteria | 768 |
| 16 | JGI25165J46597_1000054 | 3300003214 | Bacteria | 228891 |
| 17 | JGI25153J46596_10021808 | 3300003215 | Bacteria | 2379 |
| 18 | rootH1_10018115 | 3300003316 | Bacteria | 3845 |
| 19 | rootH2_10293157 | 3300003320 | Bacteria | 1472 |
| 20 | rootL2_10003812 | 3300003322 | Bacteria | 12708 |
| 21 | rootL2_10025871 | 3300003322 | Bacteria | 5171 |
| 22 | rootH1_10041734 | 3300003316 | Bacteria | 4023 |
| 23 | rootH1_10041734 | 3300003323 | Bacteria | 3489 |
| 24 | JGI25161J50226_1010203 | 3300003374 | Bacteria | 1272 |
| 25 | JGI25161J50226_1017073 | 3300003374 | Bacteria | 768 |
| 26 | Ga0007417J51691_1016591 | 3300003544 | Bacteria | 1408 |
| 27 | Ga0007410J51695_1021115 | 3300003574 | Bacteria | 1068 |
| 28 | Ga0007410J51695_1024144 | 3300003574 | Bacteria | 1299 |
| 29 | Ga0007409J51694_1006046 | 3300003575 | Bacteria | 1202 |
| 30 | Ga0007416J51690_1029903 | 3300003577 | Bacteria | 1827 |
| 31 | Ga0055538_1000002 | 3300003751 | Bacteria | 999437 |
| 32 | Ga0055538_1000026 | 3300003751 | Bacteria | 228891 |
| 33 | Ga0055538_1000117 | 3300003751 | Bacteria | 60939 |
| 34 | Ga0055539_1000002 | 3300003752 | Bacteria | 999437 |
| 35 | Ga0055539_1000033 | 3300003752 | Bacteria | 228891 |
| 36 | Ga0055539_1000163 | 3300003752 | Bacteria | 60939 |
| 37 | Ga0055533_1000004 | 3300003756 | Bacteria | 999437 |
| 38 | Ga0055533_1000044 | 3300003756 | Bacteria | 228891 |
| 39 | Ga0055533_1000166 | 3300003756 | Bacteria | 60939 |
| 40 | Ga0055532_1000005 | 3300003758 | Bacteria | 458107 |
| 41 | Ga0055525_1000002 | 3300003759 | Bacteria | 999437 |
| 42 | Ga0055525_1000052 | 3300003759 | Bacteria | 228891 |
| 43 | Ga0055525_1000081 | 3300003759 | Bacteria | 161329 |
| 44 | Ga0055525_1000227 | 3300003759 | Bacteria | 60939 |
| 45 | Ga0055535_1024759 | 3300003761 | Bacteria | 685 |
| 46 | Ga0055529_1000565 | 3300003763 | Bacteria | 30558 |
| 47 | Ga0055526_1004232 | 3300003771 | Bacteria | 8712 |
| 48 | Ga0055526_1005886 | 3300003771 | Bacteria | 6868 |
| 49 | Ga0055526_1015143 | 3300003771 | Bacteria | 3113 |
| 50 | Ga0055526_1064010 | 3300003771 | Bacteria | 771 |
| 51 | Ga0055537_1003974 | 3300003773 | Bacteria | 4369 |
| 52 | Ga0055524_1000026 | 3300003775 | Bacteria | 214653 |
| 53 | Ga0055524_1010165 | 3300003775 | Bacteria | 3766 |
| 54 | Ga0055534_1002884 | 3300003784 | Bacteria | 5709 |
| 55 | Ga0055534_1003282 | 3300003784 | Bacteria | 5146 |
| 56 | Ga0055528_1010434 | 3300003790 | Bacteria | 3777 |
| 57 | Ga0055530_10010428 | 3300003791 | Bacteria | 3435 |
| 58 | Ga0055530_10037080 | 3300003791 | Bacteria | 1222 |
| 59 | Ga0055541_1000002 | 3300003841 | Bacteria | 896405 |
| 60 | Ga0055541_1000069 | 3300003841 | Bacteria | 94648 |
| 61 | Ga0055541_1000109 | 3300003841 | Bacteria | 60939 |
| 62 | Ga0055543_1004724 | 3300004625 | Bacteria | 3637 |
| 63 | Ga0065165_1000557 | 3300005262 | Bacteria | 55476 |
| 64 | Ga0065165_1011662 | 3300005262 | Bacteria | 3637 |
| 65 | Ga0065704_10286848 | 3300005289 | Bacteria | 911 |
| 66 | Ga0065707_10223324 | 3300005295 | Bacteria | 1216 |
| 67 | Ga0070658_10310880 | 3300005327 | Bacteria | 1344 |
| 68 | Ga0070658_11126602 | 3300005327 | Bacteria | 682 |
| 69 | Ga0070658_11289576 | 3300005327 | Bacteria | 634 |
| 70 | Ga0070676_10074194 | 3300005328 | Bacteria | 2048 |
| 71 | Ga0070670_100000002 | 3300005331 | Bacteria | 568775 |
| 72 | Ga0070680_100399210 | 3300005336 | Bacteria | 1172 |
| 73 | Ga0070682_100209046 | 3300005337 | Bacteria | 1382 |
| 74 | Ga0070660_100019039 | 3300005339 | Bacteria | 5025 |
| 75 | Ga0070660_100019636 | 3300005339 | Bacteria | 4955 |
| 76 | Ga0070660_100878083 | 3300005339 | Bacteria | 756 |
| 77 | Ga0070661_100016272 | 3300005344 | Bacteria | 5256 |
| 78 | Ga0070661_100471047 | 3300005344 | Bacteria | 1002 |
| 79 | Ga0070669_100005576 | 3300005353 | Bacteria | 9091 |
| 80 | Ga0070671_100000025 | 3300005355 | Bacteria | 121912 |
| 81 | Ga0070688_100004285 | 3300005365 | Bacteria | 7416 |
| 82 | Ga0070659_100027283 | 3300005366 | Bacteria | 4399 |
| 83 | Ga0070659_100248247 | 3300005366 | Bacteria | 1474 |
| 84 | Ga0070667_100000394 | 3300005367 | Bacteria | 47270 |
| 85 | Ga0068867_100808148 | 3300005459 | Bacteria | 837 |
| 86 | Ga0070685_10000005 | 3300005466 | Bacteria | 190119 |
| 87 | Ga0068853_101402260 | 3300005539 | Bacteria | 676 |
| 88 | Ga0070665_100150604 | 3300005548 | Bacteria | 2329 |
| 89 | Ga0068855_100002941 | 3300005563 | Bacteria | 20811 |
| 90 | Ga0068855_100023836 | 3300005563 | Bacteria | 7331 |
| 91 | Ga0068855_100113778 | 3300005563 | Bacteria | 3103 |
| 92 | Ga0068855_100654854 | 3300005563 | Bacteria | 1127 |
| 93 | Ga0070664_100107270 | 3300005564 | Bacteria | 2435 |
| 94 | Ga0068854_100007911 | 3300005578 | Bacteria | 6804 |
| 95 | Ga0068854_100351826 | 3300005578 | Bacteria | 1206 |
| 96 | Ga0068856_100196880 | 3300005614 | Bacteria | 2029 |
| 97 | Ga0068856_100577120 | 3300005614 | Bacteria | 1146 |
| 98 | Ga0068852_100105451 | 3300005616 | Bacteria | 2554 |
| 99 | Ga0068852_100470435 | 3300005616 | Bacteria | 1247 |
| 100 | Ga0068859_100041050 | 3300005617 | Bacteria | 4648 |
| 101 | Ga0068864_100000003 | 3300005618 | Bacteria | 568775 |
| 102 | Ga0068851_10118595 | 3300005834 | Bacteria | 1420 |
| 103 | Ga0068860_100000326 | 3300005843 | Bacteria | 64692 |
| 104 | Ga0068862_100068501 | 3300005844 | Bacteria | 3061 |
| 105 | Ga0070717_10329720 | 3300006028 | Bacteria | 1361 |
| 106 | Ga0070712_100003941 | 3300006175 | Bacteria | 9138 |
| 107 | Ga0075362_10006912 | 3300006177 | Bacteria | 4254 |
| 108 | Ga0097621_100672441 | 3300006237 | Bacteria | 951 |
| 109 | Ga0068871_100961585 | 3300006358 | Bacteria | 794 |
| 110 | Ga0097620_100041051 | 3300006931 | Bacteria | 4648 |
| 111 | Ga0079104_1003938 | 3300006946 | Bacteria | 6622 |
| 112 | Ga0105244_10002846 | 3300009036 | Bacteria | 12839 |
| 113 | Ga0105244_10004702 | 3300009036 | Bacteria | 9297 |
| 114 | Ga0105244_10017619 | 3300009036 | Bacteria | 4031 |
| 115 | Ga0105244_10082230 | 3300009036 | Bacteria | 1593 |
| 116 | Ga0105240_10003355 | 3300009093 | Bacteria | 24916 |
| 117 | Ga0105240_10007797 | 3300009093 | Bacteria | 15467 |
| 118 | Ga0105240_10076139 | 3300009093 | Bacteria | 4137 |
| 119 | Ga0105240_10255882 | 3300009093 | Bacteria | 2022 |
| 120 | Ga0105245_10095866 | 3300009098 | Bacteria | 2737 |
| 121 | Ga0105243_10069287 | 3300009148 | Bacteria | 2845 |
| 122 | Ga0105241_10134982 | 3300009174 | Bacteria | 2002 |
| 123 | Ga0105242_10002231 | 3300009176 | Bacteria | 15286 |
| 124 | Ga0105248_10148536 | 3300009177 | Unclassified | 2644 |
| 125 | Ga0105237_10006971 | 3300009545 | Bacteria | 12457 |
| 126 | Ga0105238_10000505 | 3300009551 | Bacteria | 41099 |
| 127 | Ga0105238_10028613 | 3300009551 | Bacteria | 5677 |
| 128 | Ga0105249_10146050 | 3300009553 | Unclassified | 2273 |
| 129 | Ga0105239_10003532 | 3300010375 | Bacteria | 19140 |
| 130 | Ga0105239_10093891 | 3300010375 | Bacteria | 3313 |
| 131 | Ga0105239_10566910 | 3300010375 | Bacteria | 1294 |
| 132 | Ga0105246_10495530 | 3300011119 | Bacteria | 1036 |
| 133 | Ga0157373_10065917 | 3300013100 | Bacteria | 2562 |
| 134 | Ga0157371_10000064 | 3300013102 | Bacteria | 169056 |
| 135 | Ga0157371_10376395 | 3300013102 | Bacteria | 1036 |
| 136 | Ga0157378_11587540 | 3300013297 | Bacteria | 700 |
| 137 | Ga0163162_10090756 | 3300013306 | Bacteria | 3137 |
| 138 | Ga0157372_10418475 | 3300013307 | Bacteria | 1562 |
| 139 | Ga0157372_11872767 | 3300013307 | Bacteria | 690 |
| 140 | Ga0163163_10000136 | 3300014325 | Bacteria | 75532 |
| 141 | Ga0182008_10012348 | 3300014497 | Bacteria | 4509 |
| 142 | Ga0182008_10022337 | 3300014497 | Bacteria | 3241 |
| 143 | Ga0182008_10290110 | 3300014497 | Bacteria | 853 |
| 144 | Ga0157379_10845278 | 3300014968 | Unclassified | 866 |
| 145 | Ga0157376_11137173 | 3300014969 | Bacteria | 807 |
| 146 | Ga0182006_1000010 | 3300015261 | Bacteria | 413414 |
| 147 | Ga0182006_1000070 | 3300015261 | Bacteria | 137793 |
| 148 | Ga0182006_1003847 | 3300015261 | Bacteria | 7537 |
| 149 | Ga0182006_1011302 | 3300015261 | Bacteria | 3933 |
| 150 | Ga0182006_1019017 | 3300015261 | Bacteria | 2897 |
| 151 | Ga0182006_1137093 | 3300015261 | Bacteria | 838 |
| 152 | Ga0182007_10000021 | 3300015262 | Bacteria | 193408 |
| 153 | Ga0182007_10005022 | 3300015262 | Bacteria | 5877 |
| 154 | Ga0182007_10028545 | 3300015262 | Bacteria | 1916 |
| 155 | Ga0182007_10039625 | 3300015262 | Bacteria | 1576 |
| 156 | Ga0182007_10047837 | 3300015262 | Bacteria | 1414 |
| 157 | Ga0182005_1000003 | 3300015265 | Bacteria | 683269 |
| 158 | Ga0182005_1000009 | 3300015265 | Bacteria | 455334 |
| 159 | Ga0182005_1000140 | 3300015265 | Bacteria | 51063 |
| 160 | Ga0163161_10013082 | 3300017792 | Bacteria | 5767 |
| 161 | Ga0163161_10127977 | 3300017792 | Bacteria | 1914 |
| 162 | Ga0213872_10001180 | 3300021361 | Bacteria | 17725 |
| 163 | Ga0213872_10039352 | 3300021361 | Bacteria | 2157 |
| 164 | Ga0213872_10142017 | 3300021361 | Bacteria | 1053 |
| 165 | Ga0209435_100004 | 3300025206 | Bacteria | 633417 |
| 166 | Ga0209435_100214 | 3300025206 | Bacteria | 16487 |
| 167 | Ga0209436_104714 | 3300025208 | Bacteria | 3303 |
| 168 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 169 | Ga0209784_100020 | 3300025224 | Bacteria | 412353 |
| 170 | Ga0209784_100153 | 3300025224 | Bacteria | 62664 |
| 171 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 172 | Ga0209566_100020 | 3300025225 | Bacteria | 412353 |
| 173 | Ga0209566_100195 | 3300025225 | Bacteria | 62664 |
| 174 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 175 | Ga0209674_100035 | 3300025226 | Bacteria | 412353 |
| 176 | Ga0209674_100198 | 3300025226 | Bacteria | 62664 |
| 177 | Ga0209672_110782 | 3300025228 | Bacteria | 1217 |
| 178 | Ga0209147_100011 | 3300025229 | Bacteria | 702140 |
| 179 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 180 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 181 | Ga0209563_100038 | 3300025230 | Bacteria | 412353 |
| 182 | Ga0209563_100157 | 3300025230 | Bacteria | 62664 |
| 183 | Ga0207427_100803 | 3300025231 | Bacteria | 14223 |
| 184 | Ga0209437_100066 | 3300025233 | Bacteria | 327883 |
| 185 | Ga0209437_100084 | 3300025233 | Bacteria | 255423 |
| 186 | Ga0209258_100560 | 3300025242 | Bacteria | 32331 |
| 187 | Ga0207425_1000205 | 3300025245 | Bacteria | 47028 |
| 188 | Ga0207425_1001881 | 3300025245 | Bacteria | 8024 |
| 189 | Ga0209646_1000032 | 3300025246 | Bacteria | 375315 |
| 190 | Ga0209646_1000283 | 3300025246 | Bacteria | 44163 |
| 191 | Ga0209026_1000062 | 3300025250 | Bacteria | 213298 |
| 192 | Ga0209026_1001071 | 3300025250 | Bacteria | 13234 |
| 193 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 194 | Ga0209677_100031 | 3300025253 | Bacteria | 329719 |
| 195 | Ga0209677_100156 | 3300025253 | Bacteria | 62664 |
| 196 | Ga0209677_109110 | 3300025253 | Bacteria | 1824 |
| 197 | Ga0209759_1000054 | 3300025256 | Bacteria | 211422 |
| 198 | Ga0209759_1000548 | 3300025256 | Bacteria | 38674 |
| 199 | Ga0209233_1000060 | 3300025261 | Bacteria | 412379 |
| 200 | Ga0209565_1000163 | 3300025263 | Bacteria | 87185 |
| 201 | Ga0209565_1002537 | 3300025263 | Bacteria | 6491 |
| 202 | Ga0209565_1003524 | 3300025263 | Bacteria | 5022 |
| 203 | Ga0209565_1019823 | 3300025263 | Bacteria | 1429 |
| 204 | Ga0209455_1000063 | 3300025272 | Bacteria | 333019 |
| 205 | Ga0209673_1013569 | 3300025273 | Bacteria | 3207 |
| 206 | Ga0209130_1001475 | 3300025284 | Bacteria | 15380 |
| 207 | Ga0209675_1000635 | 3300025291 | Bacteria | 24937 |
| 208 | Ga0209675_1004769 | 3300025291 | Bacteria | 5897 |
| 209 | Ga0209675_1035477 | 3300025291 | Bacteria | 1137 |
| 210 | Ga0209025_1007316 | 3300025294 | Bacteria | 8276 |
| 211 | Ga0209564_1000026 | 3300025295 | Bacteria | 519154 |
| 212 | Ga0209564_1000098 | 3300025295 | Bacteria | 228906 |
| 213 | Ga0209564_1010469 | 3300025295 | Bacteria | 4266 |
| 214 | Ga0209758_1000270 | 3300025297 | Bacteria | 102973 |
| 215 | Ga0209050_1000183 | 3300025298 | Bacteria | 142357 |
| 216 | Ga0209050_1000753 | 3300025298 | Bacteria | 46582 |
| 217 | Ga0209256_1000013 | 3300025299 | Bacteria | 689442 |
| 218 | Ga0209256_1001083 | 3300025299 | Bacteria | 31411 |
| 219 | Ga0209256_1003724 | 3300025299 | Bacteria | 10323 |
| 220 | Ga0207426_1008085 | 3300025302 | Bacteria | 4309 |
| 221 | Ga0209051_1033169 | 3300025303 | Bacteria | 1956 |
| 222 | Ga0209257_1000010 | 3300025304 | Bacteria | 1158682 |
| 223 | Ga0207655_1006312 | 3300025728 | Bacteria | 7876 |
| 224 | Ga0207655_1007374 | 3300025728 | Bacteria | 7136 |
| 225 | Ga0207655_1072617 | 3300025728 | Bacteria | 1272 |
| 226 | Ga0207655_1102042 | 3300025728 | Bacteria | 985 |
| 227 | Ga0207680_10007523 | 3300025903 | Bacteria | 5318 |
| 228 | Ga0207705_10015832 | 3300025909 | Bacteria | 5416 |
| 229 | Ga0207705_10573990 | 3300025909 | Bacteria | 877 |
| 230 | Ga0207654_10003120 | 3300025911 | Bacteria | 8391 |
| 231 | Ga0207695_10001902 | 3300025913 | Bacteria | 32583 |
| 232 | Ga0207695_10006732 | 3300025913 | Bacteria | 14831 |
| 233 | Ga0207695_10032133 | 3300025913 | Bacteria | 5747 |
| 234 | Ga0207695_10694482 | 3300025913 | Bacteria | 898 |
| 235 | Ga0207671_10007433 | 3300025914 | Bacteria | 9507 |
| 236 | Ga0207671_10084328 | 3300025914 | Bacteria | 2386 |
| 237 | Ga0207660_10242713 | 3300025917 | Bacteria | 1420 |
| 238 | Ga0207657_10004403 | 3300025919 | Bacteria | 14895 |
| 239 | Ga0207681_10000156 | 3300025923 | Bacteria | 56382 |
| 240 | Ga0207694_10000392 | 3300025924 | Bacteria | 40819 |
| 241 | Ga0207650_10000003 | 3300025925 | Bacteria | 1123235 |
| 242 | Ga0207650_10071357 | 3300025925 | Bacteria | 2612 |
| 243 | Ga0207644_10000312 | 3300025931 | Bacteria | 31641 |
| 244 | Ga0207690_10017481 | 3300025932 | Bacteria | 4379 |
| 245 | Ga0207690_10315843 | 3300025932 | Bacteria | 1227 |
| 246 | Ga0207706_10096998 | 3300025933 | Bacteria | 2592 |
| 247 | Ga0207686_10004796 | 3300025934 | Bacteria | 7259 |
| 248 | Ga0207711_10002080 | 3300025941 | Bacteria | 18084 |
| 249 | Ga0207711_10008967 | 3300025941 | Bacteria | 8363 |
| 250 | Ga0207661_10315241 | 3300025944 | Bacteria | 1405 |
| 251 | Ga0207679_10087306 | 3300025945 | Bacteria | 2401 |
| 252 | Ga0207667_10000019 | 3300025949 | Bacteria | 386233 |
| 253 | Ga0207667_10015769 | 3300025949 | Bacteria | 8568 |
| 254 | Ga0207667_10287065 | 3300025949 | Bacteria | 1681 |
| 255 | Ga0207712_10142307 | 3300025961 | Unclassified | 1842 |
| 256 | Ga0207640_10002070 | 3300025981 | Bacteria | 10810 |
| 257 | Ga0207640_10205995 | 3300025981 | Bacteria | 1494 |
| 258 | Ga0207658_10000004 | 3300025986 | Bacteria | 569357 |
| 259 | Ga0207703_10607025 | 3300026035 | Unclassified | 1035 |
| 260 | Ga0207639_10224640 | 3300026041 | Bacteria | 1624 |
| 261 | Ga0207702_10314059 | 3300026078 | Bacteria | 1491 |
| 262 | Ga0207641_10190748 | 3300026088 | Bacteria | 1883 |
| 263 | Ga0207641_10661571 | 3300026088 | Unclassified | 1026 |
| 264 | Ga0207648_10224184 | 3300026089 | Bacteria | 1671 |
| 265 | Ga0207676_10000003 | 3300026095 | Bacteria | 1123235 |
| 266 | Ga0207674_10193579 | 3300026116 | Bacteria | 1983 |
| 267 | Ga0207674_10502681 | 3300026116 | Bacteria | 1171 |
| 268 | Ga0207698_10002422 | 3300026142 | Bacteria | 11040 |
| 269 | Ga0207698_10826271 | 3300026142 | Bacteria | 930 |
| 270 | Ga0207698_11889844 | 3300026142 | Bacteria | 612 |
| 271 | Ga0209281_1027586 | 3300027111 | Bacteria | 1039 |
| 272 | Ga0268266_10060143 | 3300028379 | Bacteria | 3274 |
| 273 | Ga0268265_10001641 | 3300028380 | Bacteria | 18332 |
| 274 | Ga0268264_10000123 | 3300028381 | Bacteria | 189361 |
| 275 | Ga0265338_10000251 | 3300028800 | Bacteria | 98343 |
| 276 | Ga0265332_10140284 | 3300031238 | Bacteria | 1013 |
| 277 | Ga0307408_100030099 | 3300031548 | Bacteria | 3767 |
| 278 | Ga0307408_100039064 | 3300031548 | Bacteria | 3352 |
| 279 | Ga0307408_100120973 | 3300031548 | Bacteria | 2028 |
| 280 | Ga0307518_10093594 | 3300031838 | Bacteria | 2159 |
| 281 | Ga0307412_10912337 | 3300031911 | Bacteria | 771 |
| 282 | Ga0307416_100654254 | 3300032002 | Bacteria | 1136 |
| 283 | Ga0307414_10045777 | 3300032004 | Bacteria | 2998 |
| 284 | Ga0307414_10817207 | 3300032004 | Bacteria | 851 |
| 285 | Ga0395899_0006725 | 3300037312 | Bacteria | 8904 |
| 286 | Ga0395899_0023733 | 3300037312 | Bacteria | 4641 |
| 287 | Ga0395899_0573065 | 3300037312 | Bacteria | 723 |
| 288 | Ga0395900_0000532 | 3300037418 | Bacteria | 53751 |
| 289 | Ga0395900_0004176 | 3300037418 | Bacteria | 15339 |
| 290 | Ga0395900_0011395 | 3300037418 | Bacteria | 9100 |
| 291 | Ga0395900_0044333 | 3300037418 | Bacteria | 4583 |
| 292 | Ga0395900_0372424 | 3300037418 | Bacteria | 1397 |
| 293 | Ga0395900_0860748 | 3300037418 | Bacteria | 831 |
| 294 | Ga0395898_0017582 | 3300037466 | Bacteria | 7296 |
| 295 | Ga0395905_0000589 | 3300037471 | Bacteria | 48792 |
| 296 | Ga0395905_0010271 | 3300037471 | Bacteria | 9115 |
| 297 | Ga0395905_0072918 | 3300037471 | Bacteria | 3218 |
| 298 | Ga0395905_0131813 | 3300037471 | Bacteria | 2350 |
| 299 | Ga0395905_0290802 | 3300037471 | Bacteria | 1521 |
| 300 | Ga0395905_0916846 | 3300037471 | Bacteria | 779 |
| 301 | Ga0395901_0000765 | 3300038443 | Bacteria | 36025 |
| 302 | Ga0395901_0002028 | 3300038443 | Bacteria | 20821 |
| 303 | Ga0395901_0009241 | 3300038443 | Bacteria | 9990 |
| 304 | Ga0395901_0319235 | 3300038443 | Bacteria | 1607 |
| 305 | Ga0436361_0065289 | 3300039447 | Bacteria | 15724 |
| 306 | Ga0436361_0179116 | 3300039447 | Bacteria | 893 |
| 307 | Ga0436361_0239425 | 3300039447 | Bacteria | 40455 |
| 308 | Ga0436361_0370552 | 3300039447 | Bacteria | 1375 |
| 309 | Ga0436361_0480035 | 3300039447 | Bacteria | 16007 |
| 310 | Ga0436361_1087377 | 3300039447 | Bacteria | 2723 |
| 311 | Ga0439465_0139031 | 3300041413 | Bacteria | 862 |
| 312 | Ga0439448_0024773 | 3300042005 | Bacteria | 1878 |
| 313 | Ga0439448_0034436 | 3300042005 | Bacteria | 1618 |
| 314 | Ga0439450_003658 | 3300042008 | Bacteria | 2563 |
| 315 | Ga0439455_0002204 | 3300042012 | Bacteria | 3488 |
| 316 | Ga0439455_0070868 | 3300042012 | Bacteria | 936 |
| 317 | Ga0450904_000854 | 3300042139 | Bacteria | 5015 |
| 318 | Ga0450906_092126 | 3300042145 | Bacteria | 550 |
| 319 | Ga0439464_0093207 | 3300042439 | Bacteria | 910 |
| 320 | Ga0466969_0024922 | 3300044656 | Bacteria | 3076 |
| 321 | Ga0466969_0401196 | 3300044656 | Bacteria | 622 |
| 322 | Ga0466972_0000283 | 3300044658 | Bacteria | 31634 |
| 323 | Ga0466972_0031399 | 3300044658 | Bacteria | 2612 |
| 324 | Ga0466981_0558362 | 3300044669 | Bacteria | 627 |
| 325 | Ga0466965_0001710 | 3300044683 | Bacteria | 9017 |
| 326 | Ga0466965_0006716 | 3300044683 | Bacteria | 5248 |
| 327 | Ga0466965_0047069 | 3300044683 | Bacteria | 2135 |
| 328 | Ga0466966_0010145 | 3300044684 | Bacteria | 6247 |
| 329 | Ga0466961_0286026 | 3300044693 | Bacteria | 1008 |
| 330 | Ga0466961_0485655 | 3300044693 | Bacteria | 746 |
| 331 | Ga0466963_0077203 | 3300044694 | Bacteria | 2250 |
| 332 | Ga0466964_0005209 | 3300044706 | Bacteria | 4821 |
| 333 | Ga0466964_0012691 | 3300044706 | Bacteria | 3189 |
| 334 | Ga0466964_0023327 | 3300044706 | Bacteria | 2406 |
| 335 | Ga0466964_0213964 | 3300044706 | Bacteria | 932 |
| 336 | Ga0466971_0182658 | 3300044719 | Bacteria | 986 |
| 337 | Ga0466971_0224141 | 3300044719 | Bacteria | 891 |
| 338 | Ga0466968_0005176 | 3300044735 | Bacteria | 4879 |
| 339 | Ga0466968_0168236 | 3300044735 | Bacteria | 1015 |
| 340 | Ga0466970_0033906 | 3300044765 | Bacteria | 2700 |
| 341 | Ga0466970_0077320 | 3300044765 | Bacteria | 1794 |
| 342 | Ga0466957_0003305 | 3300044842 | Bacteria | 8825 |
| 343 | Ga0466959_0057388 | 3300045049 | Bacteria | 2838 |
| 344 | Ga0466959_0082530 | 3300045049 | Bacteria | 2315 |
| 345 | Ga0466959_0147587 | 3300045049 | Bacteria | 1659 |
| 346 | Ga0466959_0235373 | 3300045049 | Bacteria | 1266 |
| 347 | Ga0466958_0044719 | 3300045836 | Bacteria | 2669 |
| 348 | Ga0466967_0027416 | 3300045976 | Bacteria | 4738 |
| 349 | Ga0495617_075766 | 3300046452 | Bacteria | 1104 |
| 350 | Ga0495627_004698 | 3300046453 | Bacteria | 5650 |
| 351 | Ga0495627_005183 | 3300046453 | Bacteria | 5303 |
| 352 | Ga0495592_0086444 | 3300046454 | Bacteria | 2258 |
| 353 | Ga0495603_0127264 | 3300046455 | Bacteria | 1484 |
| 354 | Ga0495590_0093492 | 3300046457 | Bacteria | 1065 |
| 355 | Ga0495629_0008589 | 3300046459 | Bacteria | 7521 |
| 356 | Ga0495629_0056479 | 3300046459 | Bacteria | 2744 |
| 357 | Ga0495638_0036578 | 3300046460 | Bacteria | 3127 |
| 358 | Ga0495638_0083406 | 3300046460 | Bacteria | 1936 |
| 359 | Ga0495638_0117589 | 3300046460 | Bacteria | 1573 |
| 360 | Ga0495651_0154334 | 3300046462 | Bacteria | 1651 |
| 361 | Ga0495653_0036769 | 3300046463 | Bacteria | 3853 |
| 362 | Ga0495653_0041862 | 3300046463 | Bacteria | 3572 |
| 363 | Ga0495653_0135297 | 3300046463 | Bacteria | 1739 |
| 364 | Ga0495650_0000051 | 3300046471 | Bacteria | 318297 |
| 365 | Ga0495650_0000212 | 3300046471 | Bacteria | 124622 |
| 366 | Ga0495650_0000712 | 3300046471 | Bacteria | 42514 |
| 367 | Ga0495650_0033656 | 3300046471 | Bacteria | 2278 |
| 368 | Ga0495580_0024981 | 3300046472 | Bacteria | 4368 |
| 369 | Ga0495582_0005030 | 3300046473 | Bacteria | 7408 |
| 370 | Ga0495582_0214083 | 3300046473 | Bacteria | 1102 |
| 371 | Ga0495605_0000005 | 3300046474 | Bacteria | 376973 |
| 372 | Ga0495605_0026659 | 3300046474 | Bacteria | 3002 |
| 373 | Ga0495605_0027564 | 3300046474 | Bacteria | 2942 |
| 374 | Ga0495605_0047131 | 3300046474 | Bacteria | 2114 |
| 375 | Ga0495639_0228194 | 3300046475 | Bacteria | 917 |
| 376 | Ga0495584_0000381 | 3300046491 | Bacteria | 30594 |
| 377 | Ga0495584_0000755 | 3300046491 | Bacteria | 21387 |
| 378 | Ga0495584_0001114 | 3300046491 | Bacteria | 16663 |
| 379 | Ga0495584_0007663 | 3300046491 | Bacteria | 5625 |
| 380 | Ga0495584_0018616 | 3300046491 | Bacteria | 3530 |
| 381 | Ga0495584_0019150 | 3300046491 | Bacteria | 3476 |
| 382 | Ga0495584_0021044 | 3300046491 | Bacteria | 3312 |
| 383 | Ga0495584_0070048 | 3300046491 | Bacteria | 1762 |
| 384 | Ga0495584_0094776 | 3300046491 | Bacteria | 1507 |
| 385 | Ga0495584_0099702 | 3300046491 | Bacteria | 1468 |
| 386 | Ga0495584_0224600 | 3300046491 | Bacteria | 954 |
| 387 | Ga0495585_0000889 | 3300046492 | Bacteria | 25313 |
| 388 | Ga0495585_0007941 | 3300046492 | Bacteria | 6449 |
| 389 | Ga0495585_0008221 | 3300046492 | Bacteria | 6333 |
| 390 | Ga0495585_0011129 | 3300046492 | Bacteria | 5335 |
| 391 | Ga0495585_0017446 | 3300046492 | Bacteria | 4147 |
| 392 | Ga0495585_0092311 | 3300046492 | Bacteria | 1629 |
| 393 | Ga0495585_0097505 | 3300046492 | Bacteria | 1576 |
| 394 | Ga0495585_0135032 | 3300046492 | Bacteria | 1295 |
| 395 | Ga0495585_0235050 | 3300046492 | Bacteria | 919 |
| 396 | Ga0495594_0016435 | 3300046499 | Bacteria | 3898 |
| 397 | Ga0495594_0293937 | 3300046499 | Bacteria | 925 |
| 398 | Ga0495594_0365398 | 3300046499 | Bacteria | 821 |
| 399 | Ga0495596_0004154 | 3300046500 | Bacteria | 7112 |
| 400 | Ga0495596_0005456 | 3300046500 | Bacteria | 6007 |
| 401 | Ga0495596_0017944 | 3300046500 | Bacteria | 2922 |
| 402 | Ga0495596_0036442 | 3300046500 | Bacteria | 1948 |
| 403 | Ga0495596_0044212 | 3300046500 | Bacteria | 1753 |
| 404 | Ga0495596_0175637 | 3300046500 | Bacteria | 833 |
| 405 | Ga0495607_0011208 | 3300046501 | Bacteria | 5980 |
| 406 | Ga0495607_0034188 | 3300046501 | Bacteria | 3086 |
| 407 | Ga0495607_0039793 | 3300046501 | Bacteria | 2805 |
| 408 | Ga0495607_0052064 | 3300046501 | Bacteria | 2373 |
| 409 | Ga0495607_0063189 | 3300046501 | Bacteria | 2095 |
| 410 | Ga0495607_0090256 | 3300046501 | Bacteria | 1662 |
| 411 | Ga0495583_0000983 | 3300046506 | Bacteria | 32667 |
| 412 | Ga0495583_0018489 | 3300046506 | Bacteria | 3667 |
| 413 | Ga0495583_0019099 | 3300046506 | Bacteria | 3587 |
| 414 | Ga0495583_0038221 | 3300046506 | Bacteria | 2269 |
| 415 | Ga0495583_0044743 | 3300046506 | Bacteria | 2051 |
| 416 | Ga0495583_0052003 | 3300046506 | Bacteria | 1865 |
| 417 | Ga0495583_0108125 | 3300046506 | Bacteria | 1180 |
| 418 | Ga0495583_0170507 | 3300046506 | Bacteria | 894 |
| 419 | Ga0495606_0000547 | 3300046507 | Bacteria | 60321 |
| 420 | Ga0495606_0002788 | 3300046507 | Bacteria | 19515 |
| 421 | Ga0495606_0003771 | 3300046507 | Bacteria | 15756 |
| 422 | Ga0495606_0036377 | 3300046507 | Bacteria | 3353 |
| 423 | Ga0495606_0050389 | 3300046507 | Bacteria | 2724 |
| 424 | Ga0495606_0072842 | 3300046507 | Bacteria | 2157 |
| 425 | Ga0495606_0115547 | 3300046507 | Bacteria | 1613 |
| 426 | Ga0495606_0119684 | 3300046507 | Bacteria | 1577 |
| 427 | Ga0495606_0259831 | 3300046507 | Bacteria | 959 |
| 428 | Ga0495606_0346055 | 3300046507 | Bacteria | 790 |
| 429 | Ga0495608_0011730 | 3300046511 | Bacteria | 6093 |
| 430 | Ga0495610_0000021 | 3300046512 | Bacteria | 336300 |
| 431 | Ga0495610_0006777 | 3300046512 | Bacteria | 7771 |
| 432 | Ga0495616_0000093 | 3300046513 | Bacteria | 75781 |
| 433 | Ga0495616_0024971 | 3300046513 | Bacteria | 3197 |
| 434 | Ga0495616_0026678 | 3300046513 | Bacteria | 3071 |
| 435 | Ga0495616_0040738 | 3300046513 | Bacteria | 2371 |
| 436 | Ga0495616_0084167 | 3300046513 | Bacteria | 1516 |
| 437 | Ga0495616_0105541 | 3300046513 | Bacteria | 1315 |
| 438 | Ga0495616_0106310 | 3300046513 | Bacteria | 1309 |
| 439 | Ga0495618_0043922 | 3300046514 | Bacteria | 2819 |
| 440 | Ga0495620_0020297 | 3300046515 | Bacteria | 3247 |
| 441 | Ga0495628_0006086 | 3300046516 | Bacteria | 10550 |
| 442 | Ga0495628_0013454 | 3300046516 | Bacteria | 6883 |
| 443 | Ga0495630_0005271 | 3300046517 | Bacteria | 9123 |
| 444 | Ga0495630_0021183 | 3300046517 | Bacteria | 4800 |
| 445 | Ga0495631_0014034 | 3300046518 | Bacteria | 3872 |
| 446 | Ga0495631_0019628 | 3300046518 | Bacteria | 3168 |
| 447 | Ga0495631_0020566 | 3300046518 | Bacteria | 3082 |
| 448 | Ga0495631_0022012 | 3300046518 | Bacteria | 2965 |
| 449 | Ga0495631_0182652 | 3300046518 | Bacteria | 898 |
| 450 | Ga0495631_0187925 | 3300046518 | Bacteria | 884 |
| 451 | Ga0495631_0221516 | 3300046518 | Bacteria | 807 |
| 452 | Ga0495632_0001724 | 3300046519 | Bacteria | 17773 |
| 453 | Ga0495632_0008471 | 3300046519 | Bacteria | 6306 |
| 454 | Ga0495632_0059363 | 3300046519 | Bacteria | 1861 |
| 455 | Ga0495637_0000305 | 3300046520 | Bacteria | 38029 |
| 456 | Ga0495637_0051276 | 3300046520 | Bacteria | 1728 |
| 457 | Ga0495643_0000096 | 3300046522 | Bacteria | 146041 |
| 458 | Ga0495643_0000181 | 3300046522 | Bacteria | 100368 |
| 459 | Ga0495643_0000983 | 3300046522 | Bacteria | 29263 |
| 460 | Ga0495643_0001269 | 3300046522 | Bacteria | 24190 |
| 461 | Ga0495643_0036792 | 3300046522 | Bacteria | 2687 |
| 462 | Ga0495643_0077756 | 3300046522 | Bacteria | 1733 |
| 463 | Ga0495643_0106851 | 3300046522 | Bacteria | 1427 |
| 464 | Ga0495643_0230749 | 3300046522 | Bacteria | 873 |
| 465 | Ga0495643_0253848 | 3300046522 | Bacteria | 819 |
| 466 | Ga0495644_0014817 | 3300046523 | Bacteria | 2985 |
| 467 | Ga0495644_0029509 | 3300046523 | Bacteria | 2072 |
| 468 | Ga0495644_0030512 | 3300046523 | Bacteria | 2035 |
| 469 | Ga0495648_0019268 | 3300046524 | Bacteria | 4804 |
| 470 | Ga0495648_0037553 | 3300046524 | Bacteria | 3110 |
| 471 | Ga0495648_0071327 | 3300046524 | Bacteria | 2014 |
| 472 | Ga0495648_0090475 | 3300046524 | Bacteria | 1715 |
| 473 | Ga0495648_0301215 | 3300046524 | Bacteria | 751 |
| 474 | Ga0495663_0104318 | 3300046525 | Bacteria | 936 |
| 475 | Ga0495666_0000293 | 3300046526 | Bacteria | 21877 |
| 476 | Ga0495666_0007083 | 3300046526 | Bacteria | 5634 |
| 477 | Ga0495642_0022230 | 3300046528 | Bacteria | 2498 |
| 478 | Ga0495642_0036277 | 3300046528 | Bacteria | 1992 |
| 479 | Ga0495642_0052284 | 3300046528 | Bacteria | 1682 |
| 480 | Ga0495642_0088467 | 3300046528 | Bacteria | 1309 |
| 481 | Ga0495642_0097643 | 3300046528 | Bacteria | 1248 |
| 482 | Ga0495642_0206597 | 3300046528 | Bacteria | 856 |
| 483 | Ga0495652_0014252 | 3300046529 | Bacteria | 7138 |
| 484 | Ga0495652_0032215 | 3300046529 | Bacteria | 4585 |
| 485 | Ga0495652_0041820 | 3300046529 | Bacteria | 3954 |
| 486 | Ga0495652_0060251 | 3300046529 | Bacteria | 3208 |
| 487 | Ga0495652_0089342 | 3300046529 | Bacteria | 2522 |
| 488 | Ga0495652_0127906 | 3300046529 | Bacteria | 2015 |
| 489 | Ga0495654_0000005 | 3300046530 | Bacteria | 491381 |
| 490 | Ga0495654_0011080 | 3300046530 | Bacteria | 4895 |
| 491 | Ga0495654_0021618 | 3300046530 | Bacteria | 3346 |
| 492 | Ga0495654_0028810 | 3300046530 | Bacteria | 2836 |
| 493 | Ga0495654_0142868 | 3300046530 | Bacteria | 1065 |
| 494 | Ga0495654_0166524 | 3300046530 | Bacteria | 964 |
| 495 | Ga0495665_0020394 | 3300046531 | Bacteria | 3560 |
| 496 | Ga0495665_0027126 | 3300046531 | Bacteria | 3075 |
| 497 | Ga0495665_0137168 | 3300046531 | Bacteria | 1279 |
| 498 | Ga0495665_0272221 | 3300046531 | Bacteria | 869 |
| 499 | Ga0495665_0381375 | 3300046531 | Bacteria | 716 |
| 500 | Ga0495640_0004944 | 3300046533 | Bacteria | 10598 |
| 501 | Ga0495586_0016302 | 3300046535 | Bacteria | 3951 |
| 502 | Ga0495586_0021007 | 3300046535 | Bacteria | 3479 |
| 503 | Ga0495586_0022390 | 3300046535 | Bacteria | 3372 |
| 504 | Ga0495586_0042318 | 3300046535 | Bacteria | 2453 |
| 505 | Ga0495586_0127766 | 3300046535 | Bacteria | 1422 |
| 506 | Ga0495586_0172270 | 3300046535 | Bacteria | 1223 |
| 507 | Ga0495586_0318063 | 3300046535 | Bacteria | 892 |
| 508 | Ga0495587_0015121 | 3300046536 | Bacteria | 4823 |
| 509 | Ga0495587_0033763 | 3300046536 | Bacteria | 3086 |
| 510 | Ga0495587_0174471 | 3300046536 | Bacteria | 1220 |
| 511 | Ga0495609_0008303 | 3300046538 | Bacteria | 5092 |
| 512 | Ga0495609_0017904 | 3300046538 | Bacteria | 3287 |
| 513 | Ga0495609_0044718 | 3300046538 | Bacteria | 1985 |
| 514 | Ga0495609_0048276 | 3300046538 | Bacteria | 1903 |
| 515 | Ga0495609_0051016 | 3300046538 | Bacteria | 1843 |
| 516 | Ga0495609_0058074 | 3300046538 | Bacteria | 1711 |
| 517 | Ga0495609_0129126 | 3300046538 | Bacteria | 1083 |
| 518 | Ga0495609_0146116 | 3300046538 | Bacteria | 1007 |
| 519 | Ga0495597_0000310 | 3300046542 | Bacteria | 43852 |
| 520 | Ga0495597_0002547 | 3300046542 | Bacteria | 11430 |
| 521 | Ga0495597_0003418 | 3300046542 | Bacteria | 9274 |
| 522 | Ga0495597_0004282 | 3300046542 | Bacteria | 7887 |
| 523 | Ga0495597_0012024 | 3300046542 | Bacteria | 4183 |
| 524 | Ga0495597_0050362 | 3300046542 | Bacteria | 1839 |
| 525 | Ga0495597_0148467 | 3300046542 | Bacteria | 963 |
| 526 | Ga0495645_0026559 | 3300046543 | Bacteria | 4204 |
| 527 | Ga0495645_0231595 | 3300046543 | Bacteria | 1237 |
| 528 | Ga0495622_0053142 | 3300046557 | Bacteria | 1879 |
| 529 | Ga0495622_0054503 | 3300046557 | Bacteria | 1855 |
| 530 | Ga0495622_0067145 | 3300046557 | Bacteria | 1657 |
| 531 | Ga0495622_0187524 | 3300046557 | Bacteria | 925 |
| 532 | Ga0495633_0000357 | 3300046558 | Bacteria | 49514 |
| 533 | Ga0495633_0002184 | 3300046558 | Bacteria | 14032 |
| 534 | Ga0495633_0009027 | 3300046558 | Bacteria | 5546 |
| 535 | Ga0495633_0022770 | 3300046558 | Bacteria | 3111 |
| 536 | Ga0495633_0034395 | 3300046558 | Bacteria | 2437 |
| 537 | Ga0495633_0040898 | 3300046558 | Bacteria | 2206 |
| 538 | Ga0495633_0071185 | 3300046558 | Bacteria | 1622 |
| 539 | Ga0495633_0123596 | 3300046558 | Bacteria | 1198 |
| 540 | Ga0495633_0215978 | 3300046558 | Bacteria | 878 |
| 541 | Ga0495667_0108419 | 3300046559 | Bacteria | 1794 |
| 542 | Ga0495656_0001209 | 3300046615 | Bacteria | 8415 |
| 543 | Ga0495656_0069076 | 3300046615 | Bacteria | 1564 |
| 544 | Ga0495656_0075758 | 3300046615 | Bacteria | 1506 |
| 545 | Ga0495656_0216050 | 3300046615 | Bacteria | 957 |
| 546 | Ga0495656_0497204 | 3300046615 | Bacteria | 646 |
| 547 | Ga0495668_0000008 | 3300046616 | Bacteria | 498364 |
| 548 | Ga0495668_0001106 | 3300046616 | Bacteria | 27873 |
| 549 | Ga0495668_0021698 | 3300046616 | Bacteria | 3678 |
| 550 | Ga0495668_0034818 | 3300046616 | Bacteria | 2823 |
| 551 | Ga0495668_0047044 | 3300046616 | Bacteria | 2395 |
| 552 | Ga0495668_0048141 | 3300046616 | Bacteria | 2365 |
| 553 | Ga0495668_0145246 | 3300046616 | Bacteria | 1298 |
| 554 | Ga0495668_0344287 | 3300046616 | Bacteria | 818 |
| 555 | Ga0495668_0397196 | 3300046616 | Bacteria | 757 |
| 556 | Ga0495634_0000991 | 3300046642 | Bacteria | 26768 |
| 557 | Ga0495634_0117670 | 3300046642 | Bacteria | 1704 |
| 558 | Ga0495634_0337122 | 3300046642 | Bacteria | 905 |
| 559 | Ga0495611_0093809 | 3300046648 | Bacteria | 1388 |
| 560 | Ga0495611_0093887 | 3300046648 | Bacteria | 1388 |
| 561 | Ga0495611_0096401 | 3300046648 | Bacteria | 1369 |
| 562 | Ga0495611_0165269 | 3300046648 | Bacteria | 1034 |
| 563 | Ga0495625_0001934 | 3300046660 | Bacteria | 23417 |
| 564 | Ga0495625_0002185 | 3300046660 | Bacteria | 21708 |
| 565 | Ga0495625_0004513 | 3300046660 | Bacteria | 13131 |
| 566 | Ga0495625_0022179 | 3300046660 | Bacteria | 4872 |
| 567 | Ga0495625_0065254 | 3300046660 | Bacteria | 2567 |
| 568 | Ga0495625_0087883 | 3300046660 | Bacteria | 2154 |
| 569 | Ga0495625_0149084 | 3300046660 | Bacteria | 1573 |
| 570 | Ga0495625_0186517 | 3300046660 | Bacteria | 1376 |
| 571 | Ga0495625_0353390 | 3300046660 | Bacteria | 928 |
| 572 | Ga0495625_0403729 | 3300046660 | Bacteria | 853 |
| 573 | Ga0495625_0463312 | 3300046660 | Bacteria | 781 |
| 574 | Ga0495635_0001964 | 3300046663 | Bacteria | 13979 |
| 575 | Ga0495659_0002967 | 3300046664 | Bacteria | 5444 |
| 576 | Ga0495659_0037958 | 3300046664 | Bacteria | 1709 |
| 577 | Ga0495661_0012263 | 3300046665 | Bacteria | 5789 |
| 578 | Ga0495661_0012374 | 3300046665 | Bacteria | 5759 |
| 579 | Ga0495661_0032622 | 3300046665 | Bacteria | 3291 |
| 580 | Ga0495661_0037214 | 3300046665 | Bacteria | 3040 |
| 581 | Ga0495661_0044067 | 3300046665 | Bacteria | 2737 |
| 582 | Ga0495661_0071706 | 3300046665 | Bacteria | 2023 |
| 583 | Ga0495661_0096991 | 3300046665 | Bacteria | 1666 |
| 584 | Ga0495661_0120669 | 3300046665 | Bacteria | 1448 |
| 585 | Ga0495661_0194571 | 3300046665 | Bacteria | 1065 |
| 586 | Ga0495661_0210518 | 3300046665 | Bacteria | 1012 |
| 587 | Ga0495661_0273676 | 3300046665 | Bacteria | 853 |
| 588 | Ga0495588_0000113 | 3300046674 | Bacteria | 137279 |
| 589 | Ga0495588_0010764 | 3300046674 | Bacteria | 4269 |
| 590 | Ga0495588_0297746 | 3300046674 | Bacteria | 849 |
| 591 | Ga0495588_0323176 | 3300046674 | Bacteria | 811 |
| 592 | Ga0495588_0471139 | 3300046674 | Bacteria | 658 |
| 593 | Ga0495657_0064926 | 3300046675 | Bacteria | 2402 |
| 594 | Ga0495599_0027691 | 3300046678 | Bacteria | 3551 |
| 595 | Ga0495623_0016264 | 3300046679 | Bacteria | 4805 |
| 596 | Ga0495623_0170724 | 3300046679 | Bacteria | 1270 |
| 597 | Ga0495623_0233308 | 3300046679 | Bacteria | 1042 |
| 598 | Ga0495623_0273114 | 3300046679 | Bacteria | 943 |
| 599 | Ga0495646_0020393 | 3300046680 | Bacteria | 4194 |
| 600 | Ga0495646_0041520 | 3300046680 | Bacteria | 2826 |
| 601 | Ga0495646_0175128 | 3300046680 | Bacteria | 1180 |
| 602 | Ga0495669_0000075 | 3300046684 | Bacteria | 65812 |
| 603 | Ga0495669_0006448 | 3300046684 | Bacteria | 4899 |
| 604 | Ga0495669_0258688 | 3300046684 | Bacteria | 836 |
| 605 | Ga0495613_0021937 | 3300046689 | Bacteria | 4760 |
| 606 | Ga0495613_0147015 | 3300046689 | Bacteria | 1682 |
| 607 | Ga0495613_0167143 | 3300046689 | Bacteria | 1562 |
| 608 | Ga0495624_0177809 | 3300046690 | Bacteria | 1297 |
| 609 | Ga0495670_0003298 | 3300046691 | Bacteria | 7954 |
| 610 | Ga0495670_0022250 | 3300046691 | Bacteria | 3130 |
| 611 | Ga0495670_0053351 | 3300046691 | Bacteria | 2025 |
| 612 | Ga0495670_0056475 | 3300046691 | Bacteria | 1969 |
| 613 | Ga0495670_0065209 | 3300046691 | Bacteria | 1835 |
| 614 | Ga0495670_0087202 | 3300046691 | Bacteria | 1594 |
| 615 | Ga0495670_0160614 | 3300046691 | Bacteria | 1180 |
| 616 | Ga0495671_0007599 | 3300046692 | Bacteria | 6162 |
| 617 | Ga0495671_0014178 | 3300046692 | Bacteria | 4295 |
| 618 | Ga0495671_0048958 | 3300046692 | Bacteria | 2107 |
| 619 | Ga0495671_0077195 | 3300046692 | Bacteria | 1633 |
| 620 | Ga0495649_0007384 | 3300046694 | Bacteria | 6710 |
| 621 | Ga0495649_0059791 | 3300046694 | Bacteria | 2051 |
| 622 | Ga0495649_0073599 | 3300046694 | Bacteria | 1830 |
| 623 | Ga0495649_0078012 | 3300046694 | Bacteria | 1773 |
| 624 | Ga0495649_0090343 | 3300046694 | Bacteria | 1633 |
| 625 | Ga0495649_0113557 | 3300046694 | Bacteria | 1435 |
| 626 | Ga0495649_0378468 | 3300046694 | Bacteria | 712 |
| 627 | Ga0495589_0001253 | 3300046794 | Bacteria | 15034 |
| 628 | Ga0495589_0027732 | 3300046794 | Bacteria | 2862 |
| 629 | Ga0495589_0072985 | 3300046794 | Bacteria | 1675 |
| 630 | Ga0495589_0080904 | 3300046794 | Bacteria | 1580 |
| 631 | Ga0495600_0011825 | 3300046809 | Bacteria | 5450 |
| 632 | Ga0495600_0070875 | 3300046809 | Bacteria | 2278 |
| 633 | Ga0495600_0194477 | 3300046809 | Bacteria | 1303 |
| 634 | Ga0495600_0199116 | 3300046809 | Bacteria | 1287 |
| 635 | Ga0495600_0524328 | 3300046809 | Bacteria | 726 |
| 636 | Ga0495660_0003778 | 3300046810 | Bacteria | 9283 |
| 637 | Ga0495660_0053711 | 3300046810 | Bacteria | 2186 |
| 638 | Ga0495660_0065622 | 3300046810 | Bacteria | 1937 |
| 639 | Ga0495660_0184307 | 3300046810 | Bacteria | 1007 |
| 640 | Ga0495581_0007750 | 3300047315 | Bacteria | 6214 |
| 641 | Ga0495581_0040566 | 3300047315 | Bacteria | 2693 |
| 642 | Ga0495581_0065186 | 3300047315 | Bacteria | 2105 |
| 643 | Ga0495581_0099725 | 3300047315 | Bacteria | 1687 |
| 644 | Ga0495604_0008392 | 3300047317 | Bacteria | 8170 |
| 645 | Ga0495604_0009665 | 3300047317 | Bacteria | 7624 |
| 646 | Ga0495604_0025743 | 3300047317 | Bacteria | 4686 |
| 647 | Ga0495604_0169591 | 3300047317 | Bacteria | 1536 |
| 648 | Ga0495636_0004688 | 3300047318 | Bacteria | 5362 |
| 649 | Ga0495636_0207537 | 3300047318 | Bacteria | 896 |
| 650 | Ga0495636_0295009 | 3300047318 | Bacteria | 757 |
| 651 | Ga0495674_0001330 | 3300047319 | Bacteria | 24082 |
| 652 | Ga0495672_0000014 | 3300047320 | Bacteria | 505636 |
| 653 | Ga0495672_0000285 | 3300047320 | Bacteria | 70145 |
| 654 | Ga0495672_0025841 | 3300047320 | Bacteria | 3754 |
| 655 | Ga0495672_0102790 | 3300047320 | Bacteria | 1547 |
| 656 | Ga0495672_0131295 | 3300047320 | Bacteria | 1317 |
| 657 | Ga0495676_0032442 | 3300047321 | Bacteria | 4408 |
| 658 | Ga0495676_0433009 | 3300047321 | Bacteria | 869 |
| 659 | Ga0495680_0005963 | 3300047322 | Bacteria | 11395 |
| 660 | Ga0495680_0090337 | 3300047322 | Bacteria | 2298 |
| 661 | Ga0495683_0000112 | 3300047323 | Bacteria | 82903 |
| 662 | Ga0495683_0038289 | 3300047323 | Bacteria | 2428 |
| 663 | Ga0495683_0055612 | 3300047323 | Bacteria | 1969 |
| 664 | Ga0495683_0182017 | 3300047323 | Bacteria | 959 |
| 665 | Ga0495683_0214538 | 3300047323 | Bacteria | 861 |
| 666 | Ga0495687_000060 | 3300047443 | Bacteria | 179124 |
| 667 | Ga0495687_010203 | 3300047443 | Bacteria | 5167 |
| 668 | Ga0495675_0000641 | 3300047444 | Bacteria | 22216 |
| 669 | Ga0495675_0102882 | 3300047444 | Bacteria | 1786 |
| 670 | Ga0495675_0114778 | 3300047444 | Bacteria | 1679 |
| 671 | Ga0495677_0003569 | 3300047445 | Bacteria | 6034 |
| 672 | Ga0495677_0004197 | 3300047445 | Bacteria | 5558 |
| 673 | Ga0495677_0008437 | 3300047445 | Bacteria | 3825 |
| 674 | Ga0495677_0013167 | 3300047445 | Bacteria | 3009 |
| 675 | Ga0495677_0033535 | 3300047445 | Bacteria | 1871 |
| 676 | Ga0495677_0036290 | 3300047445 | Bacteria | 1800 |
| 677 | Ga0495677_0091042 | 3300047445 | Bacteria | 1149 |
| 678 | Ga0495679_017776 | 3300047446 | Bacteria | 2539 |
| 679 | Ga0495685_009277 | 3300047447 | Bacteria | 3281 |
| 680 | Ga0495685_016278 | 3300047447 | Bacteria | 2539 |
| 681 | Ga0495685_105721 | 3300047447 | Bacteria | 928 |
| 682 | Ga0495673_0000033 | 3300047469 | Bacteria | 354152 |
| 683 | Ga0495673_0000034 | 3300047469 | Bacteria | 326920 |
| 684 | Ga0495681_0005423 | 3300047470 | Bacteria | 8541 |
| 685 | Ga0495681_0014139 | 3300047470 | Bacteria | 4593 |
| 686 | Ga0495681_0016409 | 3300047470 | Bacteria | 4153 |
| 687 | Ga0495681_0023598 | 3300047470 | Bacteria | 3264 |
| 688 | Ga0495681_0030386 | 3300047470 | Bacteria | 2751 |
| 689 | Ga0495681_0035504 | 3300047470 | Bacteria | 2474 |
| 690 | Ga0495681_0037873 | 3300047470 | Bacteria | 2370 |
| 691 | Ga0495681_0039116 | 3300047470 | Bacteria | 2318 |
| 692 | Ga0495681_0093372 | 3300047470 | Bacteria | 1325 |
| 693 | Ga0495681_0127366 | 3300047470 | Bacteria | 1087 |
| 694 | Ga0495681_0302280 | 3300047470 | Bacteria | 619 |
| 695 | Ga0495686_0001306 | 3300047472 | Bacteria | 28040 |
| 696 | Ga0495686_0001600 | 3300047472 | Bacteria | 23919 |
| 697 | Ga0495686_0034550 | 3300047472 | Bacteria | 3255 |
| 698 | Ga0495686_0040470 | 3300047472 | Bacteria | 2971 |
| 699 | Ga0495686_0041735 | 3300047472 | Bacteria | 2920 |
| 700 | Ga0495593_0007821 | 3300047673 | Bacteria | 6230 |
| 701 | Ga0495593_0021382 | 3300047673 | Bacteria | 3615 |
| 702 | Ga0495593_0060082 | 3300047673 | Bacteria | 1990 |
| 703 | Ga0495593_0071856 | 3300047673 | Bacteria | 1797 |
| 704 | Ga0495602_0002022 | 3300048088 | Bacteria | 20408 |
| 705 | Ga0495602_0151365 | 3300048088 | Bacteria | 1823 |
| 706 | Ga0495602_0166569 | 3300048088 | Bacteria | 1714 |
| 707 | Ga0495602_0345020 | 3300048088 | Bacteria | 1076 |
| 708 | Ga0495614_0006176 | 3300048089 | Bacteria | 5382 |
| 709 | Ga0495614_0024164 | 3300048089 | Bacteria | 2624 |
| 710 | Ga0495614_0099458 | 3300048089 | Bacteria | 1270 |
| 711 | Ga0495614_0186182 | 3300048089 | Bacteria | 935 |
| 712 | Ga0495626_0000044 | 3300048091 | Bacteria | 165533 |
| 713 | Ga0495626_0000974 | 3300048091 | Bacteria | 24662 |
| 714 | Ga0495626_0001091 | 3300048091 | Bacteria | 22989 |
| 715 | Ga0495626_0007753 | 3300048091 | Bacteria | 5948 |
| 716 | Ga0495626_0010381 | 3300048091 | Bacteria | 4971 |
| 717 | Ga0495626_0023256 | 3300048091 | Bacteria | 3054 |
| 718 | Ga0495626_0028057 | 3300048091 | Bacteria | 2732 |
| 719 | Ga0495626_0058687 | 3300048091 | Bacteria | 1757 |
| 720 | Ga0495626_0090112 | 3300048091 | Bacteria | 1349 |
| 721 | Ga0495626_0092477 | 3300048091 | Bacteria | 1328 |
| 722 | Ga0496100_0014602 | 3300048903 | Bacteria | 4564 |
| 723 | Ga0496100_0773637 | 3300048903 | Bacteria | 751 |
| 724 | Ga0496101_0133907 | 3300048904 | Bacteria | 1884 |
| 725 | Ga0496102_0000279 | 3300048905 | Bacteria | 65185 |
| 726 | Ga0496102_0000977 | 3300048905 | Bacteria | 26896 |
| 727 | Ga0496102_0065912 | 3300048905 | Bacteria | 3319 |
| 728 | Ga0496102_0599882 | 3300048905 | Bacteria | 1024 |
| 729 | Ga0496102_0778555 | 3300048905 | Bacteria | 879 |
| 730 | Ga0496103_0001678 | 3300048906 | Bacteria | 14484 |
| 731 | Ga0496103_0007002 | 3300048906 | Bacteria | 6727 |
| 732 | Ga0496103_0174887 | 3300048906 | Bacteria | 1379 |
| 733 | Ga0496107_0110383 | 3300048910 | Bacteria | 2021 |
| 734 | Ga0496107_0163164 | 3300048910 | Bacteria | 1652 |
| 735 | Ga0496107_0341651 | 3300048910 | Bacteria | 1114 |
| 736 | Ga0496109_0136903 | 3300048912 | Bacteria | 2289 |
| 737 | Ga0496110_0007252 | 3300048913 | Bacteria | 8836 |
| 738 | Ga0496111_0249845 | 3300048914 | Bacteria | 1317 |
| 739 | Ga0496111_0264928 | 3300048914 | Bacteria | 1275 |
| 740 | Ga0496112_0625724 | 3300048915 | Bacteria | 1007 |
| 741 | Ga0496113_0026839 | 3300048916 | Bacteria | 4122 |
| 742 | Ga0496114_0137840 | 3300048917 | Bacteria | 2110 |
| 743 | Ga0496114_0427586 | 3300048917 | Bacteria | 1173 |
| 744 | Ga0496115_0268235 | 3300048918 | Bacteria | 1403 |
| 745 | Ga0496116_0010763 | 3300048919 | Bacteria | 7634 |
| 746 | Ga0496116_0016976 | 3300048919 | Bacteria | 5674 |
| 747 | Ga0496116_0071545 | 3300048919 | Bacteria | 2195 |
| 748 | Ga0496117_0000010 | 3300048920 | Bacteria | 611954 |
| 749 | Ga0496118_0000009 | 3300048921 | Bacteria | 611954 |
| 750 | Ga0496118_0089671 | 3300048921 | Bacteria | 2122 |
| 751 | Ga0496121_0016466 | 3300048924 | Bacteria | 7632 |
| 752 | Ga0496121_0018662 | 3300048924 | Bacteria | 6981 |
| 753 | Ga0496121_0022185 | 3300048924 | Bacteria | 6176 |
| 754 | Ga0496121_0118573 | 3300048924 | Bacteria | 2003 |
| 755 | Ga0496121_0544422 | 3300048924 | Bacteria | 727 |
| 756 | Ga0496122_0000513 | 3300048925 | Bacteria | 80013 |
| 757 | Ga0496122_0018308 | 3300048925 | Bacteria | 6482 |
| 758 | Ga0496122_0025832 | 3300048925 | Bacteria | 5085 |
| 759 | Ga0496123_0000145 | 3300048926 | Bacteria | 144475 |
| 760 | Ga0496123_0004642 | 3300048926 | Bacteria | 14267 |
| 761 | Ga0496123_0052096 | 3300048926 | Bacteria | 2719 |
| 762 | Ga0496124_0118031 | 3300048927 | Bacteria | 2124 |
| 763 | Ga0496124_0133675 | 3300048927 | Bacteria | 1967 |
| 764 | Ga0496124_0148865 | 3300048927 | Bacteria | 1839 |
| 765 | Ga0496124_0190102 | 3300048927 | Bacteria | 1572 |
| 766 | Ga0496124_0261593 | 3300048927 | Unclassified | 1273 |
| 767 | Ga0496125_0001481 | 3300048928 | Bacteria | 33868 |
| 768 | Ga0496125_0032436 | 3300048928 | Bacteria | 4640 |
| 769 | Ga0496125_0035873 | 3300048928 | Bacteria | 4340 |
| 770 | Ga0496125_0167339 | 3300048928 | Unclassified | 1483 |
| 771 | Ga0496125_0172039 | 3300048928 | Bacteria | 1454 |
| 772 | Ga0496125_0274243 | 3300048928 | Bacteria | 1049 |
| 773 | Ga0496126_0086756 | 3300048929 | Bacteria | 2758 |
| 774 | Ga0496126_0277185 | 3300048929 | Bacteria | 1390 |
| 775 | Ga0501309_002863 | 3300049129 | Bacteria | 1909 |
| 776 | Ga0495678_000076 | 3300049459 | Bacteria | 125077 |
| 777 | Ga0495678_000175 | 3300049459 | Bacteria | 73523 |
| 778 | Ga0495678_000780 | 3300049459 | Bacteria | 28573 |
| 779 | Ga0495682_0001244 | 3300049460 | Bacteria | 14408 |
| 780 | Ga0495682_0011867 | 3300049460 | Bacteria | 3349 |
| 781 | Ga0495682_0063027 | 3300049460 | Bacteria | 1337 |
| 782 | Ga0501292_027335 | 3300049515 | Bacteria | 945 |
| 783 | Ga0501034_0144066 | 3300049571 | Bacteria | 2361 |
| 784 | Ga0501210_017290 | 3300049657 | Bacteria | 650 |
| 785 | Ga0501229_048866 | 3300049706 | Bacteria | 620 |
| 786 | Ga0501269_000437 | 3300049766 | Bacteria | 9300 |
| 787 | Ga0501035_0000816 | 3300049822 | Bacteria | 33256 |
| 788 | Ga0495601_0006228 | 3300053077 | Bacteria | 6965 |
| 789 | Ga0495601_0316794 | 3300053077 | Bacteria | 1016 |
| 790 | Ga0500650_0000107 | 3300053098 | Bacteria | 22912 |
| 791 | Ga0500594_0011747 | 3300053118 | Bacteria | 2049 |
| 792 | Ga0500594_0048637 | 3300053118 | Bacteria | 1186 |
| 793 | Ga0500595_001191 | 3300053119 | Bacteria | 14359 |
| 794 | Ga0500618_000954 | 3300053125 | Bacteria | 14768 |
| 795 | Ga0500618_001000 | 3300053125 | Bacteria | 14271 |
| 796 | Ga0500574_001023 | 3300053141 | Bacteria | 3935 |
| 797 | Ga0500634_0164240 | 3300053161 | Bacteria | 1021 |
| 798 | Ga0587084_004887 | 3300059477 | Bacteria | 1559 |
| 799 | Ga0587084_010006 | 3300059477 | Bacteria | 1236 |
| 800 | Ga0587093_004214 | 3300059478 | Bacteria | 1454 |
| 801 | Ga0587070_004835 | 3300059491 | Bacteria | 1730 |
| 802 | Ga0587080_003903 | 3300059503 | Bacteria | 1895 |
| 803 | Ga0587083_0001972 | 3300059505 | Bacteria | 2453 |
| 804 | Ga0587088_001642 | 3300059508 | Bacteria | 2372 |
| 805 | Ga0587089_007506 | 3300059509 | Bacteria | 1295 |
| 806 | Ga0587090_031712 | 3300059510 | Bacteria | 887 |
| 807 | Ga0587094_004612 | 3300059513 | Bacteria | 1574 |
| 808 | Ga0587106_007225 | 3300059605 | Bacteria | 1342 |
| 809 | Ga0587106_009761 | 3300059605 | Bacteria | 1228 |
| 810 | Ga0587062_031699 | 3300059639 | Bacteria | 813 |
| 811 | Ga0587069_003497 | 3300059642 | Bacteria | 1700 |
| 812 | Ga0587069_007957 | 3300059642 | Bacteria | 1326 |
| 813 | Ga0587069_014580 | 3300059642 | Bacteria | 1098 |
| 814 | Ga0587075_002311 | 3300059644 | Bacteria | 2000 |
| 815 | Ga0587075_042694 | 3300059644 | Bacteria | 766 |
| 816 | Ga0587076_007597 | 3300059645 | Bacteria | 1486 |
| 817 | Ga0587078_008471 | 3300059646 | Bacteria | 1153 |
| 818 | Ga0587079_015290 | 3300059647 | Bacteria | 1301 |
| 819 | Ga0587079_016520 | 3300059647 | Bacteria | 1268 |
| 820 | Ga0587079_023657 | 3300059647 | Bacteria | 1126 |
| 821 | Ga0587102_001965 | 3300059649 | Bacteria | 1531 |
| 822 | Ga0587096_00172 | 3300060247 | Bacteria | 1445 |
| 823 | Ga0587071_009863 | 3300060344 | Bacteria | 1582 |
| 824 | 2511249160 | 2511231003 | Bacteria | 5606035 |
| 825 | 2511387194 | 2511231026 | Bacteria | 5225445 |
| 826 | 2521556704 | 2521172590 | Bacteria | 5047645 |
| 827 | 2550692417 | 2548876994 | Bacteria | 4904866 |
| 828 | 2553006704 | 2551306416 | Bacteria | 6152985 |
| 829 | 2601666747 | 2600255292 | Bacteria | 6300551 |
| 830 | 2644027961 | 2643221603 | Bacteria | 6147767 |
| 831 | 2644249236 | 2643221645 | Bacteria | 7207331 |
| 832 | 2738740665 | 2738541280 | Bacteria | 6630198 |
| 833 | 2738825951 | 2738541297 | Bacteria | 6549566 |
| 834 | 2738844986 | 2738541300 | Bacteria | 6675882 |
| 835 | 2739149748 | 2738541357 | Bacteria | 6549408 |
| 836 | 2739191667 | 2738543003 | Bacteria | 6549560 |
| 837 | 2739277401 | 2738543018 | Bacteria | 6718814 |
| 838 | 2739318144 | 2738543026 | Bacteria | 6549408 |
| 839 | 2739336385 | 2738543029 | Bacteria | 6549249 |
| 840 | 2739346444 | 2738543030 | Bacteria | 6719714 |
| 841 | 2765567885 | 2765235838 | Bacteria | 5445269 |
| 842 | 2808982747 | 2808606386 | Bacteria | 4471946 |
| 843 | 2809130249 | 2808606415 | Bacteria | 4576710 |
| 844 | 2809150274 | 2808606419 | Bacteria | 4576925 |
| 845 | 2819543071 | 2818991436 | Bacteria | 5376622 |
| 846 | 2819592561 | 2818991445 | Bacteria | 4955017 |
| 847 | 2819618069 | 2818991449 | Bacteria | 5518009 |
| 848 | 2821135594 | 2821131069 | Bacteria | 6108407 |
| 849 | 2839097828 | 2839094727 | Bacteria | 5534556 |
| 850 | 2842714022 | 2842711865 | Bacteria | 7155354 |
| 851 | 2852621503 | 2852618963 | Bacteria | 4577824 |
| 852 | 2857548513 | 2857547612 | Bacteria | 6179999 |
| 853 | 2857562487 | 2857558681 | Bacteria | 6617694 |
| 854 | 2857566349 | 2857564685 | Bacteria | 6290584 |
| 855 | 2884812348 | 2884811622 | Bacteria | 5552861 |
| 856 | 2884838950 | 2884836552 | Bacteria | 5219991 |
| 857 | 2884855242 | 2884852848 | Bacteria | 5221161 |
| 858 | 2885083693 | 2885080285 | Bacteria | 6355622 |
| 859 | 2896156089 | 2896154374 | Bacteria | 5221518 |
| 860 | 2904430742 | 2904424332 | Bacteria | 7633521 |
| 861 | 2904441913 | 2904439833 | Bacteria | 5931679 |
| 862 | 2904533211 | 2904530477 | Bacteria | 5876334 |
| 863 | 2904586158 | 2904584206 | Bacteria | 6028872 |
| 864 | 2904592028 | 2904589729 | Bacteria | 6113573 |
| 865 | 2904601810 | 2904601388 | Bacteria | 5884906 |
| 866 | 2919049474 | 2919046199 | Bacteria | 5567169 |
| 867 | 2919083863 | 2919079590 | Bacteria | 5946433 |
| 868 | 2923515296 | 2923510766 | Bacteria | 5926163 |
| 869 | 2928132254 | 2928130867 | Bacteria | 5467269 |
| 870 | 2932413108 | 2932410948 | Bacteria | 6312192 |
| 871 | 2932420623 | 2932416698 | Bacteria | 6315112 |
| 872 | Ga0500618_001616 | |||
| 873 | JGI25155J39150_1000142 | |||
| 874 | JGI25155J39150_1000219 | |||
| 875 | JGI25156J39149_1000497 | |||
| 876 | JGI25156J39149_1003054 | |||
| 877 | JGI25162J39368_1000025 | |||
| 878 | JGI25162J39368_1005347 | |||
| 879 | JGI25154J39366_1000423 | |||
| 880 | JGI25154J39366_1000432 | |||
| 881 | JGI25157J39369_1000158 | |||
| 882 | JGI25157J39369_1000203 | |||
| 883 | JGI25150J39212_1001267 | |||
| 884 | JGI25150J39212_1035054 | |||
| 885 | JGI25159J45721_1011470 | |||
| 886 | JGI25159J45721_1035208 | |||
| 887 | JGI25165J46597_1000054 | |||
| 888 | JGI25153J46596_10021808 | |||
| 889 | rootH1_10018115 | |||
| 890 | rootH2_10293157 | |||
| 891 | rootL2_10003812 | |||
| 892 | rootL2_10025871 | |||
| 893 | rootH1_10041734 | |||
| 894 | JGI25161J50226_1010203 | |||
| 895 | JGI25161J50226_1017073 | |||
| 896 | Ga0007417J51691_1016591 | |||
| 897 | Ga0007410J51695_1021115 | |||
| 898 | Ga0007410J51695_1024144 | |||
| 899 | Ga0007409J51694_1006046 | |||
| 900 | Ga0007416J51690_1029903 | |||
| 901 | Ga0055538_1000002 | |||
| 902 | Ga0055538_1000026 | |||
| 903 | Ga0055538_1000117 | |||
| 904 | Ga0055539_1000002 | |||
| 905 | Ga0055539_1000033 | |||
| 906 | Ga0055539_1000163 | |||
| 907 | Ga0055533_1000004 | |||
| 908 | Ga0055533_1000044 | |||
| 909 | Ga0055533_1000166 | |||
| 910 | Ga0055532_1000005 | |||
| 911 | Ga0055525_1000002 | |||
| 912 | Ga0055525_1000052 | |||
| 913 | Ga0055525_1000081 | |||
| 914 | Ga0055525_1000227 | |||
| 915 | Ga0055535_1024759 | |||
| 916 | Ga0055529_1000565 | |||
| 917 | Ga0055526_1004232 | |||
| 918 | Ga0055526_1005886 | |||
| 919 | Ga0055526_1015143 | |||
| 920 | Ga0055526_1064010 | |||
| 921 | Ga0055537_1003974 | |||
| 922 | Ga0055524_1000026 | |||
| 923 | Ga0055524_1010165 | |||
| 924 | Ga0055534_1002884 | |||
| 925 | Ga0055534_1003282 | |||
| 926 | Ga0055528_1010434 | |||
| 927 | Ga0055530_10010428 | |||
| 928 | Ga0055530_10037080 | |||
| 929 | Ga0055541_1000002 | |||
| 930 | Ga0055541_1000069 | |||
| 931 | Ga0055541_1000109 | |||
| 932 | Ga0055543_1004724 | |||
| 933 | Ga0065165_1000557 | |||
| 934 | Ga0065165_1011662 | |||
| 935 | Ga0065704_10286848 | |||
| 936 | Ga0065707_10223324 | |||
| 937 | Ga0070658_10310880 | |||
| 938 | Ga0070658_11126602 | |||
| 939 | Ga0070658_11289576 | |||
| 940 | Ga0070676_10074194 | |||
| 941 | Ga0070670_100000002 | |||
| 942 | Ga0070680_100399210 | |||
| 943 | Ga0070682_100209046 | |||
| 944 | Ga0070660_100019039 | |||
| 945 | Ga0070660_100019636 | |||
| 946 | Ga0070660_100878083 | |||
| 947 | Ga0070661_100016272 | |||
| 948 | Ga0070661_100471047 | |||
| 949 | Ga0070669_100005576 | |||
| 950 | Ga0070671_100000025 | |||
| 951 | Ga0070688_100004285 | |||
| 952 | Ga0070659_100027283 | |||
| 953 | Ga0070659_100248247 | |||
| 954 | Ga0070667_100000394 | |||
| 955 | Ga0068867_100808148 | |||
| 956 | Ga0070685_10000005 | |||
| 957 | Ga0068853_101402260 | |||
| 958 | Ga0070665_100150604 | |||
| 959 | Ga0068855_100002941 | |||
| 960 | Ga0068855_100023836 | |||
| 961 | Ga0068855_100113778 | |||
| 962 | Ga0068855_100654854 | |||
| 963 | Ga0070664_100107270 | |||
| 964 | Ga0068854_100007911 | |||
| 965 | Ga0068854_100351826 | |||
| 966 | Ga0068856_100196880 | |||
| 967 | Ga0068856_100577120 | |||
| 968 | Ga0068852_100105451 | |||
| 969 | Ga0068852_100470435 | |||
| 970 | Ga0068859_100041050 | |||
| 971 | Ga0068864_100000003 | |||
| 972 | Ga0068851_10118595 | |||
| 973 | Ga0068860_100000326 | |||
| 974 | Ga0068862_100068501 | |||
| 975 | Ga0070717_10329720 | |||
| 976 | Ga0070712_100003941 | |||
| 977 | Ga0075362_10006912 | |||
| 978 | Ga0097621_100672441 | |||
| 979 | Ga0068871_100961585 | |||
| 980 | Ga0097620_100041051 | |||
| 981 | Ga0079104_1003938 | |||
| 982 | Ga0105244_10002846 | |||
| 983 | Ga0105244_10004702 | |||
| 984 | Ga0105244_10017619 | |||
| 985 | Ga0105244_10082230 | |||
| 986 | Ga0105240_10003355 | |||
| 987 | Ga0105240_10007797 | |||
| 988 | Ga0105240_10076139 | |||
| 989 | Ga0105240_10255882 | |||
| 990 | Ga0105245_10095866 | |||
| 991 | Ga0105243_10069287 | |||
| 992 | Ga0105241_10134982 | |||
| 993 | Ga0105242_10002231 | |||
| 994 | Ga0105248_10148536 | |||
| 995 | Ga0105237_10006971 | |||
| 996 | Ga0105238_10000505 | |||
| 997 | Ga0105238_10028613 | |||
| 998 | Ga0105249_10146050 | |||
| 999 | Ga0105239_10003532 | |||
| 1000 | Ga0105239_10093891 | |||
| 1001 | Ga0105239_10566910 | |||
| 1002 | Ga0105246_10495530 | |||
| 1003 | Ga0157373_10065917 | |||
| 1004 | Ga0157371_10000064 | |||
| 1005 | Ga0157371_10376395 | |||
| 1006 | Ga0157378_11587540 | |||
| 1007 | Ga0163162_10090756 | |||
| 1008 | Ga0157372_10418475 | |||
| 1009 | Ga0157372_11872767 | |||
| 1010 | Ga0163163_10000136 | |||
| 1011 | Ga0182008_10012348 | |||
| 1012 | Ga0182008_10022337 | |||
| 1013 | Ga0182008_10290110 | |||
| 1014 | Ga0157379_10845278 | |||
| 1015 | Ga0157376_11137173 | |||
| 1016 | Ga0182006_1000010 | |||
| 1017 | Ga0182006_1000070 | |||
| 1018 | Ga0182006_1003847 | |||
| 1019 | Ga0182006_1011302 | |||
| 1020 | Ga0182006_1019017 | |||
| 1021 | Ga0182006_1137093 | |||
| 1022 | Ga0182007_10000021 | |||
| 1023 | Ga0182007_10005022 | |||
| 1024 | Ga0182007_10028545 | |||
| 1025 | Ga0182007_10039625 | |||
| 1026 | Ga0182007_10047837 | |||
| 1027 | Ga0182005_1000003 | |||
| 1028 | Ga0182005_1000009 | |||
| 1029 | Ga0182005_1000140 | |||
| 1030 | Ga0163161_10013082 | |||
| 1031 | Ga0163161_10127977 | |||
| 1032 | Ga0213872_10001180 | |||
| 1033 | Ga0213872_10039352 | |||
| 1034 | Ga0213872_10142017 | |||
| 1035 | Ga0209435_100004 | |||
| 1036 | Ga0209435_100214 | |||
| 1037 | Ga0209436_104714 | |||
| 1038 | Ga0209784_100002 | |||
| 1039 | Ga0209784_100020 | |||
| 1040 | Ga0209784_100153 | |||
| 1041 | Ga0209566_100003 | |||
| 1042 | Ga0209566_100020 | |||
| 1043 | Ga0209566_100195 | |||
| 1044 | Ga0209674_100004 | |||
| 1045 | Ga0209674_100035 | |||
| 1046 | Ga0209674_100198 | |||
| 1047 | Ga0209672_110782 | |||
| 1048 | Ga0209147_100011 | |||
| 1049 | Ga0209563_100006 | |||
| 1050 | Ga0209563_100015 | |||
| 1051 | Ga0209563_100038 | |||
| 1052 | Ga0209563_100157 | |||
| 1053 | Ga0207427_100803 | |||
| 1054 | Ga0209437_100066 | |||
| 1055 | Ga0209437_100084 | |||
| 1056 | Ga0209258_100560 | |||
| 1057 | Ga0207425_1000205 | |||
| 1058 | Ga0207425_1001881 | |||
| 1059 | Ga0209646_1000032 | |||
| 1060 | Ga0209646_1000283 | |||
| 1061 | Ga0209026_1000062 | |||
| 1062 | Ga0209026_1001071 | |||
| 1063 | Ga0209677_100003 | |||
| 1064 | Ga0209677_100031 | |||
| 1065 | Ga0209677_100156 | |||
| 1066 | Ga0209677_109110 | |||
| 1067 | Ga0209759_1000054 | |||
| 1068 | Ga0209759_1000548 | |||
| 1069 | Ga0209233_1000060 | |||
| 1070 | Ga0209565_1000163 | |||
| 1071 | Ga0209565_1002537 | |||
| 1072 | Ga0209565_1003524 | |||
| 1073 | Ga0209565_1019823 | |||
| 1074 | Ga0209455_1000063 | |||
| 1075 | Ga0209673_1013569 | |||
| 1076 | Ga0209130_1001475 | |||
| 1077 | Ga0209675_1000635 | |||
| 1078 | Ga0209675_1004769 | |||
| 1079 | Ga0209675_1035477 | |||
| 1080 | Ga0209025_1007316 | |||
| 1081 | Ga0209564_1000026 | |||
| 1082 | Ga0209564_1000098 | |||
| 1083 | Ga0209564_1010469 | |||
| 1084 | Ga0209758_1000270 | |||
| 1085 | Ga0209050_1000183 | |||
| 1086 | Ga0209050_1000753 | |||
| 1087 | Ga0209256_1000013 | |||
| 1088 | Ga0209256_1001083 | |||
| 1089 | Ga0209256_1003724 | |||
| 1090 | Ga0207426_1008085 | |||
| 1091 | Ga0209051_1033169 | |||
| 1092 | Ga0209257_1000010 | |||
| 1093 | Ga0207655_1006312 | |||
| 1094 | Ga0207655_1007374 | |||
| 1095 | Ga0207655_1072617 | |||
| 1096 | Ga0207655_1102042 | |||
| 1097 | Ga0207680_10007523 | |||
| 1098 | Ga0207705_10015832 | |||
| 1099 | Ga0207705_10573990 | |||
| 1100 | Ga0207654_10003120 | |||
| 1101 | Ga0207695_10001902 | |||
| 1102 | Ga0207695_10006732 | |||
| 1103 | Ga0207695_10032133 | |||
| 1104 | Ga0207695_10694482 | |||
| 1105 | Ga0207671_10007433 | |||
| 1106 | Ga0207671_10084328 | |||
| 1107 | Ga0207660_10242713 | |||
| 1108 | Ga0207657_10004403 | |||
| 1109 | Ga0207681_10000156 | |||
| 1110 | Ga0207694_10000392 | |||
| 1111 | Ga0207650_10000003 | |||
| 1112 | Ga0207650_10071357 | |||
| 1113 | Ga0207644_10000312 | |||
| 1114 | Ga0207690_10017481 | |||
| 1115 | Ga0207690_10315843 | |||
| 1116 | Ga0207706_10096998 | |||
| 1117 | Ga0207686_10004796 | |||
| 1118 | Ga0207711_10002080 | |||
| 1119 | Ga0207711_10008967 | |||
| 1120 | Ga0207661_10315241 | |||
| 1121 | Ga0207679_10087306 | |||
| 1122 | Ga0207667_10000019 | |||
| 1123 | Ga0207667_10015769 | |||
| 1124 | Ga0207667_10287065 | |||
| 1125 | Ga0207712_10142307 | |||
| 1126 | Ga0207640_10002070 | |||
| 1127 | Ga0207640_10205995 | |||
| 1128 | Ga0207658_10000004 | |||
| 1129 | Ga0207703_10607025 | |||
| 1130 | Ga0207639_10224640 | |||
| 1131 | Ga0207702_10314059 | |||
| 1132 | Ga0207641_10190748 | |||
| 1133 | Ga0207641_10661571 | |||
| 1134 | Ga0207648_10224184 | |||
| 1135 | Ga0207676_10000003 | |||
| 1136 | Ga0207674_10193579 | |||
| 1137 | Ga0207674_10502681 | |||
| 1138 | Ga0207698_10002422 | |||
| 1139 | Ga0207698_10826271 | |||
| 1140 | Ga0207698_11889844 | |||
| 1141 | Ga0209281_1027586 | |||
| 1142 | Ga0268266_10060143 | |||
| 1143 | Ga0268265_10001641 | |||
| 1144 | Ga0268264_10000123 | |||
| 1145 | Ga0265338_10000251 | |||
| 1146 | Ga0265332_10140284 | |||
| 1147 | Ga0307408_100030099 | |||
| 1148 | Ga0307408_100039064 | |||
| 1149 | Ga0307408_100120973 | |||
| 1150 | Ga0307518_10093594 | |||
| 1151 | Ga0307412_10912337 | |||
| 1152 | Ga0307416_100654254 | |||
| 1153 | Ga0307414_10045777 | |||
| 1154 | Ga0307414_10817207 | |||
| 1155 | Ga0395899_0006725 | |||
| 1156 | Ga0395899_0023733 | |||
| 1157 | Ga0395899_0573065 | |||
| 1158 | Ga0395900_0000532 | |||
| 1159 | Ga0395900_0004176 | |||
| 1160 | Ga0395900_0011395 | |||
| 1161 | Ga0395900_0044333 | |||
| 1162 | Ga0395900_0372424 | |||
| 1163 | Ga0395900_0860748 | |||
| 1164 | Ga0395898_0017582 | |||
| 1165 | Ga0395905_0000589 | |||
| 1166 | Ga0395905_0010271 | |||
| 1167 | Ga0395905_0072918 | |||
| 1168 | Ga0395905_0131813 | |||
| 1169 | Ga0395905_0290802 | |||
| 1170 | Ga0395905_0916846 | |||
| 1171 | Ga0395901_0000765 | |||
| 1172 | Ga0395901_0002028 | |||
| 1173 | Ga0395901_0009241 | |||
| 1174 | Ga0395901_0319235 | |||
| 1175 | Ga0436361_0065289 | |||
| 1176 | Ga0436361_0179116 | |||
| 1177 | Ga0436361_0239425 | |||
| 1178 | Ga0436361_0370552 | |||
| 1179 | Ga0436361_0480035 | |||
| 1180 | Ga0436361_1087377 | |||
| 1181 | Ga0439465_0139031 | |||
| 1182 | Ga0439448_0024773 | |||
| 1183 | Ga0439448_0034436 | |||
| 1184 | Ga0439450_003658 | |||
| 1185 | Ga0439455_0002204 | |||
| 1186 | Ga0439455_0070868 | |||
| 1187 | Ga0450904_000854 | |||
| 1188 | Ga0450906_092126 | |||
| 1189 | Ga0439464_0093207 | |||
| 1190 | Ga0466969_0024922 | |||
| 1191 | Ga0466969_0401196 | |||
| 1192 | Ga0466972_0000283 | |||
| 1193 | Ga0466972_0031399 | |||
| 1194 | Ga0466981_0558362 | |||
| 1195 | Ga0466965_0001710 | |||
| 1196 | Ga0466965_0006716 | |||
| 1197 | Ga0466965_0047069 | |||
| 1198 | Ga0466966_0010145 | |||
| 1199 | Ga0466961_0286026 | |||
| 1200 | Ga0466961_0485655 | |||
| 1201 | Ga0466963_0077203 | |||
| 1202 | Ga0466964_0005209 | |||
| 1203 | Ga0466964_0012691 | |||
| 1204 | Ga0466964_0023327 | |||
| 1205 | Ga0466964_0213964 | |||
| 1206 | Ga0466971_0182658 | |||
| 1207 | Ga0466971_0224141 | |||
| 1208 | Ga0466968_0005176 | |||
| 1209 | Ga0466968_0168236 | |||
| 1210 | Ga0466970_0033906 | |||
| 1211 | Ga0466970_0077320 | |||
| 1212 | Ga0466957_0003305 | |||
| 1213 | Ga0466959_0057388 | |||
| 1214 | Ga0466959_0082530 | |||
| 1215 | Ga0466959_0147587 | |||
| 1216 | Ga0466959_0235373 | |||
| 1217 | Ga0466958_0044719 | |||
| 1218 | Ga0466967_0027416 | |||
| 1219 | Ga0495617_075766 | |||
| 1220 | Ga0495627_004698 | |||
| 1221 | Ga0495627_005183 | |||
| 1222 | Ga0495592_0086444 | |||
| 1223 | Ga0495603_0127264 | |||
| 1224 | Ga0495590_0093492 | |||
| 1225 | Ga0495629_0008589 | |||
| 1226 | Ga0495629_0056479 | |||
| 1227 | Ga0495638_0036578 | |||
| 1228 | Ga0495638_0083406 | |||
| 1229 | Ga0495638_0117589 | |||
| 1230 | Ga0495651_0154334 | |||
| 1231 | Ga0495653_0036769 | |||
| 1232 | Ga0495653_0041862 | |||
| 1233 | Ga0495653_0135297 | |||
| 1234 | Ga0495650_0000051 | |||
| 1235 | Ga0495650_0000212 | |||
| 1236 | Ga0495650_0000712 | |||
| 1237 | Ga0495650_0033656 | |||
| 1238 | Ga0495580_0024981 | |||
| 1239 | Ga0495582_0005030 | |||
| 1240 | Ga0495582_0214083 | |||
| 1241 | Ga0495605_0000005 | |||
| 1242 | Ga0495605_0026659 | |||
| 1243 | Ga0495605_0027564 | |||
| 1244 | Ga0495605_0047131 | |||
| 1245 | Ga0495639_0228194 | |||
| 1246 | Ga0495584_0000381 | |||
| 1247 | Ga0495584_0000755 | |||
| 1248 | Ga0495584_0001114 | |||
| 1249 | Ga0495584_0007663 | |||
| 1250 | Ga0495584_0018616 | |||
| 1251 | Ga0495584_0019150 | |||
| 1252 | Ga0495584_0021044 | |||
| 1253 | Ga0495584_0070048 | |||
| 1254 | Ga0495584_0094776 | |||
| 1255 | Ga0495584_0099702 | |||
| 1256 | Ga0495584_0224600 | |||
| 1257 | Ga0495585_0000889 | |||
| 1258 | Ga0495585_0007941 | |||
| 1259 | Ga0495585_0008221 | |||
| 1260 | Ga0495585_0011129 | |||
| 1261 | Ga0495585_0017446 | |||
| 1262 | Ga0495585_0092311 | |||
| 1263 | Ga0495585_0097505 | |||
| 1264 | Ga0495585_0135032 | |||
| 1265 | Ga0495585_0235050 | |||
| 1266 | Ga0495594_0016435 | |||
| 1267 | Ga0495594_0293937 | |||
| 1268 | Ga0495594_0365398 | |||
| 1269 | Ga0495596_0004154 | |||
| 1270 | Ga0495596_0005456 | |||
| 1271 | Ga0495596_0017944 | |||
| 1272 | Ga0495596_0036442 | |||
| 1273 | Ga0495596_0044212 | |||
| 1274 | Ga0495596_0175637 | |||
| 1275 | Ga0495607_0011208 | |||
| 1276 | Ga0495607_0034188 | |||
| 1277 | Ga0495607_0039793 | |||
| 1278 | Ga0495607_0052064 | |||
| 1279 | Ga0495607_0063189 | |||
| 1280 | Ga0495607_0090256 | |||
| 1281 | Ga0495583_0000983 | |||
| 1282 | Ga0495583_0018489 | |||
| 1283 | Ga0495583_0019099 | |||
| 1284 | Ga0495583_0038221 | |||
| 1285 | Ga0495583_0044743 | |||
| 1286 | Ga0495583_0052003 | |||
| 1287 | Ga0495583_0108125 | |||
| 1288 | Ga0495583_0170507 | |||
| 1289 | Ga0495606_0000547 | |||
| 1290 | Ga0495606_0002788 | |||
| 1291 | Ga0495606_0003771 | |||
| 1292 | Ga0495606_0036377 | |||
| 1293 | Ga0495606_0050389 | |||
| 1294 | Ga0495606_0072842 | |||
| 1295 | Ga0495606_0115547 | |||
| 1296 | Ga0495606_0119684 | |||
| 1297 | Ga0495606_0259831 | |||
| 1298 | Ga0495606_0346055 | |||
| 1299 | Ga0495608_0011730 | |||
| 1300 | Ga0495610_0000021 | |||
| 1301 | Ga0495610_0006777 | |||
| 1302 | Ga0495616_0000093 | |||
| 1303 | Ga0495616_0024971 | |||
| 1304 | Ga0495616_0026678 | |||
| 1305 | Ga0495616_0040738 | |||
| 1306 | Ga0495616_0084167 | |||
| 1307 | Ga0495616_0105541 | |||
| 1308 | Ga0495616_0106310 | |||
| 1309 | Ga0495618_0043922 | |||
| 1310 | Ga0495620_0020297 | |||
| 1311 | Ga0495628_0006086 | |||
| 1312 | Ga0495628_0013454 | |||
| 1313 | Ga0495630_0005271 | |||
| 1314 | Ga0495630_0021183 | |||
| 1315 | Ga0495631_0014034 | |||
| 1316 | Ga0495631_0019628 | |||
| 1317 | Ga0495631_0020566 | |||
| 1318 | Ga0495631_0022012 | |||
| 1319 | Ga0495631_0182652 | |||
| 1320 | Ga0495631_0187925 | |||
| 1321 | Ga0495631_0221516 | |||
| 1322 | Ga0495632_0001724 | |||
| 1323 | Ga0495632_0008471 | |||
| 1324 | Ga0495632_0059363 | |||
| 1325 | Ga0495637_0000305 | |||
| 1326 | Ga0495637_0051276 | |||
| 1327 | Ga0495643_0000096 | |||
| 1328 | Ga0495643_0000181 | |||
| 1329 | Ga0495643_0000983 | |||
| 1330 | Ga0495643_0001269 | |||
| 1331 | Ga0495643_0036792 | |||
| 1332 | Ga0495643_0077756 | |||
| 1333 | Ga0495643_0106851 | |||
| 1334 | Ga0495643_0230749 | |||
| 1335 | Ga0495643_0253848 | |||
| 1336 | Ga0495644_0014817 | |||
| 1337 | Ga0495644_0029509 | |||
| 1338 | Ga0495644_0030512 | |||
| 1339 | Ga0495648_0019268 | |||
| 1340 | Ga0495648_0037553 | |||
| 1341 | Ga0495648_0071327 | |||
| 1342 | Ga0495648_0090475 | |||
| 1343 | Ga0495648_0301215 | |||
| 1344 | Ga0495663_0104318 | |||
| 1345 | Ga0495666_0000293 | |||
| 1346 | Ga0495666_0007083 | |||
| 1347 | Ga0495642_0022230 | |||
| 1348 | Ga0495642_0036277 | |||
| 1349 | Ga0495642_0052284 | |||
| 1350 | Ga0495642_0088467 | |||
| 1351 | Ga0495642_0097643 | |||
| 1352 | Ga0495642_0206597 | |||
| 1353 | Ga0495652_0014252 | |||
| 1354 | Ga0495652_0032215 | |||
| 1355 | Ga0495652_0041820 | |||
| 1356 | Ga0495652_0060251 | |||
| 1357 | Ga0495652_0089342 | |||
| 1358 | Ga0495652_0127906 | |||
| 1359 | Ga0495654_0000005 | |||
| 1360 | Ga0495654_0011080 | |||
| 1361 | Ga0495654_0021618 | |||
| 1362 | Ga0495654_0028810 | |||
| 1363 | Ga0495654_0142868 | |||
| 1364 | Ga0495654_0166524 | |||
| 1365 | Ga0495665_0020394 | |||
| 1366 | Ga0495665_0027126 | |||
| 1367 | Ga0495665_0137168 | |||
| 1368 | Ga0495665_0272221 | |||
| 1369 | Ga0495665_0381375 | |||
| 1370 | Ga0495640_0004944 | |||
| 1371 | Ga0495586_0016302 | |||
| 1372 | Ga0495586_0021007 | |||
| 1373 | Ga0495586_0022390 | |||
| 1374 | Ga0495586_0042318 | |||
| 1375 | Ga0495586_0127766 | |||
| 1376 | Ga0495586_0172270 | |||
| 1377 | Ga0495586_0318063 | |||
| 1378 | Ga0495587_0015121 | |||
| 1379 | Ga0495587_0033763 | |||
| 1380 | Ga0495587_0174471 | |||
| 1381 | Ga0495609_0008303 | |||
| 1382 | Ga0495609_0017904 | |||
| 1383 | Ga0495609_0044718 | |||
| 1384 | Ga0495609_0048276 | |||
| 1385 | Ga0495609_0051016 | |||
| 1386 | Ga0495609_0058074 | |||
| 1387 | Ga0495609_0129126 | |||
| 1388 | Ga0495609_0146116 | |||
| 1389 | Ga0495597_0000310 | |||
| 1390 | Ga0495597_0002547 | |||
| 1391 | Ga0495597_0003418 | |||
| 1392 | Ga0495597_0004282 | |||
| 1393 | Ga0495597_0012024 | |||
| 1394 | Ga0495597_0050362 | |||
| 1395 | Ga0495597_0148467 | |||
| 1396 | Ga0495645_0026559 | |||
| 1397 | Ga0495645_0231595 | |||
| 1398 | Ga0495622_0053142 | |||
| 1399 | Ga0495622_0054503 | |||
| 1400 | Ga0495622_0067145 | |||
| 1401 | Ga0495622_0187524 | |||
| 1402 | Ga0495633_0000357 | |||
| 1403 | Ga0495633_0002184 | |||
| 1404 | Ga0495633_0009027 | |||
| 1405 | Ga0495633_0022770 | |||
| 1406 | Ga0495633_0034395 | |||
| 1407 | Ga0495633_0040898 | |||
| 1408 | Ga0495633_0071185 | |||
| 1409 | Ga0495633_0123596 | |||
| 1410 | Ga0495633_0215978 | |||
| 1411 | Ga0495667_0108419 | |||
| 1412 | Ga0495656_0001209 | |||
| 1413 | Ga0495656_0069076 | |||
| 1414 | Ga0495656_0075758 | |||
| 1415 | Ga0495656_0216050 | |||
| 1416 | Ga0495656_0497204 | |||
| 1417 | Ga0495668_0000008 | |||
| 1418 | Ga0495668_0001106 | |||
| 1419 | Ga0495668_0021698 | |||
| 1420 | Ga0495668_0034818 | |||
| 1421 | Ga0495668_0047044 | |||
| 1422 | Ga0495668_0048141 | |||
| 1423 | Ga0495668_0145246 | |||
| 1424 | Ga0495668_0344287 | |||
| 1425 | Ga0495668_0397196 | |||
| 1426 | Ga0495634_0000991 | |||
| 1427 | Ga0495634_0117670 | |||
| 1428 | Ga0495634_0337122 | |||
| 1429 | Ga0495611_0093809 | |||
| 1430 | Ga0495611_0093887 | |||
| 1431 | Ga0495611_0096401 | |||
| 1432 | Ga0495611_0165269 | |||
| 1433 | Ga0495625_0001934 | |||
| 1434 | Ga0495625_0002185 | |||
| 1435 | Ga0495625_0004513 | |||
| 1436 | Ga0495625_0022179 | |||
| 1437 | Ga0495625_0065254 | |||
| 1438 | Ga0495625_0087883 | |||
| 1439 | Ga0495625_0149084 | |||
| 1440 | Ga0495625_0186517 | |||
| 1441 | Ga0495625_0353390 | |||
| 1442 | Ga0495625_0403729 | |||
| 1443 | Ga0495625_0463312 | |||
| 1444 | Ga0495635_0001964 | |||
| 1445 | Ga0495659_0002967 | |||
| 1446 | Ga0495659_0037958 | |||
| 1447 | Ga0495661_0012263 | |||
| 1448 | Ga0495661_0012374 | |||
| 1449 | Ga0495661_0032622 | |||
| 1450 | Ga0495661_0037214 | |||
| 1451 | Ga0495661_0044067 | |||
| 1452 | Ga0495661_0071706 | |||
| 1453 | Ga0495661_0096991 | |||
| 1454 | Ga0495661_0120669 | |||
| 1455 | Ga0495661_0194571 | |||
| 1456 | Ga0495661_0210518 | |||
| 1457 | Ga0495661_0273676 | |||
| 1458 | Ga0495588_0000113 | |||
| 1459 | Ga0495588_0010764 | |||
| 1460 | Ga0495588_0297746 | |||
| 1461 | Ga0495588_0323176 | |||
| 1462 | Ga0495588_0471139 | |||
| 1463 | Ga0495657_0064926 | |||
| 1464 | Ga0495599_0027691 | |||
| 1465 | Ga0495623_0016264 | |||
| 1466 | Ga0495623_0170724 | |||
| 1467 | Ga0495623_0233308 | |||
| 1468 | Ga0495623_0273114 | |||
| 1469 | Ga0495646_0020393 | |||
| 1470 | Ga0495646_0041520 | |||
| 1471 | Ga0495646_0175128 | |||
| 1472 | Ga0495669_0000075 | |||
| 1473 | Ga0495669_0006448 | |||
| 1474 | Ga0495669_0258688 | |||
| 1475 | Ga0495613_0021937 | |||
| 1476 | Ga0495613_0147015 | |||
| 1477 | Ga0495613_0167143 | |||
| 1478 | Ga0495624_0177809 | |||
| 1479 | Ga0495670_0003298 | |||
| 1480 | Ga0495670_0022250 | |||
| 1481 | Ga0495670_0053351 | |||
| 1482 | Ga0495670_0056475 | |||
| 1483 | Ga0495670_0065209 | |||
| 1484 | Ga0495670_0087202 | |||
| 1485 | Ga0495670_0160614 | |||
| 1486 | Ga0495671_0007599 | |||
| 1487 | Ga0495671_0014178 | |||
| 1488 | Ga0495671_0048958 | |||
| 1489 | Ga0495671_0077195 | |||
| 1490 | Ga0495649_0007384 | |||
| 1491 | Ga0495649_0059791 | |||
| 1492 | Ga0495649_0073599 | |||
| 1493 | Ga0495649_0078012 | |||
| 1494 | Ga0495649_0090343 | |||
| 1495 | Ga0495649_0113557 | |||
| 1496 | Ga0495649_0378468 | |||
| 1497 | Ga0495589_0001253 | |||
| 1498 | Ga0495589_0027732 | |||
| 1499 | Ga0495589_0072985 | |||
| 1500 | Ga0495589_0080904 | |||
| 1501 | Ga0495600_0011825 | |||
| 1502 | Ga0495600_0070875 | |||
| 1503 | Ga0495600_0194477 | |||
| 1504 | Ga0495600_0199116 | |||
| 1505 | Ga0495600_0524328 | |||
| 1506 | Ga0495660_0003778 | |||
| 1507 | Ga0495660_0053711 | |||
| 1508 | Ga0495660_0065622 | |||
| 1509 | Ga0495660_0184307 | |||
| 1510 | Ga0495581_0007750 | |||
| 1511 | Ga0495581_0040566 | |||
| 1512 | Ga0495581_0065186 | |||
| 1513 | Ga0495581_0099725 | |||
| 1514 | Ga0495604_0008392 | |||
| 1515 | Ga0495604_0009665 | |||
| 1516 | Ga0495604_0025743 | |||
| 1517 | Ga0495604_0169591 | |||
| 1518 | Ga0495636_0004688 | |||
| 1519 | Ga0495636_0207537 | |||
| 1520 | Ga0495636_0295009 | |||
| 1521 | Ga0495674_0001330 | |||
| 1522 | Ga0495672_0000014 | |||
| 1523 | Ga0495672_0000285 | |||
| 1524 | Ga0495672_0025841 | |||
| 1525 | Ga0495672_0102790 | |||
| 1526 | Ga0495672_0131295 | |||
| 1527 | Ga0495676_0032442 | |||
| 1528 | Ga0495676_0433009 | |||
| 1529 | Ga0495680_0005963 | |||
| 1530 | Ga0495680_0090337 | |||
| 1531 | Ga0495683_0000112 | |||
| 1532 | Ga0495683_0038289 | |||
| 1533 | Ga0495683_0055612 | |||
| 1534 | Ga0495683_0182017 | |||
| 1535 | Ga0495683_0214538 | |||
| 1536 | Ga0495687_000060 | |||
| 1537 | Ga0495687_010203 | |||
| 1538 | Ga0495675_0000641 | |||
| 1539 | Ga0495675_0102882 | |||
| 1540 | Ga0495675_0114778 | |||
| 1541 | Ga0495677_0003569 | |||
| 1542 | Ga0495677_0004197 | |||
| 1543 | Ga0495677_0008437 | |||
| 1544 | Ga0495677_0013167 | |||
| 1545 | Ga0495677_0033535 | |||
| 1546 | Ga0495677_0036290 | |||
| 1547 | Ga0495677_0091042 | |||
| 1548 | Ga0495679_017776 | |||
| 1549 | Ga0495685_009277 | |||
| 1550 | Ga0495685_016278 | |||
| 1551 | Ga0495685_105721 | |||
| 1552 | Ga0495673_0000033 | |||
| 1553 | Ga0495673_0000034 | |||
| 1554 | Ga0495681_0005423 | |||
| 1555 | Ga0495681_0014139 | |||
| 1556 | Ga0495681_0016409 | |||
| 1557 | Ga0495681_0023598 | |||
| 1558 | Ga0495681_0030386 | |||
| 1559 | Ga0495681_0035504 | |||
| 1560 | Ga0495681_0037873 | |||
| 1561 | Ga0495681_0039116 | |||
| 1562 | Ga0495681_0093372 | |||
| 1563 | Ga0495681_0127366 | |||
| 1564 | Ga0495681_0302280 | |||
| 1565 | Ga0495686_0001306 | |||
| 1566 | Ga0495686_0001600 | |||
| 1567 | Ga0495686_0034550 | |||
| 1568 | Ga0495686_0040470 | |||
| 1569 | Ga0495686_0041735 | |||
| 1570 | Ga0495593_0007821 | |||
| 1571 | Ga0495593_0021382 | |||
| 1572 | Ga0495593_0060082 | |||
| 1573 | Ga0495593_0071856 | |||
| 1574 | Ga0495602_0002022 | |||
| 1575 | Ga0495602_0151365 | |||
| 1576 | Ga0495602_0166569 | |||
| 1577 | Ga0495602_0345020 | |||
| 1578 | Ga0495614_0006176 | |||
| 1579 | Ga0495614_0024164 | |||
| 1580 | Ga0495614_0099458 | |||
| 1581 | Ga0495614_0186182 | |||
| 1582 | Ga0495626_0000044 | |||
| 1583 | Ga0495626_0000974 | |||
| 1584 | Ga0495626_0001091 | |||
| 1585 | Ga0495626_0007753 | |||
| 1586 | Ga0495626_0010381 | |||
| 1587 | Ga0495626_0023256 | |||
| 1588 | Ga0495626_0028057 | |||
| 1589 | Ga0495626_0058687 | |||
| 1590 | Ga0495626_0090112 | |||
| 1591 | Ga0495626_0092477 | |||
| 1592 | Ga0496100_0014602 | |||
| 1593 | Ga0496100_0773637 | |||
| 1594 | Ga0496101_0133907 | |||
| 1595 | Ga0496102_0000279 | |||
| 1596 | Ga0496102_0000977 | |||
| 1597 | Ga0496102_0065912 | |||
| 1598 | Ga0496102_0599882 | |||
| 1599 | Ga0496102_0778555 | |||
| 1600 | Ga0496103_0001678 | |||
| 1601 | Ga0496103_0007002 | |||
| 1602 | Ga0496103_0174887 | |||
| 1603 | Ga0496107_0110383 | |||
| 1604 | Ga0496107_0163164 | |||
| 1605 | Ga0496107_0341651 | |||
| 1606 | Ga0496109_0136903 | |||
| 1607 | Ga0496110_0007252 | |||
| 1608 | Ga0496111_0249845 | |||
| 1609 | Ga0496111_0264928 | |||
| 1610 | Ga0496112_0625724 | |||
| 1611 | Ga0496113_0026839 | |||
| 1612 | Ga0496114_0137840 | |||
| 1613 | Ga0496114_0427586 | |||
| 1614 | Ga0496115_0268235 | |||
| 1615 | Ga0496116_0010763 | |||
| 1616 | Ga0496116_0016976 | |||
| 1617 | Ga0496116_0071545 | |||
| 1618 | Ga0496117_0000010 | |||
| 1619 | Ga0496118_0000009 | |||
| 1620 | Ga0496118_0089671 | |||
| 1621 | Ga0496121_0016466 | |||
| 1622 | Ga0496121_0018662 | |||
| 1623 | Ga0496121_0022185 | |||
| 1624 | Ga0496121_0118573 | |||
| 1625 | Ga0496121_0544422 | |||
| 1626 | Ga0496122_0000513 | |||
| 1627 | Ga0496122_0018308 | |||
| 1628 | Ga0496122_0025832 | |||
| 1629 | Ga0496123_0000145 | |||
| 1630 | Ga0496123_0004642 | |||
| 1631 | Ga0496123_0052096 | |||
| 1632 | Ga0496124_0118031 | |||
| 1633 | Ga0496124_0133675 | |||
| 1634 | Ga0496124_0148865 | |||
| 1635 | Ga0496124_0190102 | |||
| 1636 | Ga0496124_0261593 | |||
| 1637 | Ga0496125_0001481 | |||
| 1638 | Ga0496125_0032436 | |||
| 1639 | Ga0496125_0035873 | |||
| 1640 | Ga0496125_0167339 | |||
| 1641 | Ga0496125_0172039 | |||
| 1642 | Ga0496125_0274243 | |||
| 1643 | Ga0496126_0086756 | |||
| 1644 | Ga0496126_0277185 | |||
| 1645 | Ga0501309_002863 | |||
| 1646 | Ga0495678_000076 | |||
| 1647 | Ga0495678_000175 | |||
| 1648 | Ga0495678_000780 | |||
| 1649 | Ga0495682_0001244 | |||
| 1650 | Ga0495682_0011867 | |||
| 1651 | Ga0495682_0063027 | |||
| 1652 | Ga0501292_027335 | |||
| 1653 | Ga0501034_0144066 | |||
| 1654 | Ga0501210_017290 | |||
| 1655 | Ga0501229_048866 | |||
| 1656 | Ga0501269_000437 | |||
| 1657 | Ga0501035_0000816 | |||
| 1658 | Ga0495601_0006228 | |||
| 1659 | Ga0495601_0316794 | |||
| 1660 | Ga0500650_0000107 | |||
| 1661 | Ga0500594_0011747 | |||
| 1662 | Ga0500594_0048637 | |||
| 1663 | Ga0500595_001191 | |||
| 1664 | Ga0500618_000954 | |||
| 1665 | Ga0500618_001000 | |||
| 1666 | Ga0500574_001023 | |||
| 1667 | Ga0500634_0164240 | |||
| 1668 | Ga0587084_004887 | |||
| 1669 | Ga0587084_010006 | |||
| 1670 | Ga0587093_004214 | |||
| 1671 | Ga0587070_004835 | |||
| 1672 | Ga0587080_003903 | |||
| 1673 | Ga0587083_0001972 | |||
| 1674 | Ga0587088_001642 | |||
| 1675 | Ga0587089_007506 | |||
| 1676 | Ga0587090_031712 | |||
| 1677 | Ga0587094_004612 | |||
| 1678 | Ga0587106_007225 | |||
| 1679 | Ga0587106_009761 | |||
| 1680 | Ga0587062_031699 | |||
| 1681 | Ga0587069_003497 | |||
| 1682 | Ga0587069_007957 | |||
| 1683 | Ga0587069_014580 | |||
| 1684 | Ga0587075_002311 | |||
| 1685 | Ga0587075_042694 | |||
| 1686 | Ga0587076_007597 | |||
| 1687 | Ga0587078_008471 | |||
| 1688 | Ga0587079_015290 | |||
| 1689 | Ga0587079_016520 | |||
| 1690 | Ga0587079_023657 | |||
| 1691 | Ga0587102_001965 | |||
| 1692 | Ga0587096_00172 | |||
| 1693 | Ga0587071_009863 | |||
| 1694 | 2511249160 | |||
| 1695 | 2511387194 | |||
| 1696 | 2521556704 | |||
| 1697 | 2550692417 | |||
| 1698 | 2553006704 | |||
| 1699 | 2601666747 | |||
| 1700 | 2644027961 | |||
| 1701 | 2644249236 | |||
| 1702 | 2738740665 | |||
| 1703 | 2738825951 | |||
| 1704 | 2738844986 | |||
| 1705 | 2739149748 | |||
| 1706 | 2739191667 | |||
| 1707 | 2739277401 | |||
| 1708 | 2739318144 | |||
| 1709 | 2739336385 | |||
| 1710 | 2739346444 | |||
| 1711 | 2765567885 | |||
| 1712 | 2808982747 | |||
| 1713 | 2809130249 | |||
| 1714 | 2809150274 | |||
| 1715 | 2819543071 | |||
| 1716 | 2819592561 | |||
| 1717 | 2819618069 | |||
| 1718 | 2821135594 | |||
| 1719 | 2839097828 | |||
| 1720 | 2842714022 | |||
| 1721 | 2852621503 | |||
| 1722 | 2857548513 | |||
| 1723 | 2857562487 | |||
| 1724 | 2857566349 | |||
| 1725 | 2884812348 | |||
| 1726 | 2884838950 | |||
| 1727 | 2884855242 | |||
| 1728 | 2885083693 | |||
| 1729 | 2896156089 | |||
| 1730 | 2904430742 | |||
| 1731 | 2904441913 | |||
| 1732 | 2904533211 | |||
| 1733 | 2904586158 | |||
| 1734 | 2904592028 | |||
| 1735 | 2904601810 | |||
| 1736 | 2919049474 | |||
| 1737 | 2919083863 | |||
| 1738 | 2923515296 | |||
| 1739 | 2928132254 | |||
| 1740 | 2932413108 | |||
| 1741 | 2932420623 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ixh-assembly1.cif.gz_A | crystal structure of burkholderia cenocepacia bcna | 0.9606 | 32 | 194 |
| 5ixh-assembly1.cif.gz_A | crystal structure of burkholderia cenocepacia bcna | 0.9548 | 32 | 194 |
| 7bwl-assembly1.cif.gz_A | structure of antibiotic sequester from pseudomonas aerurinosa | 0.8755 | 29 | 193 |
| 1y0g-assembly2.cif.gz_D | crystal structure of the escherichia coli ycei protein, structural genomics | 0.8711 | 29 | 195 |
| 3hpe-assembly1.cif.gz_B | crystal structure of ycei (hp1286) from helicobacter pylori | 0.8566 | 30 | 193 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A8X2_23_191_2.40.128.110 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.8737 | 29 | 195 | 2.40.128.110 |
| af_Q2FUS9_3_167_2.40.128.110 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.8603 | 32 | 192 | 2.40.128.110 |
| af_P0A8X2_23_191_2.40.128.110 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.8591 | 29 | 195 | 2.40.128.110 |
| 3hpeB00 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.8566 | 30 | 193 | 2.40.128.110 |
| 5w2dA01 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.839 | 51 | 195 | 2.40.128.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4T0UWZ2-F1-model_v4 | YceI family protein | 0.936 | 49 | 195 |
|
| AF-A0A1M7K1K0-F1-model_v4 | Polyisoprenoid-binding protein YceI | 0.9359 | 30 | 194 |
|
| AF-A0A0H2M9W2-F1-model_v4 | Lipid/polyisoprenoid-binding YceI-like domain-containing protein | 0.9356 | 22 | 194 |
|
| AF-A0A7Y6YXP6-F1-model_v4 | YceI family protein | 0.9348 | 23 | 193 |
GO:0005886
GO:0009055 GO:0020037 GO:0022904 GO:0046872 |
| AF-A0A1E8FJS6-F1-model_v4 | Lipid/polyisoprenoid-binding YceI-like domain-containing protein | 0.9316 | 75 | 192 |
|