F484168
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 870 | 566 | 1740 | 473 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2958172287|2958173930 |
| Length | 415 |
| Sequence | IVHVIGGGLAGSEAAWQIAEAGVPVVLHEMRPVRGTDAHKTDGLAELVCSNSFRSDDAENNAVGLLHAEMRLAGSLIMSAGDANQVPAGGALAVDRDRFSDAVTAKIEAHPLITIQREEVPGLPPADWDQAIIATGPLTAPSLAQSIAEATGADALAFFDAIAPIVHFDTIDMNTAWFQSRYDKVGPGGTGKDYINCPMDKDQYFAFVQALLEGQKTEFKEWEGTPYFDGCLPIEVMAERGVETLRYGPMKPMGLTNAHNPSVKAYAVMQLRQDNALGTLYNMVGFQTKLKHAEQVRIFRTIPGLENAEFARLGGLHRNTYINSPTLLDPSLQLKSRPGLRFAGQITGCEGYVESAAIGLLAGRFAAASRLGHAPALPPATTAFGALLNHITGGHIVSDDEPGKRSFQPMNVNFG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 31 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 32 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 36 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 37 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 38 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 39 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 42 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 43 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 48 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 49 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 50 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 68 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 69 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 70 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 71 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 72 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 73 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 123 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 124 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 125 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 126 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 131 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 132 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 133 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 135 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 136 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 137 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 138 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 139 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 140 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 141 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 142 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 143 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 144 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 145 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 146 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 147 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 148 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 149 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 150 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 151 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 152 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 153 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 154 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 155 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 156 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 157 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 158 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 159 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 160 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 163 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 164 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 165 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 166 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 167 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 168 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 169 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 170 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 171 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 172 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 173 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 174 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 175 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 231 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 232 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 233 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 234 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 235 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 236 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 239 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 240 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 241 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 242 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 243 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 244 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 245 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 246 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 247 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 248 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 249 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 250 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 251 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 252 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 278 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 279 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 280 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 281 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 282 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 284 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 286 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 287 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 289 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 290 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 291 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 292 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 293 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 294 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 295 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 296 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 297 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 298 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 299 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 300 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 301 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 302 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 303 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 304 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 305 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 306 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 307 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 308 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 309 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 310 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 311 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 312 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 313 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 314 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 315 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 316 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 317 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 318 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 319 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 320 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 323 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 324 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 325 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 326 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 327 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 328 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 329 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 330 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 331 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 332 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 333 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 334 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 335 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 336 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 337 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 338 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 339 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 340 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 341 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 342 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 343 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 344 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 345 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 346 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 347 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 348 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 349 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 350 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 351 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 352 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 353 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 354 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 355 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 356 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 357 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 358 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 359 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 360 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 361 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 362 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 363 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 364 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 365 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 366 | 2791355199 | |||
| 367 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 368 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 369 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 370 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 371 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 372 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 373 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 374 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 375 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 376 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 377 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 378 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 379 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 380 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 381 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 382 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 383 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 384 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 385 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 386 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 387 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 388 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 389 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 390 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 391 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 392 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 393 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 394 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 395 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 396 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 397 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 398 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 399 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 400 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 401 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 402 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 403 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 404 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 405 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 406 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 407 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 408 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 409 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 410 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 411 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 412 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 413 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 414 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 415 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 416 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 417 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 418 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 419 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 420 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 421 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 422 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 423 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 424 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 425 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 426 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 427 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 428 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 429 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 430 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 431 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 432 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 433 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 434 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 435 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 436 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 437 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 438 | 2904699407 | |||
| 439 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 440 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 441 | 2906610324 | |||
| 442 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 443 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 444 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 445 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 446 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 447 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 448 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 449 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 450 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 451 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 452 | 2922368715 | |||
| 453 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 454 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 455 | 2922425934 | |||
| 456 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 457 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 458 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 459 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 460 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 461 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 462 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 463 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 464 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 465 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 466 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 467 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 468 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 469 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 470 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 471 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 472 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 473 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 474 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 475 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 476 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 477 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 478 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 479 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 480 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 481 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 482 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 483 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 484 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 485 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 486 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 487 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 488 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 489 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 490 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 491 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 492 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 493 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 494 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 495 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 496 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 497 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 498 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 499 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 500 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 501 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 502 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 503 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 504 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 505 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 506 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 507 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 508 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 509 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 510 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 511 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 512 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 513 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 514 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 515 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 516 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 517 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 518 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 519 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 520 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 521 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 522 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 523 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 524 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 525 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 526 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 527 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 528 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 529 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 530 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 531 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 532 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 533 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 534 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 535 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 536 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 537 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 538 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 539 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 540 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 541 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 542 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 543 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 544 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 545 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 546 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 547 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 548 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 549 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 550 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 551 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 552 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 553 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 554 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 555 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 556 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 557 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 558 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 559 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 560 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 561 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 562 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 563 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 564 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 565 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 566 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 72.25 |
| Metatranscriptomes | 0 |
| Isolates | 27.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.26 |
| Nodule | 21.61 |
| Rhizoplane | 4.71 |
| Rhizosphere | 47.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10001941 | 3300001990 | Bacteria | 7397 |
| 2 | JGI25406J46586_10000029 | 3300003203 | Bacteria | 70143 |
| 3 | JGI25406J46586_10002822 | 3300003203 | Bacteria | 8171 |
| 4 | JGI25153J46596_10017900 | 3300003215 | Bacteria | 2772 |
| 5 | JGI25153J46596_10024481 | 3300003215 | Bacteria | 2176 |
| 6 | JGI25160J50197_1001333 | 3300003354 | Bacteria | 12458 |
| 7 | Ga0055531_10012525 | 3300003794 | Bacteria | 3981 |
| 8 | Ga0065165_1001341 | 3300005262 | Bacteria | 27239 |
| 9 | Ga0065165_1002061 | 3300005262 | Bacteria | 18594 |
| 10 | Ga0070683_100004345 | 3300005329 | Bacteria | 11656 |
| 11 | Ga0070680_100006216 | 3300005336 | Bacteria | 9060 |
| 12 | Ga0070680_100100325 | 3300005336 | Bacteria | 2403 |
| 13 | Ga0070692_10075976 | 3300005345 | Bacteria | 1800 |
| 14 | Ga0070671_100156462 | 3300005355 | Bacteria | 1925 |
| 15 | Ga0070709_10001485 | 3300005434 | Bacteria | 12664 |
| 16 | Ga0070709_10011825 | 3300005434 | Bacteria | 4873 |
| 17 | Ga0070714_100002794 | 3300005435 | Bacteria | 12875 |
| 18 | Ga0070714_100012278 | 3300005435 | Bacteria | 6834 |
| 19 | Ga0070714_100020343 | 3300005435 | Bacteria | 5418 |
| 20 | Ga0070713_100003998 | 3300005436 | Bacteria | 9815 |
| 21 | Ga0070713_100048345 | 3300005436 | Bacteria | 3502 |
| 22 | Ga0070713_100078239 | 3300005436 | Bacteria | 2815 |
| 23 | Ga0070713_100108695 | 3300005436 | Bacteria | 2415 |
| 24 | Ga0070713_100210393 | 3300005436 | Bacteria | 1760 |
| 25 | Ga0070710_10000313 | 3300005437 | Bacteria | 23151 |
| 26 | Ga0070710_10000370 | 3300005437 | Bacteria | 21096 |
| 27 | Ga0070711_100007949 | 3300005439 | Bacteria | 6467 |
| 28 | Ga0070711_100034775 | 3300005439 | Bacteria | 3363 |
| 29 | Ga0070678_100066408 | 3300005456 | Bacteria | 2681 |
| 30 | Ga0070681_10003707 | 3300005458 | Bacteria | 14341 |
| 31 | Ga0070681_10040008 | 3300005458 | Bacteria | 4700 |
| 32 | Ga0070681_10078390 | 3300005458 | Bacteria | 3261 |
| 33 | Ga0070679_100037718 | 3300005530 | Bacteria | 4802 |
| 34 | Ga0070684_100014027 | 3300005535 | Bacteria | 6479 |
| 35 | Ga0070684_100079783 | 3300005535 | Bacteria | 2894 |
| 36 | Ga0070684_100088008 | 3300005535 | Bacteria | 2759 |
| 37 | Ga0068853_100010043 | 3300005539 | Bacteria | 7644 |
| 38 | Ga0068853_100019241 | 3300005539 | Bacteria | 5659 |
| 39 | Ga0068853_100034350 | 3300005539 | Bacteria | 4304 |
| 40 | Ga0068853_100148789 | 3300005539 | Bacteria | 2106 |
| 41 | Ga0070672_100024155 | 3300005543 | Bacteria | 4487 |
| 42 | Ga0070686_100032087 | 3300005544 | Bacteria | 3218 |
| 43 | Ga0070665_100055449 | 3300005548 | Bacteria | 3975 |
| 44 | Ga0070665_100100179 | 3300005548 | Bacteria | 2901 |
| 45 | Ga0070665_100183098 | 3300005548 | Bacteria | 2095 |
| 46 | Ga0070665_100250099 | 3300005548 | Bacteria | 1773 |
| 47 | Ga0068855_100010980 | 3300005563 | Bacteria | 10929 |
| 48 | Ga0068855_100011914 | 3300005563 | Bacteria | 10512 |
| 49 | Ga0068855_100051932 | 3300005563 | Bacteria | 4828 |
| 50 | Ga0068855_100120117 | 3300005563 | Bacteria | 3008 |
| 51 | Ga0068857_100002544 | 3300005577 | Bacteria | 14932 |
| 52 | Ga0068854_100000966 | 3300005578 | Bacteria | 17304 |
| 53 | Ga0068854_100006068 | 3300005578 | Bacteria | 7663 |
| 54 | Ga0068854_100061572 | 3300005578 | Bacteria | 2719 |
| 55 | Ga0068856_100000298 | 3300005614 | Bacteria | 54403 |
| 56 | Ga0068856_100003361 | 3300005614 | Bacteria | 16212 |
| 57 | Ga0070702_100097383 | 3300005615 | Bacteria | 1797 |
| 58 | Ga0068852_100000637 | 3300005616 | Bacteria | 22921 |
| 59 | Ga0068861_100074641 | 3300005719 | Bacteria | 2637 |
| 60 | Ga0068861_100092389 | 3300005719 | Bacteria | 2390 |
| 61 | Ga0068851_10001366 | 3300005834 | Bacteria | 10642 |
| 62 | Ga0068870_10025815 | 3300005840 | Bacteria | 2921 |
| 63 | Ga0068858_100141775 | 3300005842 | Bacteria | 2256 |
| 64 | Ga0068858_100253920 | 3300005842 | Bacteria | 1670 |
| 65 | Ga0068860_100000803 | 3300005843 | Bacteria | 35288 |
| 66 | Ga0068862_100156101 | 3300005844 | Bacteria | 2034 |
| 67 | Ga0081455_10030545 | 3300005937 | Bacteria | 4892 |
| 68 | Ga0081455_10033614 | 3300005937 | Bacteria | 4606 |
| 69 | Ga0081455_10045866 | 3300005937 | Bacteria | 3799 |
| 70 | Ga0081538_10022188 | 3300005981 | Bacteria | 4608 |
| 71 | Ga0081538_10023720 | 3300005981 | Bacteria | 4400 |
| 72 | Ga0081540_1001737 | 3300005983 | Bacteria | 18340 |
| 73 | Ga0081540_1002779 | 3300005983 | Bacteria | 14192 |
| 74 | Ga0081540_1003558 | 3300005983 | Bacteria | 12261 |
| 75 | Ga0081540_1004800 | 3300005983 | Bacteria | 10186 |
| 76 | Ga0081540_1009786 | 3300005983 | Bacteria | 6563 |
| 77 | Ga0081540_1051647 | 3300005983 | Bacteria | 2031 |
| 78 | Ga0081539_10000379 | 3300005985 | Bacteria | 97134 |
| 79 | Ga0081539_10000745 | 3300005985 | Bacteria | 64913 |
| 80 | Ga0070717_10003723 | 3300006028 | Bacteria | 10950 |
| 81 | Ga0070717_10007868 | 3300006028 | Bacteria | 7937 |
| 82 | Ga0070717_10035421 | 3300006028 | Bacteria | 4040 |
| 83 | Ga0070717_10087749 | 3300006028 | Bacteria | 2621 |
| 84 | Ga0075363_100002357 | 3300006048 | Bacteria | 7685 |
| 85 | Ga0075364_10048614 | 3300006051 | Bacteria | 2764 |
| 86 | Ga0070715_10000393 | 3300006163 | Bacteria | 11021 |
| 87 | Ga0070716_100001484 | 3300006173 | Bacteria | 10474 |
| 88 | Ga0070712_100045661 | 3300006175 | Bacteria | 3026 |
| 89 | Ga0070712_100130566 | 3300006175 | Bacteria | 1903 |
| 90 | Ga0068865_100116870 | 3300006881 | Bacteria | 1976 |
| 91 | Ga0099825_1024989 | 3300006941 | Bacteria | 3396 |
| 92 | Ga0099825_1030260 | 3300006941 | Bacteria | 2417 |
| 93 | Ga0099824_1010256 | 3300006942 | Bacteria | 11153 |
| 94 | Ga0099824_1010321 | 3300006942 | Bacteria | 11076 |
| 95 | Ga0099822_1001843 | 3300006943 | Bacteria | 25495 |
| 96 | Ga0099823_1047139 | 3300006944 | Bacteria | 2797 |
| 97 | Ga0105240_10004755 | 3300009093 | Bacteria | 20510 |
| 98 | Ga0105240_10007937 | 3300009093 | Bacteria | 15313 |
| 99 | Ga0105240_10141309 | 3300009093 | Bacteria | 2878 |
| 100 | Ga0105240_10160115 | 3300009093 | Bacteria | 2674 |
| 101 | Ga0105240_10184280 | 3300009093 | Bacteria | 2460 |
| 102 | Ga0111539_10031961 | 3300009094 | Bacteria | 6394 |
| 103 | Ga0105245_10014792 | 3300009098 | Bacteria | 6795 |
| 104 | Ga0105245_10198532 | 3300009098 | Bacteria | 1925 |
| 105 | Ga0105243_10206588 | 3300009148 | Bacteria | 1726 |
| 106 | Ga0105241_10001862 | 3300009174 | Bacteria | 16013 |
| 107 | Ga0105241_10022222 | 3300009174 | Bacteria | 4697 |
| 108 | Ga0105242_10057502 | 3300009176 | Bacteria | 3186 |
| 109 | Ga0105248_10037155 | 3300009177 | Bacteria | 5447 |
| 110 | Ga0105237_10078484 | 3300009545 | Bacteria | 3291 |
| 111 | Ga0105237_10149316 | 3300009545 | Bacteria | 2333 |
| 112 | Ga0105238_10002475 | 3300009551 | Bacteria | 18487 |
| 113 | Ga0105238_10043020 | 3300009551 | Bacteria | 4571 |
| 114 | Ga0105238_10079006 | 3300009551 | Bacteria | 3280 |
| 115 | Ga0105238_10083852 | 3300009551 | Bacteria | 3176 |
| 116 | Ga0105238_10102482 | 3300009551 | Bacteria | 2844 |
| 117 | Ga0105239_10083852 | 3300010375 | Bacteria | 3510 |
| 118 | Ga0105239_10136122 | 3300010375 | Bacteria | 2735 |
| 119 | Ga0105239_10332839 | 3300010375 | Bacteria | 1713 |
| 120 | Ga0105246_10217046 | 3300011119 | Bacteria | 1497 |
| 121 | Ga0157370_10082051 | 3300013104 | Bacteria | 3033 |
| 122 | Ga0157369_10022292 | 3300013105 | Bacteria | 7070 |
| 123 | Ga0157369_10023975 | 3300013105 | Bacteria | 6789 |
| 124 | Ga0157374_10055019 | 3300013296 | Bacteria | 3713 |
| 125 | Ga0163162_10035525 | 3300013306 | Bacteria | 4965 |
| 126 | Ga0157375_10114188 | 3300013308 | Bacteria | 2802 |
| 127 | Ga0182005_1009295 | 3300015265 | Bacteria | 2864 |
| 128 | Ga0214544_1000051 | 3300021320 | Bacteria | 134645 |
| 129 | Ga0214542_1000149 | 3300021321 | Bacteria | 102700 |
| 130 | Ga0214545_1000126 | 3300021324 | Bacteria | 91489 |
| 131 | Ga0214543_1000148 | 3300021327 | Bacteria | 98370 |
| 132 | Ga0213876_10028118 | 3300021384 | Bacteria | 2964 |
| 133 | Ga0209677_103427 | 3300025253 | Bacteria | 5166 |
| 134 | Ga0209677_106997 | 3300025253 | Bacteria | 2514 |
| 135 | Ga0209148_1000258 | 3300025254 | Bacteria | 83390 |
| 136 | Ga0209233_1001891 | 3300025261 | Bacteria | 8035 |
| 137 | Ga0209233_1002977 | 3300025261 | Bacteria | 6036 |
| 138 | Ga0209233_1006681 | 3300025261 | Bacteria | 3700 |
| 139 | Ga0209455_1002017 | 3300025272 | Bacteria | 8307 |
| 140 | Ga0209564_1001860 | 3300025295 | Bacteria | 19123 |
| 141 | Ga0209564_1002963 | 3300025295 | Bacteria | 12237 |
| 142 | Ga0209758_1000021 | 3300025297 | Bacteria | 697691 |
| 143 | Ga0209758_1000775 | 3300025297 | Bacteria | 45897 |
| 144 | Ga0209758_1001544 | 3300025297 | Bacteria | 26459 |
| 145 | Ga0209758_1002378 | 3300025297 | Bacteria | 19361 |
| 146 | Ga0209758_1003862 | 3300025297 | Bacteria | 13136 |
| 147 | Ga0209758_1005905 | 3300025297 | Bacteria | 9115 |
| 148 | Ga0209758_1016100 | 3300025297 | Bacteria | 3818 |
| 149 | Ga0209256_1004563 | 3300025299 | Bacteria | 8594 |
| 150 | Ga0207426_1000661 | 3300025302 | Bacteria | 42239 |
| 151 | Ga0207426_1001687 | 3300025302 | Bacteria | 17046 |
| 152 | Ga0209257_1002825 | 3300025304 | Bacteria | 16316 |
| 153 | Ga0207692_10002997 | 3300025898 | Bacteria | 6548 |
| 154 | Ga0207692_10004879 | 3300025898 | Bacteria | 5340 |
| 155 | Ga0207688_10046399 | 3300025901 | Bacteria | 2426 |
| 156 | Ga0207647_10001630 | 3300025904 | Bacteria | 17263 |
| 157 | Ga0207647_10003483 | 3300025904 | Bacteria | 11799 |
| 158 | Ga0207685_10006977 | 3300025905 | Bacteria | 3117 |
| 159 | Ga0207699_10002380 | 3300025906 | Bacteria | 8874 |
| 160 | Ga0207699_10021594 | 3300025906 | Bacteria | 3473 |
| 161 | Ga0207654_10000321 | 3300025911 | Bacteria | 28754 |
| 162 | Ga0207707_10000765 | 3300025912 | Bacteria | 31585 |
| 163 | Ga0207707_10002243 | 3300025912 | Bacteria | 17479 |
| 164 | Ga0207707_10087953 | 3300025912 | Bacteria | 2714 |
| 165 | Ga0207707_10138663 | 3300025912 | Bacteria | 2127 |
| 166 | Ga0207695_10000015 | 3300025913 | Bacteria | 803205 |
| 167 | Ga0207695_10000822 | 3300025913 | Bacteria | 57493 |
| 168 | Ga0207695_10002470 | 3300025913 | Bacteria | 27240 |
| 169 | Ga0207695_10104030 | 3300025913 | Bacteria | 2830 |
| 170 | Ga0207695_10122291 | 3300025913 | Bacteria | 2569 |
| 171 | Ga0207671_10008719 | 3300025914 | Bacteria | 8552 |
| 172 | Ga0207671_10082525 | 3300025914 | Bacteria | 2412 |
| 173 | Ga0207671_10109999 | 3300025914 | Bacteria | 2096 |
| 174 | Ga0207671_10159556 | 3300025914 | Bacteria | 1746 |
| 175 | Ga0207693_10001031 | 3300025915 | Bacteria | 24924 |
| 176 | Ga0207693_10033441 | 3300025915 | Bacteria | 4058 |
| 177 | Ga0207663_10000866 | 3300025916 | Bacteria | 13745 |
| 178 | Ga0207663_10017265 | 3300025916 | Bacteria | 4017 |
| 179 | Ga0207660_10074618 | 3300025917 | Bacteria | 2476 |
| 180 | Ga0207657_10012224 | 3300025919 | Bacteria | 8481 |
| 181 | Ga0207657_10013492 | 3300025919 | Bacteria | 8013 |
| 182 | Ga0207657_10079458 | 3300025919 | Bacteria | 2759 |
| 183 | Ga0207652_10006717 | 3300025921 | Bacteria | 9270 |
| 184 | Ga0207652_10019953 | 3300025921 | Bacteria | 5519 |
| 185 | Ga0207694_10000095 | 3300025924 | Bacteria | 99130 |
| 186 | Ga0207687_10014743 | 3300025927 | Bacteria | 5118 |
| 187 | Ga0207700_10005323 | 3300025928 | Bacteria | 7675 |
| 188 | Ga0207700_10036526 | 3300025928 | Bacteria | 3550 |
| 189 | Ga0207700_10050971 | 3300025928 | Bacteria | 3087 |
| 190 | Ga0207700_10060287 | 3300025928 | Bacteria | 2873 |
| 191 | Ga0207700_10129521 | 3300025928 | Bacteria | 2058 |
| 192 | Ga0207700_10142950 | 3300025928 | Bacteria | 1968 |
| 193 | Ga0207664_10010697 | 3300025929 | Bacteria | 6488 |
| 194 | Ga0207664_10010755 | 3300025929 | Bacteria | 6473 |
| 195 | Ga0207664_10011542 | 3300025929 | Bacteria | 6287 |
| 196 | Ga0207644_10116360 | 3300025931 | Bacteria | 2029 |
| 197 | Ga0207706_10094139 | 3300025933 | Bacteria | 2635 |
| 198 | Ga0207670_10035251 | 3300025936 | Bacteria | 3243 |
| 199 | Ga0207704_10035788 | 3300025938 | Bacteria | 2849 |
| 200 | Ga0207665_10000401 | 3300025939 | Bacteria | 29833 |
| 201 | Ga0207691_10020178 | 3300025940 | Bacteria | 6303 |
| 202 | Ga0207711_10067843 | 3300025941 | Bacteria | 3088 |
| 203 | Ga0207711_10080318 | 3300025941 | Bacteria | 2848 |
| 204 | Ga0207661_10005617 | 3300025944 | Bacteria | 8841 |
| 205 | Ga0207679_10034303 | 3300025945 | Bacteria | 3579 |
| 206 | Ga0207667_10017024 | 3300025949 | Bacteria | 8199 |
| 207 | Ga0207667_10314195 | 3300025949 | Bacteria | 1600 |
| 208 | Ga0207712_10068379 | 3300025961 | Bacteria | 2545 |
| 209 | Ga0207668_10033703 | 3300025972 | Bacteria | 3394 |
| 210 | Ga0207640_10090003 | 3300025981 | Bacteria | 2122 |
| 211 | Ga0207703_10014268 | 3300026035 | Bacteria | 6197 |
| 212 | Ga0207639_10040695 | 3300026041 | Bacteria | 3471 |
| 213 | Ga0207639_10069136 | 3300026041 | Bacteria | 2754 |
| 214 | Ga0207678_10026227 | 3300026067 | Bacteria | 5084 |
| 215 | Ga0207678_10082399 | 3300026067 | Bacteria | 2752 |
| 216 | Ga0207708_10012906 | 3300026075 | Bacteria | 6229 |
| 217 | Ga0207702_10000025 | 3300026078 | Bacteria | 186312 |
| 218 | Ga0207702_10000257 | 3300026078 | Bacteria | 61235 |
| 219 | Ga0207702_10117907 | 3300026078 | Bacteria | 2371 |
| 220 | Ga0207674_10003856 | 3300026116 | Bacteria | 18275 |
| 221 | Ga0207674_10031313 | 3300026116 | Bacteria | 5588 |
| 222 | Ga0207674_10088695 | 3300026116 | Bacteria | 3086 |
| 223 | Ga0207675_100137382 | 3300026118 | Bacteria | 2320 |
| 224 | Ga0207683_10166733 | 3300026121 | Bacteria | 1993 |
| 225 | Ga0207698_10004638 | 3300026142 | Bacteria | 8393 |
| 226 | Ga0209389_1000041 | 3300027296 | Bacteria | 123983 |
| 227 | Ga0209389_1000550 | 3300027296 | Bacteria | 22872 |
| 228 | Ga0209589_1000003 | 3300027357 | Bacteria | 629130 |
| 229 | Ga0209589_1000874 | 3300027357 | Bacteria | 45837 |
| 230 | Ga0209489_100003 | 3300027361 | Bacteria | 663105 |
| 231 | Ga0209489_100178 | 3300027361 | Bacteria | 99953 |
| 232 | Ga0209489_101570 | 3300027361 | Bacteria | 47095 |
| 233 | Ga0209700_100003 | 3300027363 | Bacteria | 663105 |
| 234 | Ga0209700_100010 | 3300027363 | Bacteria | 395269 |
| 235 | Ga0209588_1027745 | 3300027671 | Bacteria | 1802 |
| 236 | Ga0209813_10006602 | 3300027866 | Bacteria | 2871 |
| 237 | Ga0268266_10045903 | 3300028379 | Bacteria | 3739 |
| 238 | Ga0268266_10080405 | 3300028379 | Bacteria | 2840 |
| 239 | Ga0268264_10000022 | 3300028381 | Bacteria | 476624 |
| 240 | Ga0265323_10001986 | 3300028653 | Bacteria | 9653 |
| 241 | Ga0265336_10000896 | 3300028666 | Bacteria | 15205 |
| 242 | Ga0307517_10000139 | 3300028786 | Bacteria | 111985 |
| 243 | Ga0307517_10072343 | 3300028786 | Bacteria | 3075 |
| 244 | Ga0265338_10000146 | 3300028800 | Bacteria | 129397 |
| 245 | Ga0265330_10014896 | 3300031235 | Bacteria | 3602 |
| 246 | Ga0265330_10023017 | 3300031235 | Bacteria | 2831 |
| 247 | Ga0265332_10027906 | 3300031238 | Bacteria | 2472 |
| 248 | Ga0265339_10007663 | 3300031249 | Bacteria | 6951 |
| 249 | Ga0265339_10051673 | 3300031249 | Bacteria | 2242 |
| 250 | Ga0265316_10143122 | 3300031344 | Bacteria | 1795 |
| 251 | Ga0307408_100065243 | 3300031548 | Bacteria | 2670 |
| 252 | Ga0307508_10047903 | 3300031616 | Bacteria | 3809 |
| 253 | Ga0265342_10002873 | 3300031712 | Bacteria | 14519 |
| 254 | Ga0307516_10005838 | 3300031730 | Bacteria | 14584 |
| 255 | Ga0307516_10128749 | 3300031730 | Bacteria | 2313 |
| 256 | Ga0307409_100118715 | 3300031995 | Bacteria | 2234 |
| 257 | Ga0307507_10014169 | 3300033179 | Bacteria | 9544 |
| 258 | Ga0307510_10005273 | 3300033180 | Bacteria | 15373 |
| 259 | Ga0307510_10093177 | 3300033180 | Bacteria | 2845 |
| 260 | Ga0307510_10115987 | 3300033180 | Bacteria | 2401 |
| 261 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 262 | Ga0373934_0019513 | 3300035086 | Bacteria | 2603 |
| 263 | Ga0373923_0004793 | 3300035111 | Bacteria | 4526 |
| 264 | Ga0373923_0020440 | 3300035111 | Bacteria | 2572 |
| 265 | Ga0373945_0025227 | 3300035116 | Bacteria | 2064 |
| 266 | Ga0373953_0015747 | 3300035117 | Bacteria | 2747 |
| 267 | Ga0373954_0002068 | 3300035118 | Bacteria | 8332 |
| 268 | Ga0373956_0003593 | 3300035119 | Bacteria | 6257 |
| 269 | Ga0373957_0004004 | 3300035120 | Bacteria | 4433 |
| 270 | Ga0373943_0022161 | 3300035170 | Bacteria | 2940 |
| 271 | Ga0373955_0000352 | 3300035172 | Bacteria | 19413 |
| 272 | Ga0373924_0000523 | 3300035410 | Bacteria | 11791 |
| 273 | Ga0373924_0071787 | 3300035410 | Bacteria | 1461 |
| 274 | Ga0373935_0008955 | 3300035692 | Bacteria | 5992 |
| 275 | Ga0373935_0047362 | 3300035692 | Bacteria | 2718 |
| 276 | Ga0373935_0060470 | 3300035692 | Bacteria | 2423 |
| 277 | Ga0373927_0000432 | 3300035695 | Bacteria | 32114 |
| 278 | Ga0373927_0077064 | 3300035695 | Bacteria | 2159 |
| 279 | Ga0373927_0146905 | 3300035695 | Bacteria | 1544 |
| 280 | Ga0373933_0000144 | 3300035724 | Bacteria | 46119 |
| 281 | Ga0373933_0000739 | 3300035724 | Bacteria | 19946 |
| 282 | Ga0373933_0095696 | 3300035724 | Bacteria | 1837 |
| 283 | Ga0373947_0002975 | 3300035725 | Bacteria | 10105 |
| 284 | Ga0373947_0017680 | 3300035725 | Bacteria | 4103 |
| 285 | Ga0373937_0027373 | 3300036401 | Bacteria | 5155 |
| 286 | Ga0373937_0037852 | 3300036401 | Bacteria | 4396 |
| 287 | Ga0373937_0078931 | 3300036401 | Bacteria | 3042 |
| 288 | Ga0373925_0001942 | 3300037068 | Bacteria | 17104 |
| 289 | Ga0373925_0016085 | 3300037068 | Bacteria | 5418 |
| 290 | Ga0373925_0029626 | 3300037068 | Bacteria | 4016 |
| 291 | Ga0395900_0000591 | 3300037418 | Bacteria | 49743 |
| 292 | Ga0395900_0122949 | 3300037418 | Bacteria | 2662 |
| 293 | Ga0395900_0167218 | 3300037418 | Bacteria | 2241 |
| 294 | Ga0395900_0201690 | 3300037418 | Bacteria | 2012 |
| 295 | Ga0395905_0002994 | 3300037471 | Bacteria | 18330 |
| 296 | Ga0395905_0033841 | 3300037471 | Bacteria | 4800 |
| 297 | Ga0395905_0199407 | 3300037471 | Bacteria | 1876 |
| 298 | Ga0436364_1186536 | 3300037853 | Bacteria | 2345 |
| 299 | Ga0436365_1530339 | 3300039437 | Bacteria | 2597 |
| 300 | Ga0436365_1584135 | 3300039437 | Bacteria | 1972 |
| 301 | Ga0436363_0980009 | 3300039450 | Bacteria | 4033 |
| 302 | Ga0436362_1245968 | 3300039453 | Bacteria | 3904 |
| 303 | Ga0466972_0000727 | 3300044658 | Bacteria | 15748 |
| 304 | Ga0466972_0024728 | 3300044658 | Bacteria | 2980 |
| 305 | Ga0466972_0032559 | 3300044658 | Bacteria | 2559 |
| 306 | Ga0466965_0068150 | 3300044683 | Bacteria | 1786 |
| 307 | Ga0466966_0000600 | 3300044684 | Bacteria | 22805 |
| 308 | Ga0466961_0000162 | 3300044693 | Bacteria | 45301 |
| 309 | Ga0466960_0060323 | 3300044901 | Bacteria | 1859 |
| 310 | Ga0466959_0006053 | 3300045049 | Bacteria | 8349 |
| 311 | Ga0466967_0303805 | 3300045976 | Bacteria | 1536 |
| 312 | Ga0495592_0003507 | 3300046454 | Bacteria | 11254 |
| 313 | Ga0495603_0000067 | 3300046455 | Bacteria | 45466 |
| 314 | Ga0495603_0009052 | 3300046455 | Bacteria | 6021 |
| 315 | Ga0495603_0030497 | 3300046455 | Bacteria | 3247 |
| 316 | Ga0495603_0032368 | 3300046455 | Bacteria | 3146 |
| 317 | Ga0495603_0043571 | 3300046455 | Bacteria | 2679 |
| 318 | Ga0495629_0000627 | 3300046459 | Bacteria | 28700 |
| 319 | Ga0495629_0001123 | 3300046459 | Bacteria | 21217 |
| 320 | Ga0495629_0003475 | 3300046459 | Bacteria | 11910 |
| 321 | Ga0495629_0068534 | 3300046459 | Bacteria | 2476 |
| 322 | Ga0495638_0007579 | 3300046460 | Bacteria | 7765 |
| 323 | Ga0495638_0015570 | 3300046460 | Bacteria | 5107 |
| 324 | Ga0495641_0024871 | 3300046461 | Bacteria | 2947 |
| 325 | Ga0495651_0013494 | 3300046462 | Bacteria | 6319 |
| 326 | Ga0495651_0057469 | 3300046462 | Bacteria | 2986 |
| 327 | Ga0495653_0000212 | 3300046463 | Bacteria | 47187 |
| 328 | Ga0495580_0002382 | 3300046472 | Bacteria | 16421 |
| 329 | Ga0495580_0079029 | 3300046472 | Bacteria | 2294 |
| 330 | Ga0495582_0000049 | 3300046473 | Bacteria | 59194 |
| 331 | Ga0495582_0039041 | 3300046473 | Bacteria | 2614 |
| 332 | Ga0495639_0000106 | 3300046475 | Bacteria | 42031 |
| 333 | Ga0495662_0010243 | 3300046476 | Bacteria | 4594 |
| 334 | Ga0495664_0026418 | 3300046477 | Bacteria | 3381 |
| 335 | Ga0495664_0074036 | 3300046477 | Bacteria | 2037 |
| 336 | Ga0495585_0038381 | 3300046492 | Bacteria | 2696 |
| 337 | Ga0495594_0001628 | 3300046499 | Bacteria | 11686 |
| 338 | Ga0495606_0001093 | 3300046507 | Bacteria | 38858 |
| 339 | Ga0495608_0000742 | 3300046511 | Bacteria | 22774 |
| 340 | Ga0495628_0008083 | 3300046516 | Bacteria | 9048 |
| 341 | Ga0495628_0125495 | 3300046516 | Bacteria | 1967 |
| 342 | Ga0495630_0002734 | 3300046517 | Bacteria | 12237 |
| 343 | Ga0495630_0077792 | 3300046517 | Bacteria | 2501 |
| 344 | Ga0495632_0082287 | 3300046519 | Bacteria | 1534 |
| 345 | Ga0495648_0000704 | 3300046524 | Bacteria | 35656 |
| 346 | Ga0495648_0036436 | 3300046524 | Bacteria | 3174 |
| 347 | Ga0495652_0025258 | 3300046529 | Bacteria | 5257 |
| 348 | Ga0495652_0060615 | 3300046529 | Bacteria | 3197 |
| 349 | Ga0495652_0144145 | 3300046529 | Bacteria | 1870 |
| 350 | Ga0495665_0000101 | 3300046531 | Bacteria | 40147 |
| 351 | Ga0495640_0005046 | 3300046533 | Bacteria | 10482 |
| 352 | Ga0495640_0015250 | 3300046533 | Bacteria | 5786 |
| 353 | Ga0495587_0004455 | 3300046536 | Bacteria | 9224 |
| 354 | Ga0495621_0019959 | 3300046539 | Bacteria | 2194 |
| 355 | Ga0495645_0095430 | 3300046543 | Bacteria | 2120 |
| 356 | Ga0495622_0039981 | 3300046557 | Bacteria | 2183 |
| 357 | Ga0495667_0001112 | 3300046559 | Bacteria | 17494 |
| 358 | Ga0495667_0032807 | 3300046559 | Bacteria | 3477 |
| 359 | Ga0495667_0087585 | 3300046559 | Bacteria | 2019 |
| 360 | Ga0495668_0093235 | 3300046616 | Bacteria | 1649 |
| 361 | Ga0495634_0000267 | 3300046642 | Bacteria | 49323 |
| 362 | Ga0495634_0007967 | 3300046642 | Bacteria | 7901 |
| 363 | Ga0495634_0076238 | 3300046642 | Bacteria | 2201 |
| 364 | Ga0495635_0000230 | 3300046663 | Bacteria | 35642 |
| 365 | Ga0495635_0003015 | 3300046663 | Bacteria | 11568 |
| 366 | Ga0495661_0057867 | 3300046665 | Bacteria | 2312 |
| 367 | Ga0495588_0007534 | 3300046674 | Bacteria | 4957 |
| 368 | Ga0495588_0032271 | 3300046674 | Bacteria | 2639 |
| 369 | Ga0495657_0040465 | 3300046675 | Bacteria | 3196 |
| 370 | Ga0495599_0035578 | 3300046678 | Bacteria | 3126 |
| 371 | Ga0495623_0013532 | 3300046679 | Bacteria | 5289 |
| 372 | Ga0495646_0011570 | 3300046680 | Bacteria | 5603 |
| 373 | Ga0495646_0028609 | 3300046680 | Bacteria | 3488 |
| 374 | Ga0495646_0049237 | 3300046680 | Bacteria | 2558 |
| 375 | Ga0495658_0001665 | 3300046683 | Bacteria | 11558 |
| 376 | Ga0495669_0003220 | 3300046684 | Bacteria | 6721 |
| 377 | Ga0495669_0019491 | 3300046684 | Bacteria | 2928 |
| 378 | Ga0495613_0018046 | 3300046689 | Bacteria | 5258 |
| 379 | Ga0495613_0024471 | 3300046689 | Bacteria | 4499 |
| 380 | Ga0495613_0056031 | 3300046689 | Bacteria | 2895 |
| 381 | Ga0495624_0001957 | 3300046690 | Bacteria | 15673 |
| 382 | Ga0495624_0063891 | 3300046690 | Bacteria | 2301 |
| 383 | Ga0495624_0094670 | 3300046690 | Bacteria | 1841 |
| 384 | Ga0495624_0117225 | 3300046690 | Bacteria | 1636 |
| 385 | Ga0495600_0000274 | 3300046809 | Bacteria | 28010 |
| 386 | Ga0495600_0014489 | 3300046809 | Bacteria | 4968 |
| 387 | Ga0495581_0000022 | 3300047315 | Bacteria | 56149 |
| 388 | Ga0495581_0089349 | 3300047315 | Bacteria | 1787 |
| 389 | Ga0495604_0016181 | 3300047317 | Bacteria | 5959 |
| 390 | Ga0495604_0020884 | 3300047317 | Bacteria | 5228 |
| 391 | Ga0495674_0000629 | 3300047319 | Bacteria | 33021 |
| 392 | Ga0495674_0038113 | 3300047319 | Bacteria | 4316 |
| 393 | Ga0495680_0001284 | 3300047322 | Bacteria | 27396 |
| 394 | Ga0495680_0005881 | 3300047322 | Bacteria | 11477 |
| 395 | Ga0495687_009884 | 3300047443 | Bacteria | 5285 |
| 396 | Ga0495675_0002816 | 3300047444 | Bacteria | 10418 |
| 397 | Ga0495684_0000780 | 3300047471 | Bacteria | 25813 |
| 398 | Ga0495686_0005612 | 3300047472 | Bacteria | 9851 |
| 399 | Ga0495686_0049286 | 3300047472 | Bacteria | 2651 |
| 400 | Ga0495593_0000016 | 3300047673 | Bacteria | 80178 |
| 401 | Ga0495593_0006860 | 3300047673 | Bacteria | 6668 |
| 402 | Ga0495593_0051235 | 3300047673 | Bacteria | 2185 |
| 403 | Ga0495602_0022689 | 3300048088 | Bacteria | 6138 |
| 404 | Ga0495626_0033629 | 3300048091 | Bacteria | 2456 |
| 405 | Ga0496100_0108889 | 3300048903 | Bacteria | 1922 |
| 406 | Ga0496101_0043457 | 3300048904 | Bacteria | 3212 |
| 407 | Ga0496101_0051577 | 3300048904 | Bacteria | 2964 |
| 408 | Ga0496102_0009980 | 3300048905 | Bacteria | 8163 |
| 409 | Ga0496102_0082887 | 3300048905 | Bacteria | 2958 |
| 410 | Ga0496102_0197831 | 3300048905 | Bacteria | 1894 |
| 411 | Ga0496103_0053615 | 3300048906 | Bacteria | 2499 |
| 412 | Ga0496104_0000730 | 3300048907 | Bacteria | 28293 |
| 413 | Ga0496104_0007674 | 3300048907 | Bacteria | 9550 |
| 414 | Ga0496104_0051887 | 3300048907 | Bacteria | 3872 |
| 415 | Ga0496105_0003882 | 3300048908 | Bacteria | 11174 |
| 416 | Ga0496105_0005096 | 3300048908 | Bacteria | 9959 |
| 417 | Ga0496105_0009214 | 3300048908 | Bacteria | 7709 |
| 418 | Ga0496106_0000808 | 3300048909 | Bacteria | 22657 |
| 419 | Ga0496106_0013691 | 3300048909 | Bacteria | 5990 |
| 420 | Ga0496106_0057182 | 3300048909 | Bacteria | 2949 |
| 421 | Ga0496106_0116748 | 3300048909 | Bacteria | 2082 |
| 422 | Ga0496106_0163675 | 3300048909 | Bacteria | 1760 |
| 423 | Ga0496107_0031422 | 3300048910 | Bacteria | 3789 |
| 424 | Ga0496107_0038026 | 3300048910 | Bacteria | 3455 |
| 425 | Ga0496108_0000361 | 3300048911 | Bacteria | 38318 |
| 426 | Ga0496108_0032007 | 3300048911 | Bacteria | 4365 |
| 427 | Ga0496108_0145883 | 3300048911 | Bacteria | 2040 |
| 428 | Ga0496109_0041739 | 3300048912 | Bacteria | 4155 |
| 429 | Ga0496109_0061312 | 3300048912 | Bacteria | 3438 |
| 430 | Ga0496109_0063016 | 3300048912 | Bacteria | 3391 |
| 431 | Ga0496110_0002958 | 3300048913 | Bacteria | 12884 |
| 432 | Ga0496110_0005088 | 3300048913 | Bacteria | 10269 |
| 433 | Ga0496110_0050175 | 3300048913 | Bacteria | 3663 |
| 434 | Ga0496110_0123568 | 3300048913 | Bacteria | 2334 |
| 435 | Ga0496112_0000009 | 3300048915 | Bacteria | 299708 |
| 436 | Ga0496112_0042602 | 3300048915 | Bacteria | 4442 |
| 437 | Ga0496112_0062334 | 3300048915 | Bacteria | 3678 |
| 438 | Ga0496112_0072041 | 3300048915 | Bacteria | 3415 |
| 439 | Ga0496112_0093906 | 3300048915 | Bacteria | 2970 |
| 440 | Ga0496112_0104388 | 3300048915 | Bacteria | 2804 |
| 441 | Ga0496112_0198898 | 3300048915 | Bacteria | 1964 |
| 442 | Ga0496113_0027620 | 3300048916 | Bacteria | 4071 |
| 443 | Ga0496113_0032264 | 3300048916 | Bacteria | 3806 |
| 444 | Ga0496116_0044677 | 3300048919 | Bacteria | 3007 |
| 445 | Ga0496117_0047347 | 3300048920 | Bacteria | 3084 |
| 446 | Ga0496118_0011636 | 3300048921 | Bacteria | 8558 |
| 447 | Ga0496118_0028409 | 3300048921 | Bacteria | 4710 |
| 448 | Ga0496118_0043760 | 3300048921 | Bacteria | 3515 |
| 449 | Ga0496118_0044131 | 3300048921 | Bacteria | 3494 |
| 450 | Ga0496118_0079601 | 3300048921 | Bacteria | 2311 |
| 451 | Ga0496119_0007812 | 3300048922 | Bacteria | 9538 |
| 452 | Ga0496119_0043985 | 3300048922 | Bacteria | 2817 |
| 453 | Ga0496119_0117270 | 3300048922 | Bacteria | 1468 |
| 454 | Ga0496120_0007941 | 3300048923 | Bacteria | 7812 |
| 455 | Ga0496120_0017727 | 3300048923 | Bacteria | 4605 |
| 456 | Ga0496121_0000612 | 3300048924 | Bacteria | 66397 |
| 457 | Ga0496121_0000864 | 3300048924 | Bacteria | 54785 |
| 458 | Ga0496121_0007142 | 3300048924 | Bacteria | 13550 |
| 459 | Ga0496121_0009665 | 3300048924 | Bacteria | 11046 |
| 460 | Ga0496121_0020700 | 3300048924 | Bacteria | 6490 |
| 461 | Ga0496121_0034901 | 3300048924 | Bacteria | 4516 |
| 462 | Ga0496121_0087854 | 3300048924 | Bacteria | 2439 |
| 463 | Ga0496121_0124431 | 3300048924 | Bacteria | 1941 |
| 464 | Ga0496122_0001692 | 3300048925 | Bacteria | 34210 |
| 465 | Ga0496122_0023079 | 3300048925 | Bacteria | 5502 |
| 466 | Ga0496122_0025277 | 3300048925 | Bacteria | 5162 |
| 467 | Ga0496123_0001285 | 3300048926 | Bacteria | 35815 |
| 468 | Ga0496124_0001167 | 3300048927 | Bacteria | 41138 |
| 469 | Ga0496124_0151869 | 3300048927 | Bacteria | 1816 |
| 470 | Ga0496125_0008020 | 3300048928 | Bacteria | 11149 |
| 471 | Ga0496125_0011650 | 3300048928 | Bacteria | 8779 |
| 472 | Ga0496125_0011849 | 3300048928 | Bacteria | 8687 |
| 473 | Ga0496125_0017900 | 3300048928 | Bacteria | 6738 |
| 474 | Ga0496125_0030700 | 3300048928 | Bacteria | 4802 |
| 475 | Ga0496125_0119493 | 3300048928 | Bacteria | 1884 |
| 476 | Ga0496126_0011484 | 3300048929 | Bacteria | 9163 |
| 477 | Ga0496126_0018851 | 3300048929 | Bacteria | 6820 |
| 478 | Ga0496126_0019064 | 3300048929 | Bacteria | 6770 |
| 479 | Ga0496126_0020616 | 3300048929 | Bacteria | 6457 |
| 480 | Ga0496126_0021225 | 3300048929 | Bacteria | 6350 |
| 481 | Ga0496126_0023224 | 3300048929 | Bacteria | 6010 |
| 482 | Ga0496126_0034598 | 3300048929 | Bacteria | 4744 |
| 483 | Ga0496126_0106762 | 3300048929 | Bacteria | 2443 |
| 484 | Ga0496126_0124915 | 3300048929 | Bacteria | 2228 |
| 485 | Ga0501031_0000186 | 3300049568 | Bacteria | 34900 |
| 486 | Ga0501031_0013473 | 3300049568 | Bacteria | 5330 |
| 487 | Ga0501031_0040268 | 3300049568 | Bacteria | 3051 |
| 488 | Ga0501032_0022660 | 3300049569 | Bacteria | 4351 |
| 489 | Ga0501032_0065117 | 3300049569 | Bacteria | 2438 |
| 490 | Ga0501033_0000098 | 3300049570 | Bacteria | 82803 |
| 491 | Ga0501033_0000558 | 3300049570 | Bacteria | 34644 |
| 492 | Ga0501033_0099891 | 3300049570 | Bacteria | 2118 |
| 493 | Ga0501033_0151914 | 3300049570 | Bacteria | 1670 |
| 494 | Ga0501034_0001197 | 3300049571 | Bacteria | 35694 |
| 495 | Ga0501034_0010992 | 3300049571 | Bacteria | 9397 |
| 496 | Ga0501034_0102539 | 3300049571 | Bacteria | 2855 |
| 497 | Ga0501034_0194594 | 3300049571 | Bacteria | 1988 |
| 498 | Ga0501036_0000049 | 3300049572 | Bacteria | 75400 |
| 499 | Ga0501036_0145793 | 3300049572 | Bacteria | 1997 |
| 500 | Ga0501037_0000069 | 3300049573 | Bacteria | 95277 |
| 501 | Ga0501038_0000034 | 3300049574 | Bacteria | 128854 |
| 502 | Ga0501038_0001638 | 3300049574 | Bacteria | 20830 |
| 503 | Ga0501038_0016494 | 3300049574 | Bacteria | 6694 |
| 504 | Ga0501038_0045359 | 3300049574 | Bacteria | 3816 |
| 505 | Ga0501038_0073585 | 3300049574 | Bacteria | 2893 |
| 506 | Ga0501039_0000090 | 3300049575 | Bacteria | 63919 |
| 507 | Ga0501039_0098178 | 3300049575 | Bacteria | 2285 |
| 508 | Ga0501042_0007184 | 3300049578 | Bacteria | 7288 |
| 509 | Ga0501042_0065952 | 3300049578 | Bacteria | 2587 |
| 510 | Ga0501043_0000130 | 3300049579 | Bacteria | 69795 |
| 511 | Ga0501043_0001743 | 3300049579 | Bacteria | 18758 |
| 512 | Ga0501043_0002558 | 3300049579 | Bacteria | 15367 |
| 513 | Ga0501043_0013106 | 3300049579 | Bacteria | 6480 |
| 514 | Ga0501043_0023178 | 3300049579 | Bacteria | 4869 |
| 515 | Ga0501046_0000213 | 3300049580 | Bacteria | 60602 |
| 516 | Ga0501046_0007264 | 3300049580 | Bacteria | 9742 |
| 517 | Ga0501046_0073453 | 3300049580 | Bacteria | 2654 |
| 518 | Ga0501047_0000758 | 3300049581 | Bacteria | 33713 |
| 519 | Ga0501047_0013725 | 3300049581 | Bacteria | 7691 |
| 520 | Ga0501047_0035213 | 3300049581 | Bacteria | 4836 |
| 521 | Ga0501047_0226877 | 3300049581 | Bacteria | 1722 |
| 522 | Ga0501048_0025757 | 3300049582 | Bacteria | 4284 |
| 523 | Ga0501067_0000264 | 3300049583 | Bacteria | 28689 |
| 524 | Ga0501067_0094969 | 3300049583 | Bacteria | 1655 |
| 525 | Ga0501068_0000866 | 3300049584 | Bacteria | 15752 |
| 526 | Ga0501068_0011901 | 3300049584 | Bacteria | 4919 |
| 527 | Ga0501068_0066845 | 3300049584 | Bacteria | 2190 |
| 528 | Ga0501070_0029403 | 3300049586 | Bacteria | 4607 |
| 529 | Ga0501070_0121539 | 3300049586 | Bacteria | 2158 |
| 530 | Ga0501070_0124452 | 3300049586 | Bacteria | 2131 |
| 531 | Ga0501071_0056861 | 3300049587 | Bacteria | 2826 |
| 532 | Ga0501074_0007521 | 3300049590 | Bacteria | 7882 |
| 533 | Ga0501074_0052476 | 3300049590 | Bacteria | 2943 |
| 534 | Ga0501077_0100775 | 3300049593 | Bacteria | 1830 |
| 535 | Ga0501079_0008177 | 3300049741 | Bacteria | 7929 |
| 536 | Ga0501080_0003533 | 3300049742 | Bacteria | 13775 |
| 537 | Ga0501080_0044499 | 3300049742 | Bacteria | 4133 |
| 538 | Ga0501083_0000590 | 3300049744 | Bacteria | 23293 |
| 539 | Ga0501035_0000970 | 3300049822 | Bacteria | 30303 |
| 540 | Ga0501035_0002915 | 3300049822 | Bacteria | 16469 |
| 541 | Ga0501035_0093991 | 3300049822 | Bacteria | 2637 |
| 542 | Ga0501035_0103279 | 3300049822 | Bacteria | 2500 |
| 543 | Ga0501044_0000725 | 3300049823 | Bacteria | 39776 |
| 544 | Ga0501044_0007020 | 3300049823 | Bacteria | 12398 |
| 545 | Ga0501044_0009168 | 3300049823 | Bacteria | 10809 |
| 546 | Ga0501044_0032620 | 3300049823 | Bacteria | 5474 |
| 547 | Ga0501044_0062421 | 3300049823 | Bacteria | 3808 |
| 548 | Ga0501044_0063757 | 3300049823 | Bacteria | 3763 |
| 549 | Ga0501045_0011129 | 3300049824 | Bacteria | 6304 |
| 550 | Ga0501045_0197360 | 3300049824 | Bacteria | 1499 |
| 551 | nmdc:mga00v17_22110_c1 | 3300050491 | Bacteria | 3665 |
| 552 | nmdc:mga00v17_38144_c1 | 3300050491 | Bacteria | 2872 |
| 553 | nmdc:mga0yw44_113562_c1 | 3300050492 | Bacteria | 1738 |
| 554 | nmdc:mga0yw44_121296_c1 | 3300050492 | Bacteria | 1684 |
| 555 | nmdc:mga0yw44_33002_c1 | 3300050492 | Bacteria | 3021 |
| 556 | nmdc:mga0yw44_92155_c1 | 3300050492 | Bacteria | 1917 |
| 557 | nmdc:mga0k408_53325_c1 | 3300050493 | Bacteria | 2344 |
| 558 | nmdc:mga0k408_8390_c1 | 3300050493 | Bacteria | 5542 |
| 559 | nmdc:mga06z11_4321_c1 | 3300050494 | Bacteria | 5584 |
| 560 | nmdc:mga06z11_68646_c1 | 3300050494 | Bacteria | 1869 |
| 561 | nmdc:mga06z11_7121_c1 | 3300050494 | Bacteria | 4590 |
| 562 | nmdc:mga07m45_24777_c1 | 3300050496 | Bacteria | 3289 |
| 563 | nmdc:mga07m45_52766_c1 | 3300050496 | Bacteria | 2296 |
| 564 | nmdc:mga0n895_68838_c1 | 3300050512 | Bacteria | 3506 |
| 565 | nmdc:mga0sz30_3089_c1 | 3300050516 | Bacteria | 5965 |
| 566 | Ga0495601_0038708 | 3300053077 | Bacteria | 2982 |
| 567 | Ga0495601_0040145 | 3300053077 | Bacteria | 2931 |
| 568 | Ga0500610_0016658 | 3300053079 | Bacteria | 3511 |
| 569 | Ga0500635_0019104 | 3300053080 | Bacteria | 2079 |
| 570 | Ga0495619_0001297 | 3300053085 | Bacteria | 16439 |
| 571 | Ga0500643_000116 | 3300053087 | Bacteria | 83687 |
| 572 | Ga0500643_019292 | 3300053087 | Bacteria | 2247 |
| 573 | Ga0500646_0002421 | 3300053090 | Bacteria | 4848 |
| 574 | Ga0500646_0022973 | 3300053090 | Bacteria | 1671 |
| 575 | Ga0500651_0000593 | 3300053093 | Bacteria | 18176 |
| 576 | Ga0500566_0000050 | 3300053094 | Bacteria | 57809 |
| 577 | Ga0500566_0005487 | 3300053094 | Bacteria | 7546 |
| 578 | Ga0500566_0006937 | 3300053094 | Bacteria | 6708 |
| 579 | Ga0500640_000161 | 3300053095 | Bacteria | 13514 |
| 580 | Ga0500641_0007162 | 3300053096 | Bacteria | 3973 |
| 581 | Ga0500641_0020783 | 3300053096 | Bacteria | 2494 |
| 582 | Ga0500650_0002300 | 3300053098 | Bacteria | 6234 |
| 583 | Ga0500555_011496 | 3300053103 | Bacteria | 2543 |
| 584 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 585 | Ga0500556_0002345 | 3300053104 | Bacteria | 6165 |
| 586 | Ga0500557_000061 | 3300053105 | Bacteria | 44319 |
| 587 | Ga0500572_000033 | 3300053111 | Bacteria | 43170 |
| 588 | Ga0500572_000911 | 3300053111 | Bacteria | 9140 |
| 589 | Ga0500592_000872 | 3300053116 | Bacteria | 4909 |
| 590 | Ga0500595_003716 | 3300053119 | Bacteria | 7040 |
| 591 | Ga0500595_007498 | 3300053119 | Bacteria | 4526 |
| 592 | Ga0500608_003093 | 3300053122 | Bacteria | 6170 |
| 593 | Ga0500608_003250 | 3300053122 | Bacteria | 6055 |
| 594 | Ga0500642_0000010 | 3300053130 | Bacteria | 272552 |
| 595 | Ga0500642_0000098 | 3300053130 | Bacteria | 42383 |
| 596 | Ga0500652_001701 | 3300053131 | Bacteria | 6674 |
| 597 | Ga0500559_0000142 | 3300053136 | Bacteria | 55814 |
| 598 | Ga0500559_0001019 | 3300053136 | Bacteria | 17196 |
| 599 | Ga0500559_0001739 | 3300053136 | Bacteria | 11945 |
| 600 | Ga0500559_0016065 | 3300053136 | Bacteria | 3161 |
| 601 | Ga0500559_0044898 | 3300053136 | Bacteria | 1933 |
| 602 | Ga0500568_0000427 | 3300053139 | Bacteria | 31670 |
| 603 | Ga0500577_0000133 | 3300053142 | Bacteria | 17945 |
| 604 | Ga0500586_000857 | 3300053145 | Bacteria | 6292 |
| 605 | Ga0500604_0003801 | 3300053151 | Bacteria | 4037 |
| 606 | Ga0500616_0000045 | 3300053153 | Bacteria | 339292 |
| 607 | Ga0500616_0000069 | 3300053153 | Bacteria | 234334 |
| 608 | Ga0500616_0047891 | 3300053153 | Bacteria | 2268 |
| 609 | Ga0500619_006351 | 3300053154 | Bacteria | 2718 |
| 610 | Ga0500622_0014034 | 3300053156 | Bacteria | 4307 |
| 611 | Ga0500634_0024264 | 3300053161 | Bacteria | 3299 |
| 612 | Ga0500639_000032 | 3300053163 | Bacteria | 69113 |
| 613 | Ga0500636_0000207 | 3300053177 | Bacteria | 31845 |
| 614 | Ga0500636_0009427 | 3300053177 | Bacteria | 5672 |
| 615 | Ga0500636_0059387 | 3300053177 | Bacteria | 2234 |
| 616 | Ga0500637_0000077 | 3300053178 | Bacteria | 35359 |
| 617 | Ga0500637_0020072 | 3300053178 | Bacteria | 3613 |
| 618 | Ga0500625_003482 | 3300053729 | Bacteria | 6231 |
| 619 | Ga0500596_000116 | 3300053735 | Bacteria | 11271 |
| 620 | Ga0500596_000445 | 3300053735 | Bacteria | 7674 |
| 621 | Ga0500596_000541 | 3300053735 | Bacteria | 7170 |
| 622 | Ga0500599_000820 | 3300053736 | Bacteria | 3430 |
| 623 | Ga0500601_000135 | 3300053737 | Bacteria | 14999 |
| 624 | Ga0501084_0007469 | 3300054114 | Bacteria | 9011 |
| 625 | Ga0501082_0011999 | 3300060353 | Bacteria | 7451 |
| 626 | 2958173930 | 2958172287 | Bacteria | 6716688 |
| 627 | 2507509175 | 2507262055 | Bacteria | 8048963 |
| 628 | 2508543239 | 2508501009 | Bacteria | 7784016 |
| 629 | 2508691016 | 2508501042 | Bacteria | 8719808 |
| 630 | 2508728397 | 2508501050 | Bacteria | 9633614 |
| 631 | 2509078461 | 2508501114 | Bacteria | 7082538 |
| 632 | 2509147465 | 2508501128 | Bacteria | 8613869 |
| 633 | 2511395228 | 2511231028 | Bacteria | 8046582 |
| 634 | 2513591787 | 2513237087 | Bacteria | 5817514 |
| 635 | 2513627908 | 2513237092 | Bacteria | 8341956 |
| 636 | 2513637729 | 2513237094 | Bacteria | 8789602 |
| 637 | 2513646854 | 2513237095 | Bacteria | 8976980 |
| 638 | 2513654520 | 2513237096 | Bacteria | 8722461 |
| 639 | 2513675511 | 2513237098 | Bacteria | 9902361 |
| 640 | 2513692001 | 2513237101 | Bacteria | 7952346 |
| 641 | 2513704520 | 2513237102 | Bacteria | 7703324 |
| 642 | 2513723109 | 2513237104 | Bacteria | 10034502 |
| 643 | 2513859321 | 2513237137 | Bacteria | 9558895 |
| 644 | 2513872267 | 2513237139 | Bacteria | 8737671 |
| 645 | 2513892860 | 2513237141 | Bacteria | 8496279 |
| 646 | 2513915301 | 2513237145 | Bacteria | 8979722 |
| 647 | 2514013995 | 2513237161 | Bacteria | 8871253 |
| 648 | 2515626584 | 2515154112 | Bacteria | 8294334 |
| 649 | 2517101809 | 2517093001 | Bacteria | 9002274 |
| 650 | 2517892600 | 2517572143 | Bacteria | 9484767 |
| 651 | 2524436771 | 2524023205 | Bacteria | 8918781 |
| 652 | 2524465120 | 2524023210 | Bacteria | 9029266 |
| 653 | 2524539055 | 2524023228 | Bacteria | 10118060 |
| 654 | 2528855590 | 2528768022 | Bacteria | 10457665 |
| 655 | 2603858997 | 2602042107 | Bacteria | 6226103 |
| 656 | 2617351306 | 2617270735 | Bacteria | 9163226 |
| 657 | 2617376281 | 2617270741 | Bacteria | 8201522 |
| 658 | 2644288456 | 2643221651 | Bacteria | 4798932 |
| 659 | 2671122299 | 2667528175 | Bacteria | 7532676 |
| 660 | 2671692681 | 2671180139 | Bacteria | 4196045 |
| 661 | 2723845606 | 2721755755 | Bacteria | 8322773 |
| 662 | 2728750510 | 2728368998 | Bacteria | 8720350 |
| 663 | 2738745086 | 2738541281 | Bacteria | 5112672 |
| 664 | 2739354316 | 2738543032 | Bacteria | 5115625 |
| 665 | 2745080292 | 2744054633 | Bacteria | 8678936 |
| 666 | 2774873392 | 2773857925 | Bacteria | 6472445 |
| 667 | 2776259676 | 2775506901 | Bacteria | 9631051 |
| 668 | 2793063870 | 2791355196 | Bacteria | 7323613 |
| 669 | 2793068573 | 2791355197 | Bacteria | 8420563 |
| 670 | 2793083758 | |||
| 671 | 2805918129 | 2802429603 | Bacteria | 8777136 |
| 672 | 2818242694 | 2816332527 | Bacteria | 8933356 |
| 673 | 2824605012 | 2824600985 | Bacteria | 8488197 |
| 674 | 2824613888 | 2824609381 | Bacteria | 8672835 |
| 675 | 2824625887 | 2824617872 | Bacteria | 8814715 |
| 676 | 2824634649 | 2824626560 | Bacteria | 8813858 |
| 677 | 2824642388 | 2824635225 | Bacteria | 8785348 |
| 678 | 2824649919 | 2824644064 | Bacteria | 8743947 |
| 679 | 2824657042 | 2824653114 | Bacteria | 8493680 |
| 680 | 2824665124 | 2824661429 | Bacteria | 9877870 |
| 681 | 2824677955 | 2824671348 | Bacteria | 8369588 |
| 682 | 2824681296 | 2824679649 | Bacteria | 8248951 |
| 683 | 2824694380 | 2824687955 | Bacteria | 8360029 |
| 684 | 2824702699 | 2824696289 | Bacteria | 8335049 |
| 685 | 2824709254 | 2824704595 | Bacteria | 9667483 |
| 686 | 2824722792 | 2824714736 | Bacteria | 8717648 |
| 687 | 2824730164 | 2824723954 | Bacteria | 8758240 |
| 688 | 2824737464 | 2824732956 | Bacteria | 7810675 |
| 689 | 2824753143 | 2824746037 | Bacteria | 7911610 |
| 690 | 2824761978 | 2824753945 | Bacteria | 9787441 |
| 691 | 2824772438 | 2824763712 | Bacteria | 9792355 |
| 692 | 2824779200 | 2824773399 | Bacteria | 8360218 |
| 693 | 2835317874 | 2835312727 | Bacteria | 7413381 |
| 694 | 2838126333 | 2838122688 | Bacteria | 8803140 |
| 695 | 2841943589 | 2841941048 | Bacteria | 8688029 |
| 696 | 2841950461 | 2841949485 | Bacteria | 8680857 |
| 697 | 2841958176 | 2841957949 | Bacteria | 8652217 |
| 698 | 2841966775 | 2841966195 | Bacteria | 8673214 |
| 699 | 2841975530 | 2841974524 | Bacteria | 8931498 |
| 700 | 2841988330 | 2841983080 | Bacteria | 8395090 |
| 701 | 2842039580 | 2842038055 | Bacteria | 8002051 |
| 702 | 2842047474 | 2842045827 | Bacteria | 8006841 |
| 703 | 2842700267 | 2842698319 | Bacteria | 5190321 |
| 704 | 2844318554 | 2844315083 | Bacteria | 8138177 |
| 705 | 2847935490 | 2847930680 | Bacteria | 9342022 |
| 706 | 2847946050 | 2847939898 | Bacteria | 8606328 |
| 707 | 2849079834 | 2849076700 | Bacteria | 7039503 |
| 708 | 2857513769 | 2857509624 | Bacteria | 7472071 |
| 709 | 2857527898 | 2857524615 | Bacteria | 6615449 |
| 710 | 2874597290 | 2874590934 | Bacteria | 8299676 |
| 711 | 2874609782 | 2874604998 | Bacteria | 7834745 |
| 712 | 2874616327 | 2874612657 | Bacteria | 8252029 |
| 713 | 2874626815 | 2874620515 | Bacteria | 8290088 |
| 714 | 2874631225 | 2874628541 | Bacteria | 8630250 |
| 715 | 2874649377 | 2874645413 | Bacteria | 8214782 |
| 716 | 2876770443 | 2876761206 | Bacteria | 10111113 |
| 717 | 2876777913 | 2876771140 | Bacteria | 8287509 |
| 718 | 2876823066 | 2876818435 | Bacteria | 8274608 |
| 719 | 2879078670 | 2879074833 | Bacteria | 8279565 |
| 720 | 2879088483 | 2879083081 | Bacteria | 8587928 |
| 721 | 2879108169 | 2879099564 | Bacteria | 10442239 |
| 722 | 2879118350 | 2879110137 | Bacteria | 8907982 |
| 723 | 2879148652 | 2879142872 | Bacteria | 8267021 |
| 724 | 2881366862 | 2881364244 | Bacteria | 7710352 |
| 725 | 2881672176 | 2881665667 | Bacteria | 8175609 |
| 726 | 2882458246 | 2882456835 | Bacteria | 6863978 |
| 727 | 2885371981 | 2885366525 | Bacteria | 8326213 |
| 728 | 2885379324 | 2885374607 | Bacteria | 8927485 |
| 729 | 2885388647 | 2885383462 | Bacteria | 9473874 |
| 730 | 2885411007 | 2885409591 | Bacteria | 9235467 |
| 731 | 2888383523 | 2888378607 | Bacteria | 9652610 |
| 732 | 2888394431 | 2888388044 | Bacteria | 7304136 |
| 733 | 2888423951 | 2888419890 | Bacteria | 7857137 |
| 734 | 2889040412 | 2889033259 | Bacteria | 9099371 |
| 735 | 2893068316 | 2893066018 | Bacteria | 6158120 |
| 736 | 2894239715 | 2894232714 | Bacteria | 8834183 |
| 737 | 2903730080 | 2903727486 | Bacteria | 8281579 |
| 738 | 2903749892 | 2903748898 | Bacteria | 9972761 |
| 739 | 2903771915 | 2903768456 | Bacteria | 9749579 |
| 740 | 2904668393 | 2904666416 | Bacteria | 8226587 |
| 741 | 2904695954 | 2904690495 | Bacteria | 9412302 |
| 742 | 2904702708 | |||
| 743 | 2904717359 | 2904711408 | Bacteria | 9771557 |
| 744 | 2906603465 | 2906602504 | Bacteria | 8295279 |
| 745 | 2906618404 | |||
| 746 | 2906632215 | 2906626472 | Bacteria | 8826946 |
| 747 | 2906638704 | 2906635258 | Bacteria | 8601019 |
| 748 | 2906644718 | 2906643746 | Bacteria | 8722424 |
| 749 | 2906664106 | 2906660503 | Bacteria | 8595048 |
| 750 | 2908742925 | 2908739725 | Bacteria | 8628932 |
| 751 | 2908760583 | 2908756301 | Bacteria | 8864324 |
| 752 | 2908779597 | 2908775508 | Bacteria | 8092255 |
| 753 | 2919075298 | 2919073203 | Bacteria | 6531949 |
| 754 | 2919454640 | 2919450847 | Bacteria | 5631160 |
| 755 | 2922368282 | 2922361189 | Bacteria | 7436256 |
| 756 | 2922373736 | |||
| 757 | 2922388254 | 2922386360 | Bacteria | 7017218 |
| 758 | 2922395823 | 2922393267 | Bacteria | 8285685 |
| 759 | 2922429697 | |||
| 760 | 2929617451 | 2929615660 | Bacteria | 9193770 |
| 761 | 2929627156 | 2929624759 | Bacteria | 9339455 |
| 762 | 2932787509 | 2932784394 | Bacteria | 9704911 |
| 763 | 2932798374 | 2932794094 | Bacteria | 7915132 |
| 764 | 2932803323 | 2932801729 | Bacteria | 7987968 |
| 765 | 2932815034 | 2932809354 | Bacteria | 9135765 |
| 766 | 2932820768 | 2932818245 | Bacteria | 9955613 |
| 767 | 2932831816 | 2932828146 | Bacteria | 9745859 |
| 768 | 2933579407 | 2933577622 | Bacteria | 9116884 |
| 769 | 2935611941 | 2935608549 | Bacteria | 8203142 |
| 770 | 2935621822 | 2935616580 | Bacteria | 9032984 |
| 771 | 2935631866 | 2935630451 | Bacteria | 8169952 |
| 772 | 2935642767 | 2935638405 | Bacteria | 10015038 |
| 773 | 2935649567 | 2935648319 | Bacteria | 8801166 |
| 774 | 2935658918 | 2935656913 | Bacteria | 8965014 |
| 775 | 2935667869 | 2935665750 | Bacteria | 9571747 |
| 776 | 2935682361 | 2935675223 | Bacteria | 9928132 |
| 777 | 2935688620 | 2935684952 | Bacteria | 9590419 |
| 778 | 2935695971 | 2935694250 | Bacteria | 9291695 |
| 779 | 2935706710 | 2935703347 | Bacteria | 10242284 |
| 780 | 2935715639 | 2935713505 | Bacteria | 9608509 |
| 781 | 2935725797 | 2935722832 | Bacteria | 9608746 |
| 782 | 2935734458 | 2935732158 | Bacteria | 9706831 |
| 783 | 2935743837 | 2935741537 | Bacteria | 9707219 |
| 784 | 2935754126 | 2935750917 | Bacteria | 9590372 |
| 785 | 2935763164 | 2935760218 | Bacteria | 9817913 |
| 786 | 2935772584 | 2935769743 | Bacteria | 7878163 |
| 787 | 2935783136 | 2935777560 | Bacteria | 8077691 |
| 788 | 2935790877 | 2935785616 | Bacteria | 7962367 |
| 789 | 2935799422 | 2935793552 | Bacteria | 8012592 |
| 790 | 2935808389 | 2935801545 | Bacteria | 9301974 |
| 791 | 2935812916 | 2935810662 | Bacteria | 9401221 |
| 792 | 2935821421 | 2935819856 | Bacteria | 8261050 |
| 793 | 2935830568 | 2935827899 | Bacteria | 10038562 |
| 794 | 2935840598 | 2935837841 | Bacteria | 9454360 |
| 795 | 2935850320 | 2935847175 | Bacteria | 8228321 |
| 796 | 2935860069 | 2935855204 | Bacteria | 9035059 |
| 797 | 2935869296 | 2935864058 | Bacteria | 9784707 |
| 798 | 2935880543 | 2935873716 | Bacteria | 9632195 |
| 799 | 2935888103 | 2935883170 | Bacteria | 7964738 |
| 800 | 2935914365 | 2935908558 | Bacteria | 8568796 |
| 801 | 2935921079 | 2935916978 | Bacteria | 9113783 |
| 802 | 2935932021 | 2935926038 | Bacteria | 8601059 |
| 803 | 2935940618 | 2935934488 | Bacteria | 8602579 |
| 804 | 2935948561 | 2935942939 | Bacteria | 8599779 |
| 805 | 2935956968 | 2935951376 | Bacteria | 8602333 |
| 806 | 2935960258 | 2935959822 | Bacteria | 7869783 |
| 807 | 2935973566 | 2935967501 | Bacteria | 8603075 |
| 808 | 2935977513 | 2935975950 | Bacteria | 8347125 |
| 809 | 2935989980 | 2935984226 | Bacteria | 8302647 |
| 810 | 2935996289 | 2935992306 | Bacteria | 9802711 |
| 811 | 2936006423 | 2936002035 | Bacteria | 9362176 |
| 812 | 2936012951 | 2936011229 | Bacteria | 8801034 |
| 813 | 2936021515 | 2936019824 | Bacteria | 8804134 |
| 814 | 2936030244 | 2936028420 | Bacteria | 8965941 |
| 815 | 2936041504 | 2936037263 | Bacteria | 9446081 |
| 816 | 2936047709 | 2936046547 | Bacteria | 8903709 |
| 817 | 2936057133 | 2936055302 | Bacteria | 8785755 |
| 818 | 2939670932 | 2939669807 | Bacteria | 5028511 |
| 819 | 2940560498 | 2940556831 | Bacteria | 9590747 |
| 820 | 2941513019 | 2941507105 | Bacteria | 8166816 |
| 821 | 2941521077 | 2941515067 | Bacteria | 8166720 |
| 822 | 2941526059 | 2941523033 | Bacteria | 8169134 |
| 823 | 2941534304 | 2941531003 | Bacteria | 7653939 |
| 824 | 2941541272 | 2941538514 | Bacteria | 9402094 |
| 825 | 3005479999 | 3005474847 | Bacteria | 9259049 |
| 826 | 3005489634 | 3005483717 | Bacteria | 7877331 |
| 827 | 3005509848 | 3005506211 | Bacteria | 6943378 |
| 828 | 3005590040 | 3005587118 | Bacteria | 7794411 |
| 829 | 3005598669 | 3005594810 | Bacteria | 8716512 |
| 830 | 3005714323 | 3005710791 | Bacteria | 7622528 |
| 831 | 3005721831 | 3005718088 | Bacteria | 8283608 |
| 832 | 8001849664 | 8001845381 | Bacteria | 5804942 |
| 833 | 8006927172 | 8006926726 | Bacteria | 6749210 |
| 834 | 8006941197 | 8006933436 | Bacteria | 10410654 |
| 835 | 8006967234 | 8006964411 | Bacteria | 8966052 |
| 836 | 8006980597 | 8006973647 | Bacteria | 10679141 |
| 837 | 8006992081 | 8006984368 | Bacteria | 9651211 |
| 838 | 8006997470 | 8006994254 | Bacteria | 8309700 |
| 839 | 8016513952 | 8016511872 | Bacteria | 9921665 |
| 840 | 8016530182 | 8016522445 | Bacteria | 8156687 |
| 841 | 8016535433 | 8016530956 | Bacteria | 8155261 |
| 842 | 8016553496 | 8016548790 | Bacteria | 8155074 |
| 843 | 8016573767 | 8016566248 | Bacteria | 8158151 |
| 844 | 8016577891 | 8016575299 | Bacteria | 8154085 |
| 845 | 8016592540 | 8016583857 | Bacteria | 10421953 |
| 846 | 8016599706 | 8016595262 | Bacteria | 8149947 |
| 847 | 8016622494 | 8016613128 | Bacteria | 8794220 |
| 848 | 8016627290 | 8016622563 | Bacteria | 7999408 |
| 849 | 8016631577 | 8016630954 | Bacteria | 9217207 |
| 850 | 8017062525 | 8017057580 | Bacteria | 10023680 |
| 851 | 8019535174 | 8019530166 | Bacteria | 8155624 |
| 852 | 8019544310 | 8019538911 | Bacteria | 7872763 |
| 853 | 8019557009 | 8019555841 | Bacteria | 9642137 |
| 854 | 8019568292 | 8019565922 | Bacteria | 9639779 |
| 855 | 8019581919 | 8019576017 | Bacteria | 10049540 |
| 856 | 8019589599 | 8019586578 | Bacteria | 10212056 |
| 857 | 8019601669 | 8019597564 | Bacteria | 10041141 |
| 858 | 8019616880 | 8019608314 | Bacteria | 10042931 |
| 859 | 8019627531 | 8019619141 | Bacteria | 9218857 |
| 860 | 8019635041 | 8019629233 | Bacteria | 8687553 |
| 861 | 8019644687 | 8019638758 | Bacteria | 9062356 |
| 862 | 8019662883 | 8019659431 | Bacteria | 8577854 |
| 863 | 8019672484 | 8019668869 | Bacteria | 8791617 |
| 864 | 8019683674 | 8019678201 | Bacteria | 8863603 |
| 865 | 8019689427 | 8019687851 | Bacteria | 8712826 |
| 866 | 8055746934 | 8055742211 | Bacteria | 9226248 |
| 867 | 8056674348 | 8056673599 | Bacteria | 7871253 |
| 868 | 8056683260 | 8056681323 | Bacteria | 8472857 |
| 869 | 8056690025 | 8056689827 | Bacteria | 6712655 |
| 870 | 8056972916 | 8056967851 | Bacteria | 9038162 |
| 871 | JGI24737J22298_10001941 | |||
| 872 | JGI25406J46586_10000029 | |||
| 873 | JGI25406J46586_10002822 | |||
| 874 | JGI25153J46596_10017900 | |||
| 875 | JGI25153J46596_10024481 | |||
| 876 | JGI25160J50197_1001333 | |||
| 877 | Ga0055531_10012525 | |||
| 878 | Ga0065165_1001341 | |||
| 879 | Ga0065165_1002061 | |||
| 880 | Ga0070683_100004345 | |||
| 881 | Ga0070680_100006216 | |||
| 882 | Ga0070680_100100325 | |||
| 883 | Ga0070692_10075976 | |||
| 884 | Ga0070671_100156462 | |||
| 885 | Ga0070709_10001485 | |||
| 886 | Ga0070709_10011825 | |||
| 887 | Ga0070714_100002794 | |||
| 888 | Ga0070714_100012278 | |||
| 889 | Ga0070714_100020343 | |||
| 890 | Ga0070713_100003998 | |||
| 891 | Ga0070713_100048345 | |||
| 892 | Ga0070713_100078239 | |||
| 893 | Ga0070713_100108695 | |||
| 894 | Ga0070713_100210393 | |||
| 895 | Ga0070710_10000313 | |||
| 896 | Ga0070710_10000370 | |||
| 897 | Ga0070711_100007949 | |||
| 898 | Ga0070711_100034775 | |||
| 899 | Ga0070678_100066408 | |||
| 900 | Ga0070681_10003707 | |||
| 901 | Ga0070681_10040008 | |||
| 902 | Ga0070681_10078390 | |||
| 903 | Ga0070679_100037718 | |||
| 904 | Ga0070684_100014027 | |||
| 905 | Ga0070684_100079783 | |||
| 906 | Ga0070684_100088008 | |||
| 907 | Ga0068853_100010043 | |||
| 908 | Ga0068853_100019241 | |||
| 909 | Ga0068853_100034350 | |||
| 910 | Ga0068853_100148789 | |||
| 911 | Ga0070672_100024155 | |||
| 912 | Ga0070686_100032087 | |||
| 913 | Ga0070665_100055449 | |||
| 914 | Ga0070665_100100179 | |||
| 915 | Ga0070665_100183098 | |||
| 916 | Ga0070665_100250099 | |||
| 917 | Ga0068855_100010980 | |||
| 918 | Ga0068855_100011914 | |||
| 919 | Ga0068855_100051932 | |||
| 920 | Ga0068855_100120117 | |||
| 921 | Ga0068857_100002544 | |||
| 922 | Ga0068854_100000966 | |||
| 923 | Ga0068854_100006068 | |||
| 924 | Ga0068854_100061572 | |||
| 925 | Ga0068856_100000298 | |||
| 926 | Ga0068856_100003361 | |||
| 927 | Ga0070702_100097383 | |||
| 928 | Ga0068852_100000637 | |||
| 929 | Ga0068861_100074641 | |||
| 930 | Ga0068861_100092389 | |||
| 931 | Ga0068851_10001366 | |||
| 932 | Ga0068870_10025815 | |||
| 933 | Ga0068858_100141775 | |||
| 934 | Ga0068858_100253920 | |||
| 935 | Ga0068860_100000803 | |||
| 936 | Ga0068862_100156101 | |||
| 937 | Ga0081455_10030545 | |||
| 938 | Ga0081455_10033614 | |||
| 939 | Ga0081455_10045866 | |||
| 940 | Ga0081538_10022188 | |||
| 941 | Ga0081538_10023720 | |||
| 942 | Ga0081540_1001737 | |||
| 943 | Ga0081540_1002779 | |||
| 944 | Ga0081540_1003558 | |||
| 945 | Ga0081540_1004800 | |||
| 946 | Ga0081540_1009786 | |||
| 947 | Ga0081540_1051647 | |||
| 948 | Ga0081539_10000379 | |||
| 949 | Ga0081539_10000745 | |||
| 950 | Ga0070717_10003723 | |||
| 951 | Ga0070717_10007868 | |||
| 952 | Ga0070717_10035421 | |||
| 953 | Ga0070717_10087749 | |||
| 954 | Ga0075363_100002357 | |||
| 955 | Ga0075364_10048614 | |||
| 956 | Ga0070715_10000393 | |||
| 957 | Ga0070716_100001484 | |||
| 958 | Ga0070712_100045661 | |||
| 959 | Ga0070712_100130566 | |||
| 960 | Ga0068865_100116870 | |||
| 961 | Ga0099825_1024989 | |||
| 962 | Ga0099825_1030260 | |||
| 963 | Ga0099824_1010256 | |||
| 964 | Ga0099824_1010321 | |||
| 965 | Ga0099822_1001843 | |||
| 966 | Ga0099823_1047139 | |||
| 967 | Ga0105240_10004755 | |||
| 968 | Ga0105240_10007937 | |||
| 969 | Ga0105240_10141309 | |||
| 970 | Ga0105240_10160115 | |||
| 971 | Ga0105240_10184280 | |||
| 972 | Ga0111539_10031961 | |||
| 973 | Ga0105245_10014792 | |||
| 974 | Ga0105245_10198532 | |||
| 975 | Ga0105243_10206588 | |||
| 976 | Ga0105241_10001862 | |||
| 977 | Ga0105241_10022222 | |||
| 978 | Ga0105242_10057502 | |||
| 979 | Ga0105248_10037155 | |||
| 980 | Ga0105237_10078484 | |||
| 981 | Ga0105237_10149316 | |||
| 982 | Ga0105238_10002475 | |||
| 983 | Ga0105238_10043020 | |||
| 984 | Ga0105238_10079006 | |||
| 985 | Ga0105238_10083852 | |||
| 986 | Ga0105238_10102482 | |||
| 987 | Ga0105239_10083852 | |||
| 988 | Ga0105239_10136122 | |||
| 989 | Ga0105239_10332839 | |||
| 990 | Ga0105246_10217046 | |||
| 991 | Ga0157370_10082051 | |||
| 992 | Ga0157369_10022292 | |||
| 993 | Ga0157369_10023975 | |||
| 994 | Ga0157374_10055019 | |||
| 995 | Ga0163162_10035525 | |||
| 996 | Ga0157375_10114188 | |||
| 997 | Ga0182005_1009295 | |||
| 998 | Ga0214544_1000051 | |||
| 999 | Ga0214542_1000149 | |||
| 1000 | Ga0214545_1000126 | |||
| 1001 | Ga0214543_1000148 | |||
| 1002 | Ga0213876_10028118 | |||
| 1003 | Ga0209677_103427 | |||
| 1004 | Ga0209677_106997 | |||
| 1005 | Ga0209148_1000258 | |||
| 1006 | Ga0209233_1001891 | |||
| 1007 | Ga0209233_1002977 | |||
| 1008 | Ga0209233_1006681 | |||
| 1009 | Ga0209455_1002017 | |||
| 1010 | Ga0209564_1001860 | |||
| 1011 | Ga0209564_1002963 | |||
| 1012 | Ga0209758_1000021 | |||
| 1013 | Ga0209758_1000775 | |||
| 1014 | Ga0209758_1001544 | |||
| 1015 | Ga0209758_1002378 | |||
| 1016 | Ga0209758_1003862 | |||
| 1017 | Ga0209758_1005905 | |||
| 1018 | Ga0209758_1016100 | |||
| 1019 | Ga0209256_1004563 | |||
| 1020 | Ga0207426_1000661 | |||
| 1021 | Ga0207426_1001687 | |||
| 1022 | Ga0209257_1002825 | |||
| 1023 | Ga0207692_10002997 | |||
| 1024 | Ga0207692_10004879 | |||
| 1025 | Ga0207688_10046399 | |||
| 1026 | Ga0207647_10001630 | |||
| 1027 | Ga0207647_10003483 | |||
| 1028 | Ga0207685_10006977 | |||
| 1029 | Ga0207699_10002380 | |||
| 1030 | Ga0207699_10021594 | |||
| 1031 | Ga0207654_10000321 | |||
| 1032 | Ga0207707_10000765 | |||
| 1033 | Ga0207707_10002243 | |||
| 1034 | Ga0207707_10087953 | |||
| 1035 | Ga0207707_10138663 | |||
| 1036 | Ga0207695_10000015 | |||
| 1037 | Ga0207695_10000822 | |||
| 1038 | Ga0207695_10002470 | |||
| 1039 | Ga0207695_10104030 | |||
| 1040 | Ga0207695_10122291 | |||
| 1041 | Ga0207671_10008719 | |||
| 1042 | Ga0207671_10082525 | |||
| 1043 | Ga0207671_10109999 | |||
| 1044 | Ga0207671_10159556 | |||
| 1045 | Ga0207693_10001031 | |||
| 1046 | Ga0207693_10033441 | |||
| 1047 | Ga0207663_10000866 | |||
| 1048 | Ga0207663_10017265 | |||
| 1049 | Ga0207660_10074618 | |||
| 1050 | Ga0207657_10012224 | |||
| 1051 | Ga0207657_10013492 | |||
| 1052 | Ga0207657_10079458 | |||
| 1053 | Ga0207652_10006717 | |||
| 1054 | Ga0207652_10019953 | |||
| 1055 | Ga0207694_10000095 | |||
| 1056 | Ga0207687_10014743 | |||
| 1057 | Ga0207700_10005323 | |||
| 1058 | Ga0207700_10036526 | |||
| 1059 | Ga0207700_10050971 | |||
| 1060 | Ga0207700_10060287 | |||
| 1061 | Ga0207700_10129521 | |||
| 1062 | Ga0207700_10142950 | |||
| 1063 | Ga0207664_10010697 | |||
| 1064 | Ga0207664_10010755 | |||
| 1065 | Ga0207664_10011542 | |||
| 1066 | Ga0207644_10116360 | |||
| 1067 | Ga0207706_10094139 | |||
| 1068 | Ga0207670_10035251 | |||
| 1069 | Ga0207704_10035788 | |||
| 1070 | Ga0207665_10000401 | |||
| 1071 | Ga0207691_10020178 | |||
| 1072 | Ga0207711_10067843 | |||
| 1073 | Ga0207711_10080318 | |||
| 1074 | Ga0207661_10005617 | |||
| 1075 | Ga0207679_10034303 | |||
| 1076 | Ga0207667_10017024 | |||
| 1077 | Ga0207667_10314195 | |||
| 1078 | Ga0207712_10068379 | |||
| 1079 | Ga0207668_10033703 | |||
| 1080 | Ga0207640_10090003 | |||
| 1081 | Ga0207703_10014268 | |||
| 1082 | Ga0207639_10040695 | |||
| 1083 | Ga0207639_10069136 | |||
| 1084 | Ga0207678_10026227 | |||
| 1085 | Ga0207678_10082399 | |||
| 1086 | Ga0207708_10012906 | |||
| 1087 | Ga0207702_10000025 | |||
| 1088 | Ga0207702_10000257 | |||
| 1089 | Ga0207702_10117907 | |||
| 1090 | Ga0207674_10003856 | |||
| 1091 | Ga0207674_10031313 | |||
| 1092 | Ga0207674_10088695 | |||
| 1093 | Ga0207675_100137382 | |||
| 1094 | Ga0207683_10166733 | |||
| 1095 | Ga0207698_10004638 | |||
| 1096 | Ga0209389_1000041 | |||
| 1097 | Ga0209389_1000550 | |||
| 1098 | Ga0209589_1000003 | |||
| 1099 | Ga0209589_1000874 | |||
| 1100 | Ga0209489_100003 | |||
| 1101 | Ga0209489_100178 | |||
| 1102 | Ga0209489_101570 | |||
| 1103 | Ga0209700_100003 | |||
| 1104 | Ga0209700_100010 | |||
| 1105 | Ga0209588_1027745 | |||
| 1106 | Ga0209813_10006602 | |||
| 1107 | Ga0268266_10045903 | |||
| 1108 | Ga0268266_10080405 | |||
| 1109 | Ga0268264_10000022 | |||
| 1110 | Ga0265323_10001986 | |||
| 1111 | Ga0265336_10000896 | |||
| 1112 | Ga0307517_10000139 | |||
| 1113 | Ga0307517_10072343 | |||
| 1114 | Ga0265338_10000146 | |||
| 1115 | Ga0265330_10014896 | |||
| 1116 | Ga0265330_10023017 | |||
| 1117 | Ga0265332_10027906 | |||
| 1118 | Ga0265339_10007663 | |||
| 1119 | Ga0265339_10051673 | |||
| 1120 | Ga0265316_10143122 | |||
| 1121 | Ga0307408_100065243 | |||
| 1122 | Ga0307508_10047903 | |||
| 1123 | Ga0265342_10002873 | |||
| 1124 | Ga0307516_10005838 | |||
| 1125 | Ga0307516_10128749 | |||
| 1126 | Ga0307409_100118715 | |||
| 1127 | Ga0307507_10014169 | |||
| 1128 | Ga0307510_10005273 | |||
| 1129 | Ga0307510_10093177 | |||
| 1130 | Ga0307510_10115987 | |||
| 1131 | Ga0315911_1000001 | |||
| 1132 | Ga0373934_0019513 | |||
| 1133 | Ga0373923_0004793 | |||
| 1134 | Ga0373923_0020440 | |||
| 1135 | Ga0373945_0025227 | |||
| 1136 | Ga0373953_0015747 | |||
| 1137 | Ga0373954_0002068 | |||
| 1138 | Ga0373956_0003593 | |||
| 1139 | Ga0373957_0004004 | |||
| 1140 | Ga0373943_0022161 | |||
| 1141 | Ga0373955_0000352 | |||
| 1142 | Ga0373924_0000523 | |||
| 1143 | Ga0373924_0071787 | |||
| 1144 | Ga0373935_0008955 | |||
| 1145 | Ga0373935_0047362 | |||
| 1146 | Ga0373935_0060470 | |||
| 1147 | Ga0373927_0000432 | |||
| 1148 | Ga0373927_0077064 | |||
| 1149 | Ga0373927_0146905 | |||
| 1150 | Ga0373933_0000144 | |||
| 1151 | Ga0373933_0000739 | |||
| 1152 | Ga0373933_0095696 | |||
| 1153 | Ga0373947_0002975 | |||
| 1154 | Ga0373947_0017680 | |||
| 1155 | Ga0373937_0027373 | |||
| 1156 | Ga0373937_0037852 | |||
| 1157 | Ga0373937_0078931 | |||
| 1158 | Ga0373925_0001942 | |||
| 1159 | Ga0373925_0016085 | |||
| 1160 | Ga0373925_0029626 | |||
| 1161 | Ga0395900_0000591 | |||
| 1162 | Ga0395900_0122949 | |||
| 1163 | Ga0395900_0167218 | |||
| 1164 | Ga0395900_0201690 | |||
| 1165 | Ga0395905_0002994 | |||
| 1166 | Ga0395905_0033841 | |||
| 1167 | Ga0395905_0199407 | |||
| 1168 | Ga0436364_1186536 | |||
| 1169 | Ga0436365_1530339 | |||
| 1170 | Ga0436365_1584135 | |||
| 1171 | Ga0436363_0980009 | |||
| 1172 | Ga0436362_1245968 | |||
| 1173 | Ga0466972_0000727 | |||
| 1174 | Ga0466972_0024728 | |||
| 1175 | Ga0466972_0032559 | |||
| 1176 | Ga0466965_0068150 | |||
| 1177 | Ga0466966_0000600 | |||
| 1178 | Ga0466961_0000162 | |||
| 1179 | Ga0466960_0060323 | |||
| 1180 | Ga0466959_0006053 | |||
| 1181 | Ga0466967_0303805 | |||
| 1182 | Ga0495592_0003507 | |||
| 1183 | Ga0495603_0000067 | |||
| 1184 | Ga0495603_0009052 | |||
| 1185 | Ga0495603_0030497 | |||
| 1186 | Ga0495603_0032368 | |||
| 1187 | Ga0495603_0043571 | |||
| 1188 | Ga0495629_0000627 | |||
| 1189 | Ga0495629_0001123 | |||
| 1190 | Ga0495629_0003475 | |||
| 1191 | Ga0495629_0068534 | |||
| 1192 | Ga0495638_0007579 | |||
| 1193 | Ga0495638_0015570 | |||
| 1194 | Ga0495641_0024871 | |||
| 1195 | Ga0495651_0013494 | |||
| 1196 | Ga0495651_0057469 | |||
| 1197 | Ga0495653_0000212 | |||
| 1198 | Ga0495580_0002382 | |||
| 1199 | Ga0495580_0079029 | |||
| 1200 | Ga0495582_0000049 | |||
| 1201 | Ga0495582_0039041 | |||
| 1202 | Ga0495639_0000106 | |||
| 1203 | Ga0495662_0010243 | |||
| 1204 | Ga0495664_0026418 | |||
| 1205 | Ga0495664_0074036 | |||
| 1206 | Ga0495585_0038381 | |||
| 1207 | Ga0495594_0001628 | |||
| 1208 | Ga0495606_0001093 | |||
| 1209 | Ga0495608_0000742 | |||
| 1210 | Ga0495628_0008083 | |||
| 1211 | Ga0495628_0125495 | |||
| 1212 | Ga0495630_0002734 | |||
| 1213 | Ga0495630_0077792 | |||
| 1214 | Ga0495632_0082287 | |||
| 1215 | Ga0495648_0000704 | |||
| 1216 | Ga0495648_0036436 | |||
| 1217 | Ga0495652_0025258 | |||
| 1218 | Ga0495652_0060615 | |||
| 1219 | Ga0495652_0144145 | |||
| 1220 | Ga0495665_0000101 | |||
| 1221 | Ga0495640_0005046 | |||
| 1222 | Ga0495640_0015250 | |||
| 1223 | Ga0495587_0004455 | |||
| 1224 | Ga0495621_0019959 | |||
| 1225 | Ga0495645_0095430 | |||
| 1226 | Ga0495622_0039981 | |||
| 1227 | Ga0495667_0001112 | |||
| 1228 | Ga0495667_0032807 | |||
| 1229 | Ga0495667_0087585 | |||
| 1230 | Ga0495668_0093235 | |||
| 1231 | Ga0495634_0000267 | |||
| 1232 | Ga0495634_0007967 | |||
| 1233 | Ga0495634_0076238 | |||
| 1234 | Ga0495635_0000230 | |||
| 1235 | Ga0495635_0003015 | |||
| 1236 | Ga0495661_0057867 | |||
| 1237 | Ga0495588_0007534 | |||
| 1238 | Ga0495588_0032271 | |||
| 1239 | Ga0495657_0040465 | |||
| 1240 | Ga0495599_0035578 | |||
| 1241 | Ga0495623_0013532 | |||
| 1242 | Ga0495646_0011570 | |||
| 1243 | Ga0495646_0028609 | |||
| 1244 | Ga0495646_0049237 | |||
| 1245 | Ga0495658_0001665 | |||
| 1246 | Ga0495669_0003220 | |||
| 1247 | Ga0495669_0019491 | |||
| 1248 | Ga0495613_0018046 | |||
| 1249 | Ga0495613_0024471 | |||
| 1250 | Ga0495613_0056031 | |||
| 1251 | Ga0495624_0001957 | |||
| 1252 | Ga0495624_0063891 | |||
| 1253 | Ga0495624_0094670 | |||
| 1254 | Ga0495624_0117225 | |||
| 1255 | Ga0495600_0000274 | |||
| 1256 | Ga0495600_0014489 | |||
| 1257 | Ga0495581_0000022 | |||
| 1258 | Ga0495581_0089349 | |||
| 1259 | Ga0495604_0016181 | |||
| 1260 | Ga0495604_0020884 | |||
| 1261 | Ga0495674_0000629 | |||
| 1262 | Ga0495674_0038113 | |||
| 1263 | Ga0495680_0001284 | |||
| 1264 | Ga0495680_0005881 | |||
| 1265 | Ga0495687_009884 | |||
| 1266 | Ga0495675_0002816 | |||
| 1267 | Ga0495684_0000780 | |||
| 1268 | Ga0495686_0005612 | |||
| 1269 | Ga0495686_0049286 | |||
| 1270 | Ga0495593_0000016 | |||
| 1271 | Ga0495593_0006860 | |||
| 1272 | Ga0495593_0051235 | |||
| 1273 | Ga0495602_0022689 | |||
| 1274 | Ga0495626_0033629 | |||
| 1275 | Ga0496100_0108889 | |||
| 1276 | Ga0496101_0043457 | |||
| 1277 | Ga0496101_0051577 | |||
| 1278 | Ga0496102_0009980 | |||
| 1279 | Ga0496102_0082887 | |||
| 1280 | Ga0496102_0197831 | |||
| 1281 | Ga0496103_0053615 | |||
| 1282 | Ga0496104_0000730 | |||
| 1283 | Ga0496104_0007674 | |||
| 1284 | Ga0496104_0051887 | |||
| 1285 | Ga0496105_0003882 | |||
| 1286 | Ga0496105_0005096 | |||
| 1287 | Ga0496105_0009214 | |||
| 1288 | Ga0496106_0000808 | |||
| 1289 | Ga0496106_0013691 | |||
| 1290 | Ga0496106_0057182 | |||
| 1291 | Ga0496106_0116748 | |||
| 1292 | Ga0496106_0163675 | |||
| 1293 | Ga0496107_0031422 | |||
| 1294 | Ga0496107_0038026 | |||
| 1295 | Ga0496108_0000361 | |||
| 1296 | Ga0496108_0032007 | |||
| 1297 | Ga0496108_0145883 | |||
| 1298 | Ga0496109_0041739 | |||
| 1299 | Ga0496109_0061312 | |||
| 1300 | Ga0496109_0063016 | |||
| 1301 | Ga0496110_0002958 | |||
| 1302 | Ga0496110_0005088 | |||
| 1303 | Ga0496110_0050175 | |||
| 1304 | Ga0496110_0123568 | |||
| 1305 | Ga0496112_0000009 | |||
| 1306 | Ga0496112_0042602 | |||
| 1307 | Ga0496112_0062334 | |||
| 1308 | Ga0496112_0072041 | |||
| 1309 | Ga0496112_0093906 | |||
| 1310 | Ga0496112_0104388 | |||
| 1311 | Ga0496112_0198898 | |||
| 1312 | Ga0496113_0027620 | |||
| 1313 | Ga0496113_0032264 | |||
| 1314 | Ga0496116_0044677 | |||
| 1315 | Ga0496117_0047347 | |||
| 1316 | Ga0496118_0011636 | |||
| 1317 | Ga0496118_0028409 | |||
| 1318 | Ga0496118_0043760 | |||
| 1319 | Ga0496118_0044131 | |||
| 1320 | Ga0496118_0079601 | |||
| 1321 | Ga0496119_0007812 | |||
| 1322 | Ga0496119_0043985 | |||
| 1323 | Ga0496119_0117270 | |||
| 1324 | Ga0496120_0007941 | |||
| 1325 | Ga0496120_0017727 | |||
| 1326 | Ga0496121_0000612 | |||
| 1327 | Ga0496121_0000864 | |||
| 1328 | Ga0496121_0007142 | |||
| 1329 | Ga0496121_0009665 | |||
| 1330 | Ga0496121_0020700 | |||
| 1331 | Ga0496121_0034901 | |||
| 1332 | Ga0496121_0087854 | |||
| 1333 | Ga0496121_0124431 | |||
| 1334 | Ga0496122_0001692 | |||
| 1335 | Ga0496122_0023079 | |||
| 1336 | Ga0496122_0025277 | |||
| 1337 | Ga0496123_0001285 | |||
| 1338 | Ga0496124_0001167 | |||
| 1339 | Ga0496124_0151869 | |||
| 1340 | Ga0496125_0008020 | |||
| 1341 | Ga0496125_0011650 | |||
| 1342 | Ga0496125_0011849 | |||
| 1343 | Ga0496125_0017900 | |||
| 1344 | Ga0496125_0030700 | |||
| 1345 | Ga0496125_0119493 | |||
| 1346 | Ga0496126_0011484 | |||
| 1347 | Ga0496126_0018851 | |||
| 1348 | Ga0496126_0019064 | |||
| 1349 | Ga0496126_0020616 | |||
| 1350 | Ga0496126_0021225 | |||
| 1351 | Ga0496126_0023224 | |||
| 1352 | Ga0496126_0034598 | |||
| 1353 | Ga0496126_0106762 | |||
| 1354 | Ga0496126_0124915 | |||
| 1355 | Ga0501031_0000186 | |||
| 1356 | Ga0501031_0013473 | |||
| 1357 | Ga0501031_0040268 | |||
| 1358 | Ga0501032_0022660 | |||
| 1359 | Ga0501032_0065117 | |||
| 1360 | Ga0501033_0000098 | |||
| 1361 | Ga0501033_0000558 | |||
| 1362 | Ga0501033_0099891 | |||
| 1363 | Ga0501033_0151914 | |||
| 1364 | Ga0501034_0001197 | |||
| 1365 | Ga0501034_0010992 | |||
| 1366 | Ga0501034_0102539 | |||
| 1367 | Ga0501034_0194594 | |||
| 1368 | Ga0501036_0000049 | |||
| 1369 | Ga0501036_0145793 | |||
| 1370 | Ga0501037_0000069 | |||
| 1371 | Ga0501038_0000034 | |||
| 1372 | Ga0501038_0001638 | |||
| 1373 | Ga0501038_0016494 | |||
| 1374 | Ga0501038_0045359 | |||
| 1375 | Ga0501038_0073585 | |||
| 1376 | Ga0501039_0000090 | |||
| 1377 | Ga0501039_0098178 | |||
| 1378 | Ga0501042_0007184 | |||
| 1379 | Ga0501042_0065952 | |||
| 1380 | Ga0501043_0000130 | |||
| 1381 | Ga0501043_0001743 | |||
| 1382 | Ga0501043_0002558 | |||
| 1383 | Ga0501043_0013106 | |||
| 1384 | Ga0501043_0023178 | |||
| 1385 | Ga0501046_0000213 | |||
| 1386 | Ga0501046_0007264 | |||
| 1387 | Ga0501046_0073453 | |||
| 1388 | Ga0501047_0000758 | |||
| 1389 | Ga0501047_0013725 | |||
| 1390 | Ga0501047_0035213 | |||
| 1391 | Ga0501047_0226877 | |||
| 1392 | Ga0501048_0025757 | |||
| 1393 | Ga0501067_0000264 | |||
| 1394 | Ga0501067_0094969 | |||
| 1395 | Ga0501068_0000866 | |||
| 1396 | Ga0501068_0011901 | |||
| 1397 | Ga0501068_0066845 | |||
| 1398 | Ga0501070_0029403 | |||
| 1399 | Ga0501070_0121539 | |||
| 1400 | Ga0501070_0124452 | |||
| 1401 | Ga0501071_0056861 | |||
| 1402 | Ga0501074_0007521 | |||
| 1403 | Ga0501074_0052476 | |||
| 1404 | Ga0501077_0100775 | |||
| 1405 | Ga0501079_0008177 | |||
| 1406 | Ga0501080_0003533 | |||
| 1407 | Ga0501080_0044499 | |||
| 1408 | Ga0501083_0000590 | |||
| 1409 | Ga0501035_0000970 | |||
| 1410 | Ga0501035_0002915 | |||
| 1411 | Ga0501035_0093991 | |||
| 1412 | Ga0501035_0103279 | |||
| 1413 | Ga0501044_0000725 | |||
| 1414 | Ga0501044_0007020 | |||
| 1415 | Ga0501044_0009168 | |||
| 1416 | Ga0501044_0032620 | |||
| 1417 | Ga0501044_0062421 | |||
| 1418 | Ga0501044_0063757 | |||
| 1419 | Ga0501045_0011129 | |||
| 1420 | Ga0501045_0197360 | |||
| 1421 | nmdc:mga00v17_22110_c1 | |||
| 1422 | nmdc:mga00v17_38144_c1 | |||
| 1423 | nmdc:mga0yw44_113562_c1 | |||
| 1424 | nmdc:mga0yw44_121296_c1 | |||
| 1425 | nmdc:mga0yw44_33002_c1 | |||
| 1426 | nmdc:mga0yw44_92155_c1 | |||
| 1427 | nmdc:mga0k408_53325_c1 | |||
| 1428 | nmdc:mga0k408_8390_c1 | |||
| 1429 | nmdc:mga06z11_4321_c1 | |||
| 1430 | nmdc:mga06z11_68646_c1 | |||
| 1431 | nmdc:mga06z11_7121_c1 | |||
| 1432 | nmdc:mga07m45_24777_c1 | |||
| 1433 | nmdc:mga07m45_52766_c1 | |||
| 1434 | nmdc:mga0n895_68838_c1 | |||
| 1435 | nmdc:mga0sz30_3089_c1 | |||
| 1436 | Ga0495601_0038708 | |||
| 1437 | Ga0495601_0040145 | |||
| 1438 | Ga0500610_0016658 | |||
| 1439 | Ga0500635_0019104 | |||
| 1440 | Ga0495619_0001297 | |||
| 1441 | Ga0500643_000116 | |||
| 1442 | Ga0500643_019292 | |||
| 1443 | Ga0500646_0002421 | |||
| 1444 | Ga0500646_0022973 | |||
| 1445 | Ga0500651_0000593 | |||
| 1446 | Ga0500566_0000050 | |||
| 1447 | Ga0500566_0005487 | |||
| 1448 | Ga0500566_0006937 | |||
| 1449 | Ga0500640_000161 | |||
| 1450 | Ga0500641_0007162 | |||
| 1451 | Ga0500641_0020783 | |||
| 1452 | Ga0500650_0002300 | |||
| 1453 | Ga0500555_011496 | |||
| 1454 | Ga0500556_0000002 | |||
| 1455 | Ga0500556_0002345 | |||
| 1456 | Ga0500557_000061 | |||
| 1457 | Ga0500572_000033 | |||
| 1458 | Ga0500572_000911 | |||
| 1459 | Ga0500592_000872 | |||
| 1460 | Ga0500595_003716 | |||
| 1461 | Ga0500595_007498 | |||
| 1462 | Ga0500608_003093 | |||
| 1463 | Ga0500608_003250 | |||
| 1464 | Ga0500642_0000010 | |||
| 1465 | Ga0500642_0000098 | |||
| 1466 | Ga0500652_001701 | |||
| 1467 | Ga0500559_0000142 | |||
| 1468 | Ga0500559_0001019 | |||
| 1469 | Ga0500559_0001739 | |||
| 1470 | Ga0500559_0016065 | |||
| 1471 | Ga0500559_0044898 | |||
| 1472 | Ga0500568_0000427 | |||
| 1473 | Ga0500577_0000133 | |||
| 1474 | Ga0500586_000857 | |||
| 1475 | Ga0500604_0003801 | |||
| 1476 | Ga0500616_0000045 | |||
| 1477 | Ga0500616_0000069 | |||
| 1478 | Ga0500616_0047891 | |||
| 1479 | Ga0500619_006351 | |||
| 1480 | Ga0500622_0014034 | |||
| 1481 | Ga0500634_0024264 | |||
| 1482 | Ga0500639_000032 | |||
| 1483 | Ga0500636_0000207 | |||
| 1484 | Ga0500636_0009427 | |||
| 1485 | Ga0500636_0059387 | |||
| 1486 | Ga0500637_0000077 | |||
| 1487 | Ga0500637_0020072 | |||
| 1488 | Ga0500625_003482 | |||
| 1489 | Ga0500596_000116 | |||
| 1490 | Ga0500596_000445 | |||
| 1491 | Ga0500596_000541 | |||
| 1492 | Ga0500599_000820 | |||
| 1493 | Ga0500601_000135 | |||
| 1494 | Ga0501084_0007469 | |||
| 1495 | Ga0501082_0011999 | |||
| 1496 | 2958173930 | |||
| 1497 | 2507509175 | |||
| 1498 | 2508543239 | |||
| 1499 | 2508691016 | |||
| 1500 | 2508728397 | |||
| 1501 | 2509078461 | |||
| 1502 | 2509147465 | |||
| 1503 | 2511395228 | |||
| 1504 | 2513591787 | |||
| 1505 | 2513627908 | |||
| 1506 | 2513637729 | |||
| 1507 | 2513646854 | |||
| 1508 | 2513654520 | |||
| 1509 | 2513675511 | |||
| 1510 | 2513692001 | |||
| 1511 | 2513704520 | |||
| 1512 | 2513723109 | |||
| 1513 | 2513859321 | |||
| 1514 | 2513872267 | |||
| 1515 | 2513892860 | |||
| 1516 | 2513915301 | |||
| 1517 | 2514013995 | |||
| 1518 | 2515626584 | |||
| 1519 | 2517101809 | |||
| 1520 | 2517892600 | |||
| 1521 | 2524436771 | |||
| 1522 | 2524465120 | |||
| 1523 | 2524539055 | |||
| 1524 | 2528855590 | |||
| 1525 | 2603858997 | |||
| 1526 | 2617351306 | |||
| 1527 | 2617376281 | |||
| 1528 | 2644288456 | |||
| 1529 | 2671122299 | |||
| 1530 | 2671692681 | |||
| 1531 | 2723845606 | |||
| 1532 | 2728750510 | |||
| 1533 | 2738745086 | |||
| 1534 | 2739354316 | |||
| 1535 | 2745080292 | |||
| 1536 | 2774873392 | |||
| 1537 | 2776259676 | |||
| 1538 | 2793063870 | |||
| 1539 | 2793068573 | |||
| 1540 | 2793083758 | |||
| 1541 | 2805918129 | |||
| 1542 | 2818242694 | |||
| 1543 | 2824605012 | |||
| 1544 | 2824613888 | |||
| 1545 | 2824625887 | |||
| 1546 | 2824634649 | |||
| 1547 | 2824642388 | |||
| 1548 | 2824649919 | |||
| 1549 | 2824657042 | |||
| 1550 | 2824665124 | |||
| 1551 | 2824677955 | |||
| 1552 | 2824681296 | |||
| 1553 | 2824694380 | |||
| 1554 | 2824702699 | |||
| 1555 | 2824709254 | |||
| 1556 | 2824722792 | |||
| 1557 | 2824730164 | |||
| 1558 | 2824737464 | |||
| 1559 | 2824753143 | |||
| 1560 | 2824761978 | |||
| 1561 | 2824772438 | |||
| 1562 | 2824779200 | |||
| 1563 | 2835317874 | |||
| 1564 | 2838126333 | |||
| 1565 | 2841943589 | |||
| 1566 | 2841950461 | |||
| 1567 | 2841958176 | |||
| 1568 | 2841966775 | |||
| 1569 | 2841975530 | |||
| 1570 | 2841988330 | |||
| 1571 | 2842039580 | |||
| 1572 | 2842047474 | |||
| 1573 | 2842700267 | |||
| 1574 | 2844318554 | |||
| 1575 | 2847935490 | |||
| 1576 | 2847946050 | |||
| 1577 | 2849079834 | |||
| 1578 | 2857513769 | |||
| 1579 | 2857527898 | |||
| 1580 | 2874597290 | |||
| 1581 | 2874609782 | |||
| 1582 | 2874616327 | |||
| 1583 | 2874626815 | |||
| 1584 | 2874631225 | |||
| 1585 | 2874649377 | |||
| 1586 | 2876770443 | |||
| 1587 | 2876777913 | |||
| 1588 | 2876823066 | |||
| 1589 | 2879078670 | |||
| 1590 | 2879088483 | |||
| 1591 | 2879108169 | |||
| 1592 | 2879118350 | |||
| 1593 | 2879148652 | |||
| 1594 | 2881366862 | |||
| 1595 | 2881672176 | |||
| 1596 | 2882458246 | |||
| 1597 | 2885371981 | |||
| 1598 | 2885379324 | |||
| 1599 | 2885388647 | |||
| 1600 | 2885411007 | |||
| 1601 | 2888383523 | |||
| 1602 | 2888394431 | |||
| 1603 | 2888423951 | |||
| 1604 | 2889040412 | |||
| 1605 | 2893068316 | |||
| 1606 | 2894239715 | |||
| 1607 | 2903730080 | |||
| 1608 | 2903749892 | |||
| 1609 | 2903771915 | |||
| 1610 | 2904668393 | |||
| 1611 | 2904695954 | |||
| 1612 | 2904702708 | |||
| 1613 | 2904717359 | |||
| 1614 | 2906603465 | |||
| 1615 | 2906618404 | |||
| 1616 | 2906632215 | |||
| 1617 | 2906638704 | |||
| 1618 | 2906644718 | |||
| 1619 | 2906664106 | |||
| 1620 | 2908742925 | |||
| 1621 | 2908760583 | |||
| 1622 | 2908779597 | |||
| 1623 | 2919075298 | |||
| 1624 | 2919454640 | |||
| 1625 | 2922368282 | |||
| 1626 | 2922373736 | |||
| 1627 | 2922388254 | |||
| 1628 | 2922395823 | |||
| 1629 | 2922429697 | |||
| 1630 | 2929617451 | |||
| 1631 | 2929627156 | |||
| 1632 | 2932787509 | |||
| 1633 | 2932798374 | |||
| 1634 | 2932803323 | |||
| 1635 | 2932815034 | |||
| 1636 | 2932820768 | |||
| 1637 | 2932831816 | |||
| 1638 | 2933579407 | |||
| 1639 | 2935611941 | |||
| 1640 | 2935621822 | |||
| 1641 | 2935631866 | |||
| 1642 | 2935642767 | |||
| 1643 | 2935649567 | |||
| 1644 | 2935658918 | |||
| 1645 | 2935667869 | |||
| 1646 | 2935682361 | |||
| 1647 | 2935688620 | |||
| 1648 | 2935695971 | |||
| 1649 | 2935706710 | |||
| 1650 | 2935715639 | |||
| 1651 | 2935725797 | |||
| 1652 | 2935734458 | |||
| 1653 | 2935743837 | |||
| 1654 | 2935754126 | |||
| 1655 | 2935763164 | |||
| 1656 | 2935772584 | |||
| 1657 | 2935783136 | |||
| 1658 | 2935790877 | |||
| 1659 | 2935799422 | |||
| 1660 | 2935808389 | |||
| 1661 | 2935812916 | |||
| 1662 | 2935821421 | |||
| 1663 | 2935830568 | |||
| 1664 | 2935840598 | |||
| 1665 | 2935850320 | |||
| 1666 | 2935860069 | |||
| 1667 | 2935869296 | |||
| 1668 | 2935880543 | |||
| 1669 | 2935888103 | |||
| 1670 | 2935914365 | |||
| 1671 | 2935921079 | |||
| 1672 | 2935932021 | |||
| 1673 | 2935940618 | |||
| 1674 | 2935948561 | |||
| 1675 | 2935956968 | |||
| 1676 | 2935960258 | |||
| 1677 | 2935973566 | |||
| 1678 | 2935977513 | |||
| 1679 | 2935989980 | |||
| 1680 | 2935996289 | |||
| 1681 | 2936006423 | |||
| 1682 | 2936012951 | |||
| 1683 | 2936021515 | |||
| 1684 | 2936030244 | |||
| 1685 | 2936041504 | |||
| 1686 | 2936047709 | |||
| 1687 | 2936057133 | |||
| 1688 | 2939670932 | |||
| 1689 | 2940560498 | |||
| 1690 | 2941513019 | |||
| 1691 | 2941521077 | |||
| 1692 | 2941526059 | |||
| 1693 | 2941534304 | |||
| 1694 | 2941541272 | |||
| 1695 | 3005479999 | |||
| 1696 | 3005489634 | |||
| 1697 | 3005509848 | |||
| 1698 | 3005590040 | |||
| 1699 | 3005598669 | |||
| 1700 | 3005714323 | |||
| 1701 | 3005721831 | |||
| 1702 | 8001849664 | |||
| 1703 | 8006927172 | |||
| 1704 | 8006941197 | |||
| 1705 | 8006967234 | |||
| 1706 | 8006980597 | |||
| 1707 | 8006992081 | |||
| 1708 | 8006997470 | |||
| 1709 | 8016513952 | |||
| 1710 | 8016530182 | |||
| 1711 | 8016535433 | |||
| 1712 | 8016553496 | |||
| 1713 | 8016573767 | |||
| 1714 | 8016577891 | |||
| 1715 | 8016592540 | |||
| 1716 | 8016599706 | |||
| 1717 | 8016622494 | |||
| 1718 | 8016627290 | |||
| 1719 | 8016631577 | |||
| 1720 | 8017062525 | |||
| 1721 | 8019535174 | |||
| 1722 | 8019544310 | |||
| 1723 | 8019557009 | |||
| 1724 | 8019568292 | |||
| 1725 | 8019581919 | |||
| 1726 | 8019589599 | |||
| 1727 | 8019601669 | |||
| 1728 | 8019616880 | |||
| 1729 | 8019627531 | |||
| 1730 | 8019635041 | |||
| 1731 | 8019644687 | |||
| 1732 | 8019662883 | |||
| 1733 | 8019672484 | |||
| 1734 | 8019683674 | |||
| 1735 | 8019689427 | |||
| 1736 | 8055746934 | |||
| 1737 | 8056674348 | |||
| 1738 | 8056683260 | |||
| 1739 | 8056690025 | |||
| 1740 | 8056972916 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8a5z-assembly1.cif.gz_A | imine reductase from ensifer adhaerens a208n mutant in complex with nadp+ | 0.959 | 11 | 37 |
| 8i4n-assembly1.cif.gz_B | crystal strcuture of 6-phosphogluconate dehydrogenase from corynebacterium glutamicum | 0.9502 | 11 | 38 |
| 2vq3-assembly1.cif.gz_B | crystal structure of the membrane proximal oxidoreductase domain of human steap3, the dominant ferric reductase of the erythroid transferrin cycle | 0.9481 | 10 | 38 |
| 8c79-assembly1.cif.gz_B | crystal structure of leishmania donovani 6-phosphogluconate dehydrogenase complexed with nadph | 0.9438 | 11 | 38 |
| 7wnw-assembly1.cif.gz_B | crystal structure of imine reductase mutant(m5) from actinoalloteichus hymeniacidonis in complex with nadph | 0.94 | 11 | 37 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5z2gB02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9882 | 12 | 39 | 3.50.50.60 |
| af_Q5AMP2_2_178_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9597 | 10 | 37 | 3.40.50.720 |
| 2vq3B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9481 | 10 | 38 | 3.40.50.720 |
| af_Q2FYF3_156_325_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9457 | 10 | 38 | 3.50.50.60 |
| 1sezB01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9448 | 10 | 41 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V1SUL7-F1-model_v4 | FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(Uracil(54)-C(5))-methyltransferase TrmFO | 0.9478 | 9 | 150 |
GO:0002098
GO:0005829 GO:0008168 GO:0030488 GO:0050660 |
| AF-A0A356W6F1-F1-model_v4 | FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(Uracil(54)-C(5))-methyltransferase TrmFO | 0.9453 | 9 | 134 |
GO:0002098
GO:0005829 GO:0008168 GO:0030488 GO:0050660 |
| AF-A0A363TIK7-F1-model_v4 | FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(Uracil(54)-C(5))-methyltransferase TrmFO | 0.944 | 10 | 118 |
GO:0002098
GO:0005829 GO:0008168 GO:0030488 GO:0050660 |
| AF-A0A3D2VY89-F1-model_v4 | FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(Uracil(54)-C(5))-methyltransferase TrmFO | 0.9431 | 10 | 133 |
GO:0002098
GO:0005829 GO:0008168 GO:0030488 GO:0050660 |
| AF-A0A3S1U576-F1-model_v4 | deleted | 0.9414 | 9 | 155 |
|