F484177

General Info

Members Datasets Scaffolds Average Seq Length
871 268 1742 237

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100000368|Ga0075428_1000003682
Length 255
Sequence MSAPGPMSGSAGSAAAGGGPMLELASVETYRGPAQILRSVSLSLGAGEAVCLVGRNGAGKTTTIDTIMGLLAPRSGAVRFRGQDVTRLPAHERARLGIGYAPEDCGIFPDLTVEENFQITAWLGKAATKTNGGAADERVFSIFPEVKGLLTRRGLHLSGGQKKMVAITRALTLAPAVLLLDEPFEGLAPVVVTRFIEAVRAIKGLGVSVLIAESHVQNAGRIADRLYAIDRGEIIFAGRPAELTGNAEVMKTLHG

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
160 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
161 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
162 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
163 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
164 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
177 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
178 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
179 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
180 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
181 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
182 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
183 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
255 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
256 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
259 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
260 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
261 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
262 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
263 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
264 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.92
Nodule 0
Rhizoplane 1.49
Rhizosphere 97.47
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100000368 3300006844 Bacteria 44722
2 JGI25406J46586_10008341 3300003203 Bacteria 4698
3 JGI25404J52841_10000575 3300003659 Bacteria 5458
4 Ga0065715_10201802 3300005293 Bacteria 1358
5 Ga0065707_10009733 3300005295 Bacteria 2645
6 Ga0070676_10000758 3300005328 Bacteria 15873
7 Ga0070676_10016029 3300005328 Bacteria 4139
8 Ga0070683_100021410 3300005329 Bacteria 5772
9 Ga0070690_100069040 3300005330 Bacteria 2293
10 Ga0070690_100095137 3300005330 Bacteria 1967
11 Ga0070690_100315404 3300005330 Bacteria 1125
12 Ga0070670_100009409 3300005331 Bacteria 8342
13 Ga0068869_100001552 3300005334 Bacteria 13642
14 Ga0068869_100005186 3300005334 Bacteria 8181
15 Ga0068869_100020585 3300005334 Bacteria 4526
16 Ga0070680_100002089 3300005336 Bacteria 14754
17 Ga0070682_100000097 3300005337 Bacteria 78598
18 Ga0070660_100001696 3300005339 Bacteria 15107
19 Ga0070689_100190433 3300005340 Bacteria 1670
20 Ga0070689_100212837 3300005340 Bacteria 1583
21 Ga0070691_10007391 3300005341 Bacteria 5030
22 Ga0070691_10013719 3300005341 Bacteria 3716
23 Ga0070691_10032011 3300005341 Bacteria 2469
24 Ga0070687_100278052 3300005343 Bacteria 1052
25 Ga0070687_100315217 3300005343 Bacteria 997
26 Ga0070661_100006408 3300005344 Bacteria 8116
27 Ga0070692_10000112 3300005345 Bacteria 18746
28 Ga0070692_10024279 3300005345 Bacteria 2978
29 Ga0070692_10093410 3300005345 Bacteria 1638
30 Ga0070668_100085177 3300005347 Bacteria 2484
31 Ga0070669_100023225 3300005353 Bacteria 4441
32 Ga0070669_100055167 3300005353 Bacteria 2911
33 Ga0070669_100140726 3300005353 Bacteria 1860
34 Ga0070659_100002126 3300005366 Bacteria 14119
35 Ga0070703_10010411 3300005406 Bacteria 2621
36 Ga0070703_10062555 3300005406 Bacteria 1222
37 Ga0070703_10070145 3300005406 Bacteria 1169
38 Ga0070709_10077497 3300005434 Bacteria 2161
39 Ga0070701_10017757 3300005438 Bacteria 3331
40 Ga0070701_10018570 3300005438 Bacteria 3270
41 Ga0070701_10059735 3300005438 Bacteria 2005
42 Ga0070711_100036296 3300005439 Bacteria 3302
43 Ga0070711_100042860 3300005439 Bacteria 3062
44 Ga0070711_100516546 3300005439 Bacteria 987
45 Ga0070705_100001051 3300005440 Bacteria 15405
46 Ga0070705_100021158 3300005440 Bacteria 3455
47 Ga0070705_100370409 3300005440 Bacteria 1051
48 Ga0070705_100511448 3300005440 Bacteria 913
49 Ga0070700_100061709 3300005441 Bacteria 2366
50 Ga0070700_100081904 3300005441 Bacteria 2086
51 Ga0070700_100627574 3300005441 Bacteria 846
52 Ga0070694_100001299 3300005444 Bacteria 14529
53 Ga0070694_100096921 3300005444 Bacteria 2080
54 Ga0070708_100000615 3300005445 Bacteria 26906
55 Ga0070708_100001108 3300005445 Bacteria 20557
56 Ga0070708_100109925 3300005445 Bacteria 2532
57 Ga0070708_100111190 3300005445 Bacteria 2518
58 Ga0070708_100126090 3300005445 Bacteria 2366
59 Ga0070708_100128258 3300005445 Bacteria 2346
60 Ga0070708_100135878 3300005445 Bacteria 2278
61 Ga0070708_100194520 3300005445 Bacteria 1897
62 Ga0070708_100241093 3300005445 Bacteria 1697
63 Ga0070708_100596267 3300005445 Bacteria 1042
64 Ga0070663_100040180 3300005455 Bacteria 3273
65 Ga0070678_100128620 3300005456 Bacteria 2009
66 Ga0070662_100053653 3300005457 Bacteria 2919
67 Ga0070681_10003551 3300005458 Bacteria 14627
68 Ga0070681_10147410 3300005458 Bacteria 2282
69 Ga0068867_100000768 3300005459 Bacteria 21657
70 Ga0068867_100100050 3300005459 Bacteria 2213
71 Ga0068867_100137411 3300005459 Bacteria 1907
72 Ga0070706_100000143 3300005467 Bacteria 90046
73 Ga0070706_100018242 3300005467 Bacteria 6476
74 Ga0070706_100028362 3300005467 Bacteria 5154
75 Ga0070706_100031226 3300005467 Bacteria 4912
76 Ga0070706_100074899 3300005467 Bacteria 3133
77 Ga0070706_100132266 3300005467 Bacteria 2328
78 Ga0070706_100161918 3300005467 Bacteria 2090
79 Ga0070706_100276403 3300005467 Bacteria 1567
80 Ga0070706_100381879 3300005467 Bacteria 1312
81 Ga0070706_100387169 3300005467 Bacteria 1302
82 Ga0070706_100506934 3300005467 Bacteria 1123
83 Ga0070706_100511824 3300005467 Bacteria 1116
84 Ga0070706_100730995 3300005467 Bacteria 917
85 Ga0070707_100005455 3300005468 Bacteria 11892
86 Ga0070707_100010447 3300005468 Bacteria 8646
87 Ga0070707_100010785 3300005468 Bacteria 8511
88 Ga0070707_100011685 3300005468 Bacteria 8193
89 Ga0070707_100027721 3300005468 Bacteria 5388
90 Ga0070707_100037620 3300005468 Bacteria 4619
91 Ga0070707_100048386 3300005468 Bacteria 4073
92 Ga0070707_100073403 3300005468 Bacteria 3298
93 Ga0070707_100086546 3300005468 Bacteria 3030
94 Ga0070707_100139934 3300005468 Bacteria 2355
95 Ga0070707_100319632 3300005468 Bacteria 1508
96 Ga0070707_100354695 3300005468 Bacteria 1424
97 Ga0070707_100425954 3300005468 Bacteria 1287
98 Ga0070707_100496902 3300005468 Bacteria 1181
99 Ga0070707_100724599 3300005468 Bacteria 957
100 Ga0070698_100000035 3300005471 Bacteria 93606
101 Ga0070698_100012124 3300005471 Bacteria 9135
102 Ga0070698_100029037 3300005471 Bacteria 5740
103 Ga0070698_100035730 3300005471 Bacteria 5136
104 Ga0070698_100200906 3300005471 Bacteria 1929
105 Ga0070698_100206680 3300005471 Bacteria 1898
106 Ga0070698_100360487 3300005471 Bacteria 1385
107 Ga0070698_100714163 3300005471 Bacteria 945
108 Ga0070699_100006487 3300005518 Bacteria 10187
109 Ga0070699_100012792 3300005518 Bacteria 7234
110 Ga0070699_100016266 3300005518 Bacteria 6387
111 Ga0070699_100019832 3300005518 Bacteria 5795
112 Ga0070699_100022164 3300005518 Bacteria 5473
113 Ga0070699_100037412 3300005518 Bacteria 4199
114 Ga0070699_100072918 3300005518 Bacteria 2987
115 Ga0070699_100122124 3300005518 Bacteria 2291
116 Ga0070699_100170131 3300005518 Bacteria 1930
117 Ga0070699_100241895 3300005518 Unclassified 1611
118 Ga0070699_100335446 3300005518 Bacteria 1360
119 Ga0070699_100514854 3300005518 Bacteria 1087
120 Ga0070699_100605665 3300005518 Bacteria 999
121 Ga0070679_100000407 3300005530 Bacteria 36623
122 Ga0070684_100342712 3300005535 Bacteria 1374
123 Ga0070697_100002321 3300005536 Bacteria 14620
124 Ga0070697_100002382 3300005536 Bacteria 14468
125 Ga0070697_100004162 3300005536 Bacteria 11084
126 Ga0070697_100005097 3300005536 Bacteria 10090
127 Ga0070697_100015492 3300005536 Bacteria 5985
128 Ga0070697_100023842 3300005536 Bacteria 4870
129 Ga0070697_100054369 3300005536 Bacteria 3254
130 Ga0070697_100061281 3300005536 Unclassified 3068
131 Ga0070697_100090758 3300005536 Bacteria 2525
132 Ga0070697_100099155 3300005536 Bacteria 2418
133 Ga0070697_100149769 3300005536 Bacteria 1966
134 Ga0070697_100168548 3300005536 Bacteria 1852
135 Ga0070697_100212596 3300005536 Bacteria 1647
136 Ga0070697_100218954 3300005536 Bacteria 1622
137 Ga0070697_100256357 3300005536 Bacteria 1497
138 Ga0070697_100334623 3300005536 Bacteria 1306
139 Ga0070697_100346271 3300005536 Bacteria 1283
140 Ga0070697_100353967 3300005536 Bacteria 1269
141 Ga0070697_100426454 3300005536 Bacteria 1153
142 Ga0070697_100552867 3300005536 Bacteria 1009
143 Ga0070697_100594160 3300005536 Bacteria 973
144 Ga0068853_100002919 3300005539 Bacteria 13000
145 Ga0070672_100007262 3300005543 Bacteria 7506
146 Ga0070672_100044114 3300005543 Bacteria 3442
147 Ga0070672_100157481 3300005543 Bacteria 1882
148 Ga0070695_100000568 3300005545 Bacteria 19470
149 Ga0070695_100001366 3300005545 Bacteria 13541
150 Ga0070695_100003012 3300005545 Bacteria 9818
151 Ga0070695_100040222 3300005545 Bacteria 2959
152 Ga0070696_100000504 3300005546 Bacteria 24612
153 Ga0070696_100006645 3300005546 Bacteria 7726
154 Ga0070696_100075190 3300005546 Bacteria 2383
155 Ga0070696_100302988 3300005546 Bacteria 1224
156 Ga0070696_100392658 3300005546 Bacteria 1084
157 Ga0070696_100432850 3300005546 Bacteria 1035
158 Ga0070696_100578197 3300005546 Bacteria 903
159 Ga0070696_100620543 3300005546 Bacteria 874
160 Ga0070693_100000364 3300005547 Bacteria 20532
161 Ga0070693_100036733 3300005547 Bacteria 2726
162 Ga0070704_100002184 3300005549 Bacteria 10896
163 Ga0070704_100138993 3300005549 Bacteria 1894
164 Ga0070704_100303694 3300005549 Bacteria 1331
165 Ga0070704_100888442 3300005549 Bacteria 801
166 Ga0068855_100005917 3300005563 Bacteria 14911
167 Ga0070664_100000109 3300005564 Bacteria 53923
168 Ga0070664_100002372 3300005564 Bacteria 15140
169 Ga0068857_100006844 3300005577 Bacteria 9813
170 Ga0068857_100009668 3300005577 Bacteria 8380
171 Ga0068857_100049669 3300005577 Bacteria 3722
172 Ga0068854_100001920 3300005578 Bacteria 12670
173 Ga0068856_100003802 3300005614 Bacteria 15121
174 Ga0070702_100027792 3300005615 Bacteria 3057
175 Ga0068852_100351626 3300005616 Bacteria 1439
176 Ga0068859_100000761 3300005617 Bacteria 32461
177 Ga0068859_100713726 3300005617 Bacteria 1093
178 Ga0068864_100017413 3300005618 Bacteria 5990
179 Ga0068864_100214546 3300005618 Bacteria 1774
180 Ga0068861_100022688 3300005719 Bacteria 4525
181 Ga0068861_100050640 3300005719 Bacteria 3150
182 Ga0068861_100144696 3300005719 Bacteria 1944
183 Ga0068870_10000344 3300005840 Bacteria 17399
184 Ga0068863_100005828 3300005841 Bacteria 12074
185 Ga0068863_100044875 3300005841 Bacteria 4195
186 Ga0068863_100219406 3300005841 Bacteria 1832
187 Ga0068860_100010848 3300005843 Bacteria 8992
188 Ga0068860_100095693 3300005843 Bacteria 2830
189 Ga0068860_100154833 3300005843 Bacteria 2209
190 Ga0068860_100229337 3300005843 Bacteria 1804
191 Ga0068860_100708150 3300005843 Bacteria 1017
192 Ga0068862_100002867 3300005844 Bacteria 15113
193 Ga0068862_100015088 3300005844 Bacteria 6419
194 Ga0068862_100106177 3300005844 Bacteria 2462
195 Ga0081455_10000471 3300005937 Bacteria 52313
196 Ga0081538_10003163 3300005981 Bacteria 15659
197 Ga0081538_10014822 3300005981 Bacteria 6077
198 Ga0081540_1000399 3300005983 Bacteria 42998
199 Ga0081540_1026595 3300005983 Bacteria 3298
200 Ga0081539_10000166 3300005985 Bacteria 153758
201 Ga0075432_10103946 3300006058 Bacteria 1052
202 Ga0070716_100025651 3300006173 Bacteria 3147
203 Ga0070716_100328168 3300006173 Unclassified 1075
204 Ga0070712_100047362 3300006175 Bacteria 2975
205 Ga0097621_100512223 3300006237 Bacteria 1088
206 Ga0075428_100000152 3300006844 Bacteria 62598
207 Ga0075428_100004668 3300006844 Bacteria 15168
208 Ga0075428_100027190 3300006844 Bacteria 6334
209 Ga0075428_100052962 3300006844 Bacteria 4446
210 Ga0075428_100128809 3300006844 Bacteria 2753
211 Ga0075428_100202636 3300006844 Bacteria 2145
212 Ga0075428_100283102 3300006844 Bacteria 1784
213 Ga0075428_100603792 3300006844 Bacteria 1172
214 Ga0075428_100647650 3300006844 Bacteria 1127
215 Ga0075430_100000041 3300006846 Bacteria 66920
216 Ga0075430_100002647 3300006846 Bacteria 14931
217 Ga0075430_100018919 3300006846 Bacteria 5860
218 Ga0075430_100040129 3300006846 Bacteria 3962
219 Ga0075431_100000843 3300006847 Bacteria 26867
220 Ga0075431_100004971 3300006847 Bacteria 13086
221 Ga0075431_100020335 3300006847 Bacteria 6781
222 Ga0075431_100037842 3300006847 Bacteria 4968
223 Ga0075431_100058936 3300006847 Bacteria 3962
224 Ga0075431_100070827 3300006847 Bacteria 3598
225 Ga0075431_100081642 3300006847 Bacteria 3338
226 Ga0075431_100131885 3300006847 Bacteria 2577
227 Ga0075431_100152046 3300006847 Bacteria 2383
228 Ga0075431_100350585 3300006847 Bacteria 1484
229 Ga0075431_100612958 3300006847 Bacteria 1071
230 Ga0075431_100703762 3300006847 Bacteria 988
231 Ga0075433_10001757 3300006852 Bacteria 16204
232 Ga0075433_10002879 3300006852 Bacteria 13188
233 Ga0075433_10003747 3300006852 Bacteria 11764
234 Ga0075433_10029217 3300006852 Bacteria 4694
235 Ga0075433_10037129 3300006852 Bacteria 4201
236 Ga0075433_10058265 3300006852 Bacteria 3378
237 Ga0075433_10073609 3300006852 Bacteria 3005
238 Ga0075433_10091217 3300006852 Bacteria 2693
239 Ga0075433_10162792 3300006852 Bacteria 1986
240 Ga0075433_10340614 3300006852 Bacteria 1325
241 Ga0075433_10350716 3300006852 Bacteria 1304
242 Ga0075433_10491415 3300006852 Bacteria 1081
243 Ga0075433_10527352 3300006852 Bacteria 1039
244 Ga0075434_100000039 3300006871 Bacteria 59823
245 Ga0075434_100037154 3300006871 Bacteria 4820
246 Ga0075434_100039045 3300006871 Bacteria 4704
247 Ga0075434_100061612 3300006871 Bacteria 3733
248 Ga0075434_100094094 3300006871 Bacteria 3001
249 Ga0075434_100107567 3300006871 Bacteria 2799
250 Ga0075434_100116726 3300006871 Bacteria 2682
251 Ga0075434_100133056 3300006871 Bacteria 2506
252 Ga0075434_100148452 3300006871 Bacteria 2364
253 Ga0075434_100152398 3300006871 Bacteria 2332
254 Ga0075434_100222813 3300006871 Bacteria 1906
255 Ga0075434_100425189 3300006871 Bacteria 1349
256 Ga0075434_100440134 3300006871 Bacteria 1325
257 Ga0075429_100000211 3300006880 Bacteria 39122
258 Ga0075429_100015539 3300006880 Bacteria 6595
259 Ga0075429_100059385 3300006880 Bacteria 3331
260 Ga0075429_100077471 3300006880 Bacteria 2897
261 Ga0075429_100204567 3300006880 Bacteria 1730
262 Ga0075429_100520564 3300006880 Bacteria 1042
263 Ga0075429_100525384 3300006880 Bacteria 1037
264 Ga0075429_100559076 3300006880 Bacteria 1003
265 Ga0075436_100002481 3300006914 Bacteria 12693
266 Ga0075436_100019494 3300006914 Bacteria 4649
267 Ga0075436_100068312 3300006914 Bacteria 2455
268 Ga0075436_100166447 3300006914 Bacteria 1556
269 Ga0075436_100245942 3300006914 Bacteria 1273
270 Ga0075436_100253306 3300006914 Bacteria 1254
271 Ga0075436_100554874 3300006914 Bacteria 843
272 Ga0097620_100000761 3300006931 Bacteria 32461
273 Ga0097620_100713690 3300006931 Bacteria 1093
274 Ga0075435_100000848 3300007076 Bacteria 19123
275 Ga0075435_100003328 3300007076 Bacteria 10903
276 Ga0075435_100007812 3300007076 Bacteria 7649
277 Ga0075435_100015153 3300007076 Bacteria 5788
278 Ga0075435_100030295 3300007076 Bacteria 4253
279 Ga0075435_100121005 3300007076 Bacteria 2184
280 Ga0075435_100137049 3300007076 Bacteria 2051
281 Ga0075435_100169677 3300007076 Bacteria 1840
282 Ga0075435_100371079 3300007076 Bacteria 1228
283 Ga0075435_100377865 3300007076 Bacteria 1217
284 Ga0099794_10000045 3300007265 Bacteria 49517
285 Ga0099794_10000416 3300007265 Bacteria 14258
286 Ga0099794_10006529 3300007265 Bacteria 4732
287 Ga0099794_10011392 3300007265 Bacteria 3806
288 Ga0099794_10018378 3300007265 Bacteria 3134
289 Ga0099795_10067768 3300007788 Bacteria 1340
290 Ga0111539_10000819 3300009094 Bacteria 40336
291 Ga0111539_10001430 3300009094 Bacteria 31850
292 Ga0111539_10025794 3300009094 Bacteria 7198
293 Ga0111539_10130470 3300009094 Bacteria 2943
294 Ga0111539_10148555 3300009094 Bacteria 2744
295 Ga0111539_11045625 3300009094 Bacteria 949
296 Ga0114129_10000893 3300009147 Bacteria 38856
297 Ga0114129_10001132 3300009147 Bacteria 35229
298 Ga0114129_10003438 3300009147 Bacteria 22264
299 Ga0114129_10007065 3300009147 Bacteria 15978
300 Ga0114129_10010167 3300009147 Bacteria 13415
301 Ga0114129_10017689 3300009147 Bacteria 10148
302 Ga0114129_10029409 3300009147 Bacteria 7783
303 Ga0114129_10036473 3300009147 Bacteria 6941
304 Ga0114129_10038289 3300009147 Bacteria 6765
305 Ga0114129_10043861 3300009147 Bacteria 6293
306 Ga0114129_10195813 3300009147 Bacteria 2741
307 Ga0114129_10208468 3300009147 Bacteria 2643
308 Ga0114129_10208471 3300009147 Bacteria 2643
309 Ga0114129_10263990 3300009147 Bacteria 2306
310 Ga0114129_10266876 3300009147 Bacteria 2291
311 Ga0114129_10271339 3300009147 Bacteria 2269
312 Ga0114129_10296616 3300009147 Bacteria 2156
313 Ga0114129_10568106 3300009147 Bacteria 1473
314 Ga0114129_10620044 3300009147 Bacteria 1399
315 Ga0105243_10095040 3300009148 Bacteria 2462
316 Ga0105241_10001068 3300009174 Bacteria 20901
317 Ga0105242_10090100 3300009176 Bacteria 2579
318 Ga0105242_10125954 3300009176 Bacteria 2205
319 Ga0105237_10377535 3300009545 Bacteria 1422
320 Ga0105249_10249389 3300009553 Bacteria 1759
321 Ga0105246_10013128 3300011119 Bacteria 5185
322 Ga0157373_10001828 3300013100 Bacteria 16201
323 Ga0157369_10007014 3300013105 Bacteria 12999
324 Ga0157378_10078223 3300013297 Bacteria 2983
325 Ga0157378_10153240 3300013297 Bacteria 2149
326 Ga0163162_10056086 3300013306 Bacteria 3969
327 Ga0157372_10003186 3300013307 Bacteria 17702
328 Ga0157372_10238084 3300013307 Bacteria 2111
329 Ga0157375_10123673 3300013308 Bacteria 2700
330 Ga0157375_10262943 3300013308 Bacteria 1887
331 Ga0157375_10320133 3300013308 Bacteria 1715
332 Ga0163163_10012442 3300014325 Bacteria 7751
333 Ga0182007_10025791 3300015262 Bacteria 2044
334 Ga0163161_10219370 3300017792 Bacteria 1472
335 Ga0207653_10006330 3300025885 Bacteria 3693
336 Ga0207653_10007194 3300025885 Bacteria 3472
337 Ga0207653_10007898 3300025885 Bacteria 3316
338 Ga0207653_10012165 3300025885 Bacteria 2687
339 Ga0207685_10255064 3300025905 Bacteria 850
340 Ga0207645_10000614 3300025907 Bacteria 29540
341 Ga0207645_10010451 3300025907 Bacteria 6371
342 Ga0207643_10000700 3300025908 Bacteria 20877
343 Ga0207684_10000210 3300025910 Bacteria 90345
344 Ga0207684_10000501 3300025910 Bacteria 49523
345 Ga0207684_10003653 3300025910 Bacteria 14949
346 Ga0207684_10013924 3300025910 Bacteria 6948
347 Ga0207684_10026064 3300025910 Bacteria 4983
348 Ga0207684_10028378 3300025910 Bacteria 4768
349 Ga0207684_10030235 3300025910 Bacteria 4612
350 Ga0207684_10039843 3300025910 Bacteria 3983
351 Ga0207684_10040544 3300025910 Bacteria 3947
352 Ga0207684_10048382 3300025910 Bacteria 3606
353 Ga0207684_10080611 3300025910 Bacteria 2769
354 Ga0207684_10120195 3300025910 Bacteria 2252
355 Ga0207684_10154574 3300025910 Bacteria 1974
356 Ga0207684_10157339 3300025910 Bacteria 1956
357 Ga0207684_10205703 3300025910 Bacteria 1698
358 Ga0207654_10002800 3300025911 Bacteria 8863
359 Ga0207707_10002555 3300025912 Bacteria 16320
360 Ga0207695_10328407 3300025913 Bacteria 1418
361 Ga0207671_10292043 3300025914 Bacteria 1287
362 Ga0207693_10264978 3300025915 Bacteria 1347
363 Ga0207663_10080759 3300025916 Bacteria 2127
364 Ga0207663_10247390 3300025916 Bacteria 1310
365 Ga0207660_10000499 3300025917 Bacteria 26138
366 Ga0207662_10295051 3300025918 Bacteria 1076
367 Ga0207657_10002105 3300025919 Bacteria 21524
368 Ga0207649_10002110 3300025920 Bacteria 11274
369 Ga0207649_10843128 3300025920 Bacteria 717
370 Ga0207652_10000948 3300025921 Bacteria 27240
371 Ga0207646_10002368 3300025922 Bacteria 22281
372 Ga0207646_10004720 3300025922 Bacteria 14680
373 Ga0207646_10006234 3300025922 Bacteria 12393
374 Ga0207646_10009752 3300025922 Bacteria 9461
375 Ga0207646_10014448 3300025922 Bacteria 7497
376 Ga0207646_10017830 3300025922 Bacteria 6632
377 Ga0207646_10023294 3300025922 Bacteria 5690
378 Ga0207646_10033747 3300025922 Bacteria 4627
379 Ga0207646_10038895 3300025922 Bacteria 4281
380 Ga0207646_10051283 3300025922 Bacteria 3692
381 Ga0207646_10053289 3300025922 Bacteria 3619
382 Ga0207646_10239777 3300025922 Bacteria 1638
383 Ga0207646_10302319 3300025922 Bacteria 1445
384 Ga0207681_10059207 3300025923 Bacteria 2625
385 Ga0207681_10176262 3300025923 Bacteria 1625
386 Ga0207681_10189724 3300025923 Bacteria 1572
387 Ga0207650_10010479 3300025925 Bacteria 6357
388 Ga0207700_10059142 3300025928 Bacteria 2898
389 Ga0207644_10073970 3300025931 Bacteria 2500
390 Ga0207690_10018945 3300025932 Bacteria 4225
391 Ga0207706_10008077 3300025933 Bacteria 9712
392 Ga0207706_10030704 3300025933 Bacteria 4792
393 Ga0207706_10556263 3300025933 Bacteria 987
394 Ga0207686_10145590 3300025934 Bacteria 1643
395 Ga0207686_10189891 3300025934 Bacteria 1464
396 Ga0207709_10011881 3300025935 Bacteria 4804
397 Ga0207709_10299694 3300025935 Bacteria 1195
398 Ga0207670_10111569 3300025936 Bacteria 1972
399 Ga0207670_10167701 3300025936 Bacteria 1644
400 Ga0207670_10350285 3300025936 Bacteria 1169
401 Ga0207704_10072202 3300025938 Bacteria 2193
402 Ga0207665_10043217 3300025939 Bacteria 3013
403 Ga0207691_10036994 3300025940 Bacteria 4521
404 Ga0207691_10045678 3300025940 Bacteria 4025
405 Ga0207691_10166531 3300025940 Bacteria 1931
406 Ga0207711_10141826 3300025941 Bacteria 2163
407 Ga0207711_10729179 3300025941 Bacteria 924
408 Ga0207689_10000767 3300025942 Bacteria 30831
409 Ga0207689_10033871 3300025942 Bacteria 4243
410 Ga0207689_10550558 3300025942 Bacteria 969
411 Ga0207661_10017544 3300025944 Bacteria 5300
412 Ga0207679_10000646 3300025945 Bacteria 23265
413 Ga0207679_10099124 3300025945 Bacteria 2274
414 Ga0207667_10000470 3300025949 Bacteria 53903
415 Ga0207712_10041729 3300025961 Bacteria 3155
416 Ga0207712_10052936 3300025961 Bacteria 2846
417 Ga0207712_10095312 3300025961 Bacteria 2200
418 Ga0207712_10201416 3300025961 Bacteria 1579
419 Ga0207668_10112906 3300025972 Bacteria 2042
420 Ga0207668_10703980 3300025972 Bacteria 888
421 Ga0207640_10001767 3300025981 Bacteria 11602
422 Ga0207639_10002607 3300026041 Bacteria 12094
423 Ga0207678_10059576 3300026067 Bacteria 3285
424 Ga0207708_10061247 3300026075 Bacteria 2873
425 Ga0207708_10204487 3300026075 Bacteria 1576
426 Ga0207708_10430493 3300026075 Bacteria 1096
427 Ga0207702_10017167 3300026078 Bacteria 5987
428 Ga0207648_10005154 3300026089 Bacteria 13233
429 Ga0207676_10052896 3300026095 Bacteria 3176
430 Ga0207674_10003153 3300026116 Bacteria 20327
431 Ga0207674_10024269 3300026116 Bacteria 6482
432 Ga0207675_100051938 3300026118 Bacteria 3825
433 Ga0207698_10029791 3300026142 Bacteria 3915
434 Ga0209969_1002635 3300027360 Bacteria 2483
435 Ga0209995_1001550 3300027471 Bacteria 3561
436 Ga0209968_1001578 3300027526 Bacteria 3452
437 Ga0209999_1003121 3300027543 Bacteria 2956
438 Ga0209970_1000442 3300027614 Bacteria 7075
439 Ga0209588_1000070 3300027671 Bacteria 34509
440 Ga0209588_1001462 3300027671 Bacteria 6178
441 Ga0209588_1026226 3300027671 Bacteria 1848
442 Ga0209971_1000004 3300027682 Bacteria 110041
443 Ga0209966_1000015 3300027695 Bacteria 78092
444 Ga0209998_10000001 3300027717 Bacteria 203589
445 Ga0209974_10006197 3300027876 Bacteria 4187
446 Ga0209974_10069149 3300027876 Bacteria 1203
447 Ga0207428_10000009 3300027907 Bacteria 410565
448 Ga0207428_10021463 3300027907 Bacteria 5468
449 Ga0207428_10063192 3300027907 Bacteria 2925
450 Ga0207428_10339261 3300027907 Bacteria 1107
451 Ga0268265_10013655 3300028380 Bacteria 5525
452 Ga0268265_10024495 3300028380 Bacteria 4270
453 Ga0268264_10035599 3300028381 Bacteria 4098
454 Ga0268264_10117519 3300028381 Bacteria 2339
455 Ga0268264_10131179 3300028381 Bacteria 2222
456 Ga0268264_10293292 3300028381 Bacteria 1528
457 Ga0307408_100019824 3300031548 Bacteria 4530
458 Ga0307408_100026208 3300031548 Bacteria 4001
459 Ga0307406_10158210 3300031901 Unclassified 1625
460 Ga0307407_10050751 3300031903 Bacteria 2375
461 Ga0373948_0014391 3300034817 Bacteria 1441
462 Ga0373950_0005438 3300034818 Bacteria 1904
463 Ga0373940_0016704 3300035088 Bacteria 1821
464 Ga0373949_0055748 3300035090 Bacteria 1006
465 Ga0373951_0008506 3300035091 Bacteria 2314
466 Ga0373932_0027721 3300035112 Bacteria 1552
467 Ga0373954_0222508 3300035118 Bacteria 928
468 Ga0373961_0034887 3300035241 Bacteria 1424
469 Ga0373931_0014469 3300035691 Bacteria 3857
470 Ga0373947_0064356 3300035725 Bacteria 2236
471 Ga0373937_0269714 3300036401 Bacteria 1606
472 Ga0395899_0019861 3300037312 Bacteria 5099
473 Ga0395900_0005650 3300037418 Bacteria 13080
474 Ga0395900_0037337 3300037418 Bacteria 5010
475 Ga0395898_0020922 3300037466 Bacteria 6639
476 Ga0395905_0149538 3300037471 Bacteria 2197
477 Ga0395901_0006681 3300038443 Bacteria 11660
478 Ga0436365_1696103 3300039437 Bacteria 2712
479 Ga0439441_026288 3300042001 Bacteria 1104
480 Ga0439448_0009412 3300042005 Bacteria 2879
481 Ga0439448_0049438 3300042005 Bacteria 1374
482 Ga0439448_0086756 3300042005 Bacteria 1055
483 Ga0450889_002193 3300042144 Bacteria 1961
484 Ga0439458_0042809 3300042157 Bacteria 1103
485 Ga0439435_0035498 3300042436 Unclassified 1375
486 Ga0439459_0002679 3300042438 Bacteria 2764
487 Ga0439464_0005986 3300042439 Bacteria 3162
488 Ga0439460_0000590 3300042461 Bacteria 7982
489 Ga0451577_0011703 3300042876 Bacteria 8283
490 Ga0451577_0021415 3300042876 Bacteria 5917
491 Ga0451577_0089971 3300042876 Bacteria 2739
492 Ga0451577_0251137 3300042876 Bacteria 1601
493 Ga0453683_0011475 3300044673 Bacteria 5837
494 Ga0453683_0134075 3300044673 Bacteria 1561
495 Ga0453684_0101013 3300044712 Bacteria 3530
496 Ga0453684_0968622 3300044712 Bacteria 907
497 Ga0451576_0009605 3300045051 Bacteria 11192
498 Ga0451576_0033263 3300045051 Bacteria 5480
499 Ga0451576_0038333 3300045051 Bacteria 5072
500 Ga0451576_0074775 3300045051 Bacteria 3525
501 Ga0451576_0088007 3300045051 Bacteria 3230
502 Ga0451576_0170202 3300045051 Bacteria 2274
503 Ga0451576_0228767 3300045051 Bacteria 1942
504 Ga0451576_0872527 3300045051 Bacteria 944
505 Ga0495592_0124144 3300046454 Bacteria 1813
506 Ga0495638_0083816 3300046460 Bacteria 1930
507 Ga0495651_0042919 3300046462 Bacteria 3509
508 Ga0495580_0004222 3300046472 Bacteria 12081
509 Ga0495580_0045355 3300046472 Bacteria 3123
510 Ga0495580_0099467 3300046472 Bacteria 2023
511 Ga0495584_0098445 3300046491 Bacteria 1478
512 Ga0495618_0014538 3300046514 Bacteria 4798
513 Ga0495587_0021055 3300046536 Bacteria 4022
514 Ga0495667_0027529 3300046559 Bacteria 3830
515 Ga0495634_0024721 3300046642 Bacteria 4211
516 Ga0495669_0106293 3300046684 Bacteria 1307
517 Ga0495669_0230322 3300046684 Bacteria 889
518 Ga0495604_0058153 3300047317 Bacteria 2970
519 Ga0495636_0014957 3300047318 Bacteria 3090
520 Ga0495674_0070540 3300047319 Bacteria 3019
521 Ga0495676_0198178 3300047321 Bacteria 1397
522 Ga0495680_0115880 3300047322 Bacteria 1982
523 Ga0495677_0143881 3300047445 Bacteria 916
524 Ga0495684_0469855 3300047471 Bacteria 870
525 Ga0496101_0151062 3300048904 Bacteria 1777
526 Ga0496102_0025370 3300048905 Bacteria 5277
527 Ga0496102_0272190 3300048905 Bacteria 1597
528 Ga0496103_0112915 3300048906 Bacteria 1727
529 Ga0496103_0202035 3300048906 Bacteria 1278
530 Ga0496106_0075633 3300048909 Bacteria 2580
531 Ga0496106_0136397 3300048909 Bacteria 1928
532 Ga0496106_0460764 3300048909 Bacteria 1021
533 Ga0496107_0406265 3300048910 Bacteria 1013
534 Ga0496108_0044945 3300048911 Bacteria 3688
535 Ga0496108_0350629 3300048911 Bacteria 1288
536 Ga0496109_0229881 3300048912 Bacteria 1745
537 Ga0496114_0136697 3300048917 Bacteria 2120
538 Ga0501031_0373697 3300049568 Bacteria 922
539 Ga0501032_0451900 3300049569 Bacteria 823
540 Ga0501033_0066200 3300049570 Bacteria 2657
541 Ga0501033_0102957 3300049570 Bacteria 2082
542 Ga0501036_0014540 3300049572 Bacteria 6555
543 Ga0501036_0027049 3300049572 Bacteria 4847
544 Ga0501036_0027886 3300049572 Bacteria 4774
545 Ga0501036_0042189 3300049572 Bacteria 3863
546 Ga0501036_0183612 3300049572 Bacteria 1760
547 Ga0501036_0224011 3300049572 Bacteria 1579
548 Ga0501036_0238825 3300049572 Bacteria 1524
549 Ga0501037_0106827 3300049573 Bacteria 2017
550 Ga0501037_0209358 3300049573 Bacteria 1376
551 Ga0501038_0130214 3300049574 Bacteria 2066
552 Ga0501038_0152696 3300049574 Bacteria 1882
553 Ga0501038_0221516 3300049574 Bacteria 1509
554 Ga0501038_0230047 3300049574 Bacteria 1476
555 Ga0501038_0272327 3300049574 Bacteria 1335
556 Ga0501038_0638215 3300049574 Bacteria 803
557 Ga0501039_0000562 3300049575 Bacteria 26873
558 Ga0501039_0003884 3300049575 Bacteria 11216
559 Ga0501039_0023100 3300049575 Bacteria 4771
560 Ga0501039_0026304 3300049575 Bacteria 4471
561 Ga0501039_0027727 3300049575 Bacteria 4356
562 Ga0501039_0096022 3300049575 Bacteria 2311
563 Ga0501039_0392298 3300049575 Bacteria 1090
564 Ga0501040_0000512 3300049576 Bacteria 23238
565 Ga0501040_0003684 3300049576 Bacteria 9930
566 Ga0501040_0003922 3300049576 Bacteria 9655
567 Ga0501040_0008914 3300049576 Bacteria 6524
568 Ga0501040_0021944 3300049576 Bacteria 4269
569 Ga0501040_0025724 3300049576 Bacteria 3959
570 Ga0501040_0038018 3300049576 Bacteria 3272
571 Ga0501040_0057131 3300049576 Bacteria 2679
572 Ga0501040_0113353 3300049576 Bacteria 1897
573 Ga0501040_0357479 3300049576 Bacteria 1046
574 Ga0501041_0001135 3300049577 Bacteria 14583
575 Ga0501041_0002180 3300049577 Bacteria 11057
576 Ga0501041_0002272 3300049577 Bacteria 10870
577 Ga0501041_0014344 3300049577 Bacteria 4705
578 Ga0501041_0035423 3300049577 Bacteria 3023
579 Ga0501041_0057509 3300049577 Bacteria 2378
580 Ga0501041_0118683 3300049577 Bacteria 1643
581 Ga0501041_0523685 3300049577 Bacteria 755
582 Ga0501042_0007008 3300049578 Bacteria 7359
583 Ga0501042_0008135 3300049578 Bacteria 6908
584 Ga0501042_0011519 3300049578 Bacteria 5972
585 Ga0501042_0017679 3300049578 Bacteria 4922
586 Ga0501042_0034968 3300049578 Bacteria 3565
587 Ga0501042_0039253 3300049578 Bacteria 3364
588 Ga0501042_0116999 3300049578 Bacteria 1919
589 Ga0501042_0146229 3300049578 Bacteria 1704
590 Ga0501042_0235026 3300049578 Bacteria 1322
591 Ga0501042_0256057 3300049578 Bacteria 1263
592 Ga0501043_0011026 3300049579 Bacteria 7081
593 Ga0501043_0063621 3300049579 Bacteria 2897
594 Ga0501043_0067185 3300049579 Bacteria 2816
595 Ga0501043_0164774 3300049579 Bacteria 1731
596 Ga0501043_0275374 3300049579 Bacteria 1291
597 Ga0501046_0000635 3300049580 Bacteria 34419
598 Ga0501046_0001204 3300049580 Bacteria 25159
599 Ga0501046_0090738 3300049580 Bacteria 2351
600 Ga0501046_0105005 3300049580 Bacteria 2164
601 Ga0501046_0248649 3300049580 Bacteria 1309
602 Ga0501046_0388972 3300049580 Bacteria 1008
603 Ga0501046_0402614 3300049580 Bacteria 988
604 Ga0501047_0181834 3300049581 Bacteria 1969
605 Ga0501048_0003577 3300049582 Bacteria 11827
606 Ga0501048_0009473 3300049582 Bacteria 7311
607 Ga0501048_0020250 3300049582 Bacteria 4875
608 Ga0501048_0024785 3300049582 Bacteria 4376
609 Ga0501048_0054165 3300049582 Bacteria 2850
610 Ga0501048_0063248 3300049582 Bacteria 2618
611 Ga0501048_0082762 3300049582 Bacteria 2264
612 Ga0501048_0194375 3300049582 Bacteria 1438
613 Ga0501067_0048580 3300049583 Bacteria 2353
614 Ga0501067_0174411 3300049583 Bacteria 1198
615 Ga0501068_0032269 3300049584 Bacteria 3114
616 Ga0501068_0060577 3300049584 Bacteria 2298
617 Ga0501068_0095206 3300049584 Bacteria 1841
618 Ga0501068_0195767 3300049584 Bacteria 1281
619 Ga0501068_0224908 3300049584 Bacteria 1193
620 Ga0501068_0294227 3300049584 Bacteria 1039
621 Ga0501068_0630809 3300049584 Bacteria 699
622 Ga0501069_0189990 3300049585 Bacteria 1188
623 Ga0501070_0024182 3300049586 Bacteria 5094
624 Ga0501071_0001178 3300049587 Bacteria 14711
625 Ga0501071_0018003 3300049587 Bacteria 4885
626 Ga0501071_0068738 3300049587 Bacteria 2578
627 Ga0501071_0246390 3300049587 Bacteria 1348
628 Ga0501071_0396530 3300049587 Bacteria 1053
629 Ga0501071_0551556 3300049587 Bacteria 885
630 Ga0501072_0000521 3300049588 Bacteria 27673
631 Ga0501072_0001143 3300049588 Bacteria 19725
632 Ga0501072_0018452 3300049588 Bacteria 5373
633 Ga0501072_0019267 3300049588 Bacteria 5272
634 Ga0501072_0021539 3300049588 Bacteria 4999
635 Ga0501072_0026340 3300049588 Bacteria 4534
636 Ga0501072_0029170 3300049588 Bacteria 4308
637 Ga0501072_0066588 3300049588 Bacteria 2841
638 Ga0501072_0222482 3300049588 Bacteria 1504
639 Ga0501072_0262128 3300049588 Bacteria 1376
640 Ga0501072_0559085 3300049588 Bacteria 903
641 Ga0501073_0140751 3300049589 Bacteria 1672
642 Ga0501074_0004010 3300049590 Bacteria 10496
643 Ga0501074_0007595 3300049590 Bacteria 7847
644 Ga0501074_0027490 3300049590 Bacteria 4125
645 Ga0501074_0075815 3300049590 Bacteria 2414
646 Ga0501074_0222360 3300049590 Bacteria 1344
647 Ga0501074_0332738 3300049590 Bacteria 1078
648 Ga0501075_0001036 3300049591 Bacteria 17839
649 Ga0501075_0005529 3300049591 Bacteria 8645
650 Ga0501075_0006999 3300049591 Bacteria 7791
651 Ga0501075_0017595 3300049591 Bacteria 5162
652 Ga0501075_0024746 3300049591 Bacteria 4407
653 Ga0501075_0053215 3300049591 Bacteria 3045
654 Ga0501075_0061271 3300049591 Bacteria 2835
655 Ga0501075_0068415 3300049591 Bacteria 2683
656 Ga0501075_0095821 3300049591 Bacteria 2252
657 Ga0501075_0152069 3300049591 Bacteria 1764
658 Ga0501075_0492968 3300049591 Bacteria 935
659 Ga0501076_0000094 3300049592 Bacteria 47646
660 Ga0501076_0000896 3300049592 Bacteria 19352
661 Ga0501076_0004970 3300049592 Bacteria 9520
662 Ga0501076_0028474 3300049592 Bacteria 4338
663 Ga0501076_0073869 3300049592 Bacteria 2730
664 Ga0501076_0076659 3300049592 Bacteria 2681
665 Ga0501076_0173577 3300049592 Bacteria 1757
666 Ga0501076_0187610 3300049592 Bacteria 1687
667 Ga0501076_0230436 3300049592 Bacteria 1514
668 Ga0501076_0449309 3300049592 Bacteria 1061
669 Ga0501076_0532661 3300049592 Bacteria 968
670 Ga0501077_0000655 3300049593 Bacteria 20955
671 Ga0501077_0018584 3300049593 Bacteria 4396
672 Ga0501077_0020193 3300049593 Bacteria 4218
673 Ga0501077_0042893 3300049593 Bacteria 2875
674 Ga0501077_0103819 3300049593 Bacteria 1801
675 Ga0501077_0282518 3300049593 Bacteria 1057
676 Ga0501077_0311198 3300049593 Bacteria 1004
677 Ga0501079_0000373 3300049741 Bacteria 28806
678 Ga0501079_0000778 3300049741 Bacteria 21829
679 Ga0501079_0001373 3300049741 Bacteria 17140
680 Ga0501079_0001699 3300049741 Bacteria 15679
681 Ga0501079_0003475 3300049741 Bacteria 11582
682 Ga0501079_0018029 3300049741 Bacteria 5391
683 Ga0501079_0048864 3300049741 Bacteria 3265
684 Ga0501079_0055593 3300049741 Bacteria 3054
685 Ga0501079_0099822 3300049741 Bacteria 2250
686 Ga0501079_0111117 3300049741 Bacteria 2130
687 Ga0501079_0258980 3300049741 Bacteria 1360
688 Ga0501079_0421059 3300049741 Bacteria 1048
689 Ga0501079_0603151 3300049741 Bacteria 864
690 Ga0501080_0022428 3300049742 Bacteria 5849
691 Ga0501080_0030962 3300049742 Bacteria 4986
692 Ga0501080_0032064 3300049742 Bacteria 4899
693 Ga0501080_0085080 3300049742 Bacteria 2938
694 Ga0501080_0099938 3300049742 Bacteria 2692
695 Ga0501080_0105030 3300049742 Bacteria 2619
696 Ga0501080_0226989 3300049742 Bacteria 1707
697 Ga0501080_0402040 3300049742 Bacteria 1232
698 Ga0501080_0893206 3300049742 Bacteria 775
699 Ga0501081_0001477 3300049743 Bacteria 14407
700 Ga0501081_0001640 3300049743 Bacteria 13858
701 Ga0501081_0004173 3300049743 Bacteria 9268
702 Ga0501081_0004683 3300049743 Bacteria 8794
703 Ga0501081_0008730 3300049743 Bacteria 6587
704 Ga0501081_0010344 3300049743 Bacteria 6090
705 Ga0501081_0047644 3300049743 Bacteria 2949
706 Ga0501081_0069442 3300049743 Bacteria 2454
707 Ga0501081_0086965 3300049743 Bacteria 2195
708 Ga0501081_0116544 3300049743 Bacteria 1899
709 Ga0501081_0122830 3300049743 Bacteria 1851
710 Ga0501081_0218948 3300049743 Bacteria 1384
711 Ga0501083_0076718 3300049744 Bacteria 2218
712 Ga0501083_0115795 3300049744 Bacteria 1760
713 Ga0501083_0179167 3300049744 Bacteria 1384
714 Ga0501083_0195006 3300049744 Bacteria 1322
715 Ga0501035_0005132 3300049822 Bacteria 12390
716 Ga0501035_0097759 3300049822 Bacteria 2578
717 Ga0501035_0338075 3300049822 Bacteria 1262
718 Ga0501045_0007642 3300049824 Bacteria 7516
719 Ga0501045_0009114 3300049824 Bacteria 6932
720 Ga0501045_0011087 3300049824 Bacteria 6316
721 Ga0501045_0016272 3300049824 Bacteria 5281
722 Ga0501045_0018892 3300049824 Bacteria 4908
723 Ga0501045_0052226 3300049824 Bacteria 2984
724 Ga0501045_0098764 3300049824 Bacteria 2160
725 Ga0501045_0120684 3300049824 Bacteria 1946
726 Ga0501045_0128030 3300049824 Bacteria 1887
727 nmdc:mga0yw44_5814_c3 3300050492 Bacteria 1839
728 nmdc:mga05p37_1023831_c1 3300050507 Bacteria 874
729 nmdc:mga05p37_120563_c1 3300050507 Bacteria 2236
730 nmdc:mga05p37_133546_c1 3300050507 Bacteria 3045
731 nmdc:mga05p37_1381_c1 3300050507 Bacteria 28239
732 nmdc:mga05p37_143057_c1 3300050507 Bacteria 2929
733 nmdc:mga05p37_164629_c1 3300050507 Bacteria 2707
734 nmdc:mga05p37_168555_c1 3300050507 Bacteria 2672
735 nmdc:mga05p37_21018_c1 3300050507 Bacteria 7899
736 nmdc:mga05p37_2162_c1 3300050507 Bacteria 22903
737 nmdc:mga05p37_224625_c1 3300050507 Bacteria 2265
738 nmdc:mga05p37_231122_c1 3300050507 Bacteria 2228
739 nmdc:mga05p37_2464_c1 3300050507 Bacteria 21531
740 nmdc:mga05p37_249496_c1 3300050507 Bacteria 2130
741 nmdc:mga05p37_31427_c1 3300050507 Bacteria 6484
742 nmdc:mga05p37_336923_c1 3300050507 Bacteria 1780
743 nmdc:mga05p37_359296_c1 3300050507 Bacteria 1713
744 nmdc:mga05p37_366_c1 3300050507 Bacteria 48604
745 nmdc:mga05p37_367117_c1 3300050507 Bacteria 1690
746 nmdc:mga05p37_629430_c1 3300050507 Bacteria 1206
747 nmdc:mga05p37_732747_c1 3300050507 Bacteria 1093
748 nmdc:mga05p37_8089_c1 3300050507 Bacteria 12428
749 nmdc:mga05p37_98363_c1 3300050507 Bacteria 3604
750 nmdc:mga09592_164717_c1 3300050508 Bacteria 1916
751 nmdc:mga09592_1725_c1 3300050508 Bacteria 17600
752 nmdc:mga09592_173386_c1 3300050508 Bacteria 1865
753 nmdc:mga09592_18434_c1 3300050508 Bacteria 5725
754 nmdc:mga09592_249166_c1 3300050508 Bacteria 1539
755 nmdc:mga09592_38119_c1 3300050508 Bacteria 4033
756 nmdc:mga09592_448165_c1 3300050508 Bacteria 1114
757 nmdc:mga09592_8064_c1 3300050508 Bacteria 8566
758 nmdc:mga09592_818_c1 3300050508 Bacteria 24062
759 nmdc:mga09592_914_c1 3300050508 Bacteria 23217
760 nmdc:mga0qj67_205_c1 3300050509 Bacteria 40007
761 nmdc:mga0qj67_4642_c1 3300050509 Bacteria 9968
762 nmdc:mga06r32_131537_c1 3300050510 Bacteria 2475
763 nmdc:mga06r32_134319_c1 3300050510 Bacteria 2449
764 nmdc:mga06r32_136815_c1 3300050510 Bacteria 2424
765 nmdc:mga06r32_138977_c1 3300050510 Bacteria 2405
766 nmdc:mga06r32_229313_c1 3300050510 Bacteria 1845
767 nmdc:mga06r32_253220_c1 3300050510 Bacteria 1748
768 nmdc:mga06r32_253642_c1 3300050510 Bacteria 1747
769 nmdc:mga06r32_3562_c1 3300050510 Bacteria 13905
770 nmdc:mga06r32_45249_c1 3300050510 Bacteria 4194
771 nmdc:mga06r32_57321_c1 3300050510 Bacteria 3741
772 nmdc:mga06r32_594061_c1 3300050510 Bacteria 1078
773 nmdc:mga06r32_6997_c1 3300050510 Bacteria 10153
774 nmdc:mga08y16_171_c1 3300050511 Bacteria 56769
775 nmdc:mga08y16_218695_c1 3300050511 Bacteria 1972
776 nmdc:mga08y16_259404_c1 3300050511 Bacteria 1795
777 nmdc:mga08y16_37123_c1 3300050511 Bacteria 5117
778 nmdc:mga08y16_457640_c1 3300050511 Bacteria 1301
779 nmdc:mga08y16_640986_c1 3300050511 Bacteria 1068
780 nmdc:mga0n895_108662_c1 3300050512 Bacteria 2789
781 nmdc:mga0n895_129888_c1 3300050512 Bacteria 2544
782 nmdc:mga0n895_194789_c1 3300050512 Bacteria 2058
783 nmdc:mga0n895_2038_c1 3300050512 Bacteria 15536
784 nmdc:mga0n895_3396_c1 3300050512 Bacteria 12821
785 nmdc:mga0n895_5973_c1 3300050512 Bacteria 10252
786 nmdc:mga0n895_66970_c1 3300050512 Bacteria 3556
787 nmdc:mga0n895_67129_c1 3300050512 Bacteria 3552
788 nmdc:mga0n895_7972_c1 3300050512 Bacteria 9133
789 nmdc:mga0n895_8083_c1 3300050512 Bacteria 9083
790 nmdc:mga0n895_84612_c1 3300050512 Bacteria 3165
791 nmdc:mga0rr50_106071_c1 3300050513 Bacteria 2216
792 nmdc:mga0rr50_1063_c1 3300050513 Bacteria 14934
793 nmdc:mga0rr50_1280_c1 3300050513 Bacteria 13707
794 nmdc:mga0rr50_130457_c1 3300050513 Bacteria 2012
795 nmdc:mga0rr50_185679_c1 3300050513 Bacteria 1702
796 nmdc:mga0rr50_263240_c1 3300050513 Bacteria 1435
797 nmdc:mga0rr50_36296_c1 3300050513 Bacteria 3549
798 nmdc:mga0rr50_43927_c1 3300050513 Bacteria 3274
799 nmdc:mga0rr50_4618_c1 3300050513 Bacteria 8114
800 nmdc:mga0rr50_4720_c1 3300050513 Bacteria 8035
801 nmdc:mga0rr50_640637_c1 3300050513 Bacteria 907
802 nmdc:mga0rr50_82903_c1 3300050513 Bacteria 2478
803 nmdc:mga08x19_137664_c1 3300050514 Bacteria 1647
804 nmdc:mga08x19_1897_c1 3300050514 Bacteria 12794
805 nmdc:mga08x19_200798_c1 3300050514 Bacteria 1367
806 nmdc:mga08x19_392527_c1 3300050514 Bacteria 973
807 nmdc:mga08x19_429323_c1 3300050514 Bacteria 929
808 nmdc:mga08x19_472548_c1 3300050514 Bacteria 884
809 nmdc:mga08x19_97738_c1 3300050514 Bacteria 1944
810 nmdc:mga0a205_101021_c1 3300050515 Bacteria 2783
811 nmdc:mga0a205_108414_c1 3300050515 Bacteria 2675
812 nmdc:mga0a205_12144_c1 3300050515 Bacteria 7962
813 nmdc:mga0a205_14365_c1 3300050515 Bacteria 3260
814 nmdc:mga0a205_147176_c1 3300050515 Bacteria 2256
815 nmdc:mga0a205_149671_c1 3300050515 Bacteria 2234
816 nmdc:mga0a205_15474_c1 3300050515 Bacteria 7131
817 nmdc:mga0a205_156726_c1 3300050515 Bacteria 2175
818 nmdc:mga0a205_1757_c1 3300050515 Bacteria 18760
819 nmdc:mga0a205_181429_c1 3300050515 Bacteria 1999
820 nmdc:mga0a205_230421_c1 3300050515 Bacteria 1736
821 nmdc:mga0a205_25514_c1 3300050515 Bacteria 5631
822 nmdc:mga0a205_263435_c1 3300050515 Bacteria 1601
823 nmdc:mga0a205_333693_c1 3300050515 Bacteria 1386
824 nmdc:mga0a205_49045_c1 3300050515 Bacteria 4075
825 nmdc:mga0a205_75553_c1 3300050515 Bacteria 3256
826 nmdc:mga0a205_796_c1 3300050515 Bacteria 25603
827 Ga0495601_0003175 3300053077 Bacteria 9411
828 Ga0495655_0038862 3300053083 Bacteria 1203
829 Ga0495655_0101452 3300053083 Bacteria 853
830 Ga0495595_0026352 3300053084 Bacteria 2582
831 Ga0495619_0000968 3300053085 Bacteria 18820
832 Ga0500643_004510 3300053087 Bacteria 6263
833 Ga0500644_0000805 3300053088 Bacteria 10649
834 Ga0500651_0268704 3300053093 Bacteria 987
835 Ga0500566_0031163 3300053094 Bacteria 3110
836 Ga0500595_000002 3300053119 Bacteria 1074388
837 Ga0500616_0000002 3300053153 Bacteria 1611257
838 Ga0500645_000091 3300053730 Bacteria 70038
839 Ga0501084_0001038 3300054114 Bacteria 21597
840 Ga0501084_0004009 3300054114 Bacteria 11996
841 Ga0501084_0010215 3300054114 Bacteria 7766
842 Ga0501084_0012499 3300054114 Bacteria 7032
843 Ga0501084_0024310 3300054114 Bacteria 5053
844 Ga0501084_0042252 3300054114 Bacteria 3813
845 Ga0501084_0138250 3300054114 Bacteria 2051
846 Ga0501084_0209909 3300054114 Bacteria 1643
847 Ga0501084_0323916 3300054114 Bacteria 1302
848 Ga0501084_0572385 3300054114 Bacteria 954
849 Ga0590075_006550 3300059424 Bacteria 2760
850 Ga0501082_0000875 3300060353 Bacteria 26599
851 Ga0501082_0001216 3300060353 Bacteria 22625
852 Ga0501082_0001564 3300060353 Bacteria 20146
853 Ga0501082_0007803 3300060353 Bacteria 9236
854 Ga0501082_0010882 3300060353 Bacteria 7832
855 Ga0501082_0014047 3300060353 Bacteria 6888
856 Ga0501082_0063759 3300060353 Bacteria 3173
857 Ga0501082_0090151 3300060353 Bacteria 2648
858 Ga0501082_0138481 3300060353 Bacteria 2112
859 Ga0501082_0141361 3300060353 Bacteria 2089
860 Ga0501082_0195969 3300060353 Bacteria 1757
861 Ga0530510_0000078 3300061734 Bacteria 50426
862 Ga0530510_0001713 3300061734 Bacteria 14899
863 Ga0530510_0015855 3300061734 Bacteria 5328
864 Ga0530510_0018021 3300061734 Bacteria 5005
865 Ga0530510_0027608 3300061734 Bacteria 4067
866 Ga0530510_0030054 3300061734 Bacteria 3901
867 Ga0530510_0062761 3300061734 Bacteria 2689
868 Ga0530510_0072335 3300061734 Bacteria 2502
869 Ga0530510_0105315 3300061734 Bacteria 2064
870 Ga0530510_0178971 3300061734 Bacteria 1572
871 Ga0530510_0366309 3300061734 Bacteria 1084
872 Ga0075428_100000368
873 JGI25406J46586_10008341
874 JGI25404J52841_10000575
875 Ga0065715_10201802
876 Ga0065707_10009733
877 Ga0070676_10000758
878 Ga0070676_10016029
879 Ga0070683_100021410
880 Ga0070690_100069040
881 Ga0070690_100095137
882 Ga0070690_100315404
883 Ga0070670_100009409
884 Ga0068869_100001552
885 Ga0068869_100005186
886 Ga0068869_100020585
887 Ga0070680_100002089
888 Ga0070682_100000097
889 Ga0070660_100001696
890 Ga0070689_100190433
891 Ga0070689_100212837
892 Ga0070691_10007391
893 Ga0070691_10013719
894 Ga0070691_10032011
895 Ga0070687_100278052
896 Ga0070687_100315217
897 Ga0070661_100006408
898 Ga0070692_10000112
899 Ga0070692_10024279
900 Ga0070692_10093410
901 Ga0070668_100085177
902 Ga0070669_100023225
903 Ga0070669_100055167
904 Ga0070669_100140726
905 Ga0070659_100002126
906 Ga0070703_10010411
907 Ga0070703_10062555
908 Ga0070703_10070145
909 Ga0070709_10077497
910 Ga0070701_10017757
911 Ga0070701_10018570
912 Ga0070701_10059735
913 Ga0070711_100036296
914 Ga0070711_100042860
915 Ga0070711_100516546
916 Ga0070705_100001051
917 Ga0070705_100021158
918 Ga0070705_100370409
919 Ga0070705_100511448
920 Ga0070700_100061709
921 Ga0070700_100081904
922 Ga0070700_100627574
923 Ga0070694_100001299
924 Ga0070694_100096921
925 Ga0070708_100000615
926 Ga0070708_100001108
927 Ga0070708_100109925
928 Ga0070708_100111190
929 Ga0070708_100126090
930 Ga0070708_100128258
931 Ga0070708_100135878
932 Ga0070708_100194520
933 Ga0070708_100241093
934 Ga0070708_100596267
935 Ga0070663_100040180
936 Ga0070678_100128620
937 Ga0070662_100053653
938 Ga0070681_10003551
939 Ga0070681_10147410
940 Ga0068867_100000768
941 Ga0068867_100100050
942 Ga0068867_100137411
943 Ga0070706_100000143
944 Ga0070706_100018242
945 Ga0070706_100028362
946 Ga0070706_100031226
947 Ga0070706_100074899
948 Ga0070706_100132266
949 Ga0070706_100161918
950 Ga0070706_100276403
951 Ga0070706_100381879
952 Ga0070706_100387169
953 Ga0070706_100506934
954 Ga0070706_100511824
955 Ga0070706_100730995
956 Ga0070707_100005455
957 Ga0070707_100010447
958 Ga0070707_100010785
959 Ga0070707_100011685
960 Ga0070707_100027721
961 Ga0070707_100037620
962 Ga0070707_100048386
963 Ga0070707_100073403
964 Ga0070707_100086546
965 Ga0070707_100139934
966 Ga0070707_100319632
967 Ga0070707_100354695
968 Ga0070707_100425954
969 Ga0070707_100496902
970 Ga0070707_100724599
971 Ga0070698_100000035
972 Ga0070698_100012124
973 Ga0070698_100029037
974 Ga0070698_100035730
975 Ga0070698_100200906
976 Ga0070698_100206680
977 Ga0070698_100360487
978 Ga0070698_100714163
979 Ga0070699_100006487
980 Ga0070699_100012792
981 Ga0070699_100016266
982 Ga0070699_100019832
983 Ga0070699_100022164
984 Ga0070699_100037412
985 Ga0070699_100072918
986 Ga0070699_100122124
987 Ga0070699_100170131
988 Ga0070699_100241895
989 Ga0070699_100335446
990 Ga0070699_100514854
991 Ga0070699_100605665
992 Ga0070679_100000407
993 Ga0070684_100342712
994 Ga0070697_100002321
995 Ga0070697_100002382
996 Ga0070697_100004162
997 Ga0070697_100005097
998 Ga0070697_100015492
999 Ga0070697_100023842
1000 Ga0070697_100054369
1001 Ga0070697_100061281
1002 Ga0070697_100090758
1003 Ga0070697_100099155
1004 Ga0070697_100149769
1005 Ga0070697_100168548
1006 Ga0070697_100212596
1007 Ga0070697_100218954
1008 Ga0070697_100256357
1009 Ga0070697_100334623
1010 Ga0070697_100346271
1011 Ga0070697_100353967
1012 Ga0070697_100426454
1013 Ga0070697_100552867
1014 Ga0070697_100594160
1015 Ga0068853_100002919
1016 Ga0070672_100007262
1017 Ga0070672_100044114
1018 Ga0070672_100157481
1019 Ga0070695_100000568
1020 Ga0070695_100001366
1021 Ga0070695_100003012
1022 Ga0070695_100040222
1023 Ga0070696_100000504
1024 Ga0070696_100006645
1025 Ga0070696_100075190
1026 Ga0070696_100302988
1027 Ga0070696_100392658
1028 Ga0070696_100432850
1029 Ga0070696_100578197
1030 Ga0070696_100620543
1031 Ga0070693_100000364
1032 Ga0070693_100036733
1033 Ga0070704_100002184
1034 Ga0070704_100138993
1035 Ga0070704_100303694
1036 Ga0070704_100888442
1037 Ga0068855_100005917
1038 Ga0070664_100000109
1039 Ga0070664_100002372
1040 Ga0068857_100006844
1041 Ga0068857_100009668
1042 Ga0068857_100049669
1043 Ga0068854_100001920
1044 Ga0068856_100003802
1045 Ga0070702_100027792
1046 Ga0068852_100351626
1047 Ga0068859_100000761
1048 Ga0068859_100713726
1049 Ga0068864_100017413
1050 Ga0068864_100214546
1051 Ga0068861_100022688
1052 Ga0068861_100050640
1053 Ga0068861_100144696
1054 Ga0068870_10000344
1055 Ga0068863_100005828
1056 Ga0068863_100044875
1057 Ga0068863_100219406
1058 Ga0068860_100010848
1059 Ga0068860_100095693
1060 Ga0068860_100154833
1061 Ga0068860_100229337
1062 Ga0068860_100708150
1063 Ga0068862_100002867
1064 Ga0068862_100015088
1065 Ga0068862_100106177
1066 Ga0081455_10000471
1067 Ga0081538_10003163
1068 Ga0081538_10014822
1069 Ga0081540_1000399
1070 Ga0081540_1026595
1071 Ga0081539_10000166
1072 Ga0075432_10103946
1073 Ga0070716_100025651
1074 Ga0070716_100328168
1075 Ga0070712_100047362
1076 Ga0097621_100512223
1077 Ga0075428_100000152
1078 Ga0075428_100004668
1079 Ga0075428_100027190
1080 Ga0075428_100052962
1081 Ga0075428_100128809
1082 Ga0075428_100202636
1083 Ga0075428_100283102
1084 Ga0075428_100603792
1085 Ga0075428_100647650
1086 Ga0075430_100000041
1087 Ga0075430_100002647
1088 Ga0075430_100018919
1089 Ga0075430_100040129
1090 Ga0075431_100000843
1091 Ga0075431_100004971
1092 Ga0075431_100020335
1093 Ga0075431_100037842
1094 Ga0075431_100058936
1095 Ga0075431_100070827
1096 Ga0075431_100081642
1097 Ga0075431_100131885
1098 Ga0075431_100152046
1099 Ga0075431_100350585
1100 Ga0075431_100612958
1101 Ga0075431_100703762
1102 Ga0075433_10001757
1103 Ga0075433_10002879
1104 Ga0075433_10003747
1105 Ga0075433_10029217
1106 Ga0075433_10037129
1107 Ga0075433_10058265
1108 Ga0075433_10073609
1109 Ga0075433_10091217
1110 Ga0075433_10162792
1111 Ga0075433_10340614
1112 Ga0075433_10350716
1113 Ga0075433_10491415
1114 Ga0075433_10527352
1115 Ga0075434_100000039
1116 Ga0075434_100037154
1117 Ga0075434_100039045
1118 Ga0075434_100061612
1119 Ga0075434_100094094
1120 Ga0075434_100107567
1121 Ga0075434_100116726
1122 Ga0075434_100133056
1123 Ga0075434_100148452
1124 Ga0075434_100152398
1125 Ga0075434_100222813
1126 Ga0075434_100425189
1127 Ga0075434_100440134
1128 Ga0075429_100000211
1129 Ga0075429_100015539
1130 Ga0075429_100059385
1131 Ga0075429_100077471
1132 Ga0075429_100204567
1133 Ga0075429_100520564
1134 Ga0075429_100525384
1135 Ga0075429_100559076
1136 Ga0075436_100002481
1137 Ga0075436_100019494
1138 Ga0075436_100068312
1139 Ga0075436_100166447
1140 Ga0075436_100245942
1141 Ga0075436_100253306
1142 Ga0075436_100554874
1143 Ga0097620_100000761
1144 Ga0097620_100713690
1145 Ga0075435_100000848
1146 Ga0075435_100003328
1147 Ga0075435_100007812
1148 Ga0075435_100015153
1149 Ga0075435_100030295
1150 Ga0075435_100121005
1151 Ga0075435_100137049
1152 Ga0075435_100169677
1153 Ga0075435_100371079
1154 Ga0075435_100377865
1155 Ga0099794_10000045
1156 Ga0099794_10000416
1157 Ga0099794_10006529
1158 Ga0099794_10011392
1159 Ga0099794_10018378
1160 Ga0099795_10067768
1161 Ga0111539_10000819
1162 Ga0111539_10001430
1163 Ga0111539_10025794
1164 Ga0111539_10130470
1165 Ga0111539_10148555
1166 Ga0111539_11045625
1167 Ga0114129_10000893
1168 Ga0114129_10001132
1169 Ga0114129_10003438
1170 Ga0114129_10007065
1171 Ga0114129_10010167
1172 Ga0114129_10017689
1173 Ga0114129_10029409
1174 Ga0114129_10036473
1175 Ga0114129_10038289
1176 Ga0114129_10043861
1177 Ga0114129_10195813
1178 Ga0114129_10208468
1179 Ga0114129_10208471
1180 Ga0114129_10263990
1181 Ga0114129_10266876
1182 Ga0114129_10271339
1183 Ga0114129_10296616
1184 Ga0114129_10568106
1185 Ga0114129_10620044
1186 Ga0105243_10095040
1187 Ga0105241_10001068
1188 Ga0105242_10090100
1189 Ga0105242_10125954
1190 Ga0105237_10377535
1191 Ga0105249_10249389
1192 Ga0105246_10013128
1193 Ga0157373_10001828
1194 Ga0157369_10007014
1195 Ga0157378_10078223
1196 Ga0157378_10153240
1197 Ga0163162_10056086
1198 Ga0157372_10003186
1199 Ga0157372_10238084
1200 Ga0157375_10123673
1201 Ga0157375_10262943
1202 Ga0157375_10320133
1203 Ga0163163_10012442
1204 Ga0182007_10025791
1205 Ga0163161_10219370
1206 Ga0207653_10006330
1207 Ga0207653_10007194
1208 Ga0207653_10007898
1209 Ga0207653_10012165
1210 Ga0207685_10255064
1211 Ga0207645_10000614
1212 Ga0207645_10010451
1213 Ga0207643_10000700
1214 Ga0207684_10000210
1215 Ga0207684_10000501
1216 Ga0207684_10003653
1217 Ga0207684_10013924
1218 Ga0207684_10026064
1219 Ga0207684_10028378
1220 Ga0207684_10030235
1221 Ga0207684_10039843
1222 Ga0207684_10040544
1223 Ga0207684_10048382
1224 Ga0207684_10080611
1225 Ga0207684_10120195
1226 Ga0207684_10154574
1227 Ga0207684_10157339
1228 Ga0207684_10205703
1229 Ga0207654_10002800
1230 Ga0207707_10002555
1231 Ga0207695_10328407
1232 Ga0207671_10292043
1233 Ga0207693_10264978
1234 Ga0207663_10080759
1235 Ga0207663_10247390
1236 Ga0207660_10000499
1237 Ga0207662_10295051
1238 Ga0207657_10002105
1239 Ga0207649_10002110
1240 Ga0207649_10843128
1241 Ga0207652_10000948
1242 Ga0207646_10002368
1243 Ga0207646_10004720
1244 Ga0207646_10006234
1245 Ga0207646_10009752
1246 Ga0207646_10014448
1247 Ga0207646_10017830
1248 Ga0207646_10023294
1249 Ga0207646_10033747
1250 Ga0207646_10038895
1251 Ga0207646_10051283
1252 Ga0207646_10053289
1253 Ga0207646_10239777
1254 Ga0207646_10302319
1255 Ga0207681_10059207
1256 Ga0207681_10176262
1257 Ga0207681_10189724
1258 Ga0207650_10010479
1259 Ga0207700_10059142
1260 Ga0207644_10073970
1261 Ga0207690_10018945
1262 Ga0207706_10008077
1263 Ga0207706_10030704
1264 Ga0207706_10556263
1265 Ga0207686_10145590
1266 Ga0207686_10189891
1267 Ga0207709_10011881
1268 Ga0207709_10299694
1269 Ga0207670_10111569
1270 Ga0207670_10167701
1271 Ga0207670_10350285
1272 Ga0207704_10072202
1273 Ga0207665_10043217
1274 Ga0207691_10036994
1275 Ga0207691_10045678
1276 Ga0207691_10166531
1277 Ga0207711_10141826
1278 Ga0207711_10729179
1279 Ga0207689_10000767
1280 Ga0207689_10033871
1281 Ga0207689_10550558
1282 Ga0207661_10017544
1283 Ga0207679_10000646
1284 Ga0207679_10099124
1285 Ga0207667_10000470
1286 Ga0207712_10041729
1287 Ga0207712_10052936
1288 Ga0207712_10095312
1289 Ga0207712_10201416
1290 Ga0207668_10112906
1291 Ga0207668_10703980
1292 Ga0207640_10001767
1293 Ga0207639_10002607
1294 Ga0207678_10059576
1295 Ga0207708_10061247
1296 Ga0207708_10204487
1297 Ga0207708_10430493
1298 Ga0207702_10017167
1299 Ga0207648_10005154
1300 Ga0207676_10052896
1301 Ga0207674_10003153
1302 Ga0207674_10024269
1303 Ga0207675_100051938
1304 Ga0207698_10029791
1305 Ga0209969_1002635
1306 Ga0209995_1001550
1307 Ga0209968_1001578
1308 Ga0209999_1003121
1309 Ga0209970_1000442
1310 Ga0209588_1000070
1311 Ga0209588_1001462
1312 Ga0209588_1026226
1313 Ga0209971_1000004
1314 Ga0209966_1000015
1315 Ga0209998_10000001
1316 Ga0209974_10006197
1317 Ga0209974_10069149
1318 Ga0207428_10000009
1319 Ga0207428_10021463
1320 Ga0207428_10063192
1321 Ga0207428_10339261
1322 Ga0268265_10013655
1323 Ga0268265_10024495
1324 Ga0268264_10035599
1325 Ga0268264_10117519
1326 Ga0268264_10131179
1327 Ga0268264_10293292
1328 Ga0307408_100019824
1329 Ga0307408_100026208
1330 Ga0307406_10158210
1331 Ga0307407_10050751
1332 Ga0373948_0014391
1333 Ga0373950_0005438
1334 Ga0373940_0016704
1335 Ga0373949_0055748
1336 Ga0373951_0008506
1337 Ga0373932_0027721
1338 Ga0373954_0222508
1339 Ga0373961_0034887
1340 Ga0373931_0014469
1341 Ga0373947_0064356
1342 Ga0373937_0269714
1343 Ga0395899_0019861
1344 Ga0395900_0005650
1345 Ga0395900_0037337
1346 Ga0395898_0020922
1347 Ga0395905_0149538
1348 Ga0395901_0006681
1349 Ga0436365_1696103
1350 Ga0439441_026288
1351 Ga0439448_0009412
1352 Ga0439448_0049438
1353 Ga0439448_0086756
1354 Ga0450889_002193
1355 Ga0439458_0042809
1356 Ga0439435_0035498
1357 Ga0439459_0002679
1358 Ga0439464_0005986
1359 Ga0439460_0000590
1360 Ga0451577_0011703
1361 Ga0451577_0021415
1362 Ga0451577_0089971
1363 Ga0451577_0251137
1364 Ga0453683_0011475
1365 Ga0453683_0134075
1366 Ga0453684_0101013
1367 Ga0453684_0968622
1368 Ga0451576_0009605
1369 Ga0451576_0033263
1370 Ga0451576_0038333
1371 Ga0451576_0074775
1372 Ga0451576_0088007
1373 Ga0451576_0170202
1374 Ga0451576_0228767
1375 Ga0451576_0872527
1376 Ga0495592_0124144
1377 Ga0495638_0083816
1378 Ga0495651_0042919
1379 Ga0495580_0004222
1380 Ga0495580_0045355
1381 Ga0495580_0099467
1382 Ga0495584_0098445
1383 Ga0495618_0014538
1384 Ga0495587_0021055
1385 Ga0495667_0027529
1386 Ga0495634_0024721
1387 Ga0495669_0106293
1388 Ga0495669_0230322
1389 Ga0495604_0058153
1390 Ga0495636_0014957
1391 Ga0495674_0070540
1392 Ga0495676_0198178
1393 Ga0495680_0115880
1394 Ga0495677_0143881
1395 Ga0495684_0469855
1396 Ga0496101_0151062
1397 Ga0496102_0025370
1398 Ga0496102_0272190
1399 Ga0496103_0112915
1400 Ga0496103_0202035
1401 Ga0496106_0075633
1402 Ga0496106_0136397
1403 Ga0496106_0460764
1404 Ga0496107_0406265
1405 Ga0496108_0044945
1406 Ga0496108_0350629
1407 Ga0496109_0229881
1408 Ga0496114_0136697
1409 Ga0501031_0373697
1410 Ga0501032_0451900
1411 Ga0501033_0066200
1412 Ga0501033_0102957
1413 Ga0501036_0014540
1414 Ga0501036_0027049
1415 Ga0501036_0027886
1416 Ga0501036_0042189
1417 Ga0501036_0183612
1418 Ga0501036_0224011
1419 Ga0501036_0238825
1420 Ga0501037_0106827
1421 Ga0501037_0209358
1422 Ga0501038_0130214
1423 Ga0501038_0152696
1424 Ga0501038_0221516
1425 Ga0501038_0230047
1426 Ga0501038_0272327
1427 Ga0501038_0638215
1428 Ga0501039_0000562
1429 Ga0501039_0003884
1430 Ga0501039_0023100
1431 Ga0501039_0026304
1432 Ga0501039_0027727
1433 Ga0501039_0096022
1434 Ga0501039_0392298
1435 Ga0501040_0000512
1436 Ga0501040_0003684
1437 Ga0501040_0003922
1438 Ga0501040_0008914
1439 Ga0501040_0021944
1440 Ga0501040_0025724
1441 Ga0501040_0038018
1442 Ga0501040_0057131
1443 Ga0501040_0113353
1444 Ga0501040_0357479
1445 Ga0501041_0001135
1446 Ga0501041_0002180
1447 Ga0501041_0002272
1448 Ga0501041_0014344
1449 Ga0501041_0035423
1450 Ga0501041_0057509
1451 Ga0501041_0118683
1452 Ga0501041_0523685
1453 Ga0501042_0007008
1454 Ga0501042_0008135
1455 Ga0501042_0011519
1456 Ga0501042_0017679
1457 Ga0501042_0034968
1458 Ga0501042_0039253
1459 Ga0501042_0116999
1460 Ga0501042_0146229
1461 Ga0501042_0235026
1462 Ga0501042_0256057
1463 Ga0501043_0011026
1464 Ga0501043_0063621
1465 Ga0501043_0067185
1466 Ga0501043_0164774
1467 Ga0501043_0275374
1468 Ga0501046_0000635
1469 Ga0501046_0001204
1470 Ga0501046_0090738
1471 Ga0501046_0105005
1472 Ga0501046_0248649
1473 Ga0501046_0388972
1474 Ga0501046_0402614
1475 Ga0501047_0181834
1476 Ga0501048_0003577
1477 Ga0501048_0009473
1478 Ga0501048_0020250
1479 Ga0501048_0024785
1480 Ga0501048_0054165
1481 Ga0501048_0063248
1482 Ga0501048_0082762
1483 Ga0501048_0194375
1484 Ga0501067_0048580
1485 Ga0501067_0174411
1486 Ga0501068_0032269
1487 Ga0501068_0060577
1488 Ga0501068_0095206
1489 Ga0501068_0195767
1490 Ga0501068_0224908
1491 Ga0501068_0294227
1492 Ga0501068_0630809
1493 Ga0501069_0189990
1494 Ga0501070_0024182
1495 Ga0501071_0001178
1496 Ga0501071_0018003
1497 Ga0501071_0068738
1498 Ga0501071_0246390
1499 Ga0501071_0396530
1500 Ga0501071_0551556
1501 Ga0501072_0000521
1502 Ga0501072_0001143
1503 Ga0501072_0018452
1504 Ga0501072_0019267
1505 Ga0501072_0021539
1506 Ga0501072_0026340
1507 Ga0501072_0029170
1508 Ga0501072_0066588
1509 Ga0501072_0222482
1510 Ga0501072_0262128
1511 Ga0501072_0559085
1512 Ga0501073_0140751
1513 Ga0501074_0004010
1514 Ga0501074_0007595
1515 Ga0501074_0027490
1516 Ga0501074_0075815
1517 Ga0501074_0222360
1518 Ga0501074_0332738
1519 Ga0501075_0001036
1520 Ga0501075_0005529
1521 Ga0501075_0006999
1522 Ga0501075_0017595
1523 Ga0501075_0024746
1524 Ga0501075_0053215
1525 Ga0501075_0061271
1526 Ga0501075_0068415
1527 Ga0501075_0095821
1528 Ga0501075_0152069
1529 Ga0501075_0492968
1530 Ga0501076_0000094
1531 Ga0501076_0000896
1532 Ga0501076_0004970
1533 Ga0501076_0028474
1534 Ga0501076_0073869
1535 Ga0501076_0076659
1536 Ga0501076_0173577
1537 Ga0501076_0187610
1538 Ga0501076_0230436
1539 Ga0501076_0449309
1540 Ga0501076_0532661
1541 Ga0501077_0000655
1542 Ga0501077_0018584
1543 Ga0501077_0020193
1544 Ga0501077_0042893
1545 Ga0501077_0103819
1546 Ga0501077_0282518
1547 Ga0501077_0311198
1548 Ga0501079_0000373
1549 Ga0501079_0000778
1550 Ga0501079_0001373
1551 Ga0501079_0001699
1552 Ga0501079_0003475
1553 Ga0501079_0018029
1554 Ga0501079_0048864
1555 Ga0501079_0055593
1556 Ga0501079_0099822
1557 Ga0501079_0111117
1558 Ga0501079_0258980
1559 Ga0501079_0421059
1560 Ga0501079_0603151
1561 Ga0501080_0022428
1562 Ga0501080_0030962
1563 Ga0501080_0032064
1564 Ga0501080_0085080
1565 Ga0501080_0099938
1566 Ga0501080_0105030
1567 Ga0501080_0226989
1568 Ga0501080_0402040
1569 Ga0501080_0893206
1570 Ga0501081_0001477
1571 Ga0501081_0001640
1572 Ga0501081_0004173
1573 Ga0501081_0004683
1574 Ga0501081_0008730
1575 Ga0501081_0010344
1576 Ga0501081_0047644
1577 Ga0501081_0069442
1578 Ga0501081_0086965
1579 Ga0501081_0116544
1580 Ga0501081_0122830
1581 Ga0501081_0218948
1582 Ga0501083_0076718
1583 Ga0501083_0115795
1584 Ga0501083_0179167
1585 Ga0501083_0195006
1586 Ga0501035_0005132
1587 Ga0501035_0097759
1588 Ga0501035_0338075
1589 Ga0501045_0007642
1590 Ga0501045_0009114
1591 Ga0501045_0011087
1592 Ga0501045_0016272
1593 Ga0501045_0018892
1594 Ga0501045_0052226
1595 Ga0501045_0098764
1596 Ga0501045_0120684
1597 Ga0501045_0128030
1598 nmdc:mga0yw44_5814_c3
1599 nmdc:mga05p37_1023831_c1
1600 nmdc:mga05p37_120563_c1
1601 nmdc:mga05p37_133546_c1
1602 nmdc:mga05p37_1381_c1
1603 nmdc:mga05p37_143057_c1
1604 nmdc:mga05p37_164629_c1
1605 nmdc:mga05p37_168555_c1
1606 nmdc:mga05p37_21018_c1
1607 nmdc:mga05p37_2162_c1
1608 nmdc:mga05p37_224625_c1
1609 nmdc:mga05p37_231122_c1
1610 nmdc:mga05p37_2464_c1
1611 nmdc:mga05p37_249496_c1
1612 nmdc:mga05p37_31427_c1
1613 nmdc:mga05p37_336923_c1
1614 nmdc:mga05p37_359296_c1
1615 nmdc:mga05p37_366_c1
1616 nmdc:mga05p37_367117_c1
1617 nmdc:mga05p37_629430_c1
1618 nmdc:mga05p37_732747_c1
1619 nmdc:mga05p37_8089_c1
1620 nmdc:mga05p37_98363_c1
1621 nmdc:mga09592_164717_c1
1622 nmdc:mga09592_1725_c1
1623 nmdc:mga09592_173386_c1
1624 nmdc:mga09592_18434_c1
1625 nmdc:mga09592_249166_c1
1626 nmdc:mga09592_38119_c1
1627 nmdc:mga09592_448165_c1
1628 nmdc:mga09592_8064_c1
1629 nmdc:mga09592_818_c1
1630 nmdc:mga09592_914_c1
1631 nmdc:mga0qj67_205_c1
1632 nmdc:mga0qj67_4642_c1
1633 nmdc:mga06r32_131537_c1
1634 nmdc:mga06r32_134319_c1
1635 nmdc:mga06r32_136815_c1
1636 nmdc:mga06r32_138977_c1
1637 nmdc:mga06r32_229313_c1
1638 nmdc:mga06r32_253220_c1
1639 nmdc:mga06r32_253642_c1
1640 nmdc:mga06r32_3562_c1
1641 nmdc:mga06r32_45249_c1
1642 nmdc:mga06r32_57321_c1
1643 nmdc:mga06r32_594061_c1
1644 nmdc:mga06r32_6997_c1
1645 nmdc:mga08y16_171_c1
1646 nmdc:mga08y16_218695_c1
1647 nmdc:mga08y16_259404_c1
1648 nmdc:mga08y16_37123_c1
1649 nmdc:mga08y16_457640_c1
1650 nmdc:mga08y16_640986_c1
1651 nmdc:mga0n895_108662_c1
1652 nmdc:mga0n895_129888_c1
1653 nmdc:mga0n895_194789_c1
1654 nmdc:mga0n895_2038_c1
1655 nmdc:mga0n895_3396_c1
1656 nmdc:mga0n895_5973_c1
1657 nmdc:mga0n895_66970_c1
1658 nmdc:mga0n895_67129_c1
1659 nmdc:mga0n895_7972_c1
1660 nmdc:mga0n895_8083_c1
1661 nmdc:mga0n895_84612_c1
1662 nmdc:mga0rr50_106071_c1
1663 nmdc:mga0rr50_1063_c1
1664 nmdc:mga0rr50_1280_c1
1665 nmdc:mga0rr50_130457_c1
1666 nmdc:mga0rr50_185679_c1
1667 nmdc:mga0rr50_263240_c1
1668 nmdc:mga0rr50_36296_c1
1669 nmdc:mga0rr50_43927_c1
1670 nmdc:mga0rr50_4618_c1
1671 nmdc:mga0rr50_4720_c1
1672 nmdc:mga0rr50_640637_c1
1673 nmdc:mga0rr50_82903_c1
1674 nmdc:mga08x19_137664_c1
1675 nmdc:mga08x19_1897_c1
1676 nmdc:mga08x19_200798_c1
1677 nmdc:mga08x19_392527_c1
1678 nmdc:mga08x19_429323_c1
1679 nmdc:mga08x19_472548_c1
1680 nmdc:mga08x19_97738_c1
1681 nmdc:mga0a205_101021_c1
1682 nmdc:mga0a205_108414_c1
1683 nmdc:mga0a205_12144_c1
1684 nmdc:mga0a205_14365_c1
1685 nmdc:mga0a205_147176_c1
1686 nmdc:mga0a205_149671_c1
1687 nmdc:mga0a205_15474_c1
1688 nmdc:mga0a205_156726_c1
1689 nmdc:mga0a205_1757_c1
1690 nmdc:mga0a205_181429_c1
1691 nmdc:mga0a205_230421_c1
1692 nmdc:mga0a205_25514_c1
1693 nmdc:mga0a205_263435_c1
1694 nmdc:mga0a205_333693_c1
1695 nmdc:mga0a205_49045_c1
1696 nmdc:mga0a205_75553_c1
1697 nmdc:mga0a205_796_c1
1698 Ga0495601_0003175
1699 Ga0495655_0038862
1700 Ga0495655_0101452
1701 Ga0495595_0026352
1702 Ga0495619_0000968
1703 Ga0500643_004510
1704 Ga0500644_0000805
1705 Ga0500651_0268704
1706 Ga0500566_0031163
1707 Ga0500595_000002
1708 Ga0500616_0000002
1709 Ga0500645_000091
1710 Ga0501084_0001038
1711 Ga0501084_0004009
1712 Ga0501084_0010215
1713 Ga0501084_0012499
1714 Ga0501084_0024310
1715 Ga0501084_0042252
1716 Ga0501084_0138250
1717 Ga0501084_0209909
1718 Ga0501084_0323916
1719 Ga0501084_0572385
1720 Ga0590075_006550
1721 Ga0501082_0000875
1722 Ga0501082_0001216
1723 Ga0501082_0001564
1724 Ga0501082_0007803
1725 Ga0501082_0010882
1726 Ga0501082_0014047
1727 Ga0501082_0063759
1728 Ga0501082_0090151
1729 Ga0501082_0138481
1730 Ga0501082_0141361
1731 Ga0501082_0195969
1732 Ga0530510_0000078
1733 Ga0530510_0001713
1734 Ga0530510_0015855
1735 Ga0530510_0018021
1736 Ga0530510_0027608
1737 Ga0530510_0030054
1738 Ga0530510_0062761
1739 Ga0530510_0072335
1740 Ga0530510_0105315
1741 Ga0530510_0178971
1742 Ga0530510_0366309

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

37

185

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9322 13 248
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9305 15 236
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.918 15 248
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.9179 15 236
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9178 15 248
ID Description Score Start End Superfamily
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9451 13 248 3.40.50.300
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9437 13 77 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9423 14 244 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.929 15 231 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.926 13 248 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A537J5L1-F1-model_v4 ATP-binding cassette domain-containing protein 0.9649 1 248 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A537J5L1-F1-model_v4 ATP-binding cassette domain-containing protein 0.9611 1 248 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A854GVC9-F1-model_v4 deleted 0.9511 14 242
AF-A0A132EYC1-F1-model_v4 ABC transporter ATP-binding protein 0.9495 14 244 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A7X8Z9E7-F1-model_v4 ABC transporter ATP-binding protein 0.948 14 248 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Map