F484180
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 871 | 459 | 1742 | 245 |
Family's Representative Sequence
| Representative Sequence | 3300012497|Ga0157319_1000008|Ga0157319_1000008182 |
| Length | 276 |
| Sequence | MAAALAPAIDRRRRPADRLVAIAPTPPIQQDIPMSSTHFGFETVDETAKARRVRGVFDSVASRYDVMNDLMSMGLHRAWKRYTLAVANLKPGDRVLDIAGGTGDMARLFAKKVGERGMVVHTDINEAMLRTGRERLIDEGLVLPTNLCDAEALPYKDGSFDLVCVAFGLRNMTHKDKALAEMNRVLRPGGRLLVLEFSQVAEPLRKPYDWYSFKVLPRIGSLIAGDADSYRYLAESIRMHPPQAELKALMKSVGFGHVDVHNLTGGVVALHAGIKC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 92 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 116 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 121 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 188 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 205 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 207 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 208 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 210 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 211 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 212 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 213 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 216 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 217 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 218 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 219 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 221 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 222 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 223 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 225 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 226 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 227 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 228 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 230 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 231 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 232 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 233 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 234 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 235 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 237 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 238 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 239 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 241 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 244 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 247 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 249 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 250 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 253 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 254 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 256 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 257 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 259 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 260 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 261 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 262 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 263 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 264 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 265 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 266 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 267 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 272 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 273 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 274 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 275 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 276 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 277 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 278 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 279 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 280 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 281 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 282 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 283 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 284 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 285 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 286 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 287 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 288 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 289 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 290 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 291 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 292 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 293 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 294 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 295 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 296 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 297 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 298 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 299 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 300 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 301 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 302 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 303 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 304 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 305 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 306 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 307 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 308 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 309 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 310 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 311 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 312 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 337 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 338 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 339 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 340 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 341 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 344 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 345 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 346 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 347 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 348 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 349 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 350 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 351 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 352 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 353 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 354 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 355 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 356 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 357 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 358 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 359 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 377 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 378 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 379 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 380 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 381 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 382 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 383 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 384 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 385 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 386 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 387 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 388 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 389 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 393 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 394 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 395 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 396 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 397 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 398 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 399 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 403 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 404 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 405 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 406 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 407 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 408 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 409 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 410 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 417 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 418 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 419 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 420 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 421 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 422 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 423 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 424 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 425 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 426 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 427 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 428 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 429 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 430 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 431 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 432 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 433 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 434 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 435 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 436 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 437 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 438 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 439 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 440 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 441 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 442 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 443 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 444 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 445 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 446 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 447 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 448 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 449 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 450 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 451 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 452 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 453 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 454 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 455 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 456 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 457 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 458 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 459 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.21 |
| Metatranscriptomes | 0.11 |
| Isolates | 3.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.19 |
| Nodule | 0.46 |
| Rhizoplane | 3.67 |
| Rhizosphere | 71.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157319_1000008 | 3300012497 | Bacteria | 315600 |
| 2 | SwRhRL2b_contig_2970801 | 2162886007 | Bacteria | 1215 |
| 3 | JGI25162J39368_1000116 | 3300002737 | Bacteria | 87942 |
| 4 | JGI25150J39212_1003355 | 3300002774 | Bacteria | 3763 |
| 5 | JGI25153J46596_10007422 | 3300003215 | Bacteria | 5397 |
| 6 | JGI25153J46596_10007578 | 3300003215 | Bacteria | 5312 |
| 7 | rootL2_10000310 | 3300003322 | Bacteria | 31146 |
| 8 | rootH1_10233163 | 3300003323 | Bacteria | 2209 |
| 9 | Ga0055539_1000431 | 3300003752 | Bacteria | 14924 |
| 10 | Ga0055539_1007041 | 3300003752 | Bacteria | 1429 |
| 11 | Ga0055533_1000053 | 3300003756 | Bacteria | 199478 |
| 12 | Ga0055525_1000904 | 3300003759 | Bacteria | 8472 |
| 13 | Ga0055526_1000968 | 3300003771 | Bacteria | 21218 |
| 14 | Ga0055526_1001006 | 3300003771 | Bacteria | 20690 |
| 15 | Ga0055524_1000999 | 3300003775 | Bacteria | 17654 |
| 16 | Ga0055534_1001237 | 3300003784 | Bacteria | 10584 |
| 17 | Ga0055540_1011662 | 3300003792 | Bacteria | 2814 |
| 18 | Ga0055531_10000007 | 3300003794 | Bacteria | 225289 |
| 19 | Ga0055531_10003852 | 3300003794 | Bacteria | 9390 |
| 20 | Ga0055531_10019372 | 3300003794 | Bacteria | 2755 |
| 21 | Ga0055531_10045285 | 3300003794 | Bacteria | 1223 |
| 22 | Ga0055543_1001427 | 3300004625 | Bacteria | 9496 |
| 23 | Ga0055543_1034367 | 3300004625 | Bacteria | 874 |
| 24 | Ga0065165_1000101 | 3300005262 | Bacteria | 141486 |
| 25 | Ga0065165_1000248 | 3300005262 | Bacteria | 93216 |
| 26 | Ga0065704_10000497 | 3300005289 | Bacteria | 19639 |
| 27 | Ga0065704_10129202 | 3300005289 | Bacteria | 1651 |
| 28 | Ga0065707_10001158 | 3300005295 | Bacteria | 8594 |
| 29 | Ga0070658_10083243 | 3300005327 | Bacteria | 2630 |
| 30 | Ga0070658_10096192 | 3300005327 | Bacteria | 2445 |
| 31 | Ga0070658_10312642 | 3300005327 | Bacteria | 1341 |
| 32 | Ga0070676_10006495 | 3300005328 | Bacteria | 6246 |
| 33 | Ga0070676_10006926 | 3300005328 | Bacteria | 6071 |
| 34 | Ga0070676_10037254 | 3300005328 | Bacteria | 2805 |
| 35 | Ga0070683_100076771 | 3300005329 | Bacteria | 3123 |
| 36 | Ga0070683_100332058 | 3300005329 | Bacteria | 1447 |
| 37 | Ga0070677_10009652 | 3300005333 | Bacteria | 3278 |
| 38 | Ga0070677_10044355 | 3300005333 | Bacteria | 1769 |
| 39 | Ga0068869_100005147 | 3300005334 | Bacteria | 8201 |
| 40 | Ga0068869_100392569 | 3300005334 | Bacteria | 1139 |
| 41 | Ga0070666_10246702 | 3300005335 | Bacteria | 1264 |
| 42 | Ga0070680_100071876 | 3300005336 | Bacteria | 2843 |
| 43 | Ga0070682_100267722 | 3300005337 | Bacteria | 1240 |
| 44 | Ga0068868_100012109 | 3300005338 | Bacteria | 6298 |
| 45 | Ga0068868_100025002 | 3300005338 | Bacteria | 4537 |
| 46 | Ga0068868_100028442 | 3300005338 | Bacteria | 4274 |
| 47 | Ga0070660_100049846 | 3300005339 | Bacteria | 3220 |
| 48 | Ga0070660_100301603 | 3300005339 | Bacteria | 1313 |
| 49 | Ga0070660_100317437 | 3300005339 | Bacteria | 1279 |
| 50 | Ga0070660_100610211 | 3300005339 | Bacteria | 913 |
| 51 | Ga0070661_100022742 | 3300005344 | Bacteria | 4489 |
| 52 | Ga0070661_100450930 | 3300005344 | Bacteria | 1023 |
| 53 | Ga0070668_100040154 | 3300005347 | Bacteria | 3580 |
| 54 | Ga0070668_100243705 | 3300005347 | Bacteria | 1490 |
| 55 | Ga0070669_100063844 | 3300005353 | Bacteria | 2711 |
| 56 | Ga0070675_100007192 | 3300005354 | Bacteria | 8577 |
| 57 | Ga0070675_100026729 | 3300005354 | Bacteria | 4631 |
| 58 | Ga0070675_100161539 | 3300005354 | Bacteria | 1927 |
| 59 | Ga0070675_100172546 | 3300005354 | Bacteria | 1866 |
| 60 | Ga0070675_100324667 | 3300005354 | Bacteria | 1360 |
| 61 | Ga0070671_100013893 | 3300005355 | Bacteria | 6495 |
| 62 | Ga0070671_100027654 | 3300005355 | Bacteria | 4669 |
| 63 | Ga0070671_100098197 | 3300005355 | Bacteria | 2456 |
| 64 | Ga0070671_100162338 | 3300005355 | Bacteria | 1889 |
| 65 | Ga0070671_100199894 | 3300005355 | Bacteria | 1695 |
| 66 | Ga0070671_100403812 | 3300005355 | Bacteria | 1169 |
| 67 | Ga0070674_100207170 | 3300005356 | Bacteria | 1518 |
| 68 | Ga0070673_100093533 | 3300005364 | Bacteria | 2462 |
| 69 | Ga0070673_100193550 | 3300005364 | Bacteria | 1748 |
| 70 | Ga0070659_100027006 | 3300005366 | Bacteria | 4420 |
| 71 | Ga0070659_100062436 | 3300005366 | Bacteria | 2945 |
| 72 | Ga0070659_100088337 | 3300005366 | Bacteria | 2482 |
| 73 | Ga0070667_100660309 | 3300005367 | Bacteria | 966 |
| 74 | Ga0070714_100097912 | 3300005435 | Bacteria | 2580 |
| 75 | Ga0070705_100310254 | 3300005440 | Bacteria | 1134 |
| 76 | Ga0070663_100028153 | 3300005455 | Bacteria | 3822 |
| 77 | Ga0070663_100188316 | 3300005455 | Bacteria | 1605 |
| 78 | Ga0070678_100090868 | 3300005456 | Bacteria | 2342 |
| 79 | Ga0070662_100005330 | 3300005457 | Bacteria | 8217 |
| 80 | Ga0070662_100013586 | 3300005457 | Bacteria | 5420 |
| 81 | Ga0070662_100272547 | 3300005457 | Bacteria | 1367 |
| 82 | Ga0070662_100383280 | 3300005457 | Bacteria | 1158 |
| 83 | Ga0070662_100600127 | 3300005457 | Bacteria | 926 |
| 84 | Ga0068867_100006378 | 3300005459 | Bacteria | 8337 |
| 85 | Ga0068867_100014086 | 3300005459 | Bacteria | 5664 |
| 86 | Ga0068867_100029474 | 3300005459 | Bacteria | 3954 |
| 87 | Ga0068867_100292722 | 3300005459 | Bacteria | 1339 |
| 88 | Ga0070706_100037499 | 3300005467 | Bacteria | 4477 |
| 89 | Ga0070706_100186751 | 3300005467 | Bacteria | 1937 |
| 90 | Ga0070707_100175509 | 3300005468 | Bacteria | 2089 |
| 91 | Ga0070698_100340322 | 3300005471 | Bacteria | 1432 |
| 92 | Ga0070699_100029409 | 3300005518 | Bacteria | 4737 |
| 93 | Ga0070699_100612276 | 3300005518 | Bacteria | 993 |
| 94 | Ga0070679_100018762 | 3300005530 | Bacteria | 6715 |
| 95 | Ga0070684_100080387 | 3300005535 | Bacteria | 2883 |
| 96 | Ga0068853_100182902 | 3300005539 | Bacteria | 1901 |
| 97 | Ga0068853_100311735 | 3300005539 | Bacteria | 1457 |
| 98 | Ga0070672_100004996 | 3300005543 | Bacteria | 8737 |
| 99 | Ga0070672_100050827 | 3300005543 | Bacteria | 3230 |
| 100 | Ga0070672_100452725 | 3300005543 | Bacteria | 1106 |
| 101 | Ga0070695_100058360 | 3300005545 | Bacteria | 2495 |
| 102 | Ga0070695_100105044 | 3300005545 | Bacteria | 1908 |
| 103 | Ga0070693_100036952 | 3300005547 | Bacteria | 2720 |
| 104 | Ga0070693_100041815 | 3300005547 | Bacteria | 2580 |
| 105 | Ga0070665_100013839 | 3300005548 | Bacteria | 8114 |
| 106 | Ga0070704_100084717 | 3300005549 | Bacteria | 2344 |
| 107 | Ga0068855_100001666 | 3300005563 | Bacteria | 27785 |
| 108 | Ga0068855_100060304 | 3300005563 | Bacteria | 4437 |
| 109 | Ga0070664_100087852 | 3300005564 | Bacteria | 2688 |
| 110 | Ga0070664_100523731 | 3300005564 | Bacteria | 1094 |
| 111 | Ga0068857_100011579 | 3300005577 | Bacteria | 7673 |
| 112 | Ga0068857_100014155 | 3300005577 | Bacteria | 6947 |
| 113 | Ga0068857_100131344 | 3300005577 | Bacteria | 2259 |
| 114 | Ga0068857_100190736 | 3300005577 | Bacteria | 1867 |
| 115 | Ga0068854_100032592 | 3300005578 | Bacteria | 3627 |
| 116 | Ga0068854_100111998 | 3300005578 | Bacteria | 2060 |
| 117 | Ga0068854_100336745 | 3300005578 | Bacteria | 1231 |
| 118 | Ga0070702_100026472 | 3300005615 | Bacteria | 3116 |
| 119 | Ga0068852_100007330 | 3300005616 | Bacteria | 8047 |
| 120 | Ga0068852_100078758 | 3300005616 | Bacteria | 2916 |
| 121 | Ga0068859_100428221 | 3300005617 | Bacteria | 1420 |
| 122 | Ga0068864_100047443 | 3300005618 | Bacteria | 3689 |
| 123 | Ga0068864_100075435 | 3300005618 | Bacteria | 2944 |
| 124 | Ga0068864_100083214 | 3300005618 | Bacteria | 2810 |
| 125 | Ga0068864_100411348 | 3300005618 | Bacteria | 1287 |
| 126 | Ga0068866_10111336 | 3300005718 | Bacteria | 1528 |
| 127 | Ga0068861_100015862 | 3300005719 | Bacteria | 5319 |
| 128 | Ga0068861_100016866 | 3300005719 | Bacteria | 5175 |
| 129 | Ga0068861_100027593 | 3300005719 | Bacteria | 4138 |
| 130 | Ga0068851_10017778 | 3300005834 | Bacteria | 3421 |
| 131 | Ga0068851_10027355 | 3300005834 | Bacteria | 2811 |
| 132 | Ga0068851_10027907 | 3300005834 | Bacteria | 2785 |
| 133 | Ga0068870_10004536 | 3300005840 | Bacteria | 5983 |
| 134 | Ga0068870_10203407 | 3300005840 | Bacteria | 1202 |
| 135 | Ga0068870_10316003 | 3300005840 | Bacteria | 991 |
| 136 | Ga0068858_100047944 | 3300005842 | Bacteria | 3959 |
| 137 | Ga0068860_100038773 | 3300005843 | Bacteria | 4558 |
| 138 | Ga0068860_100175972 | 3300005843 | Bacteria | 2068 |
| 139 | Ga0068862_100007493 | 3300005844 | Bacteria | 9044 |
| 140 | Ga0068862_100010025 | 3300005844 | Bacteria | 7826 |
| 141 | Ga0075365_10010595 | 3300006038 | Bacteria | 5380 |
| 142 | Ga0075365_10011756 | 3300006038 | Bacteria | 5162 |
| 143 | Ga0075365_10057991 | 3300006038 | Bacteria | 2577 |
| 144 | Ga0075365_10129439 | 3300006038 | Bacteria | 1746 |
| 145 | Ga0075368_10009568 | 3300006042 | Bacteria | 3486 |
| 146 | Ga0075368_10011904 | 3300006042 | Bacteria | 3174 |
| 147 | Ga0075363_100001576 | 3300006048 | Bacteria | 8763 |
| 148 | Ga0075363_100073123 | 3300006048 | Bacteria | 1865 |
| 149 | Ga0075364_10003493 | 3300006051 | Bacteria | 8947 |
| 150 | Ga0075364_10056862 | 3300006051 | Bacteria | 2562 |
| 151 | Ga0075432_10000664 | 3300006058 | Bacteria | 10541 |
| 152 | Ga0075362_10001003 | 3300006177 | Bacteria | 8652 |
| 153 | Ga0075362_10003169 | 3300006177 | Bacteria | 5687 |
| 154 | Ga0075362_10036688 | 3300006177 | Bacteria | 2145 |
| 155 | Ga0075367_10001551 | 3300006178 | Bacteria | 9934 |
| 156 | Ga0075367_10036117 | 3300006178 | Bacteria | 2863 |
| 157 | Ga0075367_10073721 | 3300006178 | Bacteria | 2057 |
| 158 | Ga0075369_10020411 | 3300006186 | Bacteria | 2714 |
| 159 | Ga0075366_10000468 | 3300006195 | Bacteria | 18771 |
| 160 | Ga0075366_10054153 | 3300006195 | Bacteria | 2383 |
| 161 | Ga0075366_10054888 | 3300006195 | Bacteria | 2366 |
| 162 | Ga0075366_10088851 | 3300006195 | Bacteria | 1850 |
| 163 | Ga0075366_10133564 | 3300006195 | Bacteria | 1498 |
| 164 | Ga0075366_10227281 | 3300006195 | Bacteria | 1137 |
| 165 | Ga0097621_100009602 | 3300006237 | Bacteria | 7032 |
| 166 | Ga0097621_100167233 | 3300006237 | Bacteria | 1894 |
| 167 | Ga0075370_10000108 | 3300006353 | Bacteria | 26683 |
| 168 | Ga0075370_10000350 | 3300006353 | Bacteria | 16757 |
| 169 | Ga0075370_10011293 | 3300006353 | Bacteria | 4690 |
| 170 | Ga0075370_10018852 | 3300006353 | Bacteria | 3747 |
| 171 | Ga0075370_10018907 | 3300006353 | Bacteria | 3742 |
| 172 | Ga0075370_10024698 | 3300006353 | Bacteria | 3321 |
| 173 | Ga0068871_100011636 | 3300006358 | Bacteria | 6460 |
| 174 | Ga0075428_100045856 | 3300006844 | Bacteria | 4803 |
| 175 | Ga0075428_100097261 | 3300006844 | Bacteria | 3209 |
| 176 | Ga0075430_100012192 | 3300006846 | Bacteria | 7320 |
| 177 | Ga0075430_100041086 | 3300006846 | Bacteria | 3914 |
| 178 | Ga0075431_100002923 | 3300006847 | Bacteria | 16541 |
| 179 | Ga0075431_100030939 | 3300006847 | Bacteria | 5513 |
| 180 | Ga0075431_100044445 | 3300006847 | Bacteria | 4582 |
| 181 | Ga0075434_100107882 | 3300006871 | Bacteria | 2795 |
| 182 | Ga0075429_100003081 | 3300006880 | Bacteria | 14139 |
| 183 | Ga0075429_100128970 | 3300006880 | Bacteria | 2212 |
| 184 | Ga0068865_100031426 | 3300006881 | Bacteria | 3541 |
| 185 | Ga0068865_100084377 | 3300006881 | Bacteria | 2289 |
| 186 | Ga0097620_100428181 | 3300006931 | Bacteria | 1420 |
| 187 | Ga0099823_1000075 | 3300006944 | Bacteria | 48013 |
| 188 | Ga0105250_10000004 | 3300009092 | Bacteria | 438653 |
| 189 | Ga0105240_10281860 | 3300009093 | Bacteria | 1909 |
| 190 | Ga0105240_10932554 | 3300009093 | Bacteria | 932 |
| 191 | Ga0111539_10174509 | 3300009094 | Bacteria | 2511 |
| 192 | Ga0105245_10011588 | 3300009098 | Bacteria | 7682 |
| 193 | Ga0105245_10023648 | 3300009098 | Bacteria | 5394 |
| 194 | Ga0105245_10111571 | 3300009098 | Bacteria | 2543 |
| 195 | Ga0105245_10664617 | 3300009098 | Bacteria | 1073 |
| 196 | Ga0105243_10012663 | 3300009148 | Bacteria | 6372 |
| 197 | Ga0105243_10025933 | 3300009148 | Bacteria | 4484 |
| 198 | Ga0105243_10044521 | 3300009148 | Bacteria | 3482 |
| 199 | Ga0105243_10397397 | 3300009148 | Bacteria | 1279 |
| 200 | Ga0105241_10078048 | 3300009174 | Bacteria | 2587 |
| 201 | Ga0105242_10009898 | 3300009176 | Bacteria | 7303 |
| 202 | Ga0105242_10563802 | 3300009176 | Bacteria | 1094 |
| 203 | Ga0105242_10571267 | 3300009176 | Bacteria | 1087 |
| 204 | Ga0105242_11120328 | 3300009176 | Bacteria | 802 |
| 205 | Ga0105248_10002698 | 3300009177 | Bacteria | 19716 |
| 206 | Ga0105248_10014653 | 3300009177 | Bacteria | 8628 |
| 207 | Ga0105248_10131168 | 3300009177 | Bacteria | 2828 |
| 208 | Ga0105237_10023104 | 3300009545 | Bacteria | 6376 |
| 209 | Ga0105238_10070932 | 3300009551 | Bacteria | 3482 |
| 210 | Ga0105249_10061695 | 3300009553 | Bacteria | 3441 |
| 211 | Ga0099796_10013861 | 3300010159 | Bacteria | 2314 |
| 212 | Ga0105239_10654159 | 3300010375 | Bacteria | 1200 |
| 213 | Ga0157373_10121303 | 3300013100 | Bacteria | 1837 |
| 214 | Ga0157371_10312940 | 3300013102 | Bacteria | 1138 |
| 215 | Ga0157369_10072223 | 3300013105 | Bacteria | 3704 |
| 216 | Ga0157374_10012925 | 3300013296 | Bacteria | 7274 |
| 217 | Ga0157374_10048033 | 3300013296 | Bacteria | 3959 |
| 218 | Ga0157374_10087753 | 3300013296 | Bacteria | 2962 |
| 219 | Ga0157378_10149245 | 3300013297 | Bacteria | 2177 |
| 220 | Ga0157372_10023923 | 3300013307 | Bacteria | 6628 |
| 221 | Ga0157372_10080912 | 3300013307 | Bacteria | 3676 |
| 222 | Ga0157372_10947375 | 3300013307 | Bacteria | 998 |
| 223 | Ga0157375_10016951 | 3300013308 | Bacteria | 6564 |
| 224 | Ga0157375_10028320 | 3300013308 | Bacteria | 5250 |
| 225 | Ga0157375_10183738 | 3300013308 | Bacteria | 2243 |
| 226 | Ga0157375_10957849 | 3300013308 | Bacteria | 997 |
| 227 | Ga0157380_10079544 | 3300014326 | Bacteria | 2677 |
| 228 | Ga0157380_10725396 | 3300014326 | Bacteria | 1002 |
| 229 | Ga0157380_10969088 | 3300014326 | Bacteria | 882 |
| 230 | Ga0157379_10000729 | 3300014968 | Bacteria | 26640 |
| 231 | Ga0157379_10036452 | 3300014968 | Bacteria | 4385 |
| 232 | Ga0157379_10121245 | 3300014968 | Bacteria | 2352 |
| 233 | Ga0157376_10028980 | 3300014969 | Bacteria | 4407 |
| 234 | Ga0157376_10862522 | 3300014969 | Bacteria | 921 |
| 235 | Ga0213872_10000093 | 3300021361 | Bacteria | 83513 |
| 236 | Ga0213872_10000339 | 3300021361 | Bacteria | 39618 |
| 237 | Ga0213872_10000508 | 3300021361 | Bacteria | 30750 |
| 238 | Ga0213872_10003642 | 3300021361 | Bacteria | 8445 |
| 239 | Ga0213872_10062011 | 3300021361 | Bacteria | 1690 |
| 240 | Ga0213872_10145770 | 3300021361 | Bacteria | 1037 |
| 241 | Ga0209674_100039 | 3300025226 | Bacteria | 402292 |
| 242 | Ga0209563_100013 | 3300025230 | Bacteria | 941463 |
| 243 | Ga0209563_100080 | 3300025230 | Bacteria | 199504 |
| 244 | Ga0207427_101227 | 3300025231 | Bacteria | 9906 |
| 245 | Ga0207425_1000540 | 3300025245 | Bacteria | 22766 |
| 246 | Ga0209026_1019054 | 3300025250 | Bacteria | 1079 |
| 247 | Ga0209677_100086 | 3300025253 | Bacteria | 112759 |
| 248 | Ga0209677_101082 | 3300025253 | Bacteria | 12847 |
| 249 | Ga0209759_1003908 | 3300025256 | Bacteria | 5748 |
| 250 | Ga0209759_1006233 | 3300025256 | Bacteria | 4043 |
| 251 | Ga0209759_1012837 | 3300025256 | Bacteria | 2299 |
| 252 | Ga0209129_1000027 | 3300025258 | Bacteria | 409587 |
| 253 | Ga0209673_1007822 | 3300025273 | Bacteria | 4847 |
| 254 | Ga0209673_1023535 | 3300025273 | Bacteria | 2094 |
| 255 | Ga0209130_1005108 | 3300025284 | Bacteria | 4675 |
| 256 | Ga0209675_1003613 | 3300025291 | Bacteria | 7266 |
| 257 | Ga0209676_1011901 | 3300025292 | Bacteria | 3465 |
| 258 | Ga0209025_1080447 | 3300025294 | Bacteria | 1109 |
| 259 | Ga0209564_1000008 | 3300025295 | Bacteria | 953227 |
| 260 | Ga0209564_1000139 | 3300025295 | Bacteria | 180328 |
| 261 | Ga0209758_1000052 | 3300025297 | Bacteria | 338962 |
| 262 | Ga0209758_1000146 | 3300025297 | Bacteria | 169246 |
| 263 | Ga0209050_1000165 | 3300025298 | Bacteria | 152109 |
| 264 | Ga0209050_1003503 | 3300025298 | Bacteria | 11501 |
| 265 | Ga0209050_1007646 | 3300025298 | Bacteria | 5988 |
| 266 | Ga0209256_1000450 | 3300025299 | Bacteria | 62771 |
| 267 | Ga0209256_1002818 | 3300025299 | Bacteria | 13287 |
| 268 | Ga0209051_1000960 | 3300025303 | Bacteria | 28324 |
| 269 | Ga0209051_1001306 | 3300025303 | Bacteria | 21908 |
| 270 | Ga0209051_1001911 | 3300025303 | Bacteria | 16199 |
| 271 | Ga0209051_1003358 | 3300025303 | Bacteria | 10539 |
| 272 | Ga0209051_1017387 | 3300025303 | Bacteria | 3215 |
| 273 | Ga0209051_1029773 | 3300025303 | Bacteria | 2130 |
| 274 | Ga0209051_1031375 | 3300025303 | Bacteria | 2046 |
| 275 | Ga0209257_1000021 | 3300025304 | Bacteria | 771986 |
| 276 | Ga0209257_1002089 | 3300025304 | Bacteria | 21013 |
| 277 | Ga0209257_1003471 | 3300025304 | Bacteria | 13465 |
| 278 | Ga0209257_1008791 | 3300025304 | Bacteria | 5608 |
| 279 | Ga0209257_1015805 | 3300025304 | Bacteria | 3105 |
| 280 | Ga0209257_1022940 | 3300025304 | Bacteria | 2210 |
| 281 | Ga0207656_10015553 | 3300025321 | Bacteria | 2947 |
| 282 | Ga0207696_1000056 | 3300025711 | Bacteria | 251959 |
| 283 | Ga0207682_10006671 | 3300025893 | Bacteria | 4638 |
| 284 | Ga0207642_10076128 | 3300025899 | Bacteria | 1614 |
| 285 | Ga0207680_10152913 | 3300025903 | Bacteria | 1540 |
| 286 | Ga0207680_10296234 | 3300025903 | Bacteria | 1127 |
| 287 | Ga0207680_10334783 | 3300025903 | Bacteria | 1061 |
| 288 | Ga0207699_10011916 | 3300025906 | Bacteria | 4407 |
| 289 | Ga0207645_10003365 | 3300025907 | Bacteria | 12167 |
| 290 | Ga0207645_10017173 | 3300025907 | Bacteria | 4778 |
| 291 | Ga0207645_10020521 | 3300025907 | Bacteria | 4324 |
| 292 | Ga0207645_10042506 | 3300025907 | Bacteria | 2908 |
| 293 | Ga0207645_10098862 | 3300025907 | Bacteria | 1881 |
| 294 | Ga0207643_10013594 | 3300025908 | Bacteria | 4410 |
| 295 | Ga0207643_10072199 | 3300025908 | Bacteria | 1988 |
| 296 | Ga0207643_10206318 | 3300025908 | Bacteria | 1198 |
| 297 | Ga0207705_10019660 | 3300025909 | Bacteria | 4829 |
| 298 | Ga0207705_10031396 | 3300025909 | Bacteria | 3792 |
| 299 | Ga0207705_10127325 | 3300025909 | Bacteria | 1893 |
| 300 | Ga0207684_10032013 | 3300025910 | Bacteria | 4473 |
| 301 | Ga0207684_10108651 | 3300025910 | Bacteria | 2373 |
| 302 | Ga0207695_10032446 | 3300025913 | Bacteria | 5714 |
| 303 | Ga0207695_10062546 | 3300025913 | Bacteria | 3842 |
| 304 | Ga0207695_10108859 | 3300025913 | Bacteria | 2754 |
| 305 | Ga0207671_10029878 | 3300025914 | Bacteria | 4067 |
| 306 | Ga0207660_10022584 | 3300025917 | Bacteria | 4240 |
| 307 | Ga0207662_10170728 | 3300025918 | Bacteria | 1394 |
| 308 | Ga0207657_10028179 | 3300025919 | Bacteria | 5129 |
| 309 | Ga0207657_10056950 | 3300025919 | Bacteria | 3371 |
| 310 | Ga0207649_10137159 | 3300025920 | Bacteria | 1669 |
| 311 | Ga0207646_10073049 | 3300025922 | Bacteria | 3064 |
| 312 | Ga0207681_10008706 | 3300025923 | Bacteria | 6198 |
| 313 | Ga0207681_10056233 | 3300025923 | Bacteria | 2683 |
| 314 | Ga0207694_10085822 | 3300025924 | Bacteria | 2478 |
| 315 | Ga0207650_10020768 | 3300025925 | Bacteria | 4636 |
| 316 | Ga0207659_10002055 | 3300025926 | Bacteria | 11945 |
| 317 | Ga0207659_10086804 | 3300025926 | Bacteria | 2327 |
| 318 | Ga0207659_10212084 | 3300025926 | Bacteria | 1553 |
| 319 | Ga0207659_10290240 | 3300025926 | Bacteria | 1340 |
| 320 | Ga0207687_10051425 | 3300025927 | Bacteria | 2872 |
| 321 | Ga0207687_10098633 | 3300025927 | Bacteria | 2145 |
| 322 | Ga0207687_10127772 | 3300025927 | Bacteria | 1911 |
| 323 | Ga0207687_10772859 | 3300025927 | Bacteria | 818 |
| 324 | Ga0207664_10069180 | 3300025929 | Bacteria | 2838 |
| 325 | Ga0207644_10000130 | 3300025931 | Bacteria | 54417 |
| 326 | Ga0207644_10055786 | 3300025931 | Bacteria | 2849 |
| 327 | Ga0207644_10089739 | 3300025931 | Bacteria | 2288 |
| 328 | Ga0207644_10166814 | 3300025931 | Bacteria | 1716 |
| 329 | Ga0207690_10091070 | 3300025932 | Bacteria | 2155 |
| 330 | Ga0207690_10210446 | 3300025932 | Bacteria | 1482 |
| 331 | Ga0207690_10231906 | 3300025932 | Bacteria | 1418 |
| 332 | Ga0207706_10006516 | 3300025933 | Bacteria | 10827 |
| 333 | Ga0207706_10012430 | 3300025933 | Bacteria | 7758 |
| 334 | Ga0207706_10052927 | 3300025933 | Bacteria | 3584 |
| 335 | Ga0207706_10175376 | 3300025933 | Bacteria | 1883 |
| 336 | Ga0207706_10395719 | 3300025933 | Bacteria | 1198 |
| 337 | Ga0207686_10008348 | 3300025934 | Bacteria | 5590 |
| 338 | Ga0207686_10013174 | 3300025934 | Bacteria | 4570 |
| 339 | Ga0207686_10655153 | 3300025934 | Bacteria | 831 |
| 340 | Ga0207686_10686202 | 3300025934 | Bacteria | 813 |
| 341 | Ga0207709_10293772 | 3300025935 | Bacteria | 1205 |
| 342 | Ga0207669_10037308 | 3300025937 | Bacteria | 2787 |
| 343 | Ga0207704_10029131 | 3300025938 | Bacteria | 3074 |
| 344 | Ga0207704_10080820 | 3300025938 | Bacteria | 2100 |
| 345 | Ga0207691_10007829 | 3300025940 | Bacteria | 10293 |
| 346 | Ga0207691_10010432 | 3300025940 | Bacteria | 8913 |
| 347 | Ga0207691_10140544 | 3300025940 | Bacteria | 2128 |
| 348 | Ga0207691_10204670 | 3300025940 | Bacteria | 1716 |
| 349 | Ga0207691_10279656 | 3300025940 | Bacteria | 1436 |
| 350 | Ga0207711_10002256 | 3300025941 | Bacteria | 17295 |
| 351 | Ga0207711_10005210 | 3300025941 | Bacteria | 11014 |
| 352 | Ga0207711_10018486 | 3300025941 | Bacteria | 5796 |
| 353 | Ga0207711_10080376 | 3300025941 | Bacteria | 2847 |
| 354 | Ga0207689_10001818 | 3300025942 | Bacteria | 20157 |
| 355 | Ga0207689_10007166 | 3300025942 | Bacteria | 9803 |
| 356 | Ga0207689_10036462 | 3300025942 | Bacteria | 4082 |
| 357 | Ga0207661_10242244 | 3300025944 | Bacteria | 1600 |
| 358 | Ga0207679_10150484 | 3300025945 | Bacteria | 1893 |
| 359 | Ga0207667_10156804 | 3300025949 | Bacteria | 2342 |
| 360 | Ga0207651_10099340 | 3300025960 | Bacteria | 2155 |
| 361 | Ga0207651_10165931 | 3300025960 | Bacteria | 1736 |
| 362 | Ga0207712_10116224 | 3300025961 | Bacteria | 2015 |
| 363 | Ga0207712_10159131 | 3300025961 | Bacteria | 1753 |
| 364 | Ga0207668_10073256 | 3300025972 | Bacteria | 2454 |
| 365 | Ga0207640_10354970 | 3300025981 | Bacteria | 1179 |
| 366 | Ga0207640_10385132 | 3300025981 | Bacteria | 1137 |
| 367 | Ga0207640_10405351 | 3300025981 | Bacteria | 1111 |
| 368 | Ga0207677_10004871 | 3300026023 | Bacteria | 7243 |
| 369 | Ga0207677_10193732 | 3300026023 | Bacteria | 1610 |
| 370 | Ga0207639_10057980 | 3300026041 | Bacteria | 2976 |
| 371 | Ga0207639_10063590 | 3300026041 | Bacteria | 2858 |
| 372 | Ga0207639_10854018 | 3300026041 | Bacteria | 850 |
| 373 | Ga0207678_10000893 | 3300026067 | Bacteria | 27375 |
| 374 | Ga0207678_10052208 | 3300026067 | Bacteria | 3527 |
| 375 | Ga0207678_10193534 | 3300026067 | Bacteria | 1738 |
| 376 | Ga0207678_10305128 | 3300026067 | Bacteria | 1368 |
| 377 | Ga0207708_10006241 | 3300026075 | Bacteria | 8829 |
| 378 | Ga0207702_10096506 | 3300026078 | Bacteria | 2600 |
| 379 | Ga0207702_10209824 | 3300026078 | Bacteria | 1810 |
| 380 | Ga0207641_10043137 | 3300026088 | Bacteria | 3786 |
| 381 | Ga0207648_10001919 | 3300026089 | Bacteria | 22717 |
| 382 | Ga0207648_10010004 | 3300026089 | Bacteria | 9022 |
| 383 | Ga0207648_10022574 | 3300026089 | Bacteria | 5649 |
| 384 | Ga0207648_10233624 | 3300026089 | Bacteria | 1636 |
| 385 | Ga0207676_10202777 | 3300026095 | Bacteria | 1754 |
| 386 | Ga0207676_10225067 | 3300026095 | Bacteria | 1673 |
| 387 | Ga0207674_10002708 | 3300026116 | Bacteria | 22119 |
| 388 | Ga0207674_10023986 | 3300026116 | Bacteria | 6524 |
| 389 | Ga0207674_10037550 | 3300026116 | Bacteria | 5036 |
| 390 | Ga0207675_100000180 | 3300026118 | Bacteria | 56974 |
| 391 | Ga0207675_100004669 | 3300026118 | Bacteria | 13191 |
| 392 | Ga0207675_100007765 | 3300026118 | Bacteria | 10122 |
| 393 | Ga0207675_100222807 | 3300026118 | Bacteria | 1817 |
| 394 | Ga0207683_10118253 | 3300026121 | Bacteria | 2377 |
| 395 | Ga0207683_10156334 | 3300026121 | Bacteria | 2060 |
| 396 | Ga0207683_10161002 | 3300026121 | Bacteria | 2029 |
| 397 | Ga0207698_10006282 | 3300026142 | Bacteria | 7393 |
| 398 | Ga0209389_1000249 | 3300027296 | Bacteria | 34712 |
| 399 | Ga0209371_1021935 | 3300027312 | Bacteria | 1538 |
| 400 | Ga0209996_1003340 | 3300027395 | Bacteria | 2014 |
| 401 | Ga0209996_1022132 | 3300027395 | Bacteria | 898 |
| 402 | Ga0209984_1012034 | 3300027424 | Bacteria | 1125 |
| 403 | Ga0209995_1019473 | 3300027471 | Bacteria | 1120 |
| 404 | Ga0209968_1003253 | 3300027526 | Bacteria | 2438 |
| 405 | Ga0209982_1004919 | 3300027552 | Bacteria | 1925 |
| 406 | Ga0209982_1029463 | 3300027552 | Bacteria | 861 |
| 407 | Ga0209970_1000108 | 3300027614 | Bacteria | 11841 |
| 408 | Ga0210002_1000559 | 3300027617 | Bacteria | 5039 |
| 409 | Ga0209983_1000495 | 3300027665 | Bacteria | 8476 |
| 410 | Ga0209971_1000131 | 3300027682 | Bacteria | 22195 |
| 411 | Ga0209966_1000231 | 3300027695 | Bacteria | 21187 |
| 412 | Ga0209998_10000211 | 3300027717 | Bacteria | 20199 |
| 413 | Ga0209974_10001553 | 3300027876 | Bacteria | 8345 |
| 414 | Ga0209974_10002942 | 3300027876 | Bacteria | 6177 |
| 415 | Ga0209974_10035157 | 3300027876 | Bacteria | 1664 |
| 416 | Ga0268266_10506353 | 3300028379 | Bacteria | 1153 |
| 417 | Ga0268265_10103724 | 3300028380 | Bacteria | 2303 |
| 418 | Ga0268265_10243263 | 3300028380 | Bacteria | 1589 |
| 419 | Ga0268264_10040974 | 3300028381 | Bacteria | 3828 |
| 420 | Ga0268264_10077487 | 3300028381 | Bacteria | 2832 |
| 421 | Ga0265334_10000020 | 3300028573 | Bacteria | 133852 |
| 422 | Ga0265334_10056560 | 3300028573 | Bacteria | 1489 |
| 423 | Ga0265336_10000014 | 3300028666 | Bacteria | 241247 |
| 424 | Ga0307517_10116350 | 3300028786 | Bacteria | 2002 |
| 425 | Ga0307515_10000472 | 3300028794 | Bacteria | 96172 |
| 426 | Ga0307515_10001966 | 3300028794 | Bacteria | 45520 |
| 427 | Ga0307515_10009632 | 3300028794 | Bacteria | 18642 |
| 428 | Ga0307515_10013614 | 3300028794 | Bacteria | 15169 |
| 429 | Ga0307515_10014298 | 3300028794 | Bacteria | 14737 |
| 430 | Ga0307515_10026472 | 3300028794 | Bacteria | 9982 |
| 431 | Ga0307515_10102753 | 3300028794 | Bacteria | 3434 |
| 432 | Ga0307515_10323601 | 3300028794 | Bacteria | 1206 |
| 433 | Ga0307515_10356691 | 3300028794 | Bacteria | 1106 |
| 434 | Ga0265324_10006580 | 3300029957 | Bacteria | 4814 |
| 435 | Ga0268256_1024691 | 3300030500 | Bacteria | 1538 |
| 436 | Ga0307511_10053633 | 3300030521 | Bacteria | 3192 |
| 437 | Ga0316177_1136770 | 3300030731 | Bacteria | 6811 |
| 438 | Ga0316181_1026598 | 3300030744 | Bacteria | 2756 |
| 439 | Ga0265330_10000046 | 3300031235 | Bacteria | 108853 |
| 440 | Ga0265330_10015352 | 3300031235 | Bacteria | 3544 |
| 441 | Ga0265332_10000028 | 3300031238 | Bacteria | 184029 |
| 442 | Ga0265328_10032372 | 3300031239 | Bacteria | 1941 |
| 443 | Ga0265325_10009170 | 3300031241 | Bacteria | 5794 |
| 444 | Ga0265329_10045902 | 3300031242 | Bacteria | 1396 |
| 445 | Ga0265327_10000002 | 3300031251 | Bacteria | 856593 |
| 446 | Ga0265327_10000500 | 3300031251 | Bacteria | 68037 |
| 447 | Ga0265327_10000916 | 3300031251 | Bacteria | 43238 |
| 448 | Ga0265327_10006214 | 3300031251 | Bacteria | 9629 |
| 449 | Ga0265316_10000225 | 3300031344 | Bacteria | 65532 |
| 450 | Ga0307513_10000838 | 3300031456 | Bacteria | 44960 |
| 451 | Ga0307513_10083483 | 3300031456 | Bacteria | 3285 |
| 452 | Ga0307513_10109471 | 3300031456 | Bacteria | 2760 |
| 453 | Ga0307513_10118564 | 3300031456 | Bacteria | 2620 |
| 454 | Ga0307509_10000978 | 3300031507 | Bacteria | 48968 |
| 455 | Ga0307509_10034507 | 3300031507 | Bacteria | 5559 |
| 456 | Ga0307509_10140560 | 3300031507 | Bacteria | 2351 |
| 457 | Ga0307509_10267678 | 3300031507 | Bacteria | 1479 |
| 458 | Ga0307408_100000023 | 3300031548 | Bacteria | 295931 |
| 459 | Ga0307408_100027684 | 3300031548 | Bacteria | 3909 |
| 460 | Ga0307408_100337361 | 3300031548 | Bacteria | 1275 |
| 461 | Ga0265313_10000148 | 3300031595 | Bacteria | 73384 |
| 462 | Ga0265313_10084038 | 3300031595 | Bacteria | 1441 |
| 463 | Ga0307508_10000404 | 3300031616 | Bacteria | 51734 |
| 464 | Ga0307514_10009282 | 3300031649 | Bacteria | 8285 |
| 465 | Ga0316575_10010424 | 3300031665 | Bacteria | 3416 |
| 466 | Ga0316579_10005735 | 3300031691 | Bacteria | 5029 |
| 467 | Ga0265314_10000054 | 3300031711 | Bacteria | 184029 |
| 468 | Ga0265314_10001039 | 3300031711 | Bacteria | 32357 |
| 469 | Ga0316576_10003481 | 3300031727 | Bacteria | 9239 |
| 470 | Ga0316576_10014142 | 3300031727 | Bacteria | 5326 |
| 471 | Ga0316576_10015838 | 3300031727 | Bacteria | 5073 |
| 472 | Ga0316576_10202953 | 3300031727 | Bacteria | 1493 |
| 473 | Ga0316576_10260442 | 3300031727 | Bacteria | 1301 |
| 474 | Ga0316578_10016657 | 3300031728 | Bacteria | 3983 |
| 475 | Ga0316578_10039269 | 3300031728 | Bacteria | 2734 |
| 476 | Ga0316578_10119612 | 3300031728 | Bacteria | 1583 |
| 477 | Ga0316578_10170422 | 3300031728 | Bacteria | 1312 |
| 478 | Ga0307516_10000190 | 3300031730 | Bacteria | 79464 |
| 479 | Ga0307516_10001586 | 3300031730 | Bacteria | 31257 |
| 480 | Ga0307516_10001919 | 3300031730 | Bacteria | 28473 |
| 481 | Ga0307516_10002741 | 3300031730 | Bacteria | 23228 |
| 482 | Ga0307405_10282062 | 3300031731 | Bacteria | 1251 |
| 483 | Ga0307410_10108924 | 3300031852 | Bacteria | 2001 |
| 484 | Ga0316585_10002582 | 3300032137 | Bacteria | 4900 |
| 485 | Ga0316593_10098971 | 3300032168 | Bacteria | 1033 |
| 486 | Ga0307507_10008591 | 3300033179 | Bacteria | 14027 |
| 487 | Ga0307510_10225541 | 3300033180 | Bacteria | 1381 |
| 488 | Ga0373948_0001870 | 3300034817 | Bacteria | 3010 |
| 489 | Ga0373959_0002670 | 3300034820 | Bacteria | 2830 |
| 490 | Ga0373928_0070628 | 3300035084 | Bacteria | 863 |
| 491 | Ga0373949_0020409 | 3300035090 | Bacteria | 1516 |
| 492 | Ga0373951_0006594 | 3300035091 | Bacteria | 2652 |
| 493 | Ga0373952_0046530 | 3300035092 | Bacteria | 1020 |
| 494 | Ga0373945_0112569 | 3300035116 | Bacteria | 1075 |
| 495 | Ga0373956_0119610 | 3300035119 | Bacteria | 1230 |
| 496 | Ga0373943_0082234 | 3300035170 | Bacteria | 1653 |
| 497 | Ga0373946_0099075 | 3300035171 | Bacteria | 1304 |
| 498 | Ga0373962_0001639 | 3300035242 | Bacteria | 5317 |
| 499 | Ga0316574_0015641 | 3300035398 | Bacteria | 4405 |
| 500 | Ga0316574_0043236 | 3300035398 | Bacteria | 2783 |
| 501 | Ga0316574_0059311 | 3300035398 | Bacteria | 2399 |
| 502 | Ga0373931_0000260 | 3300035691 | Bacteria | 22370 |
| 503 | Ga0373931_0028974 | 3300035691 | Bacteria | 2839 |
| 504 | Ga0373935_0065291 | 3300035692 | Bacteria | 2335 |
| 505 | Ga0373935_0615488 | 3300035692 | Bacteria | 795 |
| 506 | Ga0373927_0060638 | 3300035695 | Bacteria | 2448 |
| 507 | Ga0373933_0223940 | 3300035724 | Bacteria | 1207 |
| 508 | Ga0373937_0027943 | 3300036401 | Bacteria | 5103 |
| 509 | Ga0373937_0087637 | 3300036401 | Bacteria | 2881 |
| 510 | Ga0373937_0226235 | 3300036401 | Bacteria | 1761 |
| 511 | Ga0316582_0017329 | 3300036647 | Bacteria | 4166 |
| 512 | Ga0316582_0036645 | 3300036647 | Bacteria | 3036 |
| 513 | Ga0316582_0073926 | 3300036647 | Bacteria | 2212 |
| 514 | Ga0316582_0098789 | 3300036647 | Bacteria | 1931 |
| 515 | Ga0316582_0104622 | 3300036647 | Bacteria | 1878 |
| 516 | Ga0316584_0002067 | 3300036712 | Bacteria | 12562 |
| 517 | Ga0316584_0022483 | 3300036712 | Bacteria | 4600 |
| 518 | Ga0316584_0031702 | 3300036712 | Bacteria | 3908 |
| 519 | Ga0316584_0122487 | 3300036712 | Bacteria | 1943 |
| 520 | Ga0373925_0011748 | 3300037068 | Bacteria | 6335 |
| 521 | Ga0395900_0000050 | 3300037418 | Bacteria | 224616 |
| 522 | Ga0395900_0057423 | 3300037418 | Bacteria | 4007 |
| 523 | Ga0395900_0109551 | 3300037418 | Bacteria | 2837 |
| 524 | Ga0395898_0018211 | 3300037466 | Bacteria | 7164 |
| 525 | Ga0395898_0045803 | 3300037466 | Bacteria | 4298 |
| 526 | Ga0395905_0001984 | 3300037471 | Bacteria | 23384 |
| 527 | Ga0395905_0021036 | 3300037471 | Bacteria | 6177 |
| 528 | Ga0395905_0054913 | 3300037471 | Bacteria | 3727 |
| 529 | Ga0395905_0074130 | 3300037471 | Bacteria | 3189 |
| 530 | Ga0395905_0083715 | 3300037471 | Bacteria | 2988 |
| 531 | Ga0395905_0216943 | 3300037471 | Bacteria | 1791 |
| 532 | Ga0395905_0932681 | 3300037471 | Bacteria | 771 |
| 533 | Ga0316581_0001404 | 3300037588 | Bacteria | 5390 |
| 534 | Ga0316581_0061952 | 3300037588 | Bacteria | 1148 |
| 535 | Ga0395901_0005935 | 3300038443 | Bacteria | 12368 |
| 536 | Ga0400490_53799 | 3300038726 | Bacteria | 5451 |
| 537 | Ga0400483_116466 | 3300039062 | Bacteria | 2991 |
| 538 | Ga0400483_153861 | 3300039062 | Bacteria | 1239 |
| 539 | Ga0400483_169795 | 3300039062 | Bacteria | 1587 |
| 540 | Ga0400483_261695 | 3300039062 | Bacteria | 4592 |
| 541 | Ga0436361_0067190 | 3300039447 | Bacteria | 38460 |
| 542 | Ga0436361_0289802 | 3300039447 | Bacteria | 31851 |
| 543 | Ga0436361_0468389 | 3300039447 | Bacteria | 14150 |
| 544 | Ga0436361_0487065 | 3300039447 | Bacteria | 63556 |
| 545 | Ga0436361_0523658 | 3300039447 | Bacteria | 15267 |
| 546 | Ga0436361_0793974 | 3300039447 | Bacteria | 3498 |
| 547 | Ga0436361_1187211 | 3300039447 | Bacteria | 1956 |
| 548 | Ga0439461_0006640 | 3300041410 | Bacteria | 2021 |
| 549 | Ga0451789_1169945 | 3300041443 | Bacteria | 2373 |
| 550 | Ga0451795_0862134 | 3300041456 | Bacteria | 1556 |
| 551 | Ga0451800_0159027 | 3300041459 | Bacteria | 5820 |
| 552 | Ga0451807_0815480 | 3300041486 | Bacteria | 2399 |
| 553 | Ga0451841_0507876 | 3300041498 | Bacteria | 1791 |
| 554 | Ga0451841_0721882 | 3300041498 | Bacteria | 2389 |
| 555 | Ga0451849_0043210 | 3300041505 | Bacteria | 2036 |
| 556 | Ga0451843_1622809 | 3300041509 | Bacteria | 1021 |
| 557 | Ga0451855_0114897 | 3300041511 | Bacteria | 976 |
| 558 | Ga0451855_1766368 | 3300041511 | Bacteria | 1905 |
| 559 | Ga0451853_0386608 | 3300041512 | Bacteria | 1355 |
| 560 | Ga0451853_1984386 | 3300041512 | Bacteria | 1287 |
| 561 | Ga0451853_3443936 | 3300041512 | Bacteria | 1901 |
| 562 | Ga0439433_0035997 | 3300041999 | Bacteria | 1143 |
| 563 | Ga0439437_003217 | 3300042000 | Bacteria | 1760 |
| 564 | Ga0439437_010466 | 3300042000 | Bacteria | 1055 |
| 565 | Ga0439455_0014352 | 3300042012 | Bacteria | 1807 |
| 566 | Ga0439462_0021267 | 3300042015 | Bacteria | 1694 |
| 567 | Ga0450915_002431 | 3300042119 | Bacteria | 976 |
| 568 | Ga0450917_000643 | 3300042120 | Bacteria | 2588 |
| 569 | Ga0450888_000372 | 3300042126 | Bacteria | 4255 |
| 570 | Ga0450890_000265 | 3300042127 | Bacteria | 7730 |
| 571 | Ga0450891_000172 | 3300042129 | Bacteria | 6204 |
| 572 | Ga0450892_000369 | 3300042130 | Bacteria | 5357 |
| 573 | Ga0450896_018074 | 3300042133 | Bacteria | 1020 |
| 574 | Ga0450898_023118 | 3300042134 | Bacteria | 1104 |
| 575 | Ga0450889_000724 | 3300042144 | Bacteria | 3546 |
| 576 | Ga0439434_0044632 | 3300042435 | Bacteria | 1366 |
| 577 | Ga0439444_0011246 | 3300042437 | Bacteria | 1446 |
| 578 | Ga0439459_0042217 | 3300042438 | Bacteria | 973 |
| 579 | Ga0450916_000410 | 3300042530 | Bacteria | 3654 |
| 580 | Ga0450893_0001970 | 3300042532 | Bacteria | 3192 |
| 581 | Ga0451577_0006813 | 3300042876 | Bacteria | 11324 |
| 582 | Ga0451577_0008542 | 3300042876 | Bacteria | 9962 |
| 583 | Ga0451577_0011170 | 3300042876 | Bacteria | 8518 |
| 584 | Ga0451577_0065013 | 3300042876 | Bacteria | 3253 |
| 585 | Ga0451577_0083129 | 3300042876 | Bacteria | 2856 |
| 586 | Ga0451577_0448281 | 3300042876 | Bacteria | 1172 |
| 587 | Ga0466969_0002013 | 3300044656 | Bacteria | 10849 |
| 588 | Ga0466969_0008421 | 3300044656 | Bacteria | 5469 |
| 589 | Ga0466969_0041626 | 3300044656 | Bacteria | 2297 |
| 590 | Ga0466972_0035699 | 3300044658 | Bacteria | 2433 |
| 591 | Ga0466965_0011163 | 3300044683 | Bacteria | 4205 |
| 592 | Ga0466965_0029198 | 3300044683 | Bacteria | 2682 |
| 593 | Ga0466965_0107718 | 3300044683 | Bacteria | 1430 |
| 594 | Ga0466966_0010218 | 3300044684 | Bacteria | 6226 |
| 595 | Ga0466966_0021661 | 3300044684 | Bacteria | 4219 |
| 596 | Ga0466966_0023898 | 3300044684 | Bacteria | 3999 |
| 597 | Ga0466966_0048250 | 3300044684 | Bacteria | 2712 |
| 598 | Ga0466966_0113306 | 3300044684 | Bacteria | 1670 |
| 599 | Ga0466961_0002200 | 3300044693 | Bacteria | 12137 |
| 600 | Ga0466961_0033437 | 3300044693 | Bacteria | 3303 |
| 601 | Ga0466961_0051535 | 3300044693 | Bacteria | 2628 |
| 602 | Ga0466961_0071277 | 3300044693 | Bacteria | 2205 |
| 603 | Ga0466963_0073113 | 3300044694 | Bacteria | 2311 |
| 604 | Ga0466963_0108794 | 3300044694 | Bacteria | 1901 |
| 605 | Ga0466964_0007954 | 3300044706 | Bacteria | 3969 |
| 606 | Ga0453684_0000891 | 3300044712 | Bacteria | 99637 |
| 607 | Ga0453684_0013441 | 3300044712 | Bacteria | 13293 |
| 608 | Ga0453684_0079940 | 3300044712 | Bacteria | 4085 |
| 609 | Ga0453684_0194566 | 3300044712 | Bacteria | 2369 |
| 610 | Ga0453684_0209467 | 3300044712 | Bacteria | 2267 |
| 611 | Ga0453684_0271033 | 3300044712 | Bacteria | 1940 |
| 612 | Ga0453684_0390796 | 3300044712 | Bacteria | 1560 |
| 613 | Ga0466971_0032473 | 3300044719 | Bacteria | 2339 |
| 614 | Ga0466971_0260961 | 3300044719 | Bacteria | 826 |
| 615 | Ga0466968_0117575 | 3300044735 | Bacteria | 1201 |
| 616 | Ga0466970_0014719 | 3300044765 | Bacteria | 4019 |
| 617 | Ga0466970_0019679 | 3300044765 | Bacteria | 3501 |
| 618 | Ga0466970_0028610 | 3300044765 | Bacteria | 2930 |
| 619 | Ga0466970_0054537 | 3300044765 | Bacteria | 2135 |
| 620 | Ga0466957_0019735 | 3300044842 | Bacteria | 3966 |
| 621 | Ga0466957_0068719 | 3300044842 | Bacteria | 2187 |
| 622 | Ga0466957_0320190 | 3300044842 | Bacteria | 1046 |
| 623 | Ga0466957_0436436 | 3300044842 | Bacteria | 900 |
| 624 | Ga0466960_0087023 | 3300044901 | Bacteria | 1585 |
| 625 | Ga0466959_0000027 | 3300045049 | Bacteria | 114262 |
| 626 | Ga0466959_0003256 | 3300045049 | Bacteria | 10576 |
| 627 | Ga0466959_0005465 | 3300045049 | Bacteria | 8705 |
| 628 | Ga0466959_0014466 | 3300045049 | Bacteria | 5734 |
| 629 | Ga0466959_0032734 | 3300045049 | Bacteria | 3848 |
| 630 | Ga0451576_0032100 | 3300045051 | Bacteria | 5596 |
| 631 | Ga0451576_0054395 | 3300045051 | Bacteria | 4191 |
| 632 | Ga0451576_0104294 | 3300045051 | Bacteria | 2949 |
| 633 | Ga0451576_0234542 | 3300045051 | Bacteria | 1916 |
| 634 | Ga0466958_0033144 | 3300045836 | Bacteria | 3076 |
| 635 | Ga0466967_0179837 | 3300045976 | Bacteria | 1994 |
| 636 | Ga0466967_0353636 | 3300045976 | Bacteria | 1422 |
| 637 | Ga0495617_135186 | 3300046452 | Bacteria | 789 |
| 638 | Ga0495590_0064940 | 3300046457 | Bacteria | 1277 |
| 639 | Ga0495650_0006230 | 3300046471 | Bacteria | 7478 |
| 640 | Ga0495650_0019004 | 3300046471 | Bacteria | 3398 |
| 641 | Ga0495583_0000418 | 3300046506 | Bacteria | 64708 |
| 642 | Ga0495606_0007392 | 3300046507 | Bacteria | 9850 |
| 643 | Ga0495610_0074407 | 3300046512 | Bacteria | 1576 |
| 644 | Ga0495620_0043096 | 3300046515 | Bacteria | 1968 |
| 645 | Ga0495628_0097515 | 3300046516 | Bacteria | 2271 |
| 646 | Ga0495632_0002445 | 3300046519 | Bacteria | 14134 |
| 647 | Ga0495632_0011605 | 3300046519 | Bacteria | 5132 |
| 648 | Ga0495632_0083743 | 3300046519 | Bacteria | 1518 |
| 649 | Ga0495643_0039998 | 3300046522 | Bacteria | 2562 |
| 650 | Ga0495643_0180498 | 3300046522 | Bacteria | 1026 |
| 651 | Ga0495648_0096955 | 3300046524 | Bacteria | 1637 |
| 652 | Ga0495652_0223422 | 3300046529 | Bacteria | 1414 |
| 653 | Ga0495586_0063537 | 3300046535 | Bacteria | 2011 |
| 654 | Ga0495621_0149453 | 3300046539 | Bacteria | 918 |
| 655 | Ga0495597_0002628 | 3300046542 | Bacteria | 11179 |
| 656 | Ga0495597_0026800 | 3300046542 | Bacteria | 2647 |
| 657 | Ga0495668_0011498 | 3300046616 | Bacteria | 5300 |
| 658 | Ga0495668_0164594 | 3300046616 | Bacteria | 1215 |
| 659 | Ga0495625_0001715 | 3300046660 | Bacteria | 25497 |
| 660 | Ga0495625_0009435 | 3300046660 | Bacteria | 8165 |
| 661 | Ga0495625_0019481 | 3300046660 | Bacteria | 5262 |
| 662 | Ga0495625_0120764 | 3300046660 | Bacteria | 1783 |
| 663 | Ga0495658_0142213 | 3300046683 | Bacteria | 1468 |
| 664 | Ga0495670_0014940 | 3300046691 | Bacteria | 3822 |
| 665 | Ga0495649_0000190 | 3300046694 | Bacteria | 53998 |
| 666 | Ga0495649_0000800 | 3300046694 | Bacteria | 25336 |
| 667 | Ga0495589_0007457 | 3300046794 | Bacteria | 5733 |
| 668 | Ga0495687_001857 | 3300047443 | Bacteria | 18408 |
| 669 | Ga0495686_0006525 | 3300047472 | Bacteria | 8909 |
| 670 | Ga0495686_0057069 | 3300047472 | Bacteria | 2438 |
| 671 | Ga0496101_0050543 | 3300048904 | Bacteria | 2993 |
| 672 | Ga0496101_0480860 | 3300048904 | Bacteria | 981 |
| 673 | Ga0496102_0050044 | 3300048905 | Bacteria | 3804 |
| 674 | Ga0496104_0154554 | 3300048907 | Bacteria | 2202 |
| 675 | Ga0496104_0300495 | 3300048907 | Bacteria | 1517 |
| 676 | Ga0496105_0080052 | 3300048908 | Bacteria | 2698 |
| 677 | Ga0496105_0469671 | 3300048908 | Bacteria | 991 |
| 678 | Ga0496106_0010561 | 3300048909 | Bacteria | 6819 |
| 679 | Ga0496107_0074769 | 3300048910 | Bacteria | 2465 |
| 680 | Ga0496108_0039727 | 3300048911 | Bacteria | 3921 |
| 681 | Ga0496108_0180959 | 3300048911 | Bacteria | 1826 |
| 682 | Ga0496108_0248772 | 3300048911 | Bacteria | 1546 |
| 683 | Ga0496108_0274243 | 3300048911 | Bacteria | 1468 |
| 684 | Ga0496109_0066126 | 3300048912 | Bacteria | 3310 |
| 685 | Ga0496109_0108502 | 3300048912 | Bacteria | 2580 |
| 686 | Ga0496109_0204329 | 3300048912 | Bacteria | 1857 |
| 687 | Ga0496109_0411156 | 3300048912 | Bacteria | 1278 |
| 688 | Ga0496109_0532072 | 3300048912 | Bacteria | 1109 |
| 689 | Ga0496110_0060393 | 3300048913 | Bacteria | 3343 |
| 690 | Ga0496110_0112931 | 3300048913 | Bacteria | 2443 |
| 691 | Ga0496111_0044391 | 3300048914 | Bacteria | 3195 |
| 692 | Ga0496112_0036230 | 3300048915 | Bacteria | 4811 |
| 693 | Ga0496113_0017705 | 3300048916 | Bacteria | 4953 |
| 694 | Ga0496113_0063308 | 3300048916 | Bacteria | 2795 |
| 695 | Ga0496114_0026475 | 3300048917 | Bacteria | 4748 |
| 696 | Ga0496114_0147788 | 3300048917 | Bacteria | 2038 |
| 697 | Ga0496115_0142416 | 3300048918 | Bacteria | 1978 |
| 698 | Ga0496117_0000085 | 3300048920 | Bacteria | 213887 |
| 699 | Ga0496122_0052463 | 3300048925 | Bacteria | 3086 |
| 700 | Ga0496124_0000138 | 3300048927 | Bacteria | 150311 |
| 701 | Ga0496124_0006369 | 3300048927 | Bacteria | 12875 |
| 702 | Ga0496125_0011386 | 3300048928 | Bacteria | 8902 |
| 703 | Ga0496125_0012796 | 3300048928 | Bacteria | 8295 |
| 704 | Ga0496126_0045349 | 3300048929 | Bacteria | 4041 |
| 705 | Ga0496126_0207546 | 3300048929 | Bacteria | 1651 |
| 706 | Ga0501291_003045 | 3300049514 | Bacteria | 2064 |
| 707 | Ga0501294_002448 | 3300049517 | Bacteria | 1758 |
| 708 | Ga0501298_012118 | 3300049521 | Bacteria | 1507 |
| 709 | Ga0501298_031299 | 3300049521 | Bacteria | 1045 |
| 710 | Ga0501300_003243 | 3300049523 | Bacteria | 2427 |
| 711 | Ga0501303_008263 | 3300049526 | Bacteria | 943 |
| 712 | Ga0501032_0032467 | 3300049569 | Bacteria | 3578 |
| 713 | Ga0501034_0076879 | 3300049571 | Bacteria | 3345 |
| 714 | Ga0501034_0110846 | 3300049571 | Bacteria | 2735 |
| 715 | Ga0501036_0006094 | 3300049572 | Bacteria | 9784 |
| 716 | Ga0501037_0068934 | 3300049573 | Bacteria | 2575 |
| 717 | Ga0501037_0078713 | 3300049573 | Bacteria | 2392 |
| 718 | Ga0501039_0192315 | 3300049575 | Bacteria | 1604 |
| 719 | Ga0501041_0186085 | 3300049577 | Bacteria | 1300 |
| 720 | Ga0501043_0000057 | 3300049579 | Bacteria | 103997 |
| 721 | Ga0501046_0000075 | 3300049580 | Bacteria | 104000 |
| 722 | Ga0501046_0113370 | 3300049580 | Bacteria | 2070 |
| 723 | Ga0501047_0000081 | 3300049581 | Bacteria | 122697 |
| 724 | Ga0501047_0152540 | 3300049581 | Bacteria | 2186 |
| 725 | Ga0501048_0001541 | 3300049582 | Bacteria | 17500 |
| 726 | Ga0501048_0002402 | 3300049582 | Bacteria | 14287 |
| 727 | Ga0501069_0098540 | 3300049585 | Bacteria | 1658 |
| 728 | Ga0501071_0202865 | 3300049587 | Bacteria | 1490 |
| 729 | Ga0501072_0088589 | 3300049588 | Bacteria | 2456 |
| 730 | Ga0501072_0104170 | 3300049588 | Bacteria | 2256 |
| 731 | Ga0501073_0129806 | 3300049589 | Bacteria | 1747 |
| 732 | Ga0501074_0107221 | 3300049590 | Bacteria | 2000 |
| 733 | Ga0501075_0040136 | 3300049591 | Bacteria | 3504 |
| 734 | Ga0501076_0060774 | 3300049592 | Bacteria | 3007 |
| 735 | Ga0501076_0069483 | 3300049592 | Bacteria | 2814 |
| 736 | Ga0501198_000019 | 3300049649 | Bacteria | 83282 |
| 737 | Ga0501206_003348 | 3300049653 | Bacteria | 2037 |
| 738 | Ga0501211_001454 | 3300049658 | Bacteria | 2531 |
| 739 | Ga0501217_005212 | 3300049661 | Bacteria | 2709 |
| 740 | Ga0501222_000055 | 3300049662 | Bacteria | 42112 |
| 741 | Ga0501222_003040 | 3300049662 | Bacteria | 2306 |
| 742 | Ga0501227_005676 | 3300049665 | Bacteria | 2674 |
| 743 | Ga0501233_006530 | 3300049668 | Bacteria | 2193 |
| 744 | Ga0501235_014796 | 3300049669 | Bacteria | 1719 |
| 745 | Ga0501249_020722 | 3300049679 | Bacteria | 1431 |
| 746 | Ga0501252_011662 | 3300049682 | Bacteria | 1054 |
| 747 | Ga0501253_007968 | 3300049683 | Bacteria | 1503 |
| 748 | Ga0501258_000573 | 3300049687 | Bacteria | 2579 |
| 749 | Ga0501221_001517 | 3300049704 | Bacteria | 3842 |
| 750 | Ga0501079_0156538 | 3300049741 | Bacteria | 1776 |
| 751 | Ga0501080_0185109 | 3300049742 | Bacteria | 1915 |
| 752 | Ga0501081_0134729 | 3300049743 | Bacteria | 1767 |
| 753 | Ga0501081_0261315 | 3300049743 | Bacteria | 1265 |
| 754 | Ga0501232_002654 | 3300049757 | Bacteria | 1572 |
| 755 | Ga0501262_001172 | 3300049759 | Bacteria | 2971 |
| 756 | Ga0501262_001821 | 3300049759 | Bacteria | 2392 |
| 757 | Ga0501264_003691 | 3300049761 | Bacteria | 1393 |
| 758 | Ga0501265_001469 | 3300049762 | Bacteria | 2654 |
| 759 | Ga0501265_005476 | 3300049762 | Bacteria | 1464 |
| 760 | Ga0501269_002119 | 3300049766 | Bacteria | 2483 |
| 761 | Ga0501270_005045 | 3300049767 | Bacteria | 1515 |
| 762 | Ga0501272_001810 | 3300049769 | Bacteria | 2079 |
| 763 | Ga0501035_0103197 | 3300049822 | Bacteria | 2501 |
| 764 | Ga0501044_0229639 | 3300049823 | Bacteria | 1804 |
| 765 | Ga0501045_0004857 | 3300049824 | Bacteria | 9302 |
| 766 | Ga0501045_0228984 | 3300049824 | Bacteria | 1383 |
| 767 | nmdc:mga03683_45721_c1 | 3300050489 | Bacteria | 1813 |
| 768 | nmdc:mga03683_7493_c1 | 3300050489 | Bacteria | 3791 |
| 769 | nmdc:mga03n38_27067_c1 | 3300050490 | Bacteria | 2374 |
| 770 | nmdc:mga03n38_61427_c1 | 3300050490 | Bacteria | 1711 |
| 771 | nmdc:mga03n38_9432_c1 | 3300050490 | Bacteria | 3552 |
| 772 | nmdc:mga00v17_2803_c1 | 3300050491 | Bacteria | 8956 |
| 773 | nmdc:mga00v17_391104_c1 | 3300050491 | Bacteria | 904 |
| 774 | nmdc:mga0yw44_112497_c1 | 3300050492 | Bacteria | 1746 |
| 775 | nmdc:mga0yw44_16241_c1 | 3300050492 | Bacteria | 4017 |
| 776 | nmdc:mga0k408_138_c1 | 3300050493 | Bacteria | 36717 |
| 777 | nmdc:mga0k408_1503_c1 | 3300050493 | Bacteria | 12602 |
| 778 | nmdc:mga0k408_17436_c1 | 3300050493 | Bacteria | 4002 |
| 779 | nmdc:mga0k408_225617_c1 | 3300050493 | Bacteria | 1118 |
| 780 | nmdc:mga0k408_278272_c1 | 3300050493 | Bacteria | 999 |
| 781 | nmdc:mga0k408_28998_c1 | 3300050493 | Bacteria | 3148 |
| 782 | nmdc:mga0k408_29319_c1 | 3300050493 | Bacteria | 3131 |
| 783 | nmdc:mga0k408_391_c1 | 3300050493 | Bacteria | 24032 |
| 784 | nmdc:mga0k408_39510_c1 | 3300050493 | Bacteria | 2712 |
| 785 | nmdc:mga0k408_45856_c1 | 3300050493 | Bacteria | 1615 |
| 786 | nmdc:mga0k408_4715_c1 | 3300050493 | Bacteria | 6796 |
| 787 | nmdc:mga0k408_48568_c1 | 3300050493 | Bacteria | 2455 |
| 788 | nmdc:mga0k408_576_c1 | 3300050493 | Bacteria | 20303 |
| 789 | nmdc:mga0k408_70079_c1 | 3300050493 | Bacteria | 2046 |
| 790 | nmdc:mga0k408_8073_c1 | 3300050493 | Bacteria | 5642 |
| 791 | nmdc:mga0k408_99455_c1 | 3300050493 | Bacteria | 1714 |
| 792 | nmdc:mga06z11_19649_c1 | 3300050494 | Bacteria | 3110 |
| 793 | nmdc:mga06z11_3638_c1 | 3300050494 | Bacteria | 5982 |
| 794 | nmdc:mga06z11_61362_c1 | 3300050494 | Bacteria | 1961 |
| 795 | nmdc:mga04h51_26992_c1 | 3300050495 | Bacteria | 1780 |
| 796 | nmdc:mga07m45_1014_c1 | 3300050496 | Bacteria | 12410 |
| 797 | nmdc:mga07m45_10764_c1 | 3300050496 | Bacteria | 4788 |
| 798 | nmdc:mga07m45_18749_c1 | 3300050496 | Bacteria | 3742 |
| 799 | nmdc:mga07m45_25133_c1 | 3300050496 | Bacteria | 3265 |
| 800 | nmdc:mga07m45_27982_c1 | 3300050496 | Bacteria | 3110 |
| 801 | nmdc:mga07m45_4479_c1 | 3300050496 | Bacteria | 6834 |
| 802 | nmdc:mga07m45_45267_c1 | 3300050496 | Bacteria | 2471 |
| 803 | nmdc:mga07m45_47048_c1 | 3300050496 | Bacteria | 2425 |
| 804 | nmdc:mga07m45_47676_c1 | 3300050496 | Bacteria | 2409 |
| 805 | nmdc:mga07m45_84631_c1 | 3300050496 | Bacteria | 1813 |
| 806 | nmdc:mga05p37_170801_c1 | 3300050507 | Bacteria | 2651 |
| 807 | nmdc:mga09592_25399_c1 | 3300050508 | Bacteria | 4903 |
| 808 | nmdc:mga09592_277117_c1 | 3300050508 | Bacteria | 1455 |
| 809 | nmdc:mga09592_390009_c1 | 3300050508 | Bacteria | 1204 |
| 810 | nmdc:mga0qj67_143761_c1 | 3300050509 | Bacteria | 1471 |
| 811 | nmdc:mga0qj67_145158_c1 | 3300050509 | Bacteria | 1924 |
| 812 | nmdc:mga0qj67_151419_c1 | 3300050509 | Bacteria | 1882 |
| 813 | nmdc:mga0qj67_23042_c1 | 3300050509 | Bacteria | 4786 |
| 814 | nmdc:mga0qj67_38364_c1 | 3300050509 | Bacteria | 3758 |
| 815 | nmdc:mga06r32_20794_c1 | 3300050510 | Bacteria | 6047 |
| 816 | nmdc:mga06r32_240838_c1 | 3300050510 | Bacteria | 1797 |
| 817 | nmdc:mga06r32_49789_c1 | 3300050510 | Bacteria | 4008 |
| 818 | nmdc:mga06r32_79528_c1 | 3300050510 | Bacteria | 3189 |
| 819 | nmdc:mga0n895_303551_c1 | 3300050512 | Bacteria | 1618 |
| 820 | nmdc:mga0rr50_216183_c1 | 3300050513 | Bacteria | 1581 |
| 821 | nmdc:mga0sz30_14739_c1 | 3300050516 | Bacteria | 3082 |
| 822 | Ga0500578_0001946 | 3300053086 | Bacteria | 18890 |
| 823 | Ga0500578_0368828 | 3300053086 | Bacteria | 835 |
| 824 | Ga0500583_0053617 | 3300053092 | Bacteria | 1881 |
| 825 | Ga0500651_0153797 | 3300053093 | Bacteria | 1379 |
| 826 | Ga0500617_050552 | 3300053124 | Bacteria | 1855 |
| 827 | Ga0500658_0000910 | 3300053134 | Bacteria | 12105 |
| 828 | Ga0500568_0001825 | 3300053139 | Bacteria | 13115 |
| 829 | Ga0500568_0006034 | 3300053139 | Bacteria | 6151 |
| 830 | Ga0500568_0006270 | 3300053139 | Bacteria | 5998 |
| 831 | Ga0500590_015680 | 3300053148 | Bacteria | 3912 |
| 832 | Ga0500622_0000002 | 3300053156 | Bacteria | 646442 |
| 833 | Ga0500622_0000124 | 3300053156 | Bacteria | 81245 |
| 834 | Ga0500622_0002040 | 3300053156 | Bacteria | 15063 |
| 835 | Ga0500622_0085555 | 3300053156 | Bacteria | 1572 |
| 836 | Ga0500636_0011155 | 3300053177 | Bacteria | 5257 |
| 837 | Ga0466962_0003926 | 3300061719 | Bacteria | 7114 |
| 838 | Ga0466962_0026079 | 3300061719 | Bacteria | 2806 |
| 839 | Ga0530510_0048089 | 3300061734 | Bacteria | 3083 |
| 840 | 2585829077 | 2585427591 | Bacteria | 5482980 |
| 841 | 2585833849 | 2585427592 | Bacteria | 5370892 |
| 842 | 2587728282 | 2585428057 | Bacteria | 6737412 |
| 843 | 2587734512 | 2585428058 | Bacteria | 6853932 |
| 844 | 2587754222 | 2585428062 | Bacteria | 6842168 |
| 845 | 2588294999 | 2588253510 | Bacteria | 6901809 |
| 846 | 2643744999 | 2643221544 | Bacteria | 5886209 |
| 847 | 2643867785 | 2643221570 | Bacteria | 5103772 |
| 848 | 2643937251 | 2643221585 | Bacteria | 5812563 |
| 849 | 2643971153 | 2643221592 | Bacteria | 6608788 |
| 850 | 2644142081 | 2643221625 | Bacteria | 6512927 |
| 851 | 2644222759 | 2643221639 | Bacteria | 6649903 |
| 852 | 2644260680 | 2643221646 | Bacteria | 6433402 |
| 853 | 2644276306 | 2643221648 | Bacteria | 6521465 |
| 854 | 2644318416 | 2643221656 | Bacteria | 5809961 |
| 855 | 2644338167 | 2643221660 | Bacteria | 4208257 |
| 856 | 2671110839 | 2667528173 | Bacteria | 5375747 |
| 857 | 2739058944 | 2738541337 | Bacteria | 6183410 |
| 858 | 2739248293 | 2738543013 | Bacteria | 5618633 |
| 859 | 2816470487 | 2816332133 | Bacteria | 7249298 |
| 860 | 2831869221 | 2831864461 | Bacteria | 6502356 |
| 861 | 2842718742 | 2842718218 | Bacteria | 4560148 |
| 862 | 2846035002 | 2846033681 | Bacteria | 4377894 |
| 863 | 2846040680 | 2846037992 | Bacteria | 4526407 |
| 864 | 2886849788 | 2886848708 | Bacteria | 5632523 |
| 865 | 2894024358 | 2894023352 | Bacteria | 5167372 |
| 866 | 2904478699 | 2904474040 | Bacteria | 5504324 |
| 867 | 2919154807 | 2919150387 | Bacteria | 5500879 |
| 868 | 2927148391 | 2927143783 | Bacteria | 5504251 |
| 869 | 2928120682 | 2928115317 | Bacteria | 6477646 |
| 870 | 2939634175 | 2939631187 | Bacteria | 6118131 |
| 871 | 2998345777 | 2998344455 | Bacteria | 4222996 |
| 872 | Ga0157319_1000008 | |||
| 873 | SwRhRL2b_contig_2970801 | |||
| 874 | JGI25162J39368_1000116 | |||
| 875 | JGI25150J39212_1003355 | |||
| 876 | JGI25153J46596_10007422 | |||
| 877 | JGI25153J46596_10007578 | |||
| 878 | rootL2_10000310 | |||
| 879 | rootH1_10233163 | |||
| 880 | Ga0055539_1000431 | |||
| 881 | Ga0055539_1007041 | |||
| 882 | Ga0055533_1000053 | |||
| 883 | Ga0055525_1000904 | |||
| 884 | Ga0055526_1000968 | |||
| 885 | Ga0055526_1001006 | |||
| 886 | Ga0055524_1000999 | |||
| 887 | Ga0055534_1001237 | |||
| 888 | Ga0055540_1011662 | |||
| 889 | Ga0055531_10000007 | |||
| 890 | Ga0055531_10003852 | |||
| 891 | Ga0055531_10019372 | |||
| 892 | Ga0055531_10045285 | |||
| 893 | Ga0055543_1001427 | |||
| 894 | Ga0055543_1034367 | |||
| 895 | Ga0065165_1000101 | |||
| 896 | Ga0065165_1000248 | |||
| 897 | Ga0065704_10000497 | |||
| 898 | Ga0065704_10129202 | |||
| 899 | Ga0065707_10001158 | |||
| 900 | Ga0070658_10083243 | |||
| 901 | Ga0070658_10096192 | |||
| 902 | Ga0070658_10312642 | |||
| 903 | Ga0070676_10006495 | |||
| 904 | Ga0070676_10006926 | |||
| 905 | Ga0070676_10037254 | |||
| 906 | Ga0070683_100076771 | |||
| 907 | Ga0070683_100332058 | |||
| 908 | Ga0070677_10009652 | |||
| 909 | Ga0070677_10044355 | |||
| 910 | Ga0068869_100005147 | |||
| 911 | Ga0068869_100392569 | |||
| 912 | Ga0070666_10246702 | |||
| 913 | Ga0070680_100071876 | |||
| 914 | Ga0070682_100267722 | |||
| 915 | Ga0068868_100012109 | |||
| 916 | Ga0068868_100025002 | |||
| 917 | Ga0068868_100028442 | |||
| 918 | Ga0070660_100049846 | |||
| 919 | Ga0070660_100301603 | |||
| 920 | Ga0070660_100317437 | |||
| 921 | Ga0070660_100610211 | |||
| 922 | Ga0070661_100022742 | |||
| 923 | Ga0070661_100450930 | |||
| 924 | Ga0070668_100040154 | |||
| 925 | Ga0070668_100243705 | |||
| 926 | Ga0070669_100063844 | |||
| 927 | Ga0070675_100007192 | |||
| 928 | Ga0070675_100026729 | |||
| 929 | Ga0070675_100161539 | |||
| 930 | Ga0070675_100172546 | |||
| 931 | Ga0070675_100324667 | |||
| 932 | Ga0070671_100013893 | |||
| 933 | Ga0070671_100027654 | |||
| 934 | Ga0070671_100098197 | |||
| 935 | Ga0070671_100162338 | |||
| 936 | Ga0070671_100199894 | |||
| 937 | Ga0070671_100403812 | |||
| 938 | Ga0070674_100207170 | |||
| 939 | Ga0070673_100093533 | |||
| 940 | Ga0070673_100193550 | |||
| 941 | Ga0070659_100027006 | |||
| 942 | Ga0070659_100062436 | |||
| 943 | Ga0070659_100088337 | |||
| 944 | Ga0070667_100660309 | |||
| 945 | Ga0070714_100097912 | |||
| 946 | Ga0070705_100310254 | |||
| 947 | Ga0070663_100028153 | |||
| 948 | Ga0070663_100188316 | |||
| 949 | Ga0070678_100090868 | |||
| 950 | Ga0070662_100005330 | |||
| 951 | Ga0070662_100013586 | |||
| 952 | Ga0070662_100272547 | |||
| 953 | Ga0070662_100383280 | |||
| 954 | Ga0070662_100600127 | |||
| 955 | Ga0068867_100006378 | |||
| 956 | Ga0068867_100014086 | |||
| 957 | Ga0068867_100029474 | |||
| 958 | Ga0068867_100292722 | |||
| 959 | Ga0070706_100037499 | |||
| 960 | Ga0070706_100186751 | |||
| 961 | Ga0070707_100175509 | |||
| 962 | Ga0070698_100340322 | |||
| 963 | Ga0070699_100029409 | |||
| 964 | Ga0070699_100612276 | |||
| 965 | Ga0070679_100018762 | |||
| 966 | Ga0070684_100080387 | |||
| 967 | Ga0068853_100182902 | |||
| 968 | Ga0068853_100311735 | |||
| 969 | Ga0070672_100004996 | |||
| 970 | Ga0070672_100050827 | |||
| 971 | Ga0070672_100452725 | |||
| 972 | Ga0070695_100058360 | |||
| 973 | Ga0070695_100105044 | |||
| 974 | Ga0070693_100036952 | |||
| 975 | Ga0070693_100041815 | |||
| 976 | Ga0070665_100013839 | |||
| 977 | Ga0070704_100084717 | |||
| 978 | Ga0068855_100001666 | |||
| 979 | Ga0068855_100060304 | |||
| 980 | Ga0070664_100087852 | |||
| 981 | Ga0070664_100523731 | |||
| 982 | Ga0068857_100011579 | |||
| 983 | Ga0068857_100014155 | |||
| 984 | Ga0068857_100131344 | |||
| 985 | Ga0068857_100190736 | |||
| 986 | Ga0068854_100032592 | |||
| 987 | Ga0068854_100111998 | |||
| 988 | Ga0068854_100336745 | |||
| 989 | Ga0070702_100026472 | |||
| 990 | Ga0068852_100007330 | |||
| 991 | Ga0068852_100078758 | |||
| 992 | Ga0068859_100428221 | |||
| 993 | Ga0068864_100047443 | |||
| 994 | Ga0068864_100075435 | |||
| 995 | Ga0068864_100083214 | |||
| 996 | Ga0068864_100411348 | |||
| 997 | Ga0068866_10111336 | |||
| 998 | Ga0068861_100015862 | |||
| 999 | Ga0068861_100016866 | |||
| 1000 | Ga0068861_100027593 | |||
| 1001 | Ga0068851_10017778 | |||
| 1002 | Ga0068851_10027355 | |||
| 1003 | Ga0068851_10027907 | |||
| 1004 | Ga0068870_10004536 | |||
| 1005 | Ga0068870_10203407 | |||
| 1006 | Ga0068870_10316003 | |||
| 1007 | Ga0068858_100047944 | |||
| 1008 | Ga0068860_100038773 | |||
| 1009 | Ga0068860_100175972 | |||
| 1010 | Ga0068862_100007493 | |||
| 1011 | Ga0068862_100010025 | |||
| 1012 | Ga0075365_10010595 | |||
| 1013 | Ga0075365_10011756 | |||
| 1014 | Ga0075365_10057991 | |||
| 1015 | Ga0075365_10129439 | |||
| 1016 | Ga0075368_10009568 | |||
| 1017 | Ga0075368_10011904 | |||
| 1018 | Ga0075363_100001576 | |||
| 1019 | Ga0075363_100073123 | |||
| 1020 | Ga0075364_10003493 | |||
| 1021 | Ga0075364_10056862 | |||
| 1022 | Ga0075432_10000664 | |||
| 1023 | Ga0075362_10001003 | |||
| 1024 | Ga0075362_10003169 | |||
| 1025 | Ga0075362_10036688 | |||
| 1026 | Ga0075367_10001551 | |||
| 1027 | Ga0075367_10036117 | |||
| 1028 | Ga0075367_10073721 | |||
| 1029 | Ga0075369_10020411 | |||
| 1030 | Ga0075366_10000468 | |||
| 1031 | Ga0075366_10054153 | |||
| 1032 | Ga0075366_10054888 | |||
| 1033 | Ga0075366_10088851 | |||
| 1034 | Ga0075366_10133564 | |||
| 1035 | Ga0075366_10227281 | |||
| 1036 | Ga0097621_100009602 | |||
| 1037 | Ga0097621_100167233 | |||
| 1038 | Ga0075370_10000108 | |||
| 1039 | Ga0075370_10000350 | |||
| 1040 | Ga0075370_10011293 | |||
| 1041 | Ga0075370_10018852 | |||
| 1042 | Ga0075370_10018907 | |||
| 1043 | Ga0075370_10024698 | |||
| 1044 | Ga0068871_100011636 | |||
| 1045 | Ga0075428_100045856 | |||
| 1046 | Ga0075428_100097261 | |||
| 1047 | Ga0075430_100012192 | |||
| 1048 | Ga0075430_100041086 | |||
| 1049 | Ga0075431_100002923 | |||
| 1050 | Ga0075431_100030939 | |||
| 1051 | Ga0075431_100044445 | |||
| 1052 | Ga0075434_100107882 | |||
| 1053 | Ga0075429_100003081 | |||
| 1054 | Ga0075429_100128970 | |||
| 1055 | Ga0068865_100031426 | |||
| 1056 | Ga0068865_100084377 | |||
| 1057 | Ga0097620_100428181 | |||
| 1058 | Ga0099823_1000075 | |||
| 1059 | Ga0105250_10000004 | |||
| 1060 | Ga0105240_10281860 | |||
| 1061 | Ga0105240_10932554 | |||
| 1062 | Ga0111539_10174509 | |||
| 1063 | Ga0105245_10011588 | |||
| 1064 | Ga0105245_10023648 | |||
| 1065 | Ga0105245_10111571 | |||
| 1066 | Ga0105245_10664617 | |||
| 1067 | Ga0105243_10012663 | |||
| 1068 | Ga0105243_10025933 | |||
| 1069 | Ga0105243_10044521 | |||
| 1070 | Ga0105243_10397397 | |||
| 1071 | Ga0105241_10078048 | |||
| 1072 | Ga0105242_10009898 | |||
| 1073 | Ga0105242_10563802 | |||
| 1074 | Ga0105242_10571267 | |||
| 1075 | Ga0105242_11120328 | |||
| 1076 | Ga0105248_10002698 | |||
| 1077 | Ga0105248_10014653 | |||
| 1078 | Ga0105248_10131168 | |||
| 1079 | Ga0105237_10023104 | |||
| 1080 | Ga0105238_10070932 | |||
| 1081 | Ga0105249_10061695 | |||
| 1082 | Ga0099796_10013861 | |||
| 1083 | Ga0105239_10654159 | |||
| 1084 | Ga0157373_10121303 | |||
| 1085 | Ga0157371_10312940 | |||
| 1086 | Ga0157369_10072223 | |||
| 1087 | Ga0157374_10012925 | |||
| 1088 | Ga0157374_10048033 | |||
| 1089 | Ga0157374_10087753 | |||
| 1090 | Ga0157378_10149245 | |||
| 1091 | Ga0157372_10023923 | |||
| 1092 | Ga0157372_10080912 | |||
| 1093 | Ga0157372_10947375 | |||
| 1094 | Ga0157375_10016951 | |||
| 1095 | Ga0157375_10028320 | |||
| 1096 | Ga0157375_10183738 | |||
| 1097 | Ga0157375_10957849 | |||
| 1098 | Ga0157380_10079544 | |||
| 1099 | Ga0157380_10725396 | |||
| 1100 | Ga0157380_10969088 | |||
| 1101 | Ga0157379_10000729 | |||
| 1102 | Ga0157379_10036452 | |||
| 1103 | Ga0157379_10121245 | |||
| 1104 | Ga0157376_10028980 | |||
| 1105 | Ga0157376_10862522 | |||
| 1106 | Ga0213872_10000093 | |||
| 1107 | Ga0213872_10000339 | |||
| 1108 | Ga0213872_10000508 | |||
| 1109 | Ga0213872_10003642 | |||
| 1110 | Ga0213872_10062011 | |||
| 1111 | Ga0213872_10145770 | |||
| 1112 | Ga0209674_100039 | |||
| 1113 | Ga0209563_100013 | |||
| 1114 | Ga0209563_100080 | |||
| 1115 | Ga0207427_101227 | |||
| 1116 | Ga0207425_1000540 | |||
| 1117 | Ga0209026_1019054 | |||
| 1118 | Ga0209677_100086 | |||
| 1119 | Ga0209677_101082 | |||
| 1120 | Ga0209759_1003908 | |||
| 1121 | Ga0209759_1006233 | |||
| 1122 | Ga0209759_1012837 | |||
| 1123 | Ga0209129_1000027 | |||
| 1124 | Ga0209673_1007822 | |||
| 1125 | Ga0209673_1023535 | |||
| 1126 | Ga0209130_1005108 | |||
| 1127 | Ga0209675_1003613 | |||
| 1128 | Ga0209676_1011901 | |||
| 1129 | Ga0209025_1080447 | |||
| 1130 | Ga0209564_1000008 | |||
| 1131 | Ga0209564_1000139 | |||
| 1132 | Ga0209758_1000052 | |||
| 1133 | Ga0209758_1000146 | |||
| 1134 | Ga0209050_1000165 | |||
| 1135 | Ga0209050_1003503 | |||
| 1136 | Ga0209050_1007646 | |||
| 1137 | Ga0209256_1000450 | |||
| 1138 | Ga0209256_1002818 | |||
| 1139 | Ga0209051_1000960 | |||
| 1140 | Ga0209051_1001306 | |||
| 1141 | Ga0209051_1001911 | |||
| 1142 | Ga0209051_1003358 | |||
| 1143 | Ga0209051_1017387 | |||
| 1144 | Ga0209051_1029773 | |||
| 1145 | Ga0209051_1031375 | |||
| 1146 | Ga0209257_1000021 | |||
| 1147 | Ga0209257_1002089 | |||
| 1148 | Ga0209257_1003471 | |||
| 1149 | Ga0209257_1008791 | |||
| 1150 | Ga0209257_1015805 | |||
| 1151 | Ga0209257_1022940 | |||
| 1152 | Ga0207656_10015553 | |||
| 1153 | Ga0207696_1000056 | |||
| 1154 | Ga0207682_10006671 | |||
| 1155 | Ga0207642_10076128 | |||
| 1156 | Ga0207680_10152913 | |||
| 1157 | Ga0207680_10296234 | |||
| 1158 | Ga0207680_10334783 | |||
| 1159 | Ga0207699_10011916 | |||
| 1160 | Ga0207645_10003365 | |||
| 1161 | Ga0207645_10017173 | |||
| 1162 | Ga0207645_10020521 | |||
| 1163 | Ga0207645_10042506 | |||
| 1164 | Ga0207645_10098862 | |||
| 1165 | Ga0207643_10013594 | |||
| 1166 | Ga0207643_10072199 | |||
| 1167 | Ga0207643_10206318 | |||
| 1168 | Ga0207705_10019660 | |||
| 1169 | Ga0207705_10031396 | |||
| 1170 | Ga0207705_10127325 | |||
| 1171 | Ga0207684_10032013 | |||
| 1172 | Ga0207684_10108651 | |||
| 1173 | Ga0207695_10032446 | |||
| 1174 | Ga0207695_10062546 | |||
| 1175 | Ga0207695_10108859 | |||
| 1176 | Ga0207671_10029878 | |||
| 1177 | Ga0207660_10022584 | |||
| 1178 | Ga0207662_10170728 | |||
| 1179 | Ga0207657_10028179 | |||
| 1180 | Ga0207657_10056950 | |||
| 1181 | Ga0207649_10137159 | |||
| 1182 | Ga0207646_10073049 | |||
| 1183 | Ga0207681_10008706 | |||
| 1184 | Ga0207681_10056233 | |||
| 1185 | Ga0207694_10085822 | |||
| 1186 | Ga0207650_10020768 | |||
| 1187 | Ga0207659_10002055 | |||
| 1188 | Ga0207659_10086804 | |||
| 1189 | Ga0207659_10212084 | |||
| 1190 | Ga0207659_10290240 | |||
| 1191 | Ga0207687_10051425 | |||
| 1192 | Ga0207687_10098633 | |||
| 1193 | Ga0207687_10127772 | |||
| 1194 | Ga0207687_10772859 | |||
| 1195 | Ga0207664_10069180 | |||
| 1196 | Ga0207644_10000130 | |||
| 1197 | Ga0207644_10055786 | |||
| 1198 | Ga0207644_10089739 | |||
| 1199 | Ga0207644_10166814 | |||
| 1200 | Ga0207690_10091070 | |||
| 1201 | Ga0207690_10210446 | |||
| 1202 | Ga0207690_10231906 | |||
| 1203 | Ga0207706_10006516 | |||
| 1204 | Ga0207706_10012430 | |||
| 1205 | Ga0207706_10052927 | |||
| 1206 | Ga0207706_10175376 | |||
| 1207 | Ga0207706_10395719 | |||
| 1208 | Ga0207686_10008348 | |||
| 1209 | Ga0207686_10013174 | |||
| 1210 | Ga0207686_10655153 | |||
| 1211 | Ga0207686_10686202 | |||
| 1212 | Ga0207709_10293772 | |||
| 1213 | Ga0207669_10037308 | |||
| 1214 | Ga0207704_10029131 | |||
| 1215 | Ga0207704_10080820 | |||
| 1216 | Ga0207691_10007829 | |||
| 1217 | Ga0207691_10010432 | |||
| 1218 | Ga0207691_10140544 | |||
| 1219 | Ga0207691_10204670 | |||
| 1220 | Ga0207691_10279656 | |||
| 1221 | Ga0207711_10002256 | |||
| 1222 | Ga0207711_10005210 | |||
| 1223 | Ga0207711_10018486 | |||
| 1224 | Ga0207711_10080376 | |||
| 1225 | Ga0207689_10001818 | |||
| 1226 | Ga0207689_10007166 | |||
| 1227 | Ga0207689_10036462 | |||
| 1228 | Ga0207661_10242244 | |||
| 1229 | Ga0207679_10150484 | |||
| 1230 | Ga0207667_10156804 | |||
| 1231 | Ga0207651_10099340 | |||
| 1232 | Ga0207651_10165931 | |||
| 1233 | Ga0207712_10116224 | |||
| 1234 | Ga0207712_10159131 | |||
| 1235 | Ga0207668_10073256 | |||
| 1236 | Ga0207640_10354970 | |||
| 1237 | Ga0207640_10385132 | |||
| 1238 | Ga0207640_10405351 | |||
| 1239 | Ga0207677_10004871 | |||
| 1240 | Ga0207677_10193732 | |||
| 1241 | Ga0207639_10057980 | |||
| 1242 | Ga0207639_10063590 | |||
| 1243 | Ga0207639_10854018 | |||
| 1244 | Ga0207678_10000893 | |||
| 1245 | Ga0207678_10052208 | |||
| 1246 | Ga0207678_10193534 | |||
| 1247 | Ga0207678_10305128 | |||
| 1248 | Ga0207708_10006241 | |||
| 1249 | Ga0207702_10096506 | |||
| 1250 | Ga0207702_10209824 | |||
| 1251 | Ga0207641_10043137 | |||
| 1252 | Ga0207648_10001919 | |||
| 1253 | Ga0207648_10010004 | |||
| 1254 | Ga0207648_10022574 | |||
| 1255 | Ga0207648_10233624 | |||
| 1256 | Ga0207676_10202777 | |||
| 1257 | Ga0207676_10225067 | |||
| 1258 | Ga0207674_10002708 | |||
| 1259 | Ga0207674_10023986 | |||
| 1260 | Ga0207674_10037550 | |||
| 1261 | Ga0207675_100000180 | |||
| 1262 | Ga0207675_100004669 | |||
| 1263 | Ga0207675_100007765 | |||
| 1264 | Ga0207675_100222807 | |||
| 1265 | Ga0207683_10118253 | |||
| 1266 | Ga0207683_10156334 | |||
| 1267 | Ga0207683_10161002 | |||
| 1268 | Ga0207698_10006282 | |||
| 1269 | Ga0209389_1000249 | |||
| 1270 | Ga0209371_1021935 | |||
| 1271 | Ga0209996_1003340 | |||
| 1272 | Ga0209996_1022132 | |||
| 1273 | Ga0209984_1012034 | |||
| 1274 | Ga0209995_1019473 | |||
| 1275 | Ga0209968_1003253 | |||
| 1276 | Ga0209982_1004919 | |||
| 1277 | Ga0209982_1029463 | |||
| 1278 | Ga0209970_1000108 | |||
| 1279 | Ga0210002_1000559 | |||
| 1280 | Ga0209983_1000495 | |||
| 1281 | Ga0209971_1000131 | |||
| 1282 | Ga0209966_1000231 | |||
| 1283 | Ga0209998_10000211 | |||
| 1284 | Ga0209974_10001553 | |||
| 1285 | Ga0209974_10002942 | |||
| 1286 | Ga0209974_10035157 | |||
| 1287 | Ga0268266_10506353 | |||
| 1288 | Ga0268265_10103724 | |||
| 1289 | Ga0268265_10243263 | |||
| 1290 | Ga0268264_10040974 | |||
| 1291 | Ga0268264_10077487 | |||
| 1292 | Ga0265334_10000020 | |||
| 1293 | Ga0265334_10056560 | |||
| 1294 | Ga0265336_10000014 | |||
| 1295 | Ga0307517_10116350 | |||
| 1296 | Ga0307515_10000472 | |||
| 1297 | Ga0307515_10001966 | |||
| 1298 | Ga0307515_10009632 | |||
| 1299 | Ga0307515_10013614 | |||
| 1300 | Ga0307515_10014298 | |||
| 1301 | Ga0307515_10026472 | |||
| 1302 | Ga0307515_10102753 | |||
| 1303 | Ga0307515_10323601 | |||
| 1304 | Ga0307515_10356691 | |||
| 1305 | Ga0265324_10006580 | |||
| 1306 | Ga0268256_1024691 | |||
| 1307 | Ga0307511_10053633 | |||
| 1308 | Ga0316177_1136770 | |||
| 1309 | Ga0316181_1026598 | |||
| 1310 | Ga0265330_10000046 | |||
| 1311 | Ga0265330_10015352 | |||
| 1312 | Ga0265332_10000028 | |||
| 1313 | Ga0265328_10032372 | |||
| 1314 | Ga0265325_10009170 | |||
| 1315 | Ga0265329_10045902 | |||
| 1316 | Ga0265327_10000002 | |||
| 1317 | Ga0265327_10000500 | |||
| 1318 | Ga0265327_10000916 | |||
| 1319 | Ga0265327_10006214 | |||
| 1320 | Ga0265316_10000225 | |||
| 1321 | Ga0307513_10000838 | |||
| 1322 | Ga0307513_10083483 | |||
| 1323 | Ga0307513_10109471 | |||
| 1324 | Ga0307513_10118564 | |||
| 1325 | Ga0307509_10000978 | |||
| 1326 | Ga0307509_10034507 | |||
| 1327 | Ga0307509_10140560 | |||
| 1328 | Ga0307509_10267678 | |||
| 1329 | Ga0307408_100000023 | |||
| 1330 | Ga0307408_100027684 | |||
| 1331 | Ga0307408_100337361 | |||
| 1332 | Ga0265313_10000148 | |||
| 1333 | Ga0265313_10084038 | |||
| 1334 | Ga0307508_10000404 | |||
| 1335 | Ga0307514_10009282 | |||
| 1336 | Ga0316575_10010424 | |||
| 1337 | Ga0316579_10005735 | |||
| 1338 | Ga0265314_10000054 | |||
| 1339 | Ga0265314_10001039 | |||
| 1340 | Ga0316576_10003481 | |||
| 1341 | Ga0316576_10014142 | |||
| 1342 | Ga0316576_10015838 | |||
| 1343 | Ga0316576_10202953 | |||
| 1344 | Ga0316576_10260442 | |||
| 1345 | Ga0316578_10016657 | |||
| 1346 | Ga0316578_10039269 | |||
| 1347 | Ga0316578_10119612 | |||
| 1348 | Ga0316578_10170422 | |||
| 1349 | Ga0307516_10000190 | |||
| 1350 | Ga0307516_10001586 | |||
| 1351 | Ga0307516_10001919 | |||
| 1352 | Ga0307516_10002741 | |||
| 1353 | Ga0307405_10282062 | |||
| 1354 | Ga0307410_10108924 | |||
| 1355 | Ga0316585_10002582 | |||
| 1356 | Ga0316593_10098971 | |||
| 1357 | Ga0307507_10008591 | |||
| 1358 | Ga0307510_10225541 | |||
| 1359 | Ga0373948_0001870 | |||
| 1360 | Ga0373959_0002670 | |||
| 1361 | Ga0373928_0070628 | |||
| 1362 | Ga0373949_0020409 | |||
| 1363 | Ga0373951_0006594 | |||
| 1364 | Ga0373952_0046530 | |||
| 1365 | Ga0373945_0112569 | |||
| 1366 | Ga0373956_0119610 | |||
| 1367 | Ga0373943_0082234 | |||
| 1368 | Ga0373946_0099075 | |||
| 1369 | Ga0373962_0001639 | |||
| 1370 | Ga0316574_0015641 | |||
| 1371 | Ga0316574_0043236 | |||
| 1372 | Ga0316574_0059311 | |||
| 1373 | Ga0373931_0000260 | |||
| 1374 | Ga0373931_0028974 | |||
| 1375 | Ga0373935_0065291 | |||
| 1376 | Ga0373935_0615488 | |||
| 1377 | Ga0373927_0060638 | |||
| 1378 | Ga0373933_0223940 | |||
| 1379 | Ga0373937_0027943 | |||
| 1380 | Ga0373937_0087637 | |||
| 1381 | Ga0373937_0226235 | |||
| 1382 | Ga0316582_0017329 | |||
| 1383 | Ga0316582_0036645 | |||
| 1384 | Ga0316582_0073926 | |||
| 1385 | Ga0316582_0098789 | |||
| 1386 | Ga0316582_0104622 | |||
| 1387 | Ga0316584_0002067 | |||
| 1388 | Ga0316584_0022483 | |||
| 1389 | Ga0316584_0031702 | |||
| 1390 | Ga0316584_0122487 | |||
| 1391 | Ga0373925_0011748 | |||
| 1392 | Ga0395900_0000050 | |||
| 1393 | Ga0395900_0057423 | |||
| 1394 | Ga0395900_0109551 | |||
| 1395 | Ga0395898_0018211 | |||
| 1396 | Ga0395898_0045803 | |||
| 1397 | Ga0395905_0001984 | |||
| 1398 | Ga0395905_0021036 | |||
| 1399 | Ga0395905_0054913 | |||
| 1400 | Ga0395905_0074130 | |||
| 1401 | Ga0395905_0083715 | |||
| 1402 | Ga0395905_0216943 | |||
| 1403 | Ga0395905_0932681 | |||
| 1404 | Ga0316581_0001404 | |||
| 1405 | Ga0316581_0061952 | |||
| 1406 | Ga0395901_0005935 | |||
| 1407 | Ga0400490_53799 | |||
| 1408 | Ga0400483_116466 | |||
| 1409 | Ga0400483_153861 | |||
| 1410 | Ga0400483_169795 | |||
| 1411 | Ga0400483_261695 | |||
| 1412 | Ga0436361_0067190 | |||
| 1413 | Ga0436361_0289802 | |||
| 1414 | Ga0436361_0468389 | |||
| 1415 | Ga0436361_0487065 | |||
| 1416 | Ga0436361_0523658 | |||
| 1417 | Ga0436361_0793974 | |||
| 1418 | Ga0436361_1187211 | |||
| 1419 | Ga0439461_0006640 | |||
| 1420 | Ga0451789_1169945 | |||
| 1421 | Ga0451795_0862134 | |||
| 1422 | Ga0451800_0159027 | |||
| 1423 | Ga0451807_0815480 | |||
| 1424 | Ga0451841_0507876 | |||
| 1425 | Ga0451841_0721882 | |||
| 1426 | Ga0451849_0043210 | |||
| 1427 | Ga0451843_1622809 | |||
| 1428 | Ga0451855_0114897 | |||
| 1429 | Ga0451855_1766368 | |||
| 1430 | Ga0451853_0386608 | |||
| 1431 | Ga0451853_1984386 | |||
| 1432 | Ga0451853_3443936 | |||
| 1433 | Ga0439433_0035997 | |||
| 1434 | Ga0439437_003217 | |||
| 1435 | Ga0439437_010466 | |||
| 1436 | Ga0439455_0014352 | |||
| 1437 | Ga0439462_0021267 | |||
| 1438 | Ga0450915_002431 | |||
| 1439 | Ga0450917_000643 | |||
| 1440 | Ga0450888_000372 | |||
| 1441 | Ga0450890_000265 | |||
| 1442 | Ga0450891_000172 | |||
| 1443 | Ga0450892_000369 | |||
| 1444 | Ga0450896_018074 | |||
| 1445 | Ga0450898_023118 | |||
| 1446 | Ga0450889_000724 | |||
| 1447 | Ga0439434_0044632 | |||
| 1448 | Ga0439444_0011246 | |||
| 1449 | Ga0439459_0042217 | |||
| 1450 | Ga0450916_000410 | |||
| 1451 | Ga0450893_0001970 | |||
| 1452 | Ga0451577_0006813 | |||
| 1453 | Ga0451577_0008542 | |||
| 1454 | Ga0451577_0011170 | |||
| 1455 | Ga0451577_0065013 | |||
| 1456 | Ga0451577_0083129 | |||
| 1457 | Ga0451577_0448281 | |||
| 1458 | Ga0466969_0002013 | |||
| 1459 | Ga0466969_0008421 | |||
| 1460 | Ga0466969_0041626 | |||
| 1461 | Ga0466972_0035699 | |||
| 1462 | Ga0466965_0011163 | |||
| 1463 | Ga0466965_0029198 | |||
| 1464 | Ga0466965_0107718 | |||
| 1465 | Ga0466966_0010218 | |||
| 1466 | Ga0466966_0021661 | |||
| 1467 | Ga0466966_0023898 | |||
| 1468 | Ga0466966_0048250 | |||
| 1469 | Ga0466966_0113306 | |||
| 1470 | Ga0466961_0002200 | |||
| 1471 | Ga0466961_0033437 | |||
| 1472 | Ga0466961_0051535 | |||
| 1473 | Ga0466961_0071277 | |||
| 1474 | Ga0466963_0073113 | |||
| 1475 | Ga0466963_0108794 | |||
| 1476 | Ga0466964_0007954 | |||
| 1477 | Ga0453684_0000891 | |||
| 1478 | Ga0453684_0013441 | |||
| 1479 | Ga0453684_0079940 | |||
| 1480 | Ga0453684_0194566 | |||
| 1481 | Ga0453684_0209467 | |||
| 1482 | Ga0453684_0271033 | |||
| 1483 | Ga0453684_0390796 | |||
| 1484 | Ga0466971_0032473 | |||
| 1485 | Ga0466971_0260961 | |||
| 1486 | Ga0466968_0117575 | |||
| 1487 | Ga0466970_0014719 | |||
| 1488 | Ga0466970_0019679 | |||
| 1489 | Ga0466970_0028610 | |||
| 1490 | Ga0466970_0054537 | |||
| 1491 | Ga0466957_0019735 | |||
| 1492 | Ga0466957_0068719 | |||
| 1493 | Ga0466957_0320190 | |||
| 1494 | Ga0466957_0436436 | |||
| 1495 | Ga0466960_0087023 | |||
| 1496 | Ga0466959_0000027 | |||
| 1497 | Ga0466959_0003256 | |||
| 1498 | Ga0466959_0005465 | |||
| 1499 | Ga0466959_0014466 | |||
| 1500 | Ga0466959_0032734 | |||
| 1501 | Ga0451576_0032100 | |||
| 1502 | Ga0451576_0054395 | |||
| 1503 | Ga0451576_0104294 | |||
| 1504 | Ga0451576_0234542 | |||
| 1505 | Ga0466958_0033144 | |||
| 1506 | Ga0466967_0179837 | |||
| 1507 | Ga0466967_0353636 | |||
| 1508 | Ga0495617_135186 | |||
| 1509 | Ga0495590_0064940 | |||
| 1510 | Ga0495650_0006230 | |||
| 1511 | Ga0495650_0019004 | |||
| 1512 | Ga0495583_0000418 | |||
| 1513 | Ga0495606_0007392 | |||
| 1514 | Ga0495610_0074407 | |||
| 1515 | Ga0495620_0043096 | |||
| 1516 | Ga0495628_0097515 | |||
| 1517 | Ga0495632_0002445 | |||
| 1518 | Ga0495632_0011605 | |||
| 1519 | Ga0495632_0083743 | |||
| 1520 | Ga0495643_0039998 | |||
| 1521 | Ga0495643_0180498 | |||
| 1522 | Ga0495648_0096955 | |||
| 1523 | Ga0495652_0223422 | |||
| 1524 | Ga0495586_0063537 | |||
| 1525 | Ga0495621_0149453 | |||
| 1526 | Ga0495597_0002628 | |||
| 1527 | Ga0495597_0026800 | |||
| 1528 | Ga0495668_0011498 | |||
| 1529 | Ga0495668_0164594 | |||
| 1530 | Ga0495625_0001715 | |||
| 1531 | Ga0495625_0009435 | |||
| 1532 | Ga0495625_0019481 | |||
| 1533 | Ga0495625_0120764 | |||
| 1534 | Ga0495658_0142213 | |||
| 1535 | Ga0495670_0014940 | |||
| 1536 | Ga0495649_0000190 | |||
| 1537 | Ga0495649_0000800 | |||
| 1538 | Ga0495589_0007457 | |||
| 1539 | Ga0495687_001857 | |||
| 1540 | Ga0495686_0006525 | |||
| 1541 | Ga0495686_0057069 | |||
| 1542 | Ga0496101_0050543 | |||
| 1543 | Ga0496101_0480860 | |||
| 1544 | Ga0496102_0050044 | |||
| 1545 | Ga0496104_0154554 | |||
| 1546 | Ga0496104_0300495 | |||
| 1547 | Ga0496105_0080052 | |||
| 1548 | Ga0496105_0469671 | |||
| 1549 | Ga0496106_0010561 | |||
| 1550 | Ga0496107_0074769 | |||
| 1551 | Ga0496108_0039727 | |||
| 1552 | Ga0496108_0180959 | |||
| 1553 | Ga0496108_0248772 | |||
| 1554 | Ga0496108_0274243 | |||
| 1555 | Ga0496109_0066126 | |||
| 1556 | Ga0496109_0108502 | |||
| 1557 | Ga0496109_0204329 | |||
| 1558 | Ga0496109_0411156 | |||
| 1559 | Ga0496109_0532072 | |||
| 1560 | Ga0496110_0060393 | |||
| 1561 | Ga0496110_0112931 | |||
| 1562 | Ga0496111_0044391 | |||
| 1563 | Ga0496112_0036230 | |||
| 1564 | Ga0496113_0017705 | |||
| 1565 | Ga0496113_0063308 | |||
| 1566 | Ga0496114_0026475 | |||
| 1567 | Ga0496114_0147788 | |||
| 1568 | Ga0496115_0142416 | |||
| 1569 | Ga0496117_0000085 | |||
| 1570 | Ga0496122_0052463 | |||
| 1571 | Ga0496124_0000138 | |||
| 1572 | Ga0496124_0006369 | |||
| 1573 | Ga0496125_0011386 | |||
| 1574 | Ga0496125_0012796 | |||
| 1575 | Ga0496126_0045349 | |||
| 1576 | Ga0496126_0207546 | |||
| 1577 | Ga0501291_003045 | |||
| 1578 | Ga0501294_002448 | |||
| 1579 | Ga0501298_012118 | |||
| 1580 | Ga0501298_031299 | |||
| 1581 | Ga0501300_003243 | |||
| 1582 | Ga0501303_008263 | |||
| 1583 | Ga0501032_0032467 | |||
| 1584 | Ga0501034_0076879 | |||
| 1585 | Ga0501034_0110846 | |||
| 1586 | Ga0501036_0006094 | |||
| 1587 | Ga0501037_0068934 | |||
| 1588 | Ga0501037_0078713 | |||
| 1589 | Ga0501039_0192315 | |||
| 1590 | Ga0501041_0186085 | |||
| 1591 | Ga0501043_0000057 | |||
| 1592 | Ga0501046_0000075 | |||
| 1593 | Ga0501046_0113370 | |||
| 1594 | Ga0501047_0000081 | |||
| 1595 | Ga0501047_0152540 | |||
| 1596 | Ga0501048_0001541 | |||
| 1597 | Ga0501048_0002402 | |||
| 1598 | Ga0501069_0098540 | |||
| 1599 | Ga0501071_0202865 | |||
| 1600 | Ga0501072_0088589 | |||
| 1601 | Ga0501072_0104170 | |||
| 1602 | Ga0501073_0129806 | |||
| 1603 | Ga0501074_0107221 | |||
| 1604 | Ga0501075_0040136 | |||
| 1605 | Ga0501076_0060774 | |||
| 1606 | Ga0501076_0069483 | |||
| 1607 | Ga0501198_000019 | |||
| 1608 | Ga0501206_003348 | |||
| 1609 | Ga0501211_001454 | |||
| 1610 | Ga0501217_005212 | |||
| 1611 | Ga0501222_000055 | |||
| 1612 | Ga0501222_003040 | |||
| 1613 | Ga0501227_005676 | |||
| 1614 | Ga0501233_006530 | |||
| 1615 | Ga0501235_014796 | |||
| 1616 | Ga0501249_020722 | |||
| 1617 | Ga0501252_011662 | |||
| 1618 | Ga0501253_007968 | |||
| 1619 | Ga0501258_000573 | |||
| 1620 | Ga0501221_001517 | |||
| 1621 | Ga0501079_0156538 | |||
| 1622 | Ga0501080_0185109 | |||
| 1623 | Ga0501081_0134729 | |||
| 1624 | Ga0501081_0261315 | |||
| 1625 | Ga0501232_002654 | |||
| 1626 | Ga0501262_001172 | |||
| 1627 | Ga0501262_001821 | |||
| 1628 | Ga0501264_003691 | |||
| 1629 | Ga0501265_001469 | |||
| 1630 | Ga0501265_005476 | |||
| 1631 | Ga0501269_002119 | |||
| 1632 | Ga0501270_005045 | |||
| 1633 | Ga0501272_001810 | |||
| 1634 | Ga0501035_0103197 | |||
| 1635 | Ga0501044_0229639 | |||
| 1636 | Ga0501045_0004857 | |||
| 1637 | Ga0501045_0228984 | |||
| 1638 | nmdc:mga03683_45721_c1 | |||
| 1639 | nmdc:mga03683_7493_c1 | |||
| 1640 | nmdc:mga03n38_27067_c1 | |||
| 1641 | nmdc:mga03n38_61427_c1 | |||
| 1642 | nmdc:mga03n38_9432_c1 | |||
| 1643 | nmdc:mga00v17_2803_c1 | |||
| 1644 | nmdc:mga00v17_391104_c1 | |||
| 1645 | nmdc:mga0yw44_112497_c1 | |||
| 1646 | nmdc:mga0yw44_16241_c1 | |||
| 1647 | nmdc:mga0k408_138_c1 | |||
| 1648 | nmdc:mga0k408_1503_c1 | |||
| 1649 | nmdc:mga0k408_17436_c1 | |||
| 1650 | nmdc:mga0k408_225617_c1 | |||
| 1651 | nmdc:mga0k408_278272_c1 | |||
| 1652 | nmdc:mga0k408_28998_c1 | |||
| 1653 | nmdc:mga0k408_29319_c1 | |||
| 1654 | nmdc:mga0k408_391_c1 | |||
| 1655 | nmdc:mga0k408_39510_c1 | |||
| 1656 | nmdc:mga0k408_45856_c1 | |||
| 1657 | nmdc:mga0k408_4715_c1 | |||
| 1658 | nmdc:mga0k408_48568_c1 | |||
| 1659 | nmdc:mga0k408_576_c1 | |||
| 1660 | nmdc:mga0k408_70079_c1 | |||
| 1661 | nmdc:mga0k408_8073_c1 | |||
| 1662 | nmdc:mga0k408_99455_c1 | |||
| 1663 | nmdc:mga06z11_19649_c1 | |||
| 1664 | nmdc:mga06z11_3638_c1 | |||
| 1665 | nmdc:mga06z11_61362_c1 | |||
| 1666 | nmdc:mga04h51_26992_c1 | |||
| 1667 | nmdc:mga07m45_1014_c1 | |||
| 1668 | nmdc:mga07m45_10764_c1 | |||
| 1669 | nmdc:mga07m45_18749_c1 | |||
| 1670 | nmdc:mga07m45_25133_c1 | |||
| 1671 | nmdc:mga07m45_27982_c1 | |||
| 1672 | nmdc:mga07m45_4479_c1 | |||
| 1673 | nmdc:mga07m45_45267_c1 | |||
| 1674 | nmdc:mga07m45_47048_c1 | |||
| 1675 | nmdc:mga07m45_47676_c1 | |||
| 1676 | nmdc:mga07m45_84631_c1 | |||
| 1677 | nmdc:mga05p37_170801_c1 | |||
| 1678 | nmdc:mga09592_25399_c1 | |||
| 1679 | nmdc:mga09592_277117_c1 | |||
| 1680 | nmdc:mga09592_390009_c1 | |||
| 1681 | nmdc:mga0qj67_143761_c1 | |||
| 1682 | nmdc:mga0qj67_145158_c1 | |||
| 1683 | nmdc:mga0qj67_151419_c1 | |||
| 1684 | nmdc:mga0qj67_23042_c1 | |||
| 1685 | nmdc:mga0qj67_38364_c1 | |||
| 1686 | nmdc:mga06r32_20794_c1 | |||
| 1687 | nmdc:mga06r32_240838_c1 | |||
| 1688 | nmdc:mga06r32_49789_c1 | |||
| 1689 | nmdc:mga06r32_79528_c1 | |||
| 1690 | nmdc:mga0n895_303551_c1 | |||
| 1691 | nmdc:mga0rr50_216183_c1 | |||
| 1692 | nmdc:mga0sz30_14739_c1 | |||
| 1693 | Ga0500578_0001946 | |||
| 1694 | Ga0500578_0368828 | |||
| 1695 | Ga0500583_0053617 | |||
| 1696 | Ga0500651_0153797 | |||
| 1697 | Ga0500617_050552 | |||
| 1698 | Ga0500658_0000910 | |||
| 1699 | Ga0500568_0001825 | |||
| 1700 | Ga0500568_0006034 | |||
| 1701 | Ga0500568_0006270 | |||
| 1702 | Ga0500590_015680 | |||
| 1703 | Ga0500622_0000002 | |||
| 1704 | Ga0500622_0000124 | |||
| 1705 | Ga0500622_0002040 | |||
| 1706 | Ga0500622_0085555 | |||
| 1707 | Ga0500636_0011155 | |||
| 1708 | Ga0466962_0003926 | |||
| 1709 | Ga0466962_0026079 | |||
| 1710 | Ga0530510_0048089 | |||
| 1711 | 2585829077 | |||
| 1712 | 2585833849 | |||
| 1713 | 2587728282 | |||
| 1714 | 2587734512 | |||
| 1715 | 2587754222 | |||
| 1716 | 2588294999 | |||
| 1717 | 2643744999 | |||
| 1718 | 2643867785 | |||
| 1719 | 2643937251 | |||
| 1720 | 2643971153 | |||
| 1721 | 2644142081 | |||
| 1722 | 2644222759 | |||
| 1723 | 2644260680 | |||
| 1724 | 2644276306 | |||
| 1725 | 2644318416 | |||
| 1726 | 2644338167 | |||
| 1727 | 2671110839 | |||
| 1728 | 2739058944 | |||
| 1729 | 2739248293 | |||
| 1730 | 2816470487 | |||
| 1731 | 2831869221 | |||
| 1732 | 2842718742 | |||
| 1733 | 2846035002 | |||
| 1734 | 2846040680 | |||
| 1735 | 2886849788 | |||
| 1736 | 2894024358 | |||
| 1737 | 2904478699 | |||
| 1738 | 2919154807 | |||
| 1739 | 2927148391 | |||
| 1740 | 2928120682 | |||
| 1741 | 2939634175 | |||
| 1742 | 2998345777 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4obx-assembly1.cif.gz_B | crystal structure of yeast coq5 in the apo form | 0.9148 | 27 | 243 |
| 5wwq-assembly1.cif.gz_A | crystal structure of human nsun6 | 0.8768 | 47 | 163 |
| 7v6h-assembly2.cif.gz_B | crystal structure of the spnl | 0.8485 | 44 | 235 |
| 4obx-assembly1.cif.gz_B | crystal structure of yeast coq5 in the apo form | 0.8438 | 27 | 243 |
| 8i9y-assembly1.cif.gz_CP | cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - ytm1-2 | 0.8396 | 45 | 163 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A887_31_251_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.989 | 27 | 243 | 3.40.50.150 |
| af_P0A887_31_251_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9669 | 27 | 243 | 3.40.50.150 |
| af_C7J169_1_82_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9573 | 35 | 105 | 3.40.50.150 |
| af_Q9VYF8_68_301_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9572 | 27 | 243 | 3.40.50.150 |
| af_P9WFR3_19_228_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9538 | 28 | 243 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U2N2G9-F1-model_v4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) | 0.9913 | 2 | 243 |
GO:0008425
GO:0009060 GO:0009234 GO:0032259 GO:0043770 |
| AF-A0A6A5KTX5-F1-model_v4 | deleted | 0.989 | 3 | 242 |
|
| AF-A0A7X1TTZ2-F1-model_v4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) | 0.9861 | 2 | 242 |
GO:0008425
GO:0009060 GO:0009234 GO:0032259 GO:0043770 |
| AF-A0A2U2N2G9-F1-model_v4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) | 0.9832 | 2 | 243 |
GO:0008425
GO:0009060 GO:0009234 GO:0032259 GO:0043770 |
| AF-A0A0D8Y6T8-F1-model_v4 | 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (EC 2.1.1.201) (Ubiquinone biosynthesis methyltransferase COQ5) | 0.983 | 2 | 242 |
GO:0008425
GO:0031314 GO:0032259 |