F484180

General Info

Members Datasets Scaffolds Average Seq Length
871 459 1742 245

Family's Representative Sequence

Representative Sequence 3300012497|Ga0157319_1000008|Ga0157319_1000008182
Length 276
Sequence MAAALAPAIDRRRRPADRLVAIAPTPPIQQDIPMSSTHFGFETVDETAKARRVRGVFDSVASRYDVMNDLMSMGLHRAWKRYTLAVANLKPGDRVLDIAGGTGDMARLFAKKVGERGMVVHTDINEAMLRTGRERLIDEGLVLPTNLCDAEALPYKDGSFDLVCVAFGLRNMTHKDKALAEMNRVLRPGGRLLVLEFSQVAEPLRKPYDWYSFKVLPRIGSLIAGDADSYRYLAESIRMHPPQAELKALMKSVGFGHVDVHNLTGGVVALHAGIKC

Samples

Sample ID Description Type Environment
1 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
116 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
120 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
121 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
123 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
124 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
188 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
205 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
206 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
207 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
208 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
209 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
210 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
211 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
212 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
213 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
214 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
215 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
216 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
217 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
218 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
219 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
220 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
221 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
222 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
223 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
224 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
225 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
226 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
227 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
228 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
229 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
230 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
231 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
232 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
233 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
234 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
235 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
237 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
238 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
239 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
240 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
241 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
242 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
243 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
244 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
245 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
246 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
247 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
248 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
249 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
250 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
251 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
253 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
254 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
255 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
256 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
257 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
259 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
260 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
261 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
262 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
263 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
264 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
265 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
266 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
267 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
268 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
269 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
270 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
271 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
272 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
273 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
274 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
275 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
276 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
277 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
278 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
279 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
280 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
281 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
282 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
283 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
284 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
285 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
286 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
287 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
288 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
289 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
290 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
291 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
292 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
293 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
294 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
295 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
296 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
297 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
298 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
299 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
300 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
301 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
302 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
303 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
304 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
305 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
306 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
307 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
308 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
309 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
310 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
311 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
312 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
313 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
314 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
315 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
316 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
317 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
318 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
319 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
320 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
321 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
322 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
323 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
324 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
325 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
326 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
327 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
328 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
329 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
330 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
331 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
332 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
333 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
334 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
338 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
339 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
340 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
341 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
342 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
343 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
344 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
345 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
346 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
347 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
348 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
349 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
350 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
351 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
352 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
353 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
354 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
355 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
356 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
357 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
358 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
359 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
370 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
371 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
372 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
373 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
374 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
375 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
376 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
377 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
378 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
379 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
380 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
381 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
382 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
383 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
384 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
385 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
386 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
387 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
388 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
389 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
390 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
391 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
392 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
393 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
394 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
395 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
396 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
397 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
398 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
399 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
402 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
403 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
404 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
405 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
406 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
407 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
408 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
409 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
410 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
411 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
412 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
413 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
414 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
415 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
416 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
417 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
418 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
419 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
420 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
421 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
422 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
423 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
424 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
425 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
426 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
427 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
428 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
429 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
430 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
431 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
432 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
433 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
434 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
435 2643221570 Acidovorax sp. Root568 Isolate Unclassified
436 2643221585 Pelomonas sp. Root662 Isolate Unclassified
437 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
438 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
439 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
440 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
441 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
442 2643221656 Pelomonas sp. Root405 Isolate Unclassified
443 2643221660 Methylibium sp. Root1272 Isolate Unclassified
444 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
445 2738541337 Pelomonas sp. BT06 Isolate Unclassified
446 2738543013 Variovorax sp. BT01 Isolate Unclassified
447 2816332133 Acidovorax radicis 2721A Isolate Unclassified
448 2831864461 Roseateles noduli HZ7 Isolate Nodule
449 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
450 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
451 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
452 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
453 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
454 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
455 2919150387 Rahnella aceris 1817 Isolate Unclassified
456 2927143783 Rahnella sp. 2050 Isolate Unclassified
457 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
458 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
459 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.21
Metatranscriptomes 0.11
Isolates 3.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.19
Nodule 0.46
Rhizoplane 3.67
Rhizosphere 71.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157319_1000008 3300012497 Bacteria 315600
2 SwRhRL2b_contig_2970801 2162886007 Bacteria 1215
3 JGI25162J39368_1000116 3300002737 Bacteria 87942
4 JGI25150J39212_1003355 3300002774 Bacteria 3763
5 JGI25153J46596_10007422 3300003215 Bacteria 5397
6 JGI25153J46596_10007578 3300003215 Bacteria 5312
7 rootL2_10000310 3300003322 Bacteria 31146
8 rootH1_10233163 3300003323 Bacteria 2209
9 Ga0055539_1000431 3300003752 Bacteria 14924
10 Ga0055539_1007041 3300003752 Bacteria 1429
11 Ga0055533_1000053 3300003756 Bacteria 199478
12 Ga0055525_1000904 3300003759 Bacteria 8472
13 Ga0055526_1000968 3300003771 Bacteria 21218
14 Ga0055526_1001006 3300003771 Bacteria 20690
15 Ga0055524_1000999 3300003775 Bacteria 17654
16 Ga0055534_1001237 3300003784 Bacteria 10584
17 Ga0055540_1011662 3300003792 Bacteria 2814
18 Ga0055531_10000007 3300003794 Bacteria 225289
19 Ga0055531_10003852 3300003794 Bacteria 9390
20 Ga0055531_10019372 3300003794 Bacteria 2755
21 Ga0055531_10045285 3300003794 Bacteria 1223
22 Ga0055543_1001427 3300004625 Bacteria 9496
23 Ga0055543_1034367 3300004625 Bacteria 874
24 Ga0065165_1000101 3300005262 Bacteria 141486
25 Ga0065165_1000248 3300005262 Bacteria 93216
26 Ga0065704_10000497 3300005289 Bacteria 19639
27 Ga0065704_10129202 3300005289 Bacteria 1651
28 Ga0065707_10001158 3300005295 Bacteria 8594
29 Ga0070658_10083243 3300005327 Bacteria 2630
30 Ga0070658_10096192 3300005327 Bacteria 2445
31 Ga0070658_10312642 3300005327 Bacteria 1341
32 Ga0070676_10006495 3300005328 Bacteria 6246
33 Ga0070676_10006926 3300005328 Bacteria 6071
34 Ga0070676_10037254 3300005328 Bacteria 2805
35 Ga0070683_100076771 3300005329 Bacteria 3123
36 Ga0070683_100332058 3300005329 Bacteria 1447
37 Ga0070677_10009652 3300005333 Bacteria 3278
38 Ga0070677_10044355 3300005333 Bacteria 1769
39 Ga0068869_100005147 3300005334 Bacteria 8201
40 Ga0068869_100392569 3300005334 Bacteria 1139
41 Ga0070666_10246702 3300005335 Bacteria 1264
42 Ga0070680_100071876 3300005336 Bacteria 2843
43 Ga0070682_100267722 3300005337 Bacteria 1240
44 Ga0068868_100012109 3300005338 Bacteria 6298
45 Ga0068868_100025002 3300005338 Bacteria 4537
46 Ga0068868_100028442 3300005338 Bacteria 4274
47 Ga0070660_100049846 3300005339 Bacteria 3220
48 Ga0070660_100301603 3300005339 Bacteria 1313
49 Ga0070660_100317437 3300005339 Bacteria 1279
50 Ga0070660_100610211 3300005339 Bacteria 913
51 Ga0070661_100022742 3300005344 Bacteria 4489
52 Ga0070661_100450930 3300005344 Bacteria 1023
53 Ga0070668_100040154 3300005347 Bacteria 3580
54 Ga0070668_100243705 3300005347 Bacteria 1490
55 Ga0070669_100063844 3300005353 Bacteria 2711
56 Ga0070675_100007192 3300005354 Bacteria 8577
57 Ga0070675_100026729 3300005354 Bacteria 4631
58 Ga0070675_100161539 3300005354 Bacteria 1927
59 Ga0070675_100172546 3300005354 Bacteria 1866
60 Ga0070675_100324667 3300005354 Bacteria 1360
61 Ga0070671_100013893 3300005355 Bacteria 6495
62 Ga0070671_100027654 3300005355 Bacteria 4669
63 Ga0070671_100098197 3300005355 Bacteria 2456
64 Ga0070671_100162338 3300005355 Bacteria 1889
65 Ga0070671_100199894 3300005355 Bacteria 1695
66 Ga0070671_100403812 3300005355 Bacteria 1169
67 Ga0070674_100207170 3300005356 Bacteria 1518
68 Ga0070673_100093533 3300005364 Bacteria 2462
69 Ga0070673_100193550 3300005364 Bacteria 1748
70 Ga0070659_100027006 3300005366 Bacteria 4420
71 Ga0070659_100062436 3300005366 Bacteria 2945
72 Ga0070659_100088337 3300005366 Bacteria 2482
73 Ga0070667_100660309 3300005367 Bacteria 966
74 Ga0070714_100097912 3300005435 Bacteria 2580
75 Ga0070705_100310254 3300005440 Bacteria 1134
76 Ga0070663_100028153 3300005455 Bacteria 3822
77 Ga0070663_100188316 3300005455 Bacteria 1605
78 Ga0070678_100090868 3300005456 Bacteria 2342
79 Ga0070662_100005330 3300005457 Bacteria 8217
80 Ga0070662_100013586 3300005457 Bacteria 5420
81 Ga0070662_100272547 3300005457 Bacteria 1367
82 Ga0070662_100383280 3300005457 Bacteria 1158
83 Ga0070662_100600127 3300005457 Bacteria 926
84 Ga0068867_100006378 3300005459 Bacteria 8337
85 Ga0068867_100014086 3300005459 Bacteria 5664
86 Ga0068867_100029474 3300005459 Bacteria 3954
87 Ga0068867_100292722 3300005459 Bacteria 1339
88 Ga0070706_100037499 3300005467 Bacteria 4477
89 Ga0070706_100186751 3300005467 Bacteria 1937
90 Ga0070707_100175509 3300005468 Bacteria 2089
91 Ga0070698_100340322 3300005471 Bacteria 1432
92 Ga0070699_100029409 3300005518 Bacteria 4737
93 Ga0070699_100612276 3300005518 Bacteria 993
94 Ga0070679_100018762 3300005530 Bacteria 6715
95 Ga0070684_100080387 3300005535 Bacteria 2883
96 Ga0068853_100182902 3300005539 Bacteria 1901
97 Ga0068853_100311735 3300005539 Bacteria 1457
98 Ga0070672_100004996 3300005543 Bacteria 8737
99 Ga0070672_100050827 3300005543 Bacteria 3230
100 Ga0070672_100452725 3300005543 Bacteria 1106
101 Ga0070695_100058360 3300005545 Bacteria 2495
102 Ga0070695_100105044 3300005545 Bacteria 1908
103 Ga0070693_100036952 3300005547 Bacteria 2720
104 Ga0070693_100041815 3300005547 Bacteria 2580
105 Ga0070665_100013839 3300005548 Bacteria 8114
106 Ga0070704_100084717 3300005549 Bacteria 2344
107 Ga0068855_100001666 3300005563 Bacteria 27785
108 Ga0068855_100060304 3300005563 Bacteria 4437
109 Ga0070664_100087852 3300005564 Bacteria 2688
110 Ga0070664_100523731 3300005564 Bacteria 1094
111 Ga0068857_100011579 3300005577 Bacteria 7673
112 Ga0068857_100014155 3300005577 Bacteria 6947
113 Ga0068857_100131344 3300005577 Bacteria 2259
114 Ga0068857_100190736 3300005577 Bacteria 1867
115 Ga0068854_100032592 3300005578 Bacteria 3627
116 Ga0068854_100111998 3300005578 Bacteria 2060
117 Ga0068854_100336745 3300005578 Bacteria 1231
118 Ga0070702_100026472 3300005615 Bacteria 3116
119 Ga0068852_100007330 3300005616 Bacteria 8047
120 Ga0068852_100078758 3300005616 Bacteria 2916
121 Ga0068859_100428221 3300005617 Bacteria 1420
122 Ga0068864_100047443 3300005618 Bacteria 3689
123 Ga0068864_100075435 3300005618 Bacteria 2944
124 Ga0068864_100083214 3300005618 Bacteria 2810
125 Ga0068864_100411348 3300005618 Bacteria 1287
126 Ga0068866_10111336 3300005718 Bacteria 1528
127 Ga0068861_100015862 3300005719 Bacteria 5319
128 Ga0068861_100016866 3300005719 Bacteria 5175
129 Ga0068861_100027593 3300005719 Bacteria 4138
130 Ga0068851_10017778 3300005834 Bacteria 3421
131 Ga0068851_10027355 3300005834 Bacteria 2811
132 Ga0068851_10027907 3300005834 Bacteria 2785
133 Ga0068870_10004536 3300005840 Bacteria 5983
134 Ga0068870_10203407 3300005840 Bacteria 1202
135 Ga0068870_10316003 3300005840 Bacteria 991
136 Ga0068858_100047944 3300005842 Bacteria 3959
137 Ga0068860_100038773 3300005843 Bacteria 4558
138 Ga0068860_100175972 3300005843 Bacteria 2068
139 Ga0068862_100007493 3300005844 Bacteria 9044
140 Ga0068862_100010025 3300005844 Bacteria 7826
141 Ga0075365_10010595 3300006038 Bacteria 5380
142 Ga0075365_10011756 3300006038 Bacteria 5162
143 Ga0075365_10057991 3300006038 Bacteria 2577
144 Ga0075365_10129439 3300006038 Bacteria 1746
145 Ga0075368_10009568 3300006042 Bacteria 3486
146 Ga0075368_10011904 3300006042 Bacteria 3174
147 Ga0075363_100001576 3300006048 Bacteria 8763
148 Ga0075363_100073123 3300006048 Bacteria 1865
149 Ga0075364_10003493 3300006051 Bacteria 8947
150 Ga0075364_10056862 3300006051 Bacteria 2562
151 Ga0075432_10000664 3300006058 Bacteria 10541
152 Ga0075362_10001003 3300006177 Bacteria 8652
153 Ga0075362_10003169 3300006177 Bacteria 5687
154 Ga0075362_10036688 3300006177 Bacteria 2145
155 Ga0075367_10001551 3300006178 Bacteria 9934
156 Ga0075367_10036117 3300006178 Bacteria 2863
157 Ga0075367_10073721 3300006178 Bacteria 2057
158 Ga0075369_10020411 3300006186 Bacteria 2714
159 Ga0075366_10000468 3300006195 Bacteria 18771
160 Ga0075366_10054153 3300006195 Bacteria 2383
161 Ga0075366_10054888 3300006195 Bacteria 2366
162 Ga0075366_10088851 3300006195 Bacteria 1850
163 Ga0075366_10133564 3300006195 Bacteria 1498
164 Ga0075366_10227281 3300006195 Bacteria 1137
165 Ga0097621_100009602 3300006237 Bacteria 7032
166 Ga0097621_100167233 3300006237 Bacteria 1894
167 Ga0075370_10000108 3300006353 Bacteria 26683
168 Ga0075370_10000350 3300006353 Bacteria 16757
169 Ga0075370_10011293 3300006353 Bacteria 4690
170 Ga0075370_10018852 3300006353 Bacteria 3747
171 Ga0075370_10018907 3300006353 Bacteria 3742
172 Ga0075370_10024698 3300006353 Bacteria 3321
173 Ga0068871_100011636 3300006358 Bacteria 6460
174 Ga0075428_100045856 3300006844 Bacteria 4803
175 Ga0075428_100097261 3300006844 Bacteria 3209
176 Ga0075430_100012192 3300006846 Bacteria 7320
177 Ga0075430_100041086 3300006846 Bacteria 3914
178 Ga0075431_100002923 3300006847 Bacteria 16541
179 Ga0075431_100030939 3300006847 Bacteria 5513
180 Ga0075431_100044445 3300006847 Bacteria 4582
181 Ga0075434_100107882 3300006871 Bacteria 2795
182 Ga0075429_100003081 3300006880 Bacteria 14139
183 Ga0075429_100128970 3300006880 Bacteria 2212
184 Ga0068865_100031426 3300006881 Bacteria 3541
185 Ga0068865_100084377 3300006881 Bacteria 2289
186 Ga0097620_100428181 3300006931 Bacteria 1420
187 Ga0099823_1000075 3300006944 Bacteria 48013
188 Ga0105250_10000004 3300009092 Bacteria 438653
189 Ga0105240_10281860 3300009093 Bacteria 1909
190 Ga0105240_10932554 3300009093 Bacteria 932
191 Ga0111539_10174509 3300009094 Bacteria 2511
192 Ga0105245_10011588 3300009098 Bacteria 7682
193 Ga0105245_10023648 3300009098 Bacteria 5394
194 Ga0105245_10111571 3300009098 Bacteria 2543
195 Ga0105245_10664617 3300009098 Bacteria 1073
196 Ga0105243_10012663 3300009148 Bacteria 6372
197 Ga0105243_10025933 3300009148 Bacteria 4484
198 Ga0105243_10044521 3300009148 Bacteria 3482
199 Ga0105243_10397397 3300009148 Bacteria 1279
200 Ga0105241_10078048 3300009174 Bacteria 2587
201 Ga0105242_10009898 3300009176 Bacteria 7303
202 Ga0105242_10563802 3300009176 Bacteria 1094
203 Ga0105242_10571267 3300009176 Bacteria 1087
204 Ga0105242_11120328 3300009176 Bacteria 802
205 Ga0105248_10002698 3300009177 Bacteria 19716
206 Ga0105248_10014653 3300009177 Bacteria 8628
207 Ga0105248_10131168 3300009177 Bacteria 2828
208 Ga0105237_10023104 3300009545 Bacteria 6376
209 Ga0105238_10070932 3300009551 Bacteria 3482
210 Ga0105249_10061695 3300009553 Bacteria 3441
211 Ga0099796_10013861 3300010159 Bacteria 2314
212 Ga0105239_10654159 3300010375 Bacteria 1200
213 Ga0157373_10121303 3300013100 Bacteria 1837
214 Ga0157371_10312940 3300013102 Bacteria 1138
215 Ga0157369_10072223 3300013105 Bacteria 3704
216 Ga0157374_10012925 3300013296 Bacteria 7274
217 Ga0157374_10048033 3300013296 Bacteria 3959
218 Ga0157374_10087753 3300013296 Bacteria 2962
219 Ga0157378_10149245 3300013297 Bacteria 2177
220 Ga0157372_10023923 3300013307 Bacteria 6628
221 Ga0157372_10080912 3300013307 Bacteria 3676
222 Ga0157372_10947375 3300013307 Bacteria 998
223 Ga0157375_10016951 3300013308 Bacteria 6564
224 Ga0157375_10028320 3300013308 Bacteria 5250
225 Ga0157375_10183738 3300013308 Bacteria 2243
226 Ga0157375_10957849 3300013308 Bacteria 997
227 Ga0157380_10079544 3300014326 Bacteria 2677
228 Ga0157380_10725396 3300014326 Bacteria 1002
229 Ga0157380_10969088 3300014326 Bacteria 882
230 Ga0157379_10000729 3300014968 Bacteria 26640
231 Ga0157379_10036452 3300014968 Bacteria 4385
232 Ga0157379_10121245 3300014968 Bacteria 2352
233 Ga0157376_10028980 3300014969 Bacteria 4407
234 Ga0157376_10862522 3300014969 Bacteria 921
235 Ga0213872_10000093 3300021361 Bacteria 83513
236 Ga0213872_10000339 3300021361 Bacteria 39618
237 Ga0213872_10000508 3300021361 Bacteria 30750
238 Ga0213872_10003642 3300021361 Bacteria 8445
239 Ga0213872_10062011 3300021361 Bacteria 1690
240 Ga0213872_10145770 3300021361 Bacteria 1037
241 Ga0209674_100039 3300025226 Bacteria 402292
242 Ga0209563_100013 3300025230 Bacteria 941463
243 Ga0209563_100080 3300025230 Bacteria 199504
244 Ga0207427_101227 3300025231 Bacteria 9906
245 Ga0207425_1000540 3300025245 Bacteria 22766
246 Ga0209026_1019054 3300025250 Bacteria 1079
247 Ga0209677_100086 3300025253 Bacteria 112759
248 Ga0209677_101082 3300025253 Bacteria 12847
249 Ga0209759_1003908 3300025256 Bacteria 5748
250 Ga0209759_1006233 3300025256 Bacteria 4043
251 Ga0209759_1012837 3300025256 Bacteria 2299
252 Ga0209129_1000027 3300025258 Bacteria 409587
253 Ga0209673_1007822 3300025273 Bacteria 4847
254 Ga0209673_1023535 3300025273 Bacteria 2094
255 Ga0209130_1005108 3300025284 Bacteria 4675
256 Ga0209675_1003613 3300025291 Bacteria 7266
257 Ga0209676_1011901 3300025292 Bacteria 3465
258 Ga0209025_1080447 3300025294 Bacteria 1109
259 Ga0209564_1000008 3300025295 Bacteria 953227
260 Ga0209564_1000139 3300025295 Bacteria 180328
261 Ga0209758_1000052 3300025297 Bacteria 338962
262 Ga0209758_1000146 3300025297 Bacteria 169246
263 Ga0209050_1000165 3300025298 Bacteria 152109
264 Ga0209050_1003503 3300025298 Bacteria 11501
265 Ga0209050_1007646 3300025298 Bacteria 5988
266 Ga0209256_1000450 3300025299 Bacteria 62771
267 Ga0209256_1002818 3300025299 Bacteria 13287
268 Ga0209051_1000960 3300025303 Bacteria 28324
269 Ga0209051_1001306 3300025303 Bacteria 21908
270 Ga0209051_1001911 3300025303 Bacteria 16199
271 Ga0209051_1003358 3300025303 Bacteria 10539
272 Ga0209051_1017387 3300025303 Bacteria 3215
273 Ga0209051_1029773 3300025303 Bacteria 2130
274 Ga0209051_1031375 3300025303 Bacteria 2046
275 Ga0209257_1000021 3300025304 Bacteria 771986
276 Ga0209257_1002089 3300025304 Bacteria 21013
277 Ga0209257_1003471 3300025304 Bacteria 13465
278 Ga0209257_1008791 3300025304 Bacteria 5608
279 Ga0209257_1015805 3300025304 Bacteria 3105
280 Ga0209257_1022940 3300025304 Bacteria 2210
281 Ga0207656_10015553 3300025321 Bacteria 2947
282 Ga0207696_1000056 3300025711 Bacteria 251959
283 Ga0207682_10006671 3300025893 Bacteria 4638
284 Ga0207642_10076128 3300025899 Bacteria 1614
285 Ga0207680_10152913 3300025903 Bacteria 1540
286 Ga0207680_10296234 3300025903 Bacteria 1127
287 Ga0207680_10334783 3300025903 Bacteria 1061
288 Ga0207699_10011916 3300025906 Bacteria 4407
289 Ga0207645_10003365 3300025907 Bacteria 12167
290 Ga0207645_10017173 3300025907 Bacteria 4778
291 Ga0207645_10020521 3300025907 Bacteria 4324
292 Ga0207645_10042506 3300025907 Bacteria 2908
293 Ga0207645_10098862 3300025907 Bacteria 1881
294 Ga0207643_10013594 3300025908 Bacteria 4410
295 Ga0207643_10072199 3300025908 Bacteria 1988
296 Ga0207643_10206318 3300025908 Bacteria 1198
297 Ga0207705_10019660 3300025909 Bacteria 4829
298 Ga0207705_10031396 3300025909 Bacteria 3792
299 Ga0207705_10127325 3300025909 Bacteria 1893
300 Ga0207684_10032013 3300025910 Bacteria 4473
301 Ga0207684_10108651 3300025910 Bacteria 2373
302 Ga0207695_10032446 3300025913 Bacteria 5714
303 Ga0207695_10062546 3300025913 Bacteria 3842
304 Ga0207695_10108859 3300025913 Bacteria 2754
305 Ga0207671_10029878 3300025914 Bacteria 4067
306 Ga0207660_10022584 3300025917 Bacteria 4240
307 Ga0207662_10170728 3300025918 Bacteria 1394
308 Ga0207657_10028179 3300025919 Bacteria 5129
309 Ga0207657_10056950 3300025919 Bacteria 3371
310 Ga0207649_10137159 3300025920 Bacteria 1669
311 Ga0207646_10073049 3300025922 Bacteria 3064
312 Ga0207681_10008706 3300025923 Bacteria 6198
313 Ga0207681_10056233 3300025923 Bacteria 2683
314 Ga0207694_10085822 3300025924 Bacteria 2478
315 Ga0207650_10020768 3300025925 Bacteria 4636
316 Ga0207659_10002055 3300025926 Bacteria 11945
317 Ga0207659_10086804 3300025926 Bacteria 2327
318 Ga0207659_10212084 3300025926 Bacteria 1553
319 Ga0207659_10290240 3300025926 Bacteria 1340
320 Ga0207687_10051425 3300025927 Bacteria 2872
321 Ga0207687_10098633 3300025927 Bacteria 2145
322 Ga0207687_10127772 3300025927 Bacteria 1911
323 Ga0207687_10772859 3300025927 Bacteria 818
324 Ga0207664_10069180 3300025929 Bacteria 2838
325 Ga0207644_10000130 3300025931 Bacteria 54417
326 Ga0207644_10055786 3300025931 Bacteria 2849
327 Ga0207644_10089739 3300025931 Bacteria 2288
328 Ga0207644_10166814 3300025931 Bacteria 1716
329 Ga0207690_10091070 3300025932 Bacteria 2155
330 Ga0207690_10210446 3300025932 Bacteria 1482
331 Ga0207690_10231906 3300025932 Bacteria 1418
332 Ga0207706_10006516 3300025933 Bacteria 10827
333 Ga0207706_10012430 3300025933 Bacteria 7758
334 Ga0207706_10052927 3300025933 Bacteria 3584
335 Ga0207706_10175376 3300025933 Bacteria 1883
336 Ga0207706_10395719 3300025933 Bacteria 1198
337 Ga0207686_10008348 3300025934 Bacteria 5590
338 Ga0207686_10013174 3300025934 Bacteria 4570
339 Ga0207686_10655153 3300025934 Bacteria 831
340 Ga0207686_10686202 3300025934 Bacteria 813
341 Ga0207709_10293772 3300025935 Bacteria 1205
342 Ga0207669_10037308 3300025937 Bacteria 2787
343 Ga0207704_10029131 3300025938 Bacteria 3074
344 Ga0207704_10080820 3300025938 Bacteria 2100
345 Ga0207691_10007829 3300025940 Bacteria 10293
346 Ga0207691_10010432 3300025940 Bacteria 8913
347 Ga0207691_10140544 3300025940 Bacteria 2128
348 Ga0207691_10204670 3300025940 Bacteria 1716
349 Ga0207691_10279656 3300025940 Bacteria 1436
350 Ga0207711_10002256 3300025941 Bacteria 17295
351 Ga0207711_10005210 3300025941 Bacteria 11014
352 Ga0207711_10018486 3300025941 Bacteria 5796
353 Ga0207711_10080376 3300025941 Bacteria 2847
354 Ga0207689_10001818 3300025942 Bacteria 20157
355 Ga0207689_10007166 3300025942 Bacteria 9803
356 Ga0207689_10036462 3300025942 Bacteria 4082
357 Ga0207661_10242244 3300025944 Bacteria 1600
358 Ga0207679_10150484 3300025945 Bacteria 1893
359 Ga0207667_10156804 3300025949 Bacteria 2342
360 Ga0207651_10099340 3300025960 Bacteria 2155
361 Ga0207651_10165931 3300025960 Bacteria 1736
362 Ga0207712_10116224 3300025961 Bacteria 2015
363 Ga0207712_10159131 3300025961 Bacteria 1753
364 Ga0207668_10073256 3300025972 Bacteria 2454
365 Ga0207640_10354970 3300025981 Bacteria 1179
366 Ga0207640_10385132 3300025981 Bacteria 1137
367 Ga0207640_10405351 3300025981 Bacteria 1111
368 Ga0207677_10004871 3300026023 Bacteria 7243
369 Ga0207677_10193732 3300026023 Bacteria 1610
370 Ga0207639_10057980 3300026041 Bacteria 2976
371 Ga0207639_10063590 3300026041 Bacteria 2858
372 Ga0207639_10854018 3300026041 Bacteria 850
373 Ga0207678_10000893 3300026067 Bacteria 27375
374 Ga0207678_10052208 3300026067 Bacteria 3527
375 Ga0207678_10193534 3300026067 Bacteria 1738
376 Ga0207678_10305128 3300026067 Bacteria 1368
377 Ga0207708_10006241 3300026075 Bacteria 8829
378 Ga0207702_10096506 3300026078 Bacteria 2600
379 Ga0207702_10209824 3300026078 Bacteria 1810
380 Ga0207641_10043137 3300026088 Bacteria 3786
381 Ga0207648_10001919 3300026089 Bacteria 22717
382 Ga0207648_10010004 3300026089 Bacteria 9022
383 Ga0207648_10022574 3300026089 Bacteria 5649
384 Ga0207648_10233624 3300026089 Bacteria 1636
385 Ga0207676_10202777 3300026095 Bacteria 1754
386 Ga0207676_10225067 3300026095 Bacteria 1673
387 Ga0207674_10002708 3300026116 Bacteria 22119
388 Ga0207674_10023986 3300026116 Bacteria 6524
389 Ga0207674_10037550 3300026116 Bacteria 5036
390 Ga0207675_100000180 3300026118 Bacteria 56974
391 Ga0207675_100004669 3300026118 Bacteria 13191
392 Ga0207675_100007765 3300026118 Bacteria 10122
393 Ga0207675_100222807 3300026118 Bacteria 1817
394 Ga0207683_10118253 3300026121 Bacteria 2377
395 Ga0207683_10156334 3300026121 Bacteria 2060
396 Ga0207683_10161002 3300026121 Bacteria 2029
397 Ga0207698_10006282 3300026142 Bacteria 7393
398 Ga0209389_1000249 3300027296 Bacteria 34712
399 Ga0209371_1021935 3300027312 Bacteria 1538
400 Ga0209996_1003340 3300027395 Bacteria 2014
401 Ga0209996_1022132 3300027395 Bacteria 898
402 Ga0209984_1012034 3300027424 Bacteria 1125
403 Ga0209995_1019473 3300027471 Bacteria 1120
404 Ga0209968_1003253 3300027526 Bacteria 2438
405 Ga0209982_1004919 3300027552 Bacteria 1925
406 Ga0209982_1029463 3300027552 Bacteria 861
407 Ga0209970_1000108 3300027614 Bacteria 11841
408 Ga0210002_1000559 3300027617 Bacteria 5039
409 Ga0209983_1000495 3300027665 Bacteria 8476
410 Ga0209971_1000131 3300027682 Bacteria 22195
411 Ga0209966_1000231 3300027695 Bacteria 21187
412 Ga0209998_10000211 3300027717 Bacteria 20199
413 Ga0209974_10001553 3300027876 Bacteria 8345
414 Ga0209974_10002942 3300027876 Bacteria 6177
415 Ga0209974_10035157 3300027876 Bacteria 1664
416 Ga0268266_10506353 3300028379 Bacteria 1153
417 Ga0268265_10103724 3300028380 Bacteria 2303
418 Ga0268265_10243263 3300028380 Bacteria 1589
419 Ga0268264_10040974 3300028381 Bacteria 3828
420 Ga0268264_10077487 3300028381 Bacteria 2832
421 Ga0265334_10000020 3300028573 Bacteria 133852
422 Ga0265334_10056560 3300028573 Bacteria 1489
423 Ga0265336_10000014 3300028666 Bacteria 241247
424 Ga0307517_10116350 3300028786 Bacteria 2002
425 Ga0307515_10000472 3300028794 Bacteria 96172
426 Ga0307515_10001966 3300028794 Bacteria 45520
427 Ga0307515_10009632 3300028794 Bacteria 18642
428 Ga0307515_10013614 3300028794 Bacteria 15169
429 Ga0307515_10014298 3300028794 Bacteria 14737
430 Ga0307515_10026472 3300028794 Bacteria 9982
431 Ga0307515_10102753 3300028794 Bacteria 3434
432 Ga0307515_10323601 3300028794 Bacteria 1206
433 Ga0307515_10356691 3300028794 Bacteria 1106
434 Ga0265324_10006580 3300029957 Bacteria 4814
435 Ga0268256_1024691 3300030500 Bacteria 1538
436 Ga0307511_10053633 3300030521 Bacteria 3192
437 Ga0316177_1136770 3300030731 Bacteria 6811
438 Ga0316181_1026598 3300030744 Bacteria 2756
439 Ga0265330_10000046 3300031235 Bacteria 108853
440 Ga0265330_10015352 3300031235 Bacteria 3544
441 Ga0265332_10000028 3300031238 Bacteria 184029
442 Ga0265328_10032372 3300031239 Bacteria 1941
443 Ga0265325_10009170 3300031241 Bacteria 5794
444 Ga0265329_10045902 3300031242 Bacteria 1396
445 Ga0265327_10000002 3300031251 Bacteria 856593
446 Ga0265327_10000500 3300031251 Bacteria 68037
447 Ga0265327_10000916 3300031251 Bacteria 43238
448 Ga0265327_10006214 3300031251 Bacteria 9629
449 Ga0265316_10000225 3300031344 Bacteria 65532
450 Ga0307513_10000838 3300031456 Bacteria 44960
451 Ga0307513_10083483 3300031456 Bacteria 3285
452 Ga0307513_10109471 3300031456 Bacteria 2760
453 Ga0307513_10118564 3300031456 Bacteria 2620
454 Ga0307509_10000978 3300031507 Bacteria 48968
455 Ga0307509_10034507 3300031507 Bacteria 5559
456 Ga0307509_10140560 3300031507 Bacteria 2351
457 Ga0307509_10267678 3300031507 Bacteria 1479
458 Ga0307408_100000023 3300031548 Bacteria 295931
459 Ga0307408_100027684 3300031548 Bacteria 3909
460 Ga0307408_100337361 3300031548 Bacteria 1275
461 Ga0265313_10000148 3300031595 Bacteria 73384
462 Ga0265313_10084038 3300031595 Bacteria 1441
463 Ga0307508_10000404 3300031616 Bacteria 51734
464 Ga0307514_10009282 3300031649 Bacteria 8285
465 Ga0316575_10010424 3300031665 Bacteria 3416
466 Ga0316579_10005735 3300031691 Bacteria 5029
467 Ga0265314_10000054 3300031711 Bacteria 184029
468 Ga0265314_10001039 3300031711 Bacteria 32357
469 Ga0316576_10003481 3300031727 Bacteria 9239
470 Ga0316576_10014142 3300031727 Bacteria 5326
471 Ga0316576_10015838 3300031727 Bacteria 5073
472 Ga0316576_10202953 3300031727 Bacteria 1493
473 Ga0316576_10260442 3300031727 Bacteria 1301
474 Ga0316578_10016657 3300031728 Bacteria 3983
475 Ga0316578_10039269 3300031728 Bacteria 2734
476 Ga0316578_10119612 3300031728 Bacteria 1583
477 Ga0316578_10170422 3300031728 Bacteria 1312
478 Ga0307516_10000190 3300031730 Bacteria 79464
479 Ga0307516_10001586 3300031730 Bacteria 31257
480 Ga0307516_10001919 3300031730 Bacteria 28473
481 Ga0307516_10002741 3300031730 Bacteria 23228
482 Ga0307405_10282062 3300031731 Bacteria 1251
483 Ga0307410_10108924 3300031852 Bacteria 2001
484 Ga0316585_10002582 3300032137 Bacteria 4900
485 Ga0316593_10098971 3300032168 Bacteria 1033
486 Ga0307507_10008591 3300033179 Bacteria 14027
487 Ga0307510_10225541 3300033180 Bacteria 1381
488 Ga0373948_0001870 3300034817 Bacteria 3010
489 Ga0373959_0002670 3300034820 Bacteria 2830
490 Ga0373928_0070628 3300035084 Bacteria 863
491 Ga0373949_0020409 3300035090 Bacteria 1516
492 Ga0373951_0006594 3300035091 Bacteria 2652
493 Ga0373952_0046530 3300035092 Bacteria 1020
494 Ga0373945_0112569 3300035116 Bacteria 1075
495 Ga0373956_0119610 3300035119 Bacteria 1230
496 Ga0373943_0082234 3300035170 Bacteria 1653
497 Ga0373946_0099075 3300035171 Bacteria 1304
498 Ga0373962_0001639 3300035242 Bacteria 5317
499 Ga0316574_0015641 3300035398 Bacteria 4405
500 Ga0316574_0043236 3300035398 Bacteria 2783
501 Ga0316574_0059311 3300035398 Bacteria 2399
502 Ga0373931_0000260 3300035691 Bacteria 22370
503 Ga0373931_0028974 3300035691 Bacteria 2839
504 Ga0373935_0065291 3300035692 Bacteria 2335
505 Ga0373935_0615488 3300035692 Bacteria 795
506 Ga0373927_0060638 3300035695 Bacteria 2448
507 Ga0373933_0223940 3300035724 Bacteria 1207
508 Ga0373937_0027943 3300036401 Bacteria 5103
509 Ga0373937_0087637 3300036401 Bacteria 2881
510 Ga0373937_0226235 3300036401 Bacteria 1761
511 Ga0316582_0017329 3300036647 Bacteria 4166
512 Ga0316582_0036645 3300036647 Bacteria 3036
513 Ga0316582_0073926 3300036647 Bacteria 2212
514 Ga0316582_0098789 3300036647 Bacteria 1931
515 Ga0316582_0104622 3300036647 Bacteria 1878
516 Ga0316584_0002067 3300036712 Bacteria 12562
517 Ga0316584_0022483 3300036712 Bacteria 4600
518 Ga0316584_0031702 3300036712 Bacteria 3908
519 Ga0316584_0122487 3300036712 Bacteria 1943
520 Ga0373925_0011748 3300037068 Bacteria 6335
521 Ga0395900_0000050 3300037418 Bacteria 224616
522 Ga0395900_0057423 3300037418 Bacteria 4007
523 Ga0395900_0109551 3300037418 Bacteria 2837
524 Ga0395898_0018211 3300037466 Bacteria 7164
525 Ga0395898_0045803 3300037466 Bacteria 4298
526 Ga0395905_0001984 3300037471 Bacteria 23384
527 Ga0395905_0021036 3300037471 Bacteria 6177
528 Ga0395905_0054913 3300037471 Bacteria 3727
529 Ga0395905_0074130 3300037471 Bacteria 3189
530 Ga0395905_0083715 3300037471 Bacteria 2988
531 Ga0395905_0216943 3300037471 Bacteria 1791
532 Ga0395905_0932681 3300037471 Bacteria 771
533 Ga0316581_0001404 3300037588 Bacteria 5390
534 Ga0316581_0061952 3300037588 Bacteria 1148
535 Ga0395901_0005935 3300038443 Bacteria 12368
536 Ga0400490_53799 3300038726 Bacteria 5451
537 Ga0400483_116466 3300039062 Bacteria 2991
538 Ga0400483_153861 3300039062 Bacteria 1239
539 Ga0400483_169795 3300039062 Bacteria 1587
540 Ga0400483_261695 3300039062 Bacteria 4592
541 Ga0436361_0067190 3300039447 Bacteria 38460
542 Ga0436361_0289802 3300039447 Bacteria 31851
543 Ga0436361_0468389 3300039447 Bacteria 14150
544 Ga0436361_0487065 3300039447 Bacteria 63556
545 Ga0436361_0523658 3300039447 Bacteria 15267
546 Ga0436361_0793974 3300039447 Bacteria 3498
547 Ga0436361_1187211 3300039447 Bacteria 1956
548 Ga0439461_0006640 3300041410 Bacteria 2021
549 Ga0451789_1169945 3300041443 Bacteria 2373
550 Ga0451795_0862134 3300041456 Bacteria 1556
551 Ga0451800_0159027 3300041459 Bacteria 5820
552 Ga0451807_0815480 3300041486 Bacteria 2399
553 Ga0451841_0507876 3300041498 Bacteria 1791
554 Ga0451841_0721882 3300041498 Bacteria 2389
555 Ga0451849_0043210 3300041505 Bacteria 2036
556 Ga0451843_1622809 3300041509 Bacteria 1021
557 Ga0451855_0114897 3300041511 Bacteria 976
558 Ga0451855_1766368 3300041511 Bacteria 1905
559 Ga0451853_0386608 3300041512 Bacteria 1355
560 Ga0451853_1984386 3300041512 Bacteria 1287
561 Ga0451853_3443936 3300041512 Bacteria 1901
562 Ga0439433_0035997 3300041999 Bacteria 1143
563 Ga0439437_003217 3300042000 Bacteria 1760
564 Ga0439437_010466 3300042000 Bacteria 1055
565 Ga0439455_0014352 3300042012 Bacteria 1807
566 Ga0439462_0021267 3300042015 Bacteria 1694
567 Ga0450915_002431 3300042119 Bacteria 976
568 Ga0450917_000643 3300042120 Bacteria 2588
569 Ga0450888_000372 3300042126 Bacteria 4255
570 Ga0450890_000265 3300042127 Bacteria 7730
571 Ga0450891_000172 3300042129 Bacteria 6204
572 Ga0450892_000369 3300042130 Bacteria 5357
573 Ga0450896_018074 3300042133 Bacteria 1020
574 Ga0450898_023118 3300042134 Bacteria 1104
575 Ga0450889_000724 3300042144 Bacteria 3546
576 Ga0439434_0044632 3300042435 Bacteria 1366
577 Ga0439444_0011246 3300042437 Bacteria 1446
578 Ga0439459_0042217 3300042438 Bacteria 973
579 Ga0450916_000410 3300042530 Bacteria 3654
580 Ga0450893_0001970 3300042532 Bacteria 3192
581 Ga0451577_0006813 3300042876 Bacteria 11324
582 Ga0451577_0008542 3300042876 Bacteria 9962
583 Ga0451577_0011170 3300042876 Bacteria 8518
584 Ga0451577_0065013 3300042876 Bacteria 3253
585 Ga0451577_0083129 3300042876 Bacteria 2856
586 Ga0451577_0448281 3300042876 Bacteria 1172
587 Ga0466969_0002013 3300044656 Bacteria 10849
588 Ga0466969_0008421 3300044656 Bacteria 5469
589 Ga0466969_0041626 3300044656 Bacteria 2297
590 Ga0466972_0035699 3300044658 Bacteria 2433
591 Ga0466965_0011163 3300044683 Bacteria 4205
592 Ga0466965_0029198 3300044683 Bacteria 2682
593 Ga0466965_0107718 3300044683 Bacteria 1430
594 Ga0466966_0010218 3300044684 Bacteria 6226
595 Ga0466966_0021661 3300044684 Bacteria 4219
596 Ga0466966_0023898 3300044684 Bacteria 3999
597 Ga0466966_0048250 3300044684 Bacteria 2712
598 Ga0466966_0113306 3300044684 Bacteria 1670
599 Ga0466961_0002200 3300044693 Bacteria 12137
600 Ga0466961_0033437 3300044693 Bacteria 3303
601 Ga0466961_0051535 3300044693 Bacteria 2628
602 Ga0466961_0071277 3300044693 Bacteria 2205
603 Ga0466963_0073113 3300044694 Bacteria 2311
604 Ga0466963_0108794 3300044694 Bacteria 1901
605 Ga0466964_0007954 3300044706 Bacteria 3969
606 Ga0453684_0000891 3300044712 Bacteria 99637
607 Ga0453684_0013441 3300044712 Bacteria 13293
608 Ga0453684_0079940 3300044712 Bacteria 4085
609 Ga0453684_0194566 3300044712 Bacteria 2369
610 Ga0453684_0209467 3300044712 Bacteria 2267
611 Ga0453684_0271033 3300044712 Bacteria 1940
612 Ga0453684_0390796 3300044712 Bacteria 1560
613 Ga0466971_0032473 3300044719 Bacteria 2339
614 Ga0466971_0260961 3300044719 Bacteria 826
615 Ga0466968_0117575 3300044735 Bacteria 1201
616 Ga0466970_0014719 3300044765 Bacteria 4019
617 Ga0466970_0019679 3300044765 Bacteria 3501
618 Ga0466970_0028610 3300044765 Bacteria 2930
619 Ga0466970_0054537 3300044765 Bacteria 2135
620 Ga0466957_0019735 3300044842 Bacteria 3966
621 Ga0466957_0068719 3300044842 Bacteria 2187
622 Ga0466957_0320190 3300044842 Bacteria 1046
623 Ga0466957_0436436 3300044842 Bacteria 900
624 Ga0466960_0087023 3300044901 Bacteria 1585
625 Ga0466959_0000027 3300045049 Bacteria 114262
626 Ga0466959_0003256 3300045049 Bacteria 10576
627 Ga0466959_0005465 3300045049 Bacteria 8705
628 Ga0466959_0014466 3300045049 Bacteria 5734
629 Ga0466959_0032734 3300045049 Bacteria 3848
630 Ga0451576_0032100 3300045051 Bacteria 5596
631 Ga0451576_0054395 3300045051 Bacteria 4191
632 Ga0451576_0104294 3300045051 Bacteria 2949
633 Ga0451576_0234542 3300045051 Bacteria 1916
634 Ga0466958_0033144 3300045836 Bacteria 3076
635 Ga0466967_0179837 3300045976 Bacteria 1994
636 Ga0466967_0353636 3300045976 Bacteria 1422
637 Ga0495617_135186 3300046452 Bacteria 789
638 Ga0495590_0064940 3300046457 Bacteria 1277
639 Ga0495650_0006230 3300046471 Bacteria 7478
640 Ga0495650_0019004 3300046471 Bacteria 3398
641 Ga0495583_0000418 3300046506 Bacteria 64708
642 Ga0495606_0007392 3300046507 Bacteria 9850
643 Ga0495610_0074407 3300046512 Bacteria 1576
644 Ga0495620_0043096 3300046515 Bacteria 1968
645 Ga0495628_0097515 3300046516 Bacteria 2271
646 Ga0495632_0002445 3300046519 Bacteria 14134
647 Ga0495632_0011605 3300046519 Bacteria 5132
648 Ga0495632_0083743 3300046519 Bacteria 1518
649 Ga0495643_0039998 3300046522 Bacteria 2562
650 Ga0495643_0180498 3300046522 Bacteria 1026
651 Ga0495648_0096955 3300046524 Bacteria 1637
652 Ga0495652_0223422 3300046529 Bacteria 1414
653 Ga0495586_0063537 3300046535 Bacteria 2011
654 Ga0495621_0149453 3300046539 Bacteria 918
655 Ga0495597_0002628 3300046542 Bacteria 11179
656 Ga0495597_0026800 3300046542 Bacteria 2647
657 Ga0495668_0011498 3300046616 Bacteria 5300
658 Ga0495668_0164594 3300046616 Bacteria 1215
659 Ga0495625_0001715 3300046660 Bacteria 25497
660 Ga0495625_0009435 3300046660 Bacteria 8165
661 Ga0495625_0019481 3300046660 Bacteria 5262
662 Ga0495625_0120764 3300046660 Bacteria 1783
663 Ga0495658_0142213 3300046683 Bacteria 1468
664 Ga0495670_0014940 3300046691 Bacteria 3822
665 Ga0495649_0000190 3300046694 Bacteria 53998
666 Ga0495649_0000800 3300046694 Bacteria 25336
667 Ga0495589_0007457 3300046794 Bacteria 5733
668 Ga0495687_001857 3300047443 Bacteria 18408
669 Ga0495686_0006525 3300047472 Bacteria 8909
670 Ga0495686_0057069 3300047472 Bacteria 2438
671 Ga0496101_0050543 3300048904 Bacteria 2993
672 Ga0496101_0480860 3300048904 Bacteria 981
673 Ga0496102_0050044 3300048905 Bacteria 3804
674 Ga0496104_0154554 3300048907 Bacteria 2202
675 Ga0496104_0300495 3300048907 Bacteria 1517
676 Ga0496105_0080052 3300048908 Bacteria 2698
677 Ga0496105_0469671 3300048908 Bacteria 991
678 Ga0496106_0010561 3300048909 Bacteria 6819
679 Ga0496107_0074769 3300048910 Bacteria 2465
680 Ga0496108_0039727 3300048911 Bacteria 3921
681 Ga0496108_0180959 3300048911 Bacteria 1826
682 Ga0496108_0248772 3300048911 Bacteria 1546
683 Ga0496108_0274243 3300048911 Bacteria 1468
684 Ga0496109_0066126 3300048912 Bacteria 3310
685 Ga0496109_0108502 3300048912 Bacteria 2580
686 Ga0496109_0204329 3300048912 Bacteria 1857
687 Ga0496109_0411156 3300048912 Bacteria 1278
688 Ga0496109_0532072 3300048912 Bacteria 1109
689 Ga0496110_0060393 3300048913 Bacteria 3343
690 Ga0496110_0112931 3300048913 Bacteria 2443
691 Ga0496111_0044391 3300048914 Bacteria 3195
692 Ga0496112_0036230 3300048915 Bacteria 4811
693 Ga0496113_0017705 3300048916 Bacteria 4953
694 Ga0496113_0063308 3300048916 Bacteria 2795
695 Ga0496114_0026475 3300048917 Bacteria 4748
696 Ga0496114_0147788 3300048917 Bacteria 2038
697 Ga0496115_0142416 3300048918 Bacteria 1978
698 Ga0496117_0000085 3300048920 Bacteria 213887
699 Ga0496122_0052463 3300048925 Bacteria 3086
700 Ga0496124_0000138 3300048927 Bacteria 150311
701 Ga0496124_0006369 3300048927 Bacteria 12875
702 Ga0496125_0011386 3300048928 Bacteria 8902
703 Ga0496125_0012796 3300048928 Bacteria 8295
704 Ga0496126_0045349 3300048929 Bacteria 4041
705 Ga0496126_0207546 3300048929 Bacteria 1651
706 Ga0501291_003045 3300049514 Bacteria 2064
707 Ga0501294_002448 3300049517 Bacteria 1758
708 Ga0501298_012118 3300049521 Bacteria 1507
709 Ga0501298_031299 3300049521 Bacteria 1045
710 Ga0501300_003243 3300049523 Bacteria 2427
711 Ga0501303_008263 3300049526 Bacteria 943
712 Ga0501032_0032467 3300049569 Bacteria 3578
713 Ga0501034_0076879 3300049571 Bacteria 3345
714 Ga0501034_0110846 3300049571 Bacteria 2735
715 Ga0501036_0006094 3300049572 Bacteria 9784
716 Ga0501037_0068934 3300049573 Bacteria 2575
717 Ga0501037_0078713 3300049573 Bacteria 2392
718 Ga0501039_0192315 3300049575 Bacteria 1604
719 Ga0501041_0186085 3300049577 Bacteria 1300
720 Ga0501043_0000057 3300049579 Bacteria 103997
721 Ga0501046_0000075 3300049580 Bacteria 104000
722 Ga0501046_0113370 3300049580 Bacteria 2070
723 Ga0501047_0000081 3300049581 Bacteria 122697
724 Ga0501047_0152540 3300049581 Bacteria 2186
725 Ga0501048_0001541 3300049582 Bacteria 17500
726 Ga0501048_0002402 3300049582 Bacteria 14287
727 Ga0501069_0098540 3300049585 Bacteria 1658
728 Ga0501071_0202865 3300049587 Bacteria 1490
729 Ga0501072_0088589 3300049588 Bacteria 2456
730 Ga0501072_0104170 3300049588 Bacteria 2256
731 Ga0501073_0129806 3300049589 Bacteria 1747
732 Ga0501074_0107221 3300049590 Bacteria 2000
733 Ga0501075_0040136 3300049591 Bacteria 3504
734 Ga0501076_0060774 3300049592 Bacteria 3007
735 Ga0501076_0069483 3300049592 Bacteria 2814
736 Ga0501198_000019 3300049649 Bacteria 83282
737 Ga0501206_003348 3300049653 Bacteria 2037
738 Ga0501211_001454 3300049658 Bacteria 2531
739 Ga0501217_005212 3300049661 Bacteria 2709
740 Ga0501222_000055 3300049662 Bacteria 42112
741 Ga0501222_003040 3300049662 Bacteria 2306
742 Ga0501227_005676 3300049665 Bacteria 2674
743 Ga0501233_006530 3300049668 Bacteria 2193
744 Ga0501235_014796 3300049669 Bacteria 1719
745 Ga0501249_020722 3300049679 Bacteria 1431
746 Ga0501252_011662 3300049682 Bacteria 1054
747 Ga0501253_007968 3300049683 Bacteria 1503
748 Ga0501258_000573 3300049687 Bacteria 2579
749 Ga0501221_001517 3300049704 Bacteria 3842
750 Ga0501079_0156538 3300049741 Bacteria 1776
751 Ga0501080_0185109 3300049742 Bacteria 1915
752 Ga0501081_0134729 3300049743 Bacteria 1767
753 Ga0501081_0261315 3300049743 Bacteria 1265
754 Ga0501232_002654 3300049757 Bacteria 1572
755 Ga0501262_001172 3300049759 Bacteria 2971
756 Ga0501262_001821 3300049759 Bacteria 2392
757 Ga0501264_003691 3300049761 Bacteria 1393
758 Ga0501265_001469 3300049762 Bacteria 2654
759 Ga0501265_005476 3300049762 Bacteria 1464
760 Ga0501269_002119 3300049766 Bacteria 2483
761 Ga0501270_005045 3300049767 Bacteria 1515
762 Ga0501272_001810 3300049769 Bacteria 2079
763 Ga0501035_0103197 3300049822 Bacteria 2501
764 Ga0501044_0229639 3300049823 Bacteria 1804
765 Ga0501045_0004857 3300049824 Bacteria 9302
766 Ga0501045_0228984 3300049824 Bacteria 1383
767 nmdc:mga03683_45721_c1 3300050489 Bacteria 1813
768 nmdc:mga03683_7493_c1 3300050489 Bacteria 3791
769 nmdc:mga03n38_27067_c1 3300050490 Bacteria 2374
770 nmdc:mga03n38_61427_c1 3300050490 Bacteria 1711
771 nmdc:mga03n38_9432_c1 3300050490 Bacteria 3552
772 nmdc:mga00v17_2803_c1 3300050491 Bacteria 8956
773 nmdc:mga00v17_391104_c1 3300050491 Bacteria 904
774 nmdc:mga0yw44_112497_c1 3300050492 Bacteria 1746
775 nmdc:mga0yw44_16241_c1 3300050492 Bacteria 4017
776 nmdc:mga0k408_138_c1 3300050493 Bacteria 36717
777 nmdc:mga0k408_1503_c1 3300050493 Bacteria 12602
778 nmdc:mga0k408_17436_c1 3300050493 Bacteria 4002
779 nmdc:mga0k408_225617_c1 3300050493 Bacteria 1118
780 nmdc:mga0k408_278272_c1 3300050493 Bacteria 999
781 nmdc:mga0k408_28998_c1 3300050493 Bacteria 3148
782 nmdc:mga0k408_29319_c1 3300050493 Bacteria 3131
783 nmdc:mga0k408_391_c1 3300050493 Bacteria 24032
784 nmdc:mga0k408_39510_c1 3300050493 Bacteria 2712
785 nmdc:mga0k408_45856_c1 3300050493 Bacteria 1615
786 nmdc:mga0k408_4715_c1 3300050493 Bacteria 6796
787 nmdc:mga0k408_48568_c1 3300050493 Bacteria 2455
788 nmdc:mga0k408_576_c1 3300050493 Bacteria 20303
789 nmdc:mga0k408_70079_c1 3300050493 Bacteria 2046
790 nmdc:mga0k408_8073_c1 3300050493 Bacteria 5642
791 nmdc:mga0k408_99455_c1 3300050493 Bacteria 1714
792 nmdc:mga06z11_19649_c1 3300050494 Bacteria 3110
793 nmdc:mga06z11_3638_c1 3300050494 Bacteria 5982
794 nmdc:mga06z11_61362_c1 3300050494 Bacteria 1961
795 nmdc:mga04h51_26992_c1 3300050495 Bacteria 1780
796 nmdc:mga07m45_1014_c1 3300050496 Bacteria 12410
797 nmdc:mga07m45_10764_c1 3300050496 Bacteria 4788
798 nmdc:mga07m45_18749_c1 3300050496 Bacteria 3742
799 nmdc:mga07m45_25133_c1 3300050496 Bacteria 3265
800 nmdc:mga07m45_27982_c1 3300050496 Bacteria 3110
801 nmdc:mga07m45_4479_c1 3300050496 Bacteria 6834
802 nmdc:mga07m45_45267_c1 3300050496 Bacteria 2471
803 nmdc:mga07m45_47048_c1 3300050496 Bacteria 2425
804 nmdc:mga07m45_47676_c1 3300050496 Bacteria 2409
805 nmdc:mga07m45_84631_c1 3300050496 Bacteria 1813
806 nmdc:mga05p37_170801_c1 3300050507 Bacteria 2651
807 nmdc:mga09592_25399_c1 3300050508 Bacteria 4903
808 nmdc:mga09592_277117_c1 3300050508 Bacteria 1455
809 nmdc:mga09592_390009_c1 3300050508 Bacteria 1204
810 nmdc:mga0qj67_143761_c1 3300050509 Bacteria 1471
811 nmdc:mga0qj67_145158_c1 3300050509 Bacteria 1924
812 nmdc:mga0qj67_151419_c1 3300050509 Bacteria 1882
813 nmdc:mga0qj67_23042_c1 3300050509 Bacteria 4786
814 nmdc:mga0qj67_38364_c1 3300050509 Bacteria 3758
815 nmdc:mga06r32_20794_c1 3300050510 Bacteria 6047
816 nmdc:mga06r32_240838_c1 3300050510 Bacteria 1797
817 nmdc:mga06r32_49789_c1 3300050510 Bacteria 4008
818 nmdc:mga06r32_79528_c1 3300050510 Bacteria 3189
819 nmdc:mga0n895_303551_c1 3300050512 Bacteria 1618
820 nmdc:mga0rr50_216183_c1 3300050513 Bacteria 1581
821 nmdc:mga0sz30_14739_c1 3300050516 Bacteria 3082
822 Ga0500578_0001946 3300053086 Bacteria 18890
823 Ga0500578_0368828 3300053086 Bacteria 835
824 Ga0500583_0053617 3300053092 Bacteria 1881
825 Ga0500651_0153797 3300053093 Bacteria 1379
826 Ga0500617_050552 3300053124 Bacteria 1855
827 Ga0500658_0000910 3300053134 Bacteria 12105
828 Ga0500568_0001825 3300053139 Bacteria 13115
829 Ga0500568_0006034 3300053139 Bacteria 6151
830 Ga0500568_0006270 3300053139 Bacteria 5998
831 Ga0500590_015680 3300053148 Bacteria 3912
832 Ga0500622_0000002 3300053156 Bacteria 646442
833 Ga0500622_0000124 3300053156 Bacteria 81245
834 Ga0500622_0002040 3300053156 Bacteria 15063
835 Ga0500622_0085555 3300053156 Bacteria 1572
836 Ga0500636_0011155 3300053177 Bacteria 5257
837 Ga0466962_0003926 3300061719 Bacteria 7114
838 Ga0466962_0026079 3300061719 Bacteria 2806
839 Ga0530510_0048089 3300061734 Bacteria 3083
840 2585829077 2585427591 Bacteria 5482980
841 2585833849 2585427592 Bacteria 5370892
842 2587728282 2585428057 Bacteria 6737412
843 2587734512 2585428058 Bacteria 6853932
844 2587754222 2585428062 Bacteria 6842168
845 2588294999 2588253510 Bacteria 6901809
846 2643744999 2643221544 Bacteria 5886209
847 2643867785 2643221570 Bacteria 5103772
848 2643937251 2643221585 Bacteria 5812563
849 2643971153 2643221592 Bacteria 6608788
850 2644142081 2643221625 Bacteria 6512927
851 2644222759 2643221639 Bacteria 6649903
852 2644260680 2643221646 Bacteria 6433402
853 2644276306 2643221648 Bacteria 6521465
854 2644318416 2643221656 Bacteria 5809961
855 2644338167 2643221660 Bacteria 4208257
856 2671110839 2667528173 Bacteria 5375747
857 2739058944 2738541337 Bacteria 6183410
858 2739248293 2738543013 Bacteria 5618633
859 2816470487 2816332133 Bacteria 7249298
860 2831869221 2831864461 Bacteria 6502356
861 2842718742 2842718218 Bacteria 4560148
862 2846035002 2846033681 Bacteria 4377894
863 2846040680 2846037992 Bacteria 4526407
864 2886849788 2886848708 Bacteria 5632523
865 2894024358 2894023352 Bacteria 5167372
866 2904478699 2904474040 Bacteria 5504324
867 2919154807 2919150387 Bacteria 5500879
868 2927148391 2927143783 Bacteria 5504251
869 2928120682 2928115317 Bacteria 6477646
870 2939634175 2939631187 Bacteria 6118131
871 2998345777 2998344455 Bacteria 4222996
872 Ga0157319_1000008
873 SwRhRL2b_contig_2970801
874 JGI25162J39368_1000116
875 JGI25150J39212_1003355
876 JGI25153J46596_10007422
877 JGI25153J46596_10007578
878 rootL2_10000310
879 rootH1_10233163
880 Ga0055539_1000431
881 Ga0055539_1007041
882 Ga0055533_1000053
883 Ga0055525_1000904
884 Ga0055526_1000968
885 Ga0055526_1001006
886 Ga0055524_1000999
887 Ga0055534_1001237
888 Ga0055540_1011662
889 Ga0055531_10000007
890 Ga0055531_10003852
891 Ga0055531_10019372
892 Ga0055531_10045285
893 Ga0055543_1001427
894 Ga0055543_1034367
895 Ga0065165_1000101
896 Ga0065165_1000248
897 Ga0065704_10000497
898 Ga0065704_10129202
899 Ga0065707_10001158
900 Ga0070658_10083243
901 Ga0070658_10096192
902 Ga0070658_10312642
903 Ga0070676_10006495
904 Ga0070676_10006926
905 Ga0070676_10037254
906 Ga0070683_100076771
907 Ga0070683_100332058
908 Ga0070677_10009652
909 Ga0070677_10044355
910 Ga0068869_100005147
911 Ga0068869_100392569
912 Ga0070666_10246702
913 Ga0070680_100071876
914 Ga0070682_100267722
915 Ga0068868_100012109
916 Ga0068868_100025002
917 Ga0068868_100028442
918 Ga0070660_100049846
919 Ga0070660_100301603
920 Ga0070660_100317437
921 Ga0070660_100610211
922 Ga0070661_100022742
923 Ga0070661_100450930
924 Ga0070668_100040154
925 Ga0070668_100243705
926 Ga0070669_100063844
927 Ga0070675_100007192
928 Ga0070675_100026729
929 Ga0070675_100161539
930 Ga0070675_100172546
931 Ga0070675_100324667
932 Ga0070671_100013893
933 Ga0070671_100027654
934 Ga0070671_100098197
935 Ga0070671_100162338
936 Ga0070671_100199894
937 Ga0070671_100403812
938 Ga0070674_100207170
939 Ga0070673_100093533
940 Ga0070673_100193550
941 Ga0070659_100027006
942 Ga0070659_100062436
943 Ga0070659_100088337
944 Ga0070667_100660309
945 Ga0070714_100097912
946 Ga0070705_100310254
947 Ga0070663_100028153
948 Ga0070663_100188316
949 Ga0070678_100090868
950 Ga0070662_100005330
951 Ga0070662_100013586
952 Ga0070662_100272547
953 Ga0070662_100383280
954 Ga0070662_100600127
955 Ga0068867_100006378
956 Ga0068867_100014086
957 Ga0068867_100029474
958 Ga0068867_100292722
959 Ga0070706_100037499
960 Ga0070706_100186751
961 Ga0070707_100175509
962 Ga0070698_100340322
963 Ga0070699_100029409
964 Ga0070699_100612276
965 Ga0070679_100018762
966 Ga0070684_100080387
967 Ga0068853_100182902
968 Ga0068853_100311735
969 Ga0070672_100004996
970 Ga0070672_100050827
971 Ga0070672_100452725
972 Ga0070695_100058360
973 Ga0070695_100105044
974 Ga0070693_100036952
975 Ga0070693_100041815
976 Ga0070665_100013839
977 Ga0070704_100084717
978 Ga0068855_100001666
979 Ga0068855_100060304
980 Ga0070664_100087852
981 Ga0070664_100523731
982 Ga0068857_100011579
983 Ga0068857_100014155
984 Ga0068857_100131344
985 Ga0068857_100190736
986 Ga0068854_100032592
987 Ga0068854_100111998
988 Ga0068854_100336745
989 Ga0070702_100026472
990 Ga0068852_100007330
991 Ga0068852_100078758
992 Ga0068859_100428221
993 Ga0068864_100047443
994 Ga0068864_100075435
995 Ga0068864_100083214
996 Ga0068864_100411348
997 Ga0068866_10111336
998 Ga0068861_100015862
999 Ga0068861_100016866
1000 Ga0068861_100027593
1001 Ga0068851_10017778
1002 Ga0068851_10027355
1003 Ga0068851_10027907
1004 Ga0068870_10004536
1005 Ga0068870_10203407
1006 Ga0068870_10316003
1007 Ga0068858_100047944
1008 Ga0068860_100038773
1009 Ga0068860_100175972
1010 Ga0068862_100007493
1011 Ga0068862_100010025
1012 Ga0075365_10010595
1013 Ga0075365_10011756
1014 Ga0075365_10057991
1015 Ga0075365_10129439
1016 Ga0075368_10009568
1017 Ga0075368_10011904
1018 Ga0075363_100001576
1019 Ga0075363_100073123
1020 Ga0075364_10003493
1021 Ga0075364_10056862
1022 Ga0075432_10000664
1023 Ga0075362_10001003
1024 Ga0075362_10003169
1025 Ga0075362_10036688
1026 Ga0075367_10001551
1027 Ga0075367_10036117
1028 Ga0075367_10073721
1029 Ga0075369_10020411
1030 Ga0075366_10000468
1031 Ga0075366_10054153
1032 Ga0075366_10054888
1033 Ga0075366_10088851
1034 Ga0075366_10133564
1035 Ga0075366_10227281
1036 Ga0097621_100009602
1037 Ga0097621_100167233
1038 Ga0075370_10000108
1039 Ga0075370_10000350
1040 Ga0075370_10011293
1041 Ga0075370_10018852
1042 Ga0075370_10018907
1043 Ga0075370_10024698
1044 Ga0068871_100011636
1045 Ga0075428_100045856
1046 Ga0075428_100097261
1047 Ga0075430_100012192
1048 Ga0075430_100041086
1049 Ga0075431_100002923
1050 Ga0075431_100030939
1051 Ga0075431_100044445
1052 Ga0075434_100107882
1053 Ga0075429_100003081
1054 Ga0075429_100128970
1055 Ga0068865_100031426
1056 Ga0068865_100084377
1057 Ga0097620_100428181
1058 Ga0099823_1000075
1059 Ga0105250_10000004
1060 Ga0105240_10281860
1061 Ga0105240_10932554
1062 Ga0111539_10174509
1063 Ga0105245_10011588
1064 Ga0105245_10023648
1065 Ga0105245_10111571
1066 Ga0105245_10664617
1067 Ga0105243_10012663
1068 Ga0105243_10025933
1069 Ga0105243_10044521
1070 Ga0105243_10397397
1071 Ga0105241_10078048
1072 Ga0105242_10009898
1073 Ga0105242_10563802
1074 Ga0105242_10571267
1075 Ga0105242_11120328
1076 Ga0105248_10002698
1077 Ga0105248_10014653
1078 Ga0105248_10131168
1079 Ga0105237_10023104
1080 Ga0105238_10070932
1081 Ga0105249_10061695
1082 Ga0099796_10013861
1083 Ga0105239_10654159
1084 Ga0157373_10121303
1085 Ga0157371_10312940
1086 Ga0157369_10072223
1087 Ga0157374_10012925
1088 Ga0157374_10048033
1089 Ga0157374_10087753
1090 Ga0157378_10149245
1091 Ga0157372_10023923
1092 Ga0157372_10080912
1093 Ga0157372_10947375
1094 Ga0157375_10016951
1095 Ga0157375_10028320
1096 Ga0157375_10183738
1097 Ga0157375_10957849
1098 Ga0157380_10079544
1099 Ga0157380_10725396
1100 Ga0157380_10969088
1101 Ga0157379_10000729
1102 Ga0157379_10036452
1103 Ga0157379_10121245
1104 Ga0157376_10028980
1105 Ga0157376_10862522
1106 Ga0213872_10000093
1107 Ga0213872_10000339
1108 Ga0213872_10000508
1109 Ga0213872_10003642
1110 Ga0213872_10062011
1111 Ga0213872_10145770
1112 Ga0209674_100039
1113 Ga0209563_100013
1114 Ga0209563_100080
1115 Ga0207427_101227
1116 Ga0207425_1000540
1117 Ga0209026_1019054
1118 Ga0209677_100086
1119 Ga0209677_101082
1120 Ga0209759_1003908
1121 Ga0209759_1006233
1122 Ga0209759_1012837
1123 Ga0209129_1000027
1124 Ga0209673_1007822
1125 Ga0209673_1023535
1126 Ga0209130_1005108
1127 Ga0209675_1003613
1128 Ga0209676_1011901
1129 Ga0209025_1080447
1130 Ga0209564_1000008
1131 Ga0209564_1000139
1132 Ga0209758_1000052
1133 Ga0209758_1000146
1134 Ga0209050_1000165
1135 Ga0209050_1003503
1136 Ga0209050_1007646
1137 Ga0209256_1000450
1138 Ga0209256_1002818
1139 Ga0209051_1000960
1140 Ga0209051_1001306
1141 Ga0209051_1001911
1142 Ga0209051_1003358
1143 Ga0209051_1017387
1144 Ga0209051_1029773
1145 Ga0209051_1031375
1146 Ga0209257_1000021
1147 Ga0209257_1002089
1148 Ga0209257_1003471
1149 Ga0209257_1008791
1150 Ga0209257_1015805
1151 Ga0209257_1022940
1152 Ga0207656_10015553
1153 Ga0207696_1000056
1154 Ga0207682_10006671
1155 Ga0207642_10076128
1156 Ga0207680_10152913
1157 Ga0207680_10296234
1158 Ga0207680_10334783
1159 Ga0207699_10011916
1160 Ga0207645_10003365
1161 Ga0207645_10017173
1162 Ga0207645_10020521
1163 Ga0207645_10042506
1164 Ga0207645_10098862
1165 Ga0207643_10013594
1166 Ga0207643_10072199
1167 Ga0207643_10206318
1168 Ga0207705_10019660
1169 Ga0207705_10031396
1170 Ga0207705_10127325
1171 Ga0207684_10032013
1172 Ga0207684_10108651
1173 Ga0207695_10032446
1174 Ga0207695_10062546
1175 Ga0207695_10108859
1176 Ga0207671_10029878
1177 Ga0207660_10022584
1178 Ga0207662_10170728
1179 Ga0207657_10028179
1180 Ga0207657_10056950
1181 Ga0207649_10137159
1182 Ga0207646_10073049
1183 Ga0207681_10008706
1184 Ga0207681_10056233
1185 Ga0207694_10085822
1186 Ga0207650_10020768
1187 Ga0207659_10002055
1188 Ga0207659_10086804
1189 Ga0207659_10212084
1190 Ga0207659_10290240
1191 Ga0207687_10051425
1192 Ga0207687_10098633
1193 Ga0207687_10127772
1194 Ga0207687_10772859
1195 Ga0207664_10069180
1196 Ga0207644_10000130
1197 Ga0207644_10055786
1198 Ga0207644_10089739
1199 Ga0207644_10166814
1200 Ga0207690_10091070
1201 Ga0207690_10210446
1202 Ga0207690_10231906
1203 Ga0207706_10006516
1204 Ga0207706_10012430
1205 Ga0207706_10052927
1206 Ga0207706_10175376
1207 Ga0207706_10395719
1208 Ga0207686_10008348
1209 Ga0207686_10013174
1210 Ga0207686_10655153
1211 Ga0207686_10686202
1212 Ga0207709_10293772
1213 Ga0207669_10037308
1214 Ga0207704_10029131
1215 Ga0207704_10080820
1216 Ga0207691_10007829
1217 Ga0207691_10010432
1218 Ga0207691_10140544
1219 Ga0207691_10204670
1220 Ga0207691_10279656
1221 Ga0207711_10002256
1222 Ga0207711_10005210
1223 Ga0207711_10018486
1224 Ga0207711_10080376
1225 Ga0207689_10001818
1226 Ga0207689_10007166
1227 Ga0207689_10036462
1228 Ga0207661_10242244
1229 Ga0207679_10150484
1230 Ga0207667_10156804
1231 Ga0207651_10099340
1232 Ga0207651_10165931
1233 Ga0207712_10116224
1234 Ga0207712_10159131
1235 Ga0207668_10073256
1236 Ga0207640_10354970
1237 Ga0207640_10385132
1238 Ga0207640_10405351
1239 Ga0207677_10004871
1240 Ga0207677_10193732
1241 Ga0207639_10057980
1242 Ga0207639_10063590
1243 Ga0207639_10854018
1244 Ga0207678_10000893
1245 Ga0207678_10052208
1246 Ga0207678_10193534
1247 Ga0207678_10305128
1248 Ga0207708_10006241
1249 Ga0207702_10096506
1250 Ga0207702_10209824
1251 Ga0207641_10043137
1252 Ga0207648_10001919
1253 Ga0207648_10010004
1254 Ga0207648_10022574
1255 Ga0207648_10233624
1256 Ga0207676_10202777
1257 Ga0207676_10225067
1258 Ga0207674_10002708
1259 Ga0207674_10023986
1260 Ga0207674_10037550
1261 Ga0207675_100000180
1262 Ga0207675_100004669
1263 Ga0207675_100007765
1264 Ga0207675_100222807
1265 Ga0207683_10118253
1266 Ga0207683_10156334
1267 Ga0207683_10161002
1268 Ga0207698_10006282
1269 Ga0209389_1000249
1270 Ga0209371_1021935
1271 Ga0209996_1003340
1272 Ga0209996_1022132
1273 Ga0209984_1012034
1274 Ga0209995_1019473
1275 Ga0209968_1003253
1276 Ga0209982_1004919
1277 Ga0209982_1029463
1278 Ga0209970_1000108
1279 Ga0210002_1000559
1280 Ga0209983_1000495
1281 Ga0209971_1000131
1282 Ga0209966_1000231
1283 Ga0209998_10000211
1284 Ga0209974_10001553
1285 Ga0209974_10002942
1286 Ga0209974_10035157
1287 Ga0268266_10506353
1288 Ga0268265_10103724
1289 Ga0268265_10243263
1290 Ga0268264_10040974
1291 Ga0268264_10077487
1292 Ga0265334_10000020
1293 Ga0265334_10056560
1294 Ga0265336_10000014
1295 Ga0307517_10116350
1296 Ga0307515_10000472
1297 Ga0307515_10001966
1298 Ga0307515_10009632
1299 Ga0307515_10013614
1300 Ga0307515_10014298
1301 Ga0307515_10026472
1302 Ga0307515_10102753
1303 Ga0307515_10323601
1304 Ga0307515_10356691
1305 Ga0265324_10006580
1306 Ga0268256_1024691
1307 Ga0307511_10053633
1308 Ga0316177_1136770
1309 Ga0316181_1026598
1310 Ga0265330_10000046
1311 Ga0265330_10015352
1312 Ga0265332_10000028
1313 Ga0265328_10032372
1314 Ga0265325_10009170
1315 Ga0265329_10045902
1316 Ga0265327_10000002
1317 Ga0265327_10000500
1318 Ga0265327_10000916
1319 Ga0265327_10006214
1320 Ga0265316_10000225
1321 Ga0307513_10000838
1322 Ga0307513_10083483
1323 Ga0307513_10109471
1324 Ga0307513_10118564
1325 Ga0307509_10000978
1326 Ga0307509_10034507
1327 Ga0307509_10140560
1328 Ga0307509_10267678
1329 Ga0307408_100000023
1330 Ga0307408_100027684
1331 Ga0307408_100337361
1332 Ga0265313_10000148
1333 Ga0265313_10084038
1334 Ga0307508_10000404
1335 Ga0307514_10009282
1336 Ga0316575_10010424
1337 Ga0316579_10005735
1338 Ga0265314_10000054
1339 Ga0265314_10001039
1340 Ga0316576_10003481
1341 Ga0316576_10014142
1342 Ga0316576_10015838
1343 Ga0316576_10202953
1344 Ga0316576_10260442
1345 Ga0316578_10016657
1346 Ga0316578_10039269
1347 Ga0316578_10119612
1348 Ga0316578_10170422
1349 Ga0307516_10000190
1350 Ga0307516_10001586
1351 Ga0307516_10001919
1352 Ga0307516_10002741
1353 Ga0307405_10282062
1354 Ga0307410_10108924
1355 Ga0316585_10002582
1356 Ga0316593_10098971
1357 Ga0307507_10008591
1358 Ga0307510_10225541
1359 Ga0373948_0001870
1360 Ga0373959_0002670
1361 Ga0373928_0070628
1362 Ga0373949_0020409
1363 Ga0373951_0006594
1364 Ga0373952_0046530
1365 Ga0373945_0112569
1366 Ga0373956_0119610
1367 Ga0373943_0082234
1368 Ga0373946_0099075
1369 Ga0373962_0001639
1370 Ga0316574_0015641
1371 Ga0316574_0043236
1372 Ga0316574_0059311
1373 Ga0373931_0000260
1374 Ga0373931_0028974
1375 Ga0373935_0065291
1376 Ga0373935_0615488
1377 Ga0373927_0060638
1378 Ga0373933_0223940
1379 Ga0373937_0027943
1380 Ga0373937_0087637
1381 Ga0373937_0226235
1382 Ga0316582_0017329
1383 Ga0316582_0036645
1384 Ga0316582_0073926
1385 Ga0316582_0098789
1386 Ga0316582_0104622
1387 Ga0316584_0002067
1388 Ga0316584_0022483
1389 Ga0316584_0031702
1390 Ga0316584_0122487
1391 Ga0373925_0011748
1392 Ga0395900_0000050
1393 Ga0395900_0057423
1394 Ga0395900_0109551
1395 Ga0395898_0018211
1396 Ga0395898_0045803
1397 Ga0395905_0001984
1398 Ga0395905_0021036
1399 Ga0395905_0054913
1400 Ga0395905_0074130
1401 Ga0395905_0083715
1402 Ga0395905_0216943
1403 Ga0395905_0932681
1404 Ga0316581_0001404
1405 Ga0316581_0061952
1406 Ga0395901_0005935
1407 Ga0400490_53799
1408 Ga0400483_116466
1409 Ga0400483_153861
1410 Ga0400483_169795
1411 Ga0400483_261695
1412 Ga0436361_0067190
1413 Ga0436361_0289802
1414 Ga0436361_0468389
1415 Ga0436361_0487065
1416 Ga0436361_0523658
1417 Ga0436361_0793974
1418 Ga0436361_1187211
1419 Ga0439461_0006640
1420 Ga0451789_1169945
1421 Ga0451795_0862134
1422 Ga0451800_0159027
1423 Ga0451807_0815480
1424 Ga0451841_0507876
1425 Ga0451841_0721882
1426 Ga0451849_0043210
1427 Ga0451843_1622809
1428 Ga0451855_0114897
1429 Ga0451855_1766368
1430 Ga0451853_0386608
1431 Ga0451853_1984386
1432 Ga0451853_3443936
1433 Ga0439433_0035997
1434 Ga0439437_003217
1435 Ga0439437_010466
1436 Ga0439455_0014352
1437 Ga0439462_0021267
1438 Ga0450915_002431
1439 Ga0450917_000643
1440 Ga0450888_000372
1441 Ga0450890_000265
1442 Ga0450891_000172
1443 Ga0450892_000369
1444 Ga0450896_018074
1445 Ga0450898_023118
1446 Ga0450889_000724
1447 Ga0439434_0044632
1448 Ga0439444_0011246
1449 Ga0439459_0042217
1450 Ga0450916_000410
1451 Ga0450893_0001970
1452 Ga0451577_0006813
1453 Ga0451577_0008542
1454 Ga0451577_0011170
1455 Ga0451577_0065013
1456 Ga0451577_0083129
1457 Ga0451577_0448281
1458 Ga0466969_0002013
1459 Ga0466969_0008421
1460 Ga0466969_0041626
1461 Ga0466972_0035699
1462 Ga0466965_0011163
1463 Ga0466965_0029198
1464 Ga0466965_0107718
1465 Ga0466966_0010218
1466 Ga0466966_0021661
1467 Ga0466966_0023898
1468 Ga0466966_0048250
1469 Ga0466966_0113306
1470 Ga0466961_0002200
1471 Ga0466961_0033437
1472 Ga0466961_0051535
1473 Ga0466961_0071277
1474 Ga0466963_0073113
1475 Ga0466963_0108794
1476 Ga0466964_0007954
1477 Ga0453684_0000891
1478 Ga0453684_0013441
1479 Ga0453684_0079940
1480 Ga0453684_0194566
1481 Ga0453684_0209467
1482 Ga0453684_0271033
1483 Ga0453684_0390796
1484 Ga0466971_0032473
1485 Ga0466971_0260961
1486 Ga0466968_0117575
1487 Ga0466970_0014719
1488 Ga0466970_0019679
1489 Ga0466970_0028610
1490 Ga0466970_0054537
1491 Ga0466957_0019735
1492 Ga0466957_0068719
1493 Ga0466957_0320190
1494 Ga0466957_0436436
1495 Ga0466960_0087023
1496 Ga0466959_0000027
1497 Ga0466959_0003256
1498 Ga0466959_0005465
1499 Ga0466959_0014466
1500 Ga0466959_0032734
1501 Ga0451576_0032100
1502 Ga0451576_0054395
1503 Ga0451576_0104294
1504 Ga0451576_0234542
1505 Ga0466958_0033144
1506 Ga0466967_0179837
1507 Ga0466967_0353636
1508 Ga0495617_135186
1509 Ga0495590_0064940
1510 Ga0495650_0006230
1511 Ga0495650_0019004
1512 Ga0495583_0000418
1513 Ga0495606_0007392
1514 Ga0495610_0074407
1515 Ga0495620_0043096
1516 Ga0495628_0097515
1517 Ga0495632_0002445
1518 Ga0495632_0011605
1519 Ga0495632_0083743
1520 Ga0495643_0039998
1521 Ga0495643_0180498
1522 Ga0495648_0096955
1523 Ga0495652_0223422
1524 Ga0495586_0063537
1525 Ga0495621_0149453
1526 Ga0495597_0002628
1527 Ga0495597_0026800
1528 Ga0495668_0011498
1529 Ga0495668_0164594
1530 Ga0495625_0001715
1531 Ga0495625_0009435
1532 Ga0495625_0019481
1533 Ga0495625_0120764
1534 Ga0495658_0142213
1535 Ga0495670_0014940
1536 Ga0495649_0000190
1537 Ga0495649_0000800
1538 Ga0495589_0007457
1539 Ga0495687_001857
1540 Ga0495686_0006525
1541 Ga0495686_0057069
1542 Ga0496101_0050543
1543 Ga0496101_0480860
1544 Ga0496102_0050044
1545 Ga0496104_0154554
1546 Ga0496104_0300495
1547 Ga0496105_0080052
1548 Ga0496105_0469671
1549 Ga0496106_0010561
1550 Ga0496107_0074769
1551 Ga0496108_0039727
1552 Ga0496108_0180959
1553 Ga0496108_0248772
1554 Ga0496108_0274243
1555 Ga0496109_0066126
1556 Ga0496109_0108502
1557 Ga0496109_0204329
1558 Ga0496109_0411156
1559 Ga0496109_0532072
1560 Ga0496110_0060393
1561 Ga0496110_0112931
1562 Ga0496111_0044391
1563 Ga0496112_0036230
1564 Ga0496113_0017705
1565 Ga0496113_0063308
1566 Ga0496114_0026475
1567 Ga0496114_0147788
1568 Ga0496115_0142416
1569 Ga0496117_0000085
1570 Ga0496122_0052463
1571 Ga0496124_0000138
1572 Ga0496124_0006369
1573 Ga0496125_0011386
1574 Ga0496125_0012796
1575 Ga0496126_0045349
1576 Ga0496126_0207546
1577 Ga0501291_003045
1578 Ga0501294_002448
1579 Ga0501298_012118
1580 Ga0501298_031299
1581 Ga0501300_003243
1582 Ga0501303_008263
1583 Ga0501032_0032467
1584 Ga0501034_0076879
1585 Ga0501034_0110846
1586 Ga0501036_0006094
1587 Ga0501037_0068934
1588 Ga0501037_0078713
1589 Ga0501039_0192315
1590 Ga0501041_0186085
1591 Ga0501043_0000057
1592 Ga0501046_0000075
1593 Ga0501046_0113370
1594 Ga0501047_0000081
1595 Ga0501047_0152540
1596 Ga0501048_0001541
1597 Ga0501048_0002402
1598 Ga0501069_0098540
1599 Ga0501071_0202865
1600 Ga0501072_0088589
1601 Ga0501072_0104170
1602 Ga0501073_0129806
1603 Ga0501074_0107221
1604 Ga0501075_0040136
1605 Ga0501076_0060774
1606 Ga0501076_0069483
1607 Ga0501198_000019
1608 Ga0501206_003348
1609 Ga0501211_001454
1610 Ga0501217_005212
1611 Ga0501222_000055
1612 Ga0501222_003040
1613 Ga0501227_005676
1614 Ga0501233_006530
1615 Ga0501235_014796
1616 Ga0501249_020722
1617 Ga0501252_011662
1618 Ga0501253_007968
1619 Ga0501258_000573
1620 Ga0501221_001517
1621 Ga0501079_0156538
1622 Ga0501080_0185109
1623 Ga0501081_0134729
1624 Ga0501081_0261315
1625 Ga0501232_002654
1626 Ga0501262_001172
1627 Ga0501262_001821
1628 Ga0501264_003691
1629 Ga0501265_001469
1630 Ga0501265_005476
1631 Ga0501269_002119
1632 Ga0501270_005045
1633 Ga0501272_001810
1634 Ga0501035_0103197
1635 Ga0501044_0229639
1636 Ga0501045_0004857
1637 Ga0501045_0228984
1638 nmdc:mga03683_45721_c1
1639 nmdc:mga03683_7493_c1
1640 nmdc:mga03n38_27067_c1
1641 nmdc:mga03n38_61427_c1
1642 nmdc:mga03n38_9432_c1
1643 nmdc:mga00v17_2803_c1
1644 nmdc:mga00v17_391104_c1
1645 nmdc:mga0yw44_112497_c1
1646 nmdc:mga0yw44_16241_c1
1647 nmdc:mga0k408_138_c1
1648 nmdc:mga0k408_1503_c1
1649 nmdc:mga0k408_17436_c1
1650 nmdc:mga0k408_225617_c1
1651 nmdc:mga0k408_278272_c1
1652 nmdc:mga0k408_28998_c1
1653 nmdc:mga0k408_29319_c1
1654 nmdc:mga0k408_391_c1
1655 nmdc:mga0k408_39510_c1
1656 nmdc:mga0k408_45856_c1
1657 nmdc:mga0k408_4715_c1
1658 nmdc:mga0k408_48568_c1
1659 nmdc:mga0k408_576_c1
1660 nmdc:mga0k408_70079_c1
1661 nmdc:mga0k408_8073_c1
1662 nmdc:mga0k408_99455_c1
1663 nmdc:mga06z11_19649_c1
1664 nmdc:mga06z11_3638_c1
1665 nmdc:mga06z11_61362_c1
1666 nmdc:mga04h51_26992_c1
1667 nmdc:mga07m45_1014_c1
1668 nmdc:mga07m45_10764_c1
1669 nmdc:mga07m45_18749_c1
1670 nmdc:mga07m45_25133_c1
1671 nmdc:mga07m45_27982_c1
1672 nmdc:mga07m45_4479_c1
1673 nmdc:mga07m45_45267_c1
1674 nmdc:mga07m45_47048_c1
1675 nmdc:mga07m45_47676_c1
1676 nmdc:mga07m45_84631_c1
1677 nmdc:mga05p37_170801_c1
1678 nmdc:mga09592_25399_c1
1679 nmdc:mga09592_277117_c1
1680 nmdc:mga09592_390009_c1
1681 nmdc:mga0qj67_143761_c1
1682 nmdc:mga0qj67_145158_c1
1683 nmdc:mga0qj67_151419_c1
1684 nmdc:mga0qj67_23042_c1
1685 nmdc:mga0qj67_38364_c1
1686 nmdc:mga06r32_20794_c1
1687 nmdc:mga06r32_240838_c1
1688 nmdc:mga06r32_49789_c1
1689 nmdc:mga06r32_79528_c1
1690 nmdc:mga0n895_303551_c1
1691 nmdc:mga0rr50_216183_c1
1692 nmdc:mga0sz30_14739_c1
1693 Ga0500578_0001946
1694 Ga0500578_0368828
1695 Ga0500583_0053617
1696 Ga0500651_0153797
1697 Ga0500617_050552
1698 Ga0500658_0000910
1699 Ga0500568_0001825
1700 Ga0500568_0006034
1701 Ga0500568_0006270
1702 Ga0500590_015680
1703 Ga0500622_0000002
1704 Ga0500622_0000124
1705 Ga0500622_0002040
1706 Ga0500622_0085555
1707 Ga0500636_0011155
1708 Ga0466962_0003926
1709 Ga0466962_0026079
1710 Ga0530510_0048089
1711 2585829077
1712 2585833849
1713 2587728282
1714 2587734512
1715 2587754222
1716 2588294999
1717 2643744999
1718 2643867785
1719 2643937251
1720 2643971153
1721 2644142081
1722 2644222759
1723 2644260680
1724 2644276306
1725 2644318416
1726 2644338167
1727 2671110839
1728 2739058944
1729 2739248293
1730 2816470487
1731 2831869221
1732 2842718742
1733 2846035002
1734 2846040680
1735 2886849788
1736 2894024358
1737 2904478699
1738 2919154807
1739 2927148391
1740 2928120682
1741 2939634175
1742 2998345777

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

45

275

0.97

PF13649

Methyltransf_25

Methyltransferase domain

95

190

0.97

PF08241

Methyltransf_11

Methyltransferase domain

96

194

0.96

PF13847

Methyltransf_31

Methyltransferase domain

89

237

0.91

PF08242

Methyltransf_12

Methyltransferase domain

96

192

0.87

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

78

206

0.86

PF07021

MetW

Methionine biosynthesis protein MetW

80

199

0.79

PF13489

Methyltransf_23

Methyltransferase domain

71

260

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.9148 27 243
5wwq-assembly1.cif.gz_A crystal structure of human nsun6 0.8768 47 163
7v6h-assembly2.cif.gz_B crystal structure of the spnl 0.8485 44 235
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.8438 27 243
8i9y-assembly1.cif.gz_CP cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - ytm1-2 0.8396 45 163
ID Description Score Start End Superfamily
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.989 27 243 3.40.50.150
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9669 27 243 3.40.50.150
af_C7J169_1_82_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9573 35 105 3.40.50.150
af_Q9VYF8_68_301_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9572 27 243 3.40.50.150
af_P9WFR3_19_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9538 28 243 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2U2N2G9-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9913 2 243 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770
AF-A0A6A5KTX5-F1-model_v4 deleted 0.989 3 242
AF-A0A7X1TTZ2-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9861 2 242 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770
AF-A0A2U2N2G9-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9832 2 243 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770
AF-A0A0D8Y6T8-F1-model_v4 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (EC 2.1.1.201) (Ubiquinone biosynthesis methyltransferase COQ5) 0.983 2 242 GO:0008425
GO:0031314
GO:0032259

Map