F484184

General Info

Members Datasets Scaffolds Average Seq Length
871 505 1742 391

Family's Representative Sequence

Representative Sequence 3300025292|Ga0209676_1001194|Ga0209676_100119421
Length 446
Sequence MFKTRQHFTISLAKLRLFLLSKIVKIFVKIDISASSICMQCSFLNGEKGRMFMTNEVVIVSAVRTAIGSFQGTLKDVPATKLGSIVIKEALVRAGVAGEKVGEVIMGNVLSAGLGQNPARQAAIAAGLPHEVSALTINKVCGSGLKAVHLATQAILAGDADIVVAGGFENMSQAPYVLKNAREGFRMGDQKVVDTMIHDGLWCAFNDYHMGVTAENLCDVYEISREEQDAFAARSQQRAEAAITAGKFNDEIIAVEIPQRKGDPIVFDKDEFPRQGVTAESLSKLRPAFKKDGSVTAANASGINDGAAAVVVMSKEKAEELGIRPMALITANASAGVDPAIMGTGPVTAVKKALAKADVTLDNIDLIEANEAFAAQSIAVDRELGFNHDKLNVNGGAIALGHPIGASGARILVTLLHEMEKRDAKTGLATLCIGGGQGVATVVKRP

Samples

Sample ID Description Type Environment
1 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
113 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
114 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
115 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
122 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
172 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
174 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
179 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
180 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
181 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
182 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
183 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
184 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
192 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
193 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
201 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
202 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
203 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
206 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
207 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
208 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
209 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
211 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
212 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
213 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
217 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
218 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
222 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
223 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
226 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
229 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
232 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
233 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
234 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
235 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
236 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
237 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
238 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
239 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
240 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
241 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
242 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
243 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
244 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
245 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
246 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
247 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
248 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
249 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
250 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
251 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
252 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
253 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
254 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
255 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
256 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
257 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
260 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
261 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
262 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
263 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
264 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
265 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
266 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
267 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
268 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
269 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
270 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
271 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
272 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
273 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
274 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
275 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
276 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
277 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
278 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
279 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
280 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
281 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
282 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
283 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
284 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
285 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
286 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
287 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
288 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
289 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
290 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
291 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
294 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
295 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
296 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
297 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
298 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
299 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
300 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
301 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
302 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
317 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
318 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
319 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
320 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
321 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
322 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
323 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
324 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
325 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
326 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
327 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
328 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
329 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
331 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
353 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
354 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
355 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
356 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
357 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
358 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
359 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
360 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
361 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
362 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
363 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
364 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
367 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
368 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
369 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
370 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
371 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
372 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
373 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
374 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
375 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
376 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
377 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
378 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
379 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
380 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
381 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
382 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
383 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
384 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
385 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
386 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
387 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
388 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
389 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
390 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
391 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
392 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
393 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
394 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
395 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
396 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
397 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
398 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
399 2509276019 Ensifer aridi TW10 Isolate Nodule
400 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
401 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
402 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
403 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
404 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
405 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
406 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
407 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
408 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
409 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
410 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
411 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
412 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
413 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
414 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
415 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
416 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
417 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
418 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
419 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
420 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
421 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
422 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
423 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
424 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
425 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
426 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
427 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
428 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
429 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
430 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
431 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
432 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
433 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
434 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
435 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
436 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
437 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
438 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
439 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
440 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
441 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
442 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
443 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
444 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
445 2636415599 Klebsiella variicola DX120E Isolate Unclassified
446 2643221732 Bacillus sp. Root239 Isolate Unclassified
447 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
448 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
449 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
450 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
451 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
452 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
453 2738543017 Bacillus sp. OV186 Isolate Unclassified
454 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
455 2751185917 Enterobacter sp. HK169 Isolate Unclassified
456 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
457 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
458 2775507074 Klebsiella sp. D5A Isolate Unclassified
459 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
460 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
461 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
462 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
463 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
464 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
465 2821118458 Enterobacter asburiae 609 Isolate Unclassified
466 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
467 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
468 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
469 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
470 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
471 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
472 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
473 2857586860 Bacillus sp. R-71935 Isolate Unclassified
474 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
475 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
476 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
477 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
478 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
479 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
480 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
481 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
482 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
483 2919720352 Priestia megaterium 4340 Isolate Unclassified
484 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
485 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
486 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
487 2929004312 Priestia megaterium 1104 Isolate Unclassified
488 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
489 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
490 2937539931 Pantoea sp. LS15 Isolate Unclassified
491 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
492 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
493 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
494 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
495 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
496 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
497 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
498 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
499 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
500 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
501 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
502 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
503 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
504 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
505 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.19
Metatranscriptomes 2.18
Isolates 12.63

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 6.77
Nodule 0.69
Rhizoplane 10.1
Rhizosphere 67.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209676_1001194 3300025292 Bacteria 27901
2 SwRhRL2b_contig_2703074 2162886007 Bacteria 7875
3 JGI24736J21556_1001340 3300001904 Bacteria 4498
4 JGI24740J21852_10006911 3300001979 Bacteria 4660
5 JGI24735J21928_10001258 3300002067 Bacteria 8994
6 Ga0006778J45830_1026826 3300003162 Bacteria 1257
7 JGI25151J46595_10000302 3300003187 Bacteria 54102
8 JGI25151J46595_10002958 3300003187 Bacteria 9705
9 JGI25151J46595_10007108 3300003187 Bacteria 5523
10 JGI25151J46595_10039571 3300003187 Bacteria 1739
11 rootH2_10023994 3300003320 Bacteria 23941
12 rootH2_10083643 3300003320 Bacteria 8038
13 Ga0007416J51690_1021970 3300003577 Bacteria 1317
14 Ga0007429J51699_1018838 3300003579 Bacteria 1263
15 Ga0055532_1000060 3300003758 Bacteria 150321
16 Ga0055532_1001176 3300003758 Bacteria 7896
17 Ga0055542_1000589 3300003762 Bacteria 31380
18 Ga0055529_1004088 3300003763 Bacteria 2272
19 Ga0055536_1000461 3300003781 Bacteria 28659
20 Ga0055536_1000666 3300003781 Bacteria 23120
21 Ga0055530_10000424 3300003791 Bacteria 37602
22 Ga0055540_1000122 3300003792 Bacteria 81293
23 Ga0055531_10000146 3300003794 Bacteria 81289
24 Ga0058692_1000622 3300003856 Bacteria 14677
25 Ga0058692_1000674 3300003856 Bacteria 14060
26 Ga0058692_1007359 3300003856 Bacteria 2929
27 Ga0065714_10084763 3300005288 Bacteria 2182
28 Ga0065704_10070699 3300005289 Bacteria 17430
29 Ga0065704_10083393 3300005289 Bacteria 3473
30 Ga0065707_10105464 3300005295 Bacteria 2630
31 Ga0070658_10006314 3300005327 Bacteria 9600
32 Ga0070676_10055192 3300005328 Bacteria 2344
33 Ga0070676_10061532 3300005328 Bacteria 2232
34 Ga0070690_100049678 3300005330 Bacteria 2675
35 Ga0070670_100045743 3300005331 Bacteria 3763
36 Ga0070670_100057539 3300005331 Bacteria 3337
37 Ga0070666_10004186 3300005335 Bacteria 8755
38 Ga0070680_100009507 3300005336 Bacteria 7467
39 Ga0070682_100059039 3300005337 Bacteria 2421
40 Ga0070689_100015633 3300005340 Bacteria 5539
41 Ga0070689_100065480 3300005340 Bacteria 2830
42 Ga0070692_10129027 3300005345 Bacteria 1419
43 Ga0070668_100000707 3300005347 Bacteria 22821
44 Ga0070668_100004391 3300005347 Bacteria 10460
45 Ga0070673_100067712 3300005364 Bacteria 2856
46 Ga0070688_100022333 3300005365 Bacteria 3706
47 Ga0070667_100003824 3300005367 Bacteria 12796
48 Ga0070709_10065471 3300005434 Bacteria 2327
49 Ga0070714_100074276 3300005435 Bacteria 2947
50 Ga0070713_100037681 3300005436 Bacteria 3910
51 Ga0070713_100051297 3300005436 Bacteria 3411
52 Ga0070713_100063212 3300005436 Bacteria 3102
53 Ga0070710_10021576 3300005437 Bacteria 3358
54 Ga0070705_100049180 3300005440 Bacteria 2447
55 Ga0070700_100006997 3300005441 Bacteria 6056
56 Ga0070694_100001005 3300005444 Bacteria 16031
57 Ga0070694_100058197 3300005444 Bacteria 2629
58 Ga0070708_100026124 3300005445 Bacteria 4995
59 Ga0070663_100020685 3300005455 Bacteria 4360
60 Ga0070663_100163365 3300005455 Bacteria 1716
61 Ga0070681_10004050 3300005458 Bacteria 13835
62 Ga0070681_10078648 3300005458 Bacteria 3254
63 Ga0070681_10145752 3300005458 Bacteria 2297
64 Ga0068867_100027781 3300005459 Bacteria 4070
65 Ga0070685_10093879 3300005466 Bacteria 1821
66 Ga0070706_100004372 3300005467 Bacteria 13649
67 Ga0070706_100153608 3300005467 Bacteria 2149
68 Ga0070707_100064773 3300005468 Bacteria 3510
69 Ga0070699_100000540 3300005518 Bacteria 35757
70 Ga0070699_100184242 3300005518 Bacteria 1853
71 Ga0070679_100025738 3300005530 Bacteria 5774
72 Ga0070679_100073177 3300005530 Bacteria 3419
73 Ga0070684_100100836 3300005535 Bacteria 2579
74 Ga0070697_100127625 3300005536 Bacteria 2131
75 Ga0068853_100000230 3300005539 Bacteria 39593
76 Ga0068853_100360062 3300005539 Bacteria 1355
77 Ga0070695_100000710 3300005545 Bacteria 17788
78 Ga0070695_100010886 3300005545 Bacteria 5434
79 Ga0070696_100000156 3300005546 Bacteria 38002
80 Ga0070665_100000406 3300005548 Bacteria 63162
81 Ga0070665_100006587 3300005548 Bacteria 11805
82 Ga0070665_100011615 3300005548 Bacteria 8903
83 Ga0068855_100000034 3300005563 Bacteria 166436
84 Ga0068855_100161923 3300005563 Bacteria 2539
85 Ga0068857_100006498 3300005577 Bacteria 10028
86 Ga0068854_100106278 3300005578 Bacteria 2111
87 Ga0068854_100185818 3300005578 Bacteria 1626
88 Ga0068856_100031657 3300005614 Bacteria 5176
89 Ga0068852_100018197 3300005616 Bacteria 5532
90 Ga0068859_100199657 3300005617 Bacteria 2084
91 Ga0068864_100164996 3300005618 Bacteria 2016
92 Ga0068861_100031979 3300005719 Bacteria 3871
93 Ga0068858_100037806 3300005842 Bacteria 4476
94 Ga0068860_100000351 3300005843 Bacteria 61888
95 Ga0068860_100007718 3300005843 Bacteria 10756
96 Ga0068860_100078572 3300005843 Bacteria 3138
97 Ga0068862_100024035 3300005844 Bacteria 5109
98 Ga0068862_100045374 3300005844 Bacteria 3750
99 Ga0068862_100050025 3300005844 Bacteria 3571
100 Ga0068862_100063471 3300005844 Bacteria 3178
101 Ga0081455_10000028 3300005937 Bacteria 155778
102 Ga0081455_10001108 3300005937 Bacteria 33842
103 Ga0081455_10045047 3300005937 Bacteria 3842
104 Ga0081455_10100945 3300005937 Bacteria 2317
105 Ga0081538_10007910 3300005981 Bacteria 9109
106 Ga0081538_10018206 3300005981 Bacteria 5289
107 Ga0081538_10020695 3300005981 Bacteria 4831
108 Ga0081538_10024985 3300005981 Bacteria 4235
109 Ga0081540_1000060 3300005983 Bacteria 119707
110 Ga0081540_1043059 3300005983 Bacteria 2321
111 Ga0081539_10000977 3300005985 Bacteria 53347
112 Ga0081539_10005453 3300005985 Bacteria 12976
113 Ga0081539_10010261 3300005985 Bacteria 7651
114 Ga0081539_10015990 3300005985 Bacteria 5403
115 Ga0070717_10024871 3300006028 Bacteria 4757
116 Ga0070717_10057481 3300006028 Bacteria 3215
117 Ga0070717_10080726 3300006028 Bacteria 2729
118 Ga0075365_10009401 3300006038 Bacteria 5617
119 Ga0075365_10036665 3300006038 Bacteria 3178
120 Ga0075363_100038942 3300006048 Bacteria 2501
121 Ga0075364_10043851 3300006051 Bacteria 2908
122 Ga0070715_10015199 3300006163 Bacteria 2866
123 Ga0070716_100027329 3300006173 Bacteria 3064
124 Ga0070716_100216075 3300006173 Bacteria 1285
125 Ga0070712_100014972 3300006175 Bacteria 4986
126 Ga0070712_100068020 3300006175 Bacteria 2536
127 Ga0075366_10017931 3300006195 Bacteria 4084
128 Ga0075370_10011338 3300006353 Bacteria 4681
129 Ga0075370_10014893 3300006353 Bacteria 4154
130 Ga0075428_100002387 3300006844 Bacteria 20393
131 Ga0075428_100002525 3300006844 Bacteria 19895
132 Ga0075428_100057384 3300006844 Bacteria 4262
133 Ga0075430_100060823 3300006846 Bacteria 3174
134 Ga0075430_100089607 3300006846 Bacteria 2573
135 Ga0075431_100005137 3300006847 Bacteria 12878
136 Ga0075431_100087766 3300006847 Bacteria 3210
137 Ga0075433_10011214 3300006852 Bacteria 7213
138 Ga0075433_10122881 3300006852 Bacteria 2306
139 Ga0075434_100067556 3300006871 Bacteria 3560
140 Ga0075434_100091899 3300006871 Bacteria 3036
141 Ga0075434_100192022 3300006871 Bacteria 2063
142 Ga0075436_100002374 3300006914 Bacteria 13001
143 Ga0075436_100043110 3300006914 Bacteria 3110
144 Ga0097620_100199661 3300006931 Bacteria 2084
145 Ga0079104_1001990 3300006946 Bacteria 11958
146 Ga0075435_100029369 3300007076 Bacteria 4314
147 Ga0075435_100079607 3300007076 Bacteria 2689
148 Ga0099794_10008524 3300007265 Bacteria 4264
149 Ga0105251_10000064 3300009011 Bacteria 100095
150 Ga0105251_10001689 3300009011 Bacteria 18557
151 Ga0105251_10008061 3300009011 Bacteria 6386
152 Ga0105251_10034656 3300009011 Bacteria 2496
153 Ga0105250_10000053 3300009092 Bacteria 114563
154 Ga0105250_10001882 3300009092 Bacteria 10908
155 Ga0105250_10005639 3300009092 Bacteria 5591
156 Ga0105250_10043755 3300009092 Bacteria 1795
157 Ga0105240_10022032 3300009093 Bacteria 8460
158 Ga0111539_10018998 3300009094 Bacteria 8497
159 Ga0111539_10034619 3300009094 Bacteria 6120
160 Ga0105245_10005334 3300009098 Bacteria 11294
161 Ga0114129_10023661 3300009147 Bacteria 8707
162 Ga0114129_10032683 3300009147 Bacteria 7352
163 Ga0114129_10040156 3300009147 Bacteria 6597
164 Ga0114129_10098515 3300009147 Bacteria 4046
165 Ga0105241_10016604 3300009174 Bacteria 5402
166 Ga0105248_10000001 3300009177 Bacteria 1881304
167 Ga0105248_10024110 3300009177 Bacteria 6762
168 Ga0105248_10069958 3300009177 Bacteria 3941
169 Ga0105249_10299309 3300009553 Bacteria 1613
170 Ga0105148_100251 3300009978 Bacteria 7349
171 Ga0099796_10000988 3300010159 Bacteria 5342
172 Ga0099796_10004076 3300010159 Bacteria 3486
173 Ga0105246_10004282 3300011119 Bacteria 8680
174 Ga0157345_1000058 3300012498 Bacteria 23631
175 Ga0157370_10004253 3300013104 Bacteria 16534
176 Ga0157370_10110370 3300013104 Bacteria 2571
177 Ga0157369_10002217 3300013105 Bacteria 23382
178 Ga0157369_10002227 3300013105 Bacteria 23348
179 Ga0157369_10007939 3300013105 Bacteria 12204
180 Ga0157369_10298786 3300013105 Bacteria 1675
181 Ga0157369_10406137 3300013105 Bacteria 1413
182 Ga0157374_10098952 3300013296 Bacteria 2793
183 Ga0163162_10201294 3300013306 Bacteria 2120
184 Ga0157372_10337573 3300013307 Bacteria 1755
185 Ga0157375_10254859 3300013308 Bacteria 1916
186 Ga0163163_10245913 3300014325 Bacteria 1839
187 Ga0182008_10101987 3300014497 Bacteria 1419
188 Ga0183366_1001 3300015679 Bacteria 2743932
189 Ga0183370_1001 3300015680 Bacteria 2743932
190 Ga0183369_1001 3300015685 Bacteria 2743932
191 Ga0183368_1001 3300015687 Bacteria 2743932
192 Ga0163161_10006599 3300017792 Bacteria 8034
193 Ga0206356_10667046 3300020070 Bacteria 1781
194 Ga0213872_10000860 3300021361 Bacteria 21983
195 Ga0213872_10022550 3300021361 Bacteria 2900
196 Ga0213876_10000084 3300021384 Bacteria 107178
197 Ga0213876_10000103 3300021384 Bacteria 94164
198 Ga0247553_100221 3300023672 Bacteria 1911
199 Ga0228598_1000875 3300024227 Bacteria 6508
200 Ga0209784_100118 3300025224 Bacteria 83084
201 Ga0209147_100080 3300025229 Bacteria 196308
202 Ga0209147_100101 3300025229 Bacteria 161976
203 Ga0209148_1000384 3300025254 Bacteria 53115
204 Ga0209455_1000152 3300025272 Bacteria 125942
205 Ga0209675_1005781 3300025291 Bacteria 5095
206 Ga0209676_1000020 3300025292 Bacteria 617256
207 Ga0209676_1000102 3300025292 Bacteria 227372
208 Ga0209676_1000427 3300025292 Bacteria 73627
209 Ga0209025_1000262 3300025294 Bacteria 123617
210 Ga0209025_1002935 3300025294 Bacteria 16963
211 Ga0209025_1004102 3300025294 Bacteria 12975
212 Ga0209025_1005174 3300025294 Bacteria 10787
213 Ga0209025_1008076 3300025294 Bacteria 7661
214 Ga0209050_1000105 3300025298 Bacteria 227285
215 Ga0209051_1000066 3300025303 Bacteria 227369
216 Ga0209257_1000124 3300025304 Bacteria 218195
217 Ga0207696_1000088 3300025711 Bacteria 190313
218 Ga0207696_1000116 3300025711 Bacteria 148125
219 Ga0207696_1002383 3300025711 Bacteria 9275
220 Ga0207696_1005207 3300025711 Bacteria 5440
221 Ga0207655_1007416 3300025728 Bacteria 7114
222 Ga0207655_1026537 3300025728 Bacteria 2781
223 Ga0207713_1000002 3300025735 Bacteria 1061749
224 Ga0207713_1000370 3300025735 Bacteria 48903
225 Ga0207713_1000883 3300025735 Bacteria 27325
226 Ga0207713_1002682 3300025735 Bacteria 12729
227 Ga0207713_1002965 3300025735 Bacteria 11859
228 Ga0207713_1025470 3300025735 Bacteria 2731
229 Ga0207713_1032114 3300025735 Bacteria 2310
230 Ga0207713_1037039 3300025735 Bacteria 2085
231 Ga0207653_10000724 3300025885 Bacteria 11298
232 Ga0207692_10022673 3300025898 Bacteria 2893
233 Ga0207692_10095516 3300025898 Bacteria 1621
234 Ga0207688_10006050 3300025901 Bacteria 6583
235 Ga0207680_10000192 3300025903 Bacteria 29474
236 Ga0207685_10004693 3300025905 Bacteria 3511
237 Ga0207699_10158718 3300025906 Bacteria 1503
238 Ga0207645_10046281 3300025907 Bacteria 2779
239 Ga0207684_10006877 3300025910 Bacteria 10292
240 Ga0207684_10033976 3300025910 Bacteria 4336
241 Ga0207707_10013817 3300025912 Bacteria 7041
242 Ga0207707_10019402 3300025912 Bacteria 5935
243 Ga0207695_10141179 3300025913 Bacteria 2357
244 Ga0207693_10002296 3300025915 Bacteria 16616
245 Ga0207693_10024341 3300025915 Bacteria 4805
246 Ga0207693_10049456 3300025915 Bacteria 3301
247 Ga0207693_10064671 3300025915 Bacteria 2865
248 Ga0207663_10019794 3300025916 Bacteria 3799
249 Ga0207660_10003986 3300025917 Bacteria 9626
250 Ga0207660_10184586 3300025917 Bacteria 1622
251 Ga0207646_10026623 3300025922 Bacteria 5275
252 Ga0207650_10002443 3300025925 Bacteria 12941
253 Ga0207650_10099874 3300025925 Bacteria 2232
254 Ga0207659_10112886 3300025926 Bacteria 2069
255 Ga0207687_10066936 3300025927 Bacteria 2554
256 Ga0207700_10007976 3300025928 Bacteria 6520
257 Ga0207700_10075251 3300025928 Bacteria 2616
258 Ga0207700_10301932 3300025928 Bacteria 1383
259 Ga0207664_10079190 3300025929 Bacteria 2667
260 Ga0207670_10009459 3300025936 Bacteria 5562
261 Ga0207670_10016209 3300025936 Bacteria 4471
262 Ga0207670_10170450 3300025936 Bacteria 1632
263 Ga0207665_10000117 3300025939 Bacteria 52204
264 Ga0207665_10272203 3300025939 Bacteria 1258
265 Ga0207691_10133928 3300025940 Bacteria 2187
266 Ga0207711_10000001 3300025941 Bacteria 1325674
267 Ga0207711_10013853 3300025941 Bacteria 6697
268 Ga0207667_10108121 3300025949 Bacteria 2869
269 Ga0207651_10014448 3300025960 Bacteria 4560
270 Ga0207712_10014325 3300025961 Bacteria 5099
271 Ga0207668_10000002 3300025972 Bacteria 209163
272 Ga0207668_10025508 3300025972 Bacteria 3826
273 Ga0207668_10033453 3300025972 Bacteria 3406
274 Ga0207640_10073191 3300025981 Bacteria 2315
275 Ga0207640_10096434 3300025981 Bacteria 2062
276 Ga0207703_10003659 3300026035 Bacteria 12816
277 Ga0207639_10000338 3300026041 Bacteria 32510
278 Ga0207639_10017877 3300026041 Bacteria 5029
279 Ga0207678_10029207 3300026067 Bacteria 4811
280 Ga0207708_10013835 3300026075 Bacteria 6030
281 Ga0207641_10165713 3300026088 Bacteria 2012
282 Ga0207648_10040324 3300026089 Bacteria 4104
283 Ga0207648_10160414 3300026089 Bacteria 1986
284 Ga0207674_10004781 3300026116 Bacteria 16234
285 Ga0207674_10013979 3300026116 Bacteria 8875
286 Ga0207675_100267322 3300026118 Bacteria 1659
287 Ga0207698_10142237 3300026142 Bacteria 2069
288 Ga0209281_1000820 3300027111 Bacteria 28065
289 Ga0209371_1000001 3300027312 Bacteria 2771503
290 Ga0209371_1000020 3300027312 Bacteria 556282
291 Ga0209371_1001119 3300027312 Bacteria 19769
292 Ga0209371_1002623 3300027312 Bacteria 9844
293 Ga0209371_1006607 3300027312 Bacteria 4256
294 Ga0209813_10012558 3300027866 Bacteria 2242
295 Ga0209974_10026553 3300027876 Bacteria 1917
296 Ga0268266_10000435 3300028379 Bacteria 62710
297 Ga0268266_10000811 3300028379 Bacteria 41188
298 Ga0268265_10006024 3300028380 Bacteria 8250
299 Ga0268264_10000749 3300028381 Bacteria 36626
300 Ga0268264_10035403 3300028381 Bacteria 4111
301 Ga0268264_10049442 3300028381 Bacteria 3498
302 Ga0307517_10008180 3300028786 Bacteria 15041
303 Ga0268256_1000001 3300030500 Bacteria 2771065
304 Ga0268256_1000057 3300030500 Bacteria 229991
305 Ga0268256_1000951 3300030500 Bacteria 19769
306 Ga0268256_1002322 3300030500 Bacteria 9844
307 Ga0268256_1006662 3300030500 Bacteria 4256
308 Ga0316178_1118621 3300030735 Bacteria 29653
309 Ga0265330_10055322 3300031235 Bacteria 1733
310 Ga0265332_10001502 3300031238 Bacteria 12971
311 Ga0265320_10000039 3300031240 Bacteria 134478
312 Ga0265320_10000550 3300031240 Bacteria 28890
313 Ga0265325_10048989 3300031241 Bacteria 2182
314 Ga0265325_10058138 3300031241 Bacteria 1970
315 Ga0265340_10040691 3300031247 Bacteria 2288
316 Ga0265339_10011897 3300031249 Bacteria 5336
317 Ga0265339_10036463 3300031249 Bacteria 2752
318 Ga0307513_10000077 3300031456 Bacteria 134167
319 Ga0307408_100006252 3300031548 Bacteria 7906
320 Ga0307408_100029279 3300031548 Bacteria 3813
321 Ga0307408_100058061 3300031548 Bacteria 2812
322 Ga0316575_10017975 3300031665 Bacteria 2692
323 Ga0265314_10013436 3300031711 Bacteria 6613
324 Ga0265314_10014914 3300031711 Bacteria 6190
325 Ga0265314_10019715 3300031711 Bacteria 5217
326 Ga0265314_10097843 3300031711 Bacteria 1894
327 Ga0265342_10008983 3300031712 Bacteria 7097
328 Ga0265342_10092051 3300031712 Bacteria 1737
329 Ga0316576_10034845 3300031727 Bacteria 3590
330 Ga0316576_10042757 3300031727 Bacteria 3266
331 Ga0316576_10155394 3300031727 Bacteria 1724
332 Ga0316578_10000916 3300031728 Bacteria 11148
333 Ga0316578_10014050 3300031728 Bacteria 4264
334 Ga0316578_10092765 3300031728 Bacteria 1805
335 Ga0307405_10082306 3300031731 Bacteria 2106
336 Ga0307410_10023315 3300031852 Bacteria 3845
337 Ga0307410_10110887 3300031852 Bacteria 1985
338 Ga0307410_10154752 3300031852 Bacteria 1711
339 Ga0307412_10085309 3300031911 Bacteria 2194
340 Ga0307412_10117093 3300031911 Bacteria 1912
341 Ga0307409_100042898 3300031995 Bacteria 3392
342 Ga0307409_100219446 3300031995 Bacteria 1715
343 Ga0307416_100053199 3300032002 Bacteria 3247
344 Ga0307416_100087297 3300032002 Bacteria 2662
345 Ga0307416_100194892 3300032002 Bacteria 1915
346 Ga0307414_10156780 3300032004 Bacteria 1803
347 Ga0316053_101354 3300032120 Bacteria 1289
348 Ga0316585_10015583 3300032137 Bacteria 2283
349 Ga0316580_10011049 3300032139 Bacteria 2736
350 Ga0316580_10013050 3300032139 Bacteria 2532
351 Ga0316588_1010906 3300033528 Bacteria 1927
352 Ga0316596_1007729 3300033541 Bacteria 2547
353 Ga0373926_0013371 3300035083 Bacteria 2783
354 Ga0373926_0059021 3300035083 Bacteria 1396
355 Ga0373940_0006440 3300035088 Bacteria 2604
356 Ga0373944_0002385 3300035089 Bacteria 4783
357 Ga0373949_0010649 3300035090 Bacteria 2017
358 Ga0373923_0009386 3300035111 Bacteria 3530
359 Ga0373932_0011803 3300035112 Bacteria 2141
360 Ga0373939_0019131 3300035114 Bacteria 1844
361 Ga0373941_0009585 3300035115 Bacteria 2443
362 Ga0373956_0012242 3300035119 Bacteria 3552
363 Ga0373956_0052707 3300035119 Bacteria 1830
364 Ga0373943_0007037 3300035170 Bacteria 5046
365 Ga0373955_0026576 3300035172 Bacteria 2983
366 Ga0373961_0004207 3300035241 Bacteria 3493
367 Ga0316574_0006329 3300035398 Bacteria 6390
368 Ga0316574_0007076 3300035398 Bacteria 6122
369 Ga0316574_0012119 3300035398 Bacteria 4924
370 Ga0373924_0051158 3300035410 Bacteria 1712
371 Ga0373931_0002980 3300035691 Bacteria 7564
372 Ga0373931_0009777 3300035691 Bacteria 4592
373 Ga0373935_0001583 3300035692 Bacteria 12687
374 Ga0373935_0003507 3300035692 Bacteria 9123
375 Ga0373935_0052567 3300035692 Bacteria 2590
376 Ga0373927_0000243 3300035695 Bacteria 42834
377 Ga0373927_0050482 3300035695 Bacteria 2690
378 Ga0373933_0008345 3300035724 Bacteria 5656
379 Ga0373933_0039115 3300035724 Bacteria 2789
380 Ga0373933_0075339 3300035724 Bacteria 2060
381 Ga0373947_0006288 3300035725 Bacteria 6904
382 Ga0373937_0014589 3300036401 Bacteria 6940
383 Ga0373937_0041928 3300036401 Bacteria 4176
384 Ga0373937_0057447 3300036401 Bacteria 3574
385 Ga0316582_0039051 3300036647 Bacteria 2954
386 Ga0316582_0100345 3300036647 Bacteria 1916
387 Ga0316584_0020718 3300036712 Bacteria 4771
388 Ga0316584_0044039 3300036712 Bacteria 3328
389 Ga0373925_0102445 3300037068 Bacteria 2202
390 Ga0395898_0041459 3300037466 Bacteria 4547
391 Ga0436364_0777042 3300037853 Bacteria 1376
392 Ga0436364_0943381 3300037853 Bacteria 2572
393 Ga0436364_0992727 3300037853 Bacteria 1286
394 Ga0395901_0085923 3300038443 Bacteria 3289
395 Ga0237819_00896 3300038705 Bacteria 9258
396 Ga0400483_011703 3300039062 Bacteria 5250
397 Ga0400483_144988 3300039062 Bacteria 3461
398 Ga0400483_150944 3300039062 Bacteria 17535
399 Ga0400489_33857 3300039093 Bacteria 3056
400 Ga0436365_0203066 3300039437 Bacteria 111457
401 Ga0436365_0924222 3300039437 Bacteria 2939
402 Ga0436365_1805879 3300039437 Bacteria 2909
403 Ga0436365_1861022 3300039437 Bacteria 74232
404 Ga0436360_0886478 3300039438 Bacteria 2494
405 Ga0436361_0453677 3300039447 Bacteria 28726
406 Ga0436361_0984484 3300039447 Bacteria 2052
407 Ga0436361_1001866 3300039447 Bacteria 37490
408 Ga0436363_0439161 3300039450 Bacteria 2158
409 Ga0436363_0452161 3300039450 Bacteria 1463
410 Ga0436363_1190291 3300039450 Bacteria 1539
411 Ga0436362_0660459 3300039453 Bacteria 1558
412 Ga0439436_0001265 3300041404 Bacteria 7214
413 Ga0439438_005534 3300041405 Bacteria 4626
414 Ga0439438_006885 3300041405 Bacteria 3957
415 Ga0439447_007714 3300041407 Bacteria 3389
416 Ga0451853_1896193 3300041512 Bacteria 2018
417 Ga0439432_013194 3300042006 Bacteria 2812
418 Ga0439432_014713 3300042006 Bacteria 2646
419 Ga0439450_000469 3300042008 Bacteria 5250
420 Ga0439452_000142 3300042010 Bacteria 54077
421 Ga0439452_000221 3300042010 Bacteria 40244
422 Ga0439452_001405 3300042010 Bacteria 9905
423 Ga0439455_0035371 3300042012 Bacteria 1260
424 Ga0450902_015737 3300042137 Bacteria 1229
425 Ga0450904_001512 3300042139 Bacteria 3203
426 Ga0439434_0008880 3300042435 Bacteria 2953
427 Ga0450916_001727 3300042530 Bacteria 2218
428 Ga0453683_0005602 3300044673 Bacteria 8730
429 Ga0453684_0003922 3300044712 Bacteria 32678
430 Ga0453684_0011998 3300044712 Bacteria 14410
431 Ga0453684_0048239 3300044712 Bacteria 5635
432 Ga0453684_0244145 3300044712 Bacteria 2066
433 Ga0453684_0278560 3300044712 Bacteria 1908
434 Ga0466960_0136396 3300044901 Bacteria 1300
435 Ga0466959_0035190 3300045049 Bacteria 3706
436 Ga0451576_0000016 3300045051 Bacteria 565050
437 Ga0451576_0000051 3300045051 Bacteria 313453
438 Ga0451576_0000696 3300045051 Bacteria 68242
439 Ga0451576_0013071 3300045051 Bacteria 9297
440 Ga0495591_003608 3300046458 Bacteria 7885
441 Ga0495629_0029522 3300046459 Bacteria 3887
442 Ga0495638_0007527 3300046460 Bacteria 7793
443 Ga0495641_0042091 3300046461 Bacteria 2119
444 Ga0495651_0019514 3300046462 Bacteria 5256
445 Ga0495651_0130188 3300046462 Bacteria 1838
446 Ga0495653_0027546 3300046463 Bacteria 4547
447 Ga0495650_0000005 3300046471 Bacteria 766553
448 Ga0495580_0046745 3300046472 Bacteria 3070
449 Ga0495662_0025639 3300046476 Bacteria 2847
450 Ga0495662_0053389 3300046476 Bacteria 1951
451 Ga0495664_0069604 3300046477 Bacteria 2100
452 Ga0495584_0020115 3300046491 Bacteria 3391
453 Ga0495584_0052579 3300046491 Bacteria 2050
454 Ga0495585_0002318 3300046492 Bacteria 13716
455 Ga0495607_0000668 3300046501 Bacteria 33232
456 Ga0495583_0000447 3300046506 Bacteria 61780
457 Ga0495583_0010816 3300046506 Bacteria 5283
458 Ga0495606_0044385 3300046507 Bacteria 2956
459 Ga0495608_0061405 3300046511 Bacteria 2471
460 Ga0495610_0004539 3300046512 Bacteria 10212
461 Ga0495618_0095864 3300046514 Eukaryota 1897
462 Ga0495618_0131624 3300046514 Bacteria 1600
463 Ga0495628_0045518 3300046516 Bacteria 3488
464 Ga0495652_0077715 3300046529 Bacteria 2750
465 Ga0495652_0094290 3300046529 Bacteria 2441
466 Ga0495654_0003014 3300046530 Bacteria 10501
467 Ga0495640_0005373 3300046533 Bacteria 10190
468 Ga0495640_0061829 3300046533 Bacteria 2542
469 Ga0495587_0018878 3300046536 Bacteria 4274
470 Ga0495587_0069761 3300046536 Bacteria 2046
471 Ga0495645_0001277 3300046543 Bacteria 17149
472 Ga0495633_0024969 3300046558 Bacteria 2948
473 Ga0495667_0128996 3300046559 Bacteria 1631
474 Ga0495634_0066926 3300046642 Bacteria 2377
475 Ga0495635_0020720 3300046663 Bacteria 4580
476 Ga0495599_0033264 3300046678 Bacteria 3239
477 Ga0495646_0031506 3300046680 Bacteria 3304
478 Ga0495647_0091441 3300046681 Bacteria 1248
479 Ga0495658_0075819 3300046683 Bacteria 1963
480 Ga0495613_0001199 3300046689 Bacteria 19784
481 Ga0495613_0187394 3300046689 Bacteria 1463
482 Ga0495671_0074401 3300046692 Bacteria 1666
483 Ga0495649_0000777 3300046694 Bacteria 25668
484 Ga0495649_0001900 3300046694 Bacteria 15256
485 Ga0495649_0005219 3300046694 Bacteria 8313
486 Ga0495600_0068905 3300046809 Bacteria 2312
487 Ga0495604_0024793 3300047317 Bacteria 4785
488 Ga0495604_0094935 3300047317 Bacteria 2204
489 Ga0495604_0203218 3300047317 Bacteria 1373
490 Ga0495674_0002065 3300047319 Bacteria 19693
491 Ga0495674_0018921 3300047319 Bacteria 6405
492 Ga0495674_0109410 3300047319 Bacteria 2344
493 Ga0495676_0124179 3300047321 Bacteria 1873
494 Ga0495680_0074380 3300047322 Bacteria 2580
495 Ga0495683_0022584 3300047323 Bacteria 3235
496 Ga0495675_0059761 3300047444 Bacteria 2416
497 Ga0495679_012913 3300047446 Bacteria 3158
498 Ga0495684_0014934 3300047471 Bacteria 5981
499 Ga0495684_0067146 3300047471 Bacteria 2727
500 Ga0495684_0091239 3300047471 Bacteria 2308
501 Ga0495593_0013645 3300047673 Bacteria 4629
502 Ga0495593_0015025 3300047673 Bacteria 4397
503 Ga0495593_0021887 3300047673 Bacteria 3567
504 Ga0495602_0024310 3300048088 Bacteria 5879
505 Ga0495602_0177774 3300048088 Bacteria 1645
506 Ga0496100_0245144 3300048903 Bacteria 1323
507 Ga0496101_0057632 3300048904 Bacteria 2810
508 Ga0496102_0024135 3300048905 Bacteria 5404
509 Ga0496102_0238494 3300048905 Bacteria 1715
510 Ga0496102_0243049 3300048905 Bacteria 1697
511 Ga0496103_0011761 3300048906 Bacteria 5192
512 Ga0496104_0000449 3300048907 Bacteria 35646
513 Ga0496104_0002199 3300048907 Bacteria 16874
514 Ga0496104_0009135 3300048907 Bacteria 8813
515 Ga0496104_0013664 3300048907 Bacteria 7320
516 Ga0496104_0085492 3300048907 Bacteria 3011
517 Ga0496104_0184392 3300048907 Bacteria 1997
518 Ga0496105_0002469 3300048908 Bacteria 13385
519 Ga0496105_0006002 3300048908 Bacteria 9278
520 Ga0496105_0009008 3300048908 Bacteria 7787
521 Ga0496105_0068782 3300048908 Bacteria 2926
522 Ga0496105_0091271 3300048908 Bacteria 2515
523 Ga0496106_0001760 3300048909 Bacteria 16160
524 Ga0496106_0022779 3300048909 Bacteria 4653
525 Ga0496106_0022817 3300048909 Bacteria 4649
526 Ga0496107_0033613 3300048910 Bacteria 3670
527 Ga0496107_0326795 3300048910 Bacteria 1141
528 Ga0496108_0002321 3300048911 Bacteria 15223
529 Ga0496108_0010630 3300048911 Bacteria 7466
530 Ga0496108_0087161 3300048911 Bacteria 2651
531 Ga0496109_0033184 3300048912 Bacteria 4643
532 Ga0496110_0004012 3300048913 Bacteria 11346
533 Ga0496110_0006378 3300048913 Bacteria 9328
534 Ga0496110_0014478 3300048913 Bacteria 6552
535 Ga0496110_0130943 3300048913 Bacteria 2265
536 Ga0496110_0167942 3300048913 Bacteria 1990
537 Ga0496110_0256996 3300048913 Bacteria 1590
538 Ga0496111_0005262 3300048914 Bacteria 8258
539 Ga0496111_0046266 3300048914 Bacteria 3133
540 Ga0496111_0066041 3300048914 Bacteria 2626
541 Ga0496111_0110256 3300048914 Bacteria 2027
542 Ga0496112_0007190 3300048915 Bacteria 9862
543 Ga0496112_0028322 3300048915 Bacteria 5406
544 Ga0496112_0062681 3300048915 Bacteria 3668
545 Ga0496113_0184103 3300048916 Bacteria 1656
546 Ga0496113_0195128 3300048916 Bacteria 1608
547 Ga0496114_0031868 3300048917 Bacteria 4337
548 Ga0496115_0029287 3300048918 Bacteria 4323
549 Ga0496115_0032343 3300048918 Bacteria 4127
550 Ga0496116_0002683 3300048919 Bacteria 18391
551 Ga0496116_0013421 3300048919 Bacteria 6606
552 Ga0496116_0017493 3300048919 Bacteria 5560
553 Ga0496116_0023278 3300048919 Bacteria 4616
554 Ga0496116_0037362 3300048919 Bacteria 3387
555 Ga0496116_0064856 3300048919 Bacteria 2345
556 Ga0496117_0001622 3300048920 Bacteria 31785
557 Ga0496117_0008046 3300048920 Bacteria 10108
558 Ga0496117_0008546 3300048920 Bacteria 9710
559 Ga0496117_0049826 3300048920 Bacteria 2974
560 Ga0496117_0062267 3300048920 Bacteria 2557
561 Ga0496117_0065527 3300048920 Bacteria 2469
562 Ga0496117_0066130 3300048920 Bacteria 2453
563 Ga0496118_0000015 3300048921 Bacteria 551359
564 Ga0496118_0005930 3300048921 Bacteria 13661
565 Ga0496119_0000841 3300048922 Bacteria 40637
566 Ga0496119_0001419 3300048922 Bacteria 29009
567 Ga0496119_0003785 3300048922 Bacteria 15466
568 Ga0496119_0010725 3300048922 Bacteria 7680
569 Ga0496120_0001068 3300048923 Bacteria 36230
570 Ga0496120_0003719 3300048923 Bacteria 13569
571 Ga0496120_0006370 3300048923 Bacteria 9077
572 Ga0496120_0018028 3300048923 Bacteria 4561
573 Ga0496120_0018282 3300048923 Bacteria 4523
574 Ga0496120_0018283 3300048923 Bacteria 4523
575 Ga0496121_0004213 3300048924 Bacteria 19602
576 Ga0496121_0004271 3300048924 Bacteria 19402
577 Ga0496121_0006970 3300048924 Bacteria 13755
578 Ga0496121_0008075 3300048924 Bacteria 12536
579 Ga0496121_0034501 3300048924 Bacteria 4553
580 Ga0496121_0174712 3300048924 Bacteria 1556
581 Ga0496122_0000202 3300048925 Bacteria 132984
582 Ga0496122_0000259 3300048925 Bacteria 119366
583 Ga0496122_0001139 3300048925 Bacteria 45609
584 Ga0496122_0008382 3300048925 Bacteria 11170
585 Ga0496122_0012999 3300048925 Bacteria 8207
586 Ga0496122_0014310 3300048925 Bacteria 7680
587 Ga0496122_0024755 3300048925 Bacteria 5242
588 Ga0496122_0030357 3300048925 Bacteria 4529
589 Ga0496122_0033844 3300048925 Bacteria 4194
590 Ga0496122_0039679 3300048925 Bacteria 3751
591 Ga0496122_0175949 3300048925 Bacteria 1282
592 Ga0496123_0000144 3300048926 Bacteria 144603
593 Ga0496123_0000209 3300048926 Bacteria 119480
594 Ga0496123_0001178 3300048926 Bacteria 38532
595 Ga0496123_0006680 3300048926 Bacteria 11118
596 Ga0496123_0008091 3300048926 Bacteria 9725
597 Ga0496123_0008482 3300048926 Bacteria 9434
598 Ga0496123_0015055 3300048926 Bacteria 6369
599 Ga0496123_0077027 3300048926 Bacteria 2050
600 Ga0496123_0100344 3300048926 Bacteria 1686
601 Ga0496123_0130560 3300048926 Bacteria 1392
602 Ga0496124_0005265 3300048927 Bacteria 14637
603 Ga0496124_0014963 3300048927 Bacteria 7468
604 Ga0496124_0030441 3300048927 Bacteria 4790
605 Ga0496124_0045115 3300048927 Bacteria 3779
606 Ga0496124_0065945 3300048927 Bacteria 3017
607 Ga0496124_0138639 3300048927 Bacteria 1922
608 Ga0496124_0158960 3300048927 Bacteria 1764
609 Ga0496124_0175192 3300048927 Bacteria 1656
610 Ga0496125_0000009 3300048928 Bacteria 677678
611 Ga0496125_0004716 3300048928 Bacteria 15541
612 Ga0496125_0004820 3300048928 Bacteria 15335
613 Ga0496125_0005489 3300048928 Bacteria 14066
614 Ga0496125_0061793 3300048928 Bacteria 3001
615 Ga0496125_0081889 3300048928 Bacteria 2463
616 Ga0496126_0000779 3300048929 Bacteria 57561
617 Ga0496126_0003414 3300048929 Bacteria 20080
618 Ga0496126_0039952 3300048929 Bacteria 4350
619 Ga0496126_0045247 3300048929 Bacteria 4046
620 Ga0496126_0070293 3300048929 Bacteria 3119
621 Ga0496126_0078009 3300048929 Bacteria 2935
622 Ga0501305_000167 3300049161 Bacteria 4473
623 Ga0501305_007969 3300049161 Bacteria 1359
624 Ga0495678_004515 3300049459 Bacteria 8024
625 Ga0501312_000134 3300049528 Bacteria 4637
626 Ga0501314_003831 3300049530 Bacteria 1226
627 Ga0501315_005212 3300049531 Bacteria 1399
628 Ga0501316_004946 3300049532 Bacteria 1361
629 Ga0501317_002748 3300049533 Bacteria 1692
630 Ga0501317_005478 3300049533 Bacteria 1361
631 Ga0501323_000290 3300049539 Bacteria 3467
632 Ga0501323_007455 3300049539 Bacteria 1249
633 Ga0501335_004207 3300049551 Bacteria 1250
634 Ga0501031_0004673 3300049568 Bacteria 8892
635 Ga0501032_0000006 3300049569 Bacteria 261727
636 Ga0501032_0000045 3300049569 Bacteria 110632
637 Ga0501032_0004902 3300049569 Bacteria 10016
638 Ga0501033_0000053 3300049570 Bacteria 109042
639 Ga0501033_0036195 3300049570 Bacteria 3700
640 Ga0501033_0278252 3300049570 Bacteria 1182
641 Ga0501034_0000001 3300049571 Bacteria 2184493
642 Ga0501034_0000030 3300049571 Bacteria 248180
643 Ga0501034_0049632 3300049571 Bacteria 4234
644 Ga0501034_0080709 3300049571 Bacteria 3256
645 Ga0501034_0116188 3300049571 Bacteria 2664
646 Ga0501034_0120067 3300049571 Bacteria 2615
647 Ga0501034_0158550 3300049571 Bacteria 2235
648 Ga0501036_0000003 3300049572 Bacteria 261545
649 Ga0501037_0000003 3300049573 Bacteria 261548
650 Ga0501037_0003548 3300049573 Bacteria 11318
651 Ga0501038_0000004 3300049574 Bacteria 261289
652 Ga0501038_0001565 3300049574 Bacteria 21184
653 Ga0501038_0059157 3300049574 Bacteria 3283
654 Ga0501038_0128540 3300049574 Bacteria 2083
655 Ga0501038_0363520 3300049574 Bacteria 1125
656 Ga0501039_0000008 3300049575 Bacteria 274778
657 Ga0501039_0000041 3300049575 Bacteria 113488
658 Ga0501039_0004448 3300049575 Bacteria 10579
659 Ga0501040_0000210 3300049576 Bacteria 34012
660 Ga0501042_0004169 3300049578 Bacteria 9187
661 Ga0501042_0147115 3300049578 Bacteria 1698
662 Ga0501043_0000431 3300049579 Bacteria 37716
663 Ga0501046_0003231 3300049580 Bacteria 14971
664 Ga0501047_0002242 3300049581 Bacteria 18498
665 Ga0501047_0172586 3300049581 Bacteria 2031
666 Ga0501048_0004383 3300049582 Bacteria 10748
667 Ga0501067_0002609 3300049583 Bacteria 9976
668 Ga0501067_0036201 3300049583 Bacteria 2741
669 Ga0501070_0022527 3300049586 Bacteria 5277
670 Ga0501070_0102913 3300049586 Bacteria 2362
671 Ga0501070_0187233 3300049586 Bacteria 1702
672 Ga0501071_0027148 3300049587 Bacteria 4025
673 Ga0501073_0050441 3300049589 Bacteria 2916
674 Ga0501074_0005445 3300049590 Bacteria 9155
675 Ga0501074_0136259 3300049590 Bacteria 1756
676 Ga0501077_0101486 3300049593 Bacteria 1823
677 Ga0501077_0134376 3300049593 Bacteria 1569
678 Ga0501077_0195196 3300049593 Bacteria 1286
679 Ga0501223_000043 3300049663 Bacteria 44137
680 Ga0501224_000019 3300049664 Bacteria 78204
681 Ga0501233_000077 3300049668 Bacteria 13013
682 Ga0501225_0000065 3300049705 Bacteria 34445
683 Ga0501079_0094950 3300049741 Bacteria 2311
684 Ga0501083_0008771 3300049744 Bacteria 7135
685 Ga0501035_0000031 3300049822 Bacteria 175591
686 Ga0501044_0000008 3300049823 Bacteria 274778
687 Ga0501044_0000509 3300049823 Bacteria 47320
688 Ga0501044_0023168 3300049823 Bacteria 6608
689 Ga0501044_0068659 3300049823 Bacteria 3610
690 Ga0501044_0121115 3300049823 Bacteria 2617
691 Ga0501044_0139541 3300049823 Bacteria 2413
692 Ga0501226_000080 3300049853 Bacteria 29131
693 nmdc:mga03683_8756_c1 3300050489 Bacteria 3570
694 nmdc:mga00v17_15936_c1 3300050491 Bacteria 4229
695 nmdc:mga00v17_18634_c1 3300050491 Bacteria 3947
696 nmdc:mga00v17_49332_c1 3300050491 Bacteria 2553
697 nmdc:mga0yw44_3196_c1 3300050492 Bacteria 7210
698 nmdc:mga0yw44_56678_c1 3300050492 Bacteria 2389
699 nmdc:mga0yw44_6604_c1 3300050492 Bacteria 5622
700 nmdc:mga0k408_11707_c1 3300050493 Bacteria 4783
701 nmdc:mga0k408_42615_c1 3300050493 Bacteria 2614
702 nmdc:mga07m45_17202_c1 3300050496 Bacteria 3154
703 nmdc:mga05p37_10714_c1 3300050507 Bacteria 10882
704 nmdc:mga05p37_350142_c1 3300050507 Bacteria 1739
705 nmdc:mga05p37_87537_c1 3300050507 Bacteria 3839
706 nmdc:mga0qj67_43499_c1 3300050509 Bacteria 3537
707 nmdc:mga0qj67_83049_c1 3300050509 Bacteria 2568
708 nmdc:mga06r32_57677_c1 3300050510 Bacteria 3730
709 nmdc:mga06r32_8428_c1 3300050510 Bacteria 9289
710 nmdc:mga06r32_84974_c1 3300050510 Bacteria 3085
711 nmdc:mga08y16_167369_c1 3300050511 Bacteria 2283
712 nmdc:mga08y16_45093_c1 3300050511 Bacteria 4619
713 nmdc:mga08y16_67799_c1 3300050511 Bacteria 3722
714 nmdc:mga08y16_87369_c1 3300050511 Bacteria 3249
715 nmdc:mga0n895_183322_c1 3300050512 Bacteria 2125
716 nmdc:mga0n895_214691_c1 3300050512 Bacteria 1954
717 nmdc:mga0n895_2737_c1 3300050512 Bacteria 13916
718 nmdc:mga0n895_33904_c1 3300050512 Bacteria 4910
719 nmdc:mga0n895_58450_c1 3300050512 Bacteria 3802
720 nmdc:mga0n895_87600_c1 3300050512 Bacteria 3111
721 nmdc:mga0rr50_29874_c1 3300050513 Bacteria 3850
722 nmdc:mga0rr50_81888_c1 3300050513 Bacteria 2492
723 nmdc:mga08x19_60609_c1 3300050514 Bacteria 2451
724 nmdc:mga08x19_6_c2 3300050514 Bacteria 52011
725 nmdc:mga08x19_99118_c1 3300050514 Bacteria 1931
726 nmdc:mga0a205_105164_c1 3300050515 Bacteria 2721
727 nmdc:mga0a205_125132_c1 3300050515 Bacteria 2470
728 nmdc:mga0a205_190609_c1 3300050515 Bacteria 1942
729 nmdc:mga0a205_26885_c1 3300050515 Bacteria 3025
730 nmdc:mga0a205_3402_c1 3300050515 Bacteria 14185
731 Ga0495601_0001526 3300053077 Bacteria 12769
732 Ga0495601_0001594 3300053077 Bacteria 12527
733 Ga0495601_0179478 3300053077 Bacteria 1384
734 Ga0495612_0001337 3300053078 Bacteria 10155
735 Ga0495612_0037001 3300053078 Bacteria 1981
736 Ga0495595_0005548 3300053084 Bacteria 5106
737 Ga0495595_0026650 3300053084 Bacteria 2570
738 Ga0495595_0078953 3300053084 Bacteria 1565
739 Ga0495619_0004091 3300053085 Bacteria 9333
740 Ga0495619_0005185 3300053085 Bacteria 8260
741 Ga0495619_0210745 3300053085 Bacteria 1345
742 Ga0500643_001292 3300053087 Bacteria 14753
743 Ga0500651_0036112 3300053093 Bacteria 3114
744 Ga0500641_0004747 3300053096 Bacteria 4808
745 Ga0500556_0002197 3300053104 Bacteria 6547
746 Ga0500658_0023651 3300053134 Bacteria 2348
747 Ga0500559_0000042 3300053136 Bacteria 101570
748 Ga0500568_0000127 3300053139 Bacteria 68647
749 Ga0500588_0002612 3300053146 Bacteria 3696
750 Ga0500616_0013338 3300053153 Bacteria 4776
751 Ga0500619_003726 3300053154 Bacteria 3169
752 Ga0501084_0000234 3300054114 Bacteria 41758
753 Ga0501084_0069303 3300054114 Bacteria 2953
754 Ga0501084_0087990 3300054114 Bacteria 2608
755 Ga0590074_006728 3300059423 Bacteria 1909
756 Ga0590075_004026 3300059424 Bacteria 3477
757 Ga0590075_016712 3300059424 Bacteria 1806
758 Ga0501082_0017108 3300060353 Bacteria 6247
759 Ga0501082_0017151 3300060353 Bacteria 6238
760 Ga0501082_0030808 3300060353 Bacteria 4624
761 Ga0530510_0196755 3300061734 Bacteria 1497
762 2509380352 2509276019 Bacteria 6802256
763 2511180339 2510917027 Bacteria 5287437
764 2512328703 2512047018 Bacteria 6663241
765 2523102757 2522572158 Bacteria 6514390
766 2555258593 2554235234 Bacteria 5762085
767 2595091378 2593339131 Bacteria 5116855
768 2599408997 2599185169 Bacteria 5441380
769 2600401724 2600254943 Bacteria 2613887
770 2601522485 2600255254 Bacteria 5281859
771 2601527512 2600255255 Bacteria 5282785
772 2601614342 2600255280 Bacteria 5292309
773 2601619063 2600255281 Bacteria 5288753
774 2601642325 2600255287 Bacteria 5210468
775 2601647179 2600255288 Bacteria 5282738
776 2601652489 2600255289 Bacteria 5281907
777 2601657816 2600255290 Bacteria 5282218
778 2601662148 2600255291 Bacteria 5217298
779 2601695106 2600255298 Bacteria 5215185
780 2601699778 2600255299 Bacteria 5218662
781 2601706335 2600255300 Bacteria 5287774
782 2601710641 2600255301 Bacteria 5280532
783 2601715655 2600255302 Bacteria 5288235
784 2601720129 2600255303 Bacteria 5219315
785 2601726060 2600255304 Bacteria 5283973
786 2601730601 2600255305 Bacteria 5282329
787 2601735618 2600255306 Bacteria 5281613
788 2601740887 2600255307 Bacteria 5439064
789 2601750817 2600255309 Bacteria 5431045
790 2602018071 2600255392 Bacteria 5437392
791 2603642730 2602042047 Bacteria 4697674
792 2603659511 2602042052 Bacteria 5215873
793 2603664787 2602042053 Bacteria 5214361
794 2603703331 2602042067 Bacteria 4863713
795 2603837993 2602042103 Bacteria 5284714
796 2603843071 2602042104 Bacteria 5281639
797 2603848144 2602042105 Bacteria 5282303
798 2603853215 2602042106 Bacteria 5282744
799 2603867150 2602042109 Bacteria 5152801
800 2603871270 2602042110 Bacteria 5283285
801 2603876192 2602042111 Bacteria 5212080
802 2606048463 2603880178 Bacteria 5283018
803 2606069214 2603880184 Bacteria 5217896
804 2606145030 2603880202 Bacteria 5284684
805 2606175864 2603880211 Bacteria 5284226
806 2609912190 2609459761 Bacteria 5513740
807 2609914142 2609459761 Bacteria 5513740
808 2616550830 2615840698 Bacteria 7319877
809 2637224901 2636415599 Bacteria 5718434
810 2644724222 2643221732 Bacteria 5756404
811 2671103257 2667528172 Bacteria 5170840
812 2671693840 2671180139 Bacteria 4196045
813 2676406137 2675903046 Bacteria 5451247
814 2681997605 2681812866 Bacteria 4552357
815 2682006883 2681812869 Bacteria 5014465
816 2688065515 2687453257 Bacteria 6784659
817 2739269064 2738543017 Bacteria 4271950
818 2745166031 2744054657 Bacteria 5016802
819 2753855684 2751185917 Bacteria 4551186
820 2765588668 2765235842 Bacteria 4799256
821 2775538672 2775506706 Bacteria 4873073
822 2777022071 2775507074 Bacteria 5532402
823 2777761910 2775507177 Bacteria 4384303
824 2777839577 2775507192 Bacteria 4622234
825 2791212505 2788500588 Bacteria 4584915
826 2817620822 2816332336 Bacteria 5207640
827 2819626102 2818991451 Bacteria 4697364
828 2819709379 2818991465 Bacteria 5388835
829 2821119487 2821118458 Bacteria 4714306
830 2823374455 2823373977 Bacteria 4779415
831 2834579536 2834578030 Bacteria 3530182
832 2841964569 2841957949 Bacteria 8652217
833 2844427226 2844425489 Bacteria 4854065
834 2852675098 2852673933 Bacteria 3347676
835 2857460768 2857460504 Bacteria 5194327
836 2857471243 2857465823 Bacteria 6772595
837 2857588011 2857586860 Bacteria 4354574
838 2857595433 2857591370 Bacteria 6569758
839 2881644282 2881644220 Bacteria 5302661
840 2904514224 2904513164 Bacteria 5476410
841 2904606772 2904606771 Bacteria 4684500
842 2915597836 2915597211 Bacteria 6475886
843 2915610581 2915606848 Bacteria 6032732
844 2919110462 2919108558 Bacteria 5897419
845 2919139565 2919138771 Bacteria 5281312
846 2919140319 2919138771 Bacteria 5281312
847 2919414354 2919414237 Bacteria 5429133
848 2919723097 2919720352 Bacteria 5986006
849 2923634548 2923634449 Bacteria 4753480
850 2927834395 2927833300 Bacteria 4923934
851 2928511811 2928510474 Bacteria 4815308
852 2929006248 2929004312 Bacteria 5678476
853 2929189345 2929183550 Bacteria 6377511
854 2936345166 2936340661 Bacteria 5139038
855 2937540260 2937539931 Bacteria 4639830
856 2939573629 2939573065 Bacteria 4926053
857 2939593417 2939593269 Bacteria 4798695
858 2945876230 2945874760 Bacteria 5527237
859 2945877976 2945874760 Bacteria 5527237
860 2960319997 2960319331 Bacteria 5502575
861 2969081884 2969079654 Bacteria 5439582
862 2971821821 2971820967 Bacteria 5823634
863 2984564313 2984559226 Bacteria 5683096
864 2984597045 2984595703 Bacteria 5682994
865 3000376911 3000376612 Bacteria 4705565
866 3007856383 3007855910 Bacteria 5637581
867 8018408444 8018405270 Bacteria 4978981
868 8022949707 8022948649 Bacteria 5366783
869 8054845071 8054844752 Bacteria 4450330
870 8055533182 8055531788 Bacteria 5249694
871 8057305068 8057304971 Bacteria 4649742
872 Ga0209676_1001194
873 SwRhRL2b_contig_2703074
874 JGI24736J21556_1001340
875 JGI24740J21852_10006911
876 JGI24735J21928_10001258
877 Ga0006778J45830_1026826
878 JGI25151J46595_10000302
879 JGI25151J46595_10002958
880 JGI25151J46595_10007108
881 JGI25151J46595_10039571
882 rootH2_10023994
883 rootH2_10083643
884 Ga0007416J51690_1021970
885 Ga0007429J51699_1018838
886 Ga0055532_1000060
887 Ga0055532_1001176
888 Ga0055542_1000589
889 Ga0055529_1004088
890 Ga0055536_1000461
891 Ga0055536_1000666
892 Ga0055530_10000424
893 Ga0055540_1000122
894 Ga0055531_10000146
895 Ga0058692_1000622
896 Ga0058692_1000674
897 Ga0058692_1007359
898 Ga0065714_10084763
899 Ga0065704_10070699
900 Ga0065704_10083393
901 Ga0065707_10105464
902 Ga0070658_10006314
903 Ga0070676_10055192
904 Ga0070676_10061532
905 Ga0070690_100049678
906 Ga0070670_100045743
907 Ga0070670_100057539
908 Ga0070666_10004186
909 Ga0070680_100009507
910 Ga0070682_100059039
911 Ga0070689_100015633
912 Ga0070689_100065480
913 Ga0070692_10129027
914 Ga0070668_100000707
915 Ga0070668_100004391
916 Ga0070673_100067712
917 Ga0070688_100022333
918 Ga0070667_100003824
919 Ga0070709_10065471
920 Ga0070714_100074276
921 Ga0070713_100037681
922 Ga0070713_100051297
923 Ga0070713_100063212
924 Ga0070710_10021576
925 Ga0070705_100049180
926 Ga0070700_100006997
927 Ga0070694_100001005
928 Ga0070694_100058197
929 Ga0070708_100026124
930 Ga0070663_100020685
931 Ga0070663_100163365
932 Ga0070681_10004050
933 Ga0070681_10078648
934 Ga0070681_10145752
935 Ga0068867_100027781
936 Ga0070685_10093879
937 Ga0070706_100004372
938 Ga0070706_100153608
939 Ga0070707_100064773
940 Ga0070699_100000540
941 Ga0070699_100184242
942 Ga0070679_100025738
943 Ga0070679_100073177
944 Ga0070684_100100836
945 Ga0070697_100127625
946 Ga0068853_100000230
947 Ga0068853_100360062
948 Ga0070695_100000710
949 Ga0070695_100010886
950 Ga0070696_100000156
951 Ga0070665_100000406
952 Ga0070665_100006587
953 Ga0070665_100011615
954 Ga0068855_100000034
955 Ga0068855_100161923
956 Ga0068857_100006498
957 Ga0068854_100106278
958 Ga0068854_100185818
959 Ga0068856_100031657
960 Ga0068852_100018197
961 Ga0068859_100199657
962 Ga0068864_100164996
963 Ga0068861_100031979
964 Ga0068858_100037806
965 Ga0068860_100000351
966 Ga0068860_100007718
967 Ga0068860_100078572
968 Ga0068862_100024035
969 Ga0068862_100045374
970 Ga0068862_100050025
971 Ga0068862_100063471
972 Ga0081455_10000028
973 Ga0081455_10001108
974 Ga0081455_10045047
975 Ga0081455_10100945
976 Ga0081538_10007910
977 Ga0081538_10018206
978 Ga0081538_10020695
979 Ga0081538_10024985
980 Ga0081540_1000060
981 Ga0081540_1043059
982 Ga0081539_10000977
983 Ga0081539_10005453
984 Ga0081539_10010261
985 Ga0081539_10015990
986 Ga0070717_10024871
987 Ga0070717_10057481
988 Ga0070717_10080726
989 Ga0075365_10009401
990 Ga0075365_10036665
991 Ga0075363_100038942
992 Ga0075364_10043851
993 Ga0070715_10015199
994 Ga0070716_100027329
995 Ga0070716_100216075
996 Ga0070712_100014972
997 Ga0070712_100068020
998 Ga0075366_10017931
999 Ga0075370_10011338
1000 Ga0075370_10014893
1001 Ga0075428_100002387
1002 Ga0075428_100002525
1003 Ga0075428_100057384
1004 Ga0075430_100060823
1005 Ga0075430_100089607
1006 Ga0075431_100005137
1007 Ga0075431_100087766
1008 Ga0075433_10011214
1009 Ga0075433_10122881
1010 Ga0075434_100067556
1011 Ga0075434_100091899
1012 Ga0075434_100192022
1013 Ga0075436_100002374
1014 Ga0075436_100043110
1015 Ga0097620_100199661
1016 Ga0079104_1001990
1017 Ga0075435_100029369
1018 Ga0075435_100079607
1019 Ga0099794_10008524
1020 Ga0105251_10000064
1021 Ga0105251_10001689
1022 Ga0105251_10008061
1023 Ga0105251_10034656
1024 Ga0105250_10000053
1025 Ga0105250_10001882
1026 Ga0105250_10005639
1027 Ga0105250_10043755
1028 Ga0105240_10022032
1029 Ga0111539_10018998
1030 Ga0111539_10034619
1031 Ga0105245_10005334
1032 Ga0114129_10023661
1033 Ga0114129_10032683
1034 Ga0114129_10040156
1035 Ga0114129_10098515
1036 Ga0105241_10016604
1037 Ga0105248_10000001
1038 Ga0105248_10024110
1039 Ga0105248_10069958
1040 Ga0105249_10299309
1041 Ga0105148_100251
1042 Ga0099796_10000988
1043 Ga0099796_10004076
1044 Ga0105246_10004282
1045 Ga0157345_1000058
1046 Ga0157370_10004253
1047 Ga0157370_10110370
1048 Ga0157369_10002217
1049 Ga0157369_10002227
1050 Ga0157369_10007939
1051 Ga0157369_10298786
1052 Ga0157369_10406137
1053 Ga0157374_10098952
1054 Ga0163162_10201294
1055 Ga0157372_10337573
1056 Ga0157375_10254859
1057 Ga0163163_10245913
1058 Ga0182008_10101987
1059 Ga0183366_1001
1060 Ga0183370_1001
1061 Ga0183369_1001
1062 Ga0183368_1001
1063 Ga0163161_10006599
1064 Ga0206356_10667046
1065 Ga0213872_10000860
1066 Ga0213872_10022550
1067 Ga0213876_10000084
1068 Ga0213876_10000103
1069 Ga0247553_100221
1070 Ga0228598_1000875
1071 Ga0209784_100118
1072 Ga0209147_100080
1073 Ga0209147_100101
1074 Ga0209148_1000384
1075 Ga0209455_1000152
1076 Ga0209675_1005781
1077 Ga0209676_1000020
1078 Ga0209676_1000102
1079 Ga0209676_1000427
1080 Ga0209025_1000262
1081 Ga0209025_1002935
1082 Ga0209025_1004102
1083 Ga0209025_1005174
1084 Ga0209025_1008076
1085 Ga0209050_1000105
1086 Ga0209051_1000066
1087 Ga0209257_1000124
1088 Ga0207696_1000088
1089 Ga0207696_1000116
1090 Ga0207696_1002383
1091 Ga0207696_1005207
1092 Ga0207655_1007416
1093 Ga0207655_1026537
1094 Ga0207713_1000002
1095 Ga0207713_1000370
1096 Ga0207713_1000883
1097 Ga0207713_1002682
1098 Ga0207713_1002965
1099 Ga0207713_1025470
1100 Ga0207713_1032114
1101 Ga0207713_1037039
1102 Ga0207653_10000724
1103 Ga0207692_10022673
1104 Ga0207692_10095516
1105 Ga0207688_10006050
1106 Ga0207680_10000192
1107 Ga0207685_10004693
1108 Ga0207699_10158718
1109 Ga0207645_10046281
1110 Ga0207684_10006877
1111 Ga0207684_10033976
1112 Ga0207707_10013817
1113 Ga0207707_10019402
1114 Ga0207695_10141179
1115 Ga0207693_10002296
1116 Ga0207693_10024341
1117 Ga0207693_10049456
1118 Ga0207693_10064671
1119 Ga0207663_10019794
1120 Ga0207660_10003986
1121 Ga0207660_10184586
1122 Ga0207646_10026623
1123 Ga0207650_10002443
1124 Ga0207650_10099874
1125 Ga0207659_10112886
1126 Ga0207687_10066936
1127 Ga0207700_10007976
1128 Ga0207700_10075251
1129 Ga0207700_10301932
1130 Ga0207664_10079190
1131 Ga0207670_10009459
1132 Ga0207670_10016209
1133 Ga0207670_10170450
1134 Ga0207665_10000117
1135 Ga0207665_10272203
1136 Ga0207691_10133928
1137 Ga0207711_10000001
1138 Ga0207711_10013853
1139 Ga0207667_10108121
1140 Ga0207651_10014448
1141 Ga0207712_10014325
1142 Ga0207668_10000002
1143 Ga0207668_10025508
1144 Ga0207668_10033453
1145 Ga0207640_10073191
1146 Ga0207640_10096434
1147 Ga0207703_10003659
1148 Ga0207639_10000338
1149 Ga0207639_10017877
1150 Ga0207678_10029207
1151 Ga0207708_10013835
1152 Ga0207641_10165713
1153 Ga0207648_10040324
1154 Ga0207648_10160414
1155 Ga0207674_10004781
1156 Ga0207674_10013979
1157 Ga0207675_100267322
1158 Ga0207698_10142237
1159 Ga0209281_1000820
1160 Ga0209371_1000001
1161 Ga0209371_1000020
1162 Ga0209371_1001119
1163 Ga0209371_1002623
1164 Ga0209371_1006607
1165 Ga0209813_10012558
1166 Ga0209974_10026553
1167 Ga0268266_10000435
1168 Ga0268266_10000811
1169 Ga0268265_10006024
1170 Ga0268264_10000749
1171 Ga0268264_10035403
1172 Ga0268264_10049442
1173 Ga0307517_10008180
1174 Ga0268256_1000001
1175 Ga0268256_1000057
1176 Ga0268256_1000951
1177 Ga0268256_1002322
1178 Ga0268256_1006662
1179 Ga0316178_1118621
1180 Ga0265330_10055322
1181 Ga0265332_10001502
1182 Ga0265320_10000039
1183 Ga0265320_10000550
1184 Ga0265325_10048989
1185 Ga0265325_10058138
1186 Ga0265340_10040691
1187 Ga0265339_10011897
1188 Ga0265339_10036463
1189 Ga0307513_10000077
1190 Ga0307408_100006252
1191 Ga0307408_100029279
1192 Ga0307408_100058061
1193 Ga0316575_10017975
1194 Ga0265314_10013436
1195 Ga0265314_10014914
1196 Ga0265314_10019715
1197 Ga0265314_10097843
1198 Ga0265342_10008983
1199 Ga0265342_10092051
1200 Ga0316576_10034845
1201 Ga0316576_10042757
1202 Ga0316576_10155394
1203 Ga0316578_10000916
1204 Ga0316578_10014050
1205 Ga0316578_10092765
1206 Ga0307405_10082306
1207 Ga0307410_10023315
1208 Ga0307410_10110887
1209 Ga0307410_10154752
1210 Ga0307412_10085309
1211 Ga0307412_10117093
1212 Ga0307409_100042898
1213 Ga0307409_100219446
1214 Ga0307416_100053199
1215 Ga0307416_100087297
1216 Ga0307416_100194892
1217 Ga0307414_10156780
1218 Ga0316053_101354
1219 Ga0316585_10015583
1220 Ga0316580_10011049
1221 Ga0316580_10013050
1222 Ga0316588_1010906
1223 Ga0316596_1007729
1224 Ga0373926_0013371
1225 Ga0373926_0059021
1226 Ga0373940_0006440
1227 Ga0373944_0002385
1228 Ga0373949_0010649
1229 Ga0373923_0009386
1230 Ga0373932_0011803
1231 Ga0373939_0019131
1232 Ga0373941_0009585
1233 Ga0373956_0012242
1234 Ga0373956_0052707
1235 Ga0373943_0007037
1236 Ga0373955_0026576
1237 Ga0373961_0004207
1238 Ga0316574_0006329
1239 Ga0316574_0007076
1240 Ga0316574_0012119
1241 Ga0373924_0051158
1242 Ga0373931_0002980
1243 Ga0373931_0009777
1244 Ga0373935_0001583
1245 Ga0373935_0003507
1246 Ga0373935_0052567
1247 Ga0373927_0000243
1248 Ga0373927_0050482
1249 Ga0373933_0008345
1250 Ga0373933_0039115
1251 Ga0373933_0075339
1252 Ga0373947_0006288
1253 Ga0373937_0014589
1254 Ga0373937_0041928
1255 Ga0373937_0057447
1256 Ga0316582_0039051
1257 Ga0316582_0100345
1258 Ga0316584_0020718
1259 Ga0316584_0044039
1260 Ga0373925_0102445
1261 Ga0395898_0041459
1262 Ga0436364_0777042
1263 Ga0436364_0943381
1264 Ga0436364_0992727
1265 Ga0395901_0085923
1266 Ga0237819_00896
1267 Ga0400483_011703
1268 Ga0400483_144988
1269 Ga0400483_150944
1270 Ga0400489_33857
1271 Ga0436365_0203066
1272 Ga0436365_0924222
1273 Ga0436365_1805879
1274 Ga0436365_1861022
1275 Ga0436360_0886478
1276 Ga0436361_0453677
1277 Ga0436361_0984484
1278 Ga0436361_1001866
1279 Ga0436363_0439161
1280 Ga0436363_0452161
1281 Ga0436363_1190291
1282 Ga0436362_0660459
1283 Ga0439436_0001265
1284 Ga0439438_005534
1285 Ga0439438_006885
1286 Ga0439447_007714
1287 Ga0451853_1896193
1288 Ga0439432_013194
1289 Ga0439432_014713
1290 Ga0439450_000469
1291 Ga0439452_000142
1292 Ga0439452_000221
1293 Ga0439452_001405
1294 Ga0439455_0035371
1295 Ga0450902_015737
1296 Ga0450904_001512
1297 Ga0439434_0008880
1298 Ga0450916_001727
1299 Ga0453683_0005602
1300 Ga0453684_0003922
1301 Ga0453684_0011998
1302 Ga0453684_0048239
1303 Ga0453684_0244145
1304 Ga0453684_0278560
1305 Ga0466960_0136396
1306 Ga0466959_0035190
1307 Ga0451576_0000016
1308 Ga0451576_0000051
1309 Ga0451576_0000696
1310 Ga0451576_0013071
1311 Ga0495591_003608
1312 Ga0495629_0029522
1313 Ga0495638_0007527
1314 Ga0495641_0042091
1315 Ga0495651_0019514
1316 Ga0495651_0130188
1317 Ga0495653_0027546
1318 Ga0495650_0000005
1319 Ga0495580_0046745
1320 Ga0495662_0025639
1321 Ga0495662_0053389
1322 Ga0495664_0069604
1323 Ga0495584_0020115
1324 Ga0495584_0052579
1325 Ga0495585_0002318
1326 Ga0495607_0000668
1327 Ga0495583_0000447
1328 Ga0495583_0010816
1329 Ga0495606_0044385
1330 Ga0495608_0061405
1331 Ga0495610_0004539
1332 Ga0495618_0095864
1333 Ga0495618_0131624
1334 Ga0495628_0045518
1335 Ga0495652_0077715
1336 Ga0495652_0094290
1337 Ga0495654_0003014
1338 Ga0495640_0005373
1339 Ga0495640_0061829
1340 Ga0495587_0018878
1341 Ga0495587_0069761
1342 Ga0495645_0001277
1343 Ga0495633_0024969
1344 Ga0495667_0128996
1345 Ga0495634_0066926
1346 Ga0495635_0020720
1347 Ga0495599_0033264
1348 Ga0495646_0031506
1349 Ga0495647_0091441
1350 Ga0495658_0075819
1351 Ga0495613_0001199
1352 Ga0495613_0187394
1353 Ga0495671_0074401
1354 Ga0495649_0000777
1355 Ga0495649_0001900
1356 Ga0495649_0005219
1357 Ga0495600_0068905
1358 Ga0495604_0024793
1359 Ga0495604_0094935
1360 Ga0495604_0203218
1361 Ga0495674_0002065
1362 Ga0495674_0018921
1363 Ga0495674_0109410
1364 Ga0495676_0124179
1365 Ga0495680_0074380
1366 Ga0495683_0022584
1367 Ga0495675_0059761
1368 Ga0495679_012913
1369 Ga0495684_0014934
1370 Ga0495684_0067146
1371 Ga0495684_0091239
1372 Ga0495593_0013645
1373 Ga0495593_0015025
1374 Ga0495593_0021887
1375 Ga0495602_0024310
1376 Ga0495602_0177774
1377 Ga0496100_0245144
1378 Ga0496101_0057632
1379 Ga0496102_0024135
1380 Ga0496102_0238494
1381 Ga0496102_0243049
1382 Ga0496103_0011761
1383 Ga0496104_0000449
1384 Ga0496104_0002199
1385 Ga0496104_0009135
1386 Ga0496104_0013664
1387 Ga0496104_0085492
1388 Ga0496104_0184392
1389 Ga0496105_0002469
1390 Ga0496105_0006002
1391 Ga0496105_0009008
1392 Ga0496105_0068782
1393 Ga0496105_0091271
1394 Ga0496106_0001760
1395 Ga0496106_0022779
1396 Ga0496106_0022817
1397 Ga0496107_0033613
1398 Ga0496107_0326795
1399 Ga0496108_0002321
1400 Ga0496108_0010630
1401 Ga0496108_0087161
1402 Ga0496109_0033184
1403 Ga0496110_0004012
1404 Ga0496110_0006378
1405 Ga0496110_0014478
1406 Ga0496110_0130943
1407 Ga0496110_0167942
1408 Ga0496110_0256996
1409 Ga0496111_0005262
1410 Ga0496111_0046266
1411 Ga0496111_0066041
1412 Ga0496111_0110256
1413 Ga0496112_0007190
1414 Ga0496112_0028322
1415 Ga0496112_0062681
1416 Ga0496113_0184103
1417 Ga0496113_0195128
1418 Ga0496114_0031868
1419 Ga0496115_0029287
1420 Ga0496115_0032343
1421 Ga0496116_0002683
1422 Ga0496116_0013421
1423 Ga0496116_0017493
1424 Ga0496116_0023278
1425 Ga0496116_0037362
1426 Ga0496116_0064856
1427 Ga0496117_0001622
1428 Ga0496117_0008046
1429 Ga0496117_0008546
1430 Ga0496117_0049826
1431 Ga0496117_0062267
1432 Ga0496117_0065527
1433 Ga0496117_0066130
1434 Ga0496118_0000015
1435 Ga0496118_0005930
1436 Ga0496119_0000841
1437 Ga0496119_0001419
1438 Ga0496119_0003785
1439 Ga0496119_0010725
1440 Ga0496120_0001068
1441 Ga0496120_0003719
1442 Ga0496120_0006370
1443 Ga0496120_0018028
1444 Ga0496120_0018282
1445 Ga0496120_0018283
1446 Ga0496121_0004213
1447 Ga0496121_0004271
1448 Ga0496121_0006970
1449 Ga0496121_0008075
1450 Ga0496121_0034501
1451 Ga0496121_0174712
1452 Ga0496122_0000202
1453 Ga0496122_0000259
1454 Ga0496122_0001139
1455 Ga0496122_0008382
1456 Ga0496122_0012999
1457 Ga0496122_0014310
1458 Ga0496122_0024755
1459 Ga0496122_0030357
1460 Ga0496122_0033844
1461 Ga0496122_0039679
1462 Ga0496122_0175949
1463 Ga0496123_0000144
1464 Ga0496123_0000209
1465 Ga0496123_0001178
1466 Ga0496123_0006680
1467 Ga0496123_0008091
1468 Ga0496123_0008482
1469 Ga0496123_0015055
1470 Ga0496123_0077027
1471 Ga0496123_0100344
1472 Ga0496123_0130560
1473 Ga0496124_0005265
1474 Ga0496124_0014963
1475 Ga0496124_0030441
1476 Ga0496124_0045115
1477 Ga0496124_0065945
1478 Ga0496124_0138639
1479 Ga0496124_0158960
1480 Ga0496124_0175192
1481 Ga0496125_0000009
1482 Ga0496125_0004716
1483 Ga0496125_0004820
1484 Ga0496125_0005489
1485 Ga0496125_0061793
1486 Ga0496125_0081889
1487 Ga0496126_0000779
1488 Ga0496126_0003414
1489 Ga0496126_0039952
1490 Ga0496126_0045247
1491 Ga0496126_0070293
1492 Ga0496126_0078009
1493 Ga0501305_000167
1494 Ga0501305_007969
1495 Ga0495678_004515
1496 Ga0501312_000134
1497 Ga0501314_003831
1498 Ga0501315_005212
1499 Ga0501316_004946
1500 Ga0501317_002748
1501 Ga0501317_005478
1502 Ga0501323_000290
1503 Ga0501323_007455
1504 Ga0501335_004207
1505 Ga0501031_0004673
1506 Ga0501032_0000006
1507 Ga0501032_0000045
1508 Ga0501032_0004902
1509 Ga0501033_0000053
1510 Ga0501033_0036195
1511 Ga0501033_0278252
1512 Ga0501034_0000001
1513 Ga0501034_0000030
1514 Ga0501034_0049632
1515 Ga0501034_0080709
1516 Ga0501034_0116188
1517 Ga0501034_0120067
1518 Ga0501034_0158550
1519 Ga0501036_0000003
1520 Ga0501037_0000003
1521 Ga0501037_0003548
1522 Ga0501038_0000004
1523 Ga0501038_0001565
1524 Ga0501038_0059157
1525 Ga0501038_0128540
1526 Ga0501038_0363520
1527 Ga0501039_0000008
1528 Ga0501039_0000041
1529 Ga0501039_0004448
1530 Ga0501040_0000210
1531 Ga0501042_0004169
1532 Ga0501042_0147115
1533 Ga0501043_0000431
1534 Ga0501046_0003231
1535 Ga0501047_0002242
1536 Ga0501047_0172586
1537 Ga0501048_0004383
1538 Ga0501067_0002609
1539 Ga0501067_0036201
1540 Ga0501070_0022527
1541 Ga0501070_0102913
1542 Ga0501070_0187233
1543 Ga0501071_0027148
1544 Ga0501073_0050441
1545 Ga0501074_0005445
1546 Ga0501074_0136259
1547 Ga0501077_0101486
1548 Ga0501077_0134376
1549 Ga0501077_0195196
1550 Ga0501223_000043
1551 Ga0501224_000019
1552 Ga0501233_000077
1553 Ga0501225_0000065
1554 Ga0501079_0094950
1555 Ga0501083_0008771
1556 Ga0501035_0000031
1557 Ga0501044_0000008
1558 Ga0501044_0000509
1559 Ga0501044_0023168
1560 Ga0501044_0068659
1561 Ga0501044_0121115
1562 Ga0501044_0139541
1563 Ga0501226_000080
1564 nmdc:mga03683_8756_c1
1565 nmdc:mga00v17_15936_c1
1566 nmdc:mga00v17_18634_c1
1567 nmdc:mga00v17_49332_c1
1568 nmdc:mga0yw44_3196_c1
1569 nmdc:mga0yw44_56678_c1
1570 nmdc:mga0yw44_6604_c1
1571 nmdc:mga0k408_11707_c1
1572 nmdc:mga0k408_42615_c1
1573 nmdc:mga07m45_17202_c1
1574 nmdc:mga05p37_10714_c1
1575 nmdc:mga05p37_350142_c1
1576 nmdc:mga05p37_87537_c1
1577 nmdc:mga0qj67_43499_c1
1578 nmdc:mga0qj67_83049_c1
1579 nmdc:mga06r32_57677_c1
1580 nmdc:mga06r32_8428_c1
1581 nmdc:mga06r32_84974_c1
1582 nmdc:mga08y16_167369_c1
1583 nmdc:mga08y16_45093_c1
1584 nmdc:mga08y16_67799_c1
1585 nmdc:mga08y16_87369_c1
1586 nmdc:mga0n895_183322_c1
1587 nmdc:mga0n895_214691_c1
1588 nmdc:mga0n895_2737_c1
1589 nmdc:mga0n895_33904_c1
1590 nmdc:mga0n895_58450_c1
1591 nmdc:mga0n895_87600_c1
1592 nmdc:mga0rr50_29874_c1
1593 nmdc:mga0rr50_81888_c1
1594 nmdc:mga08x19_60609_c1
1595 nmdc:mga08x19_6_c2
1596 nmdc:mga08x19_99118_c1
1597 nmdc:mga0a205_105164_c1
1598 nmdc:mga0a205_125132_c1
1599 nmdc:mga0a205_190609_c1
1600 nmdc:mga0a205_26885_c1
1601 nmdc:mga0a205_3402_c1
1602 Ga0495601_0001526
1603 Ga0495601_0001594
1604 Ga0495601_0179478
1605 Ga0495612_0001337
1606 Ga0495612_0037001
1607 Ga0495595_0005548
1608 Ga0495595_0026650
1609 Ga0495595_0078953
1610 Ga0495619_0004091
1611 Ga0495619_0005185
1612 Ga0495619_0210745
1613 Ga0500643_001292
1614 Ga0500651_0036112
1615 Ga0500641_0004747
1616 Ga0500556_0002197
1617 Ga0500658_0023651
1618 Ga0500559_0000042
1619 Ga0500568_0000127
1620 Ga0500588_0002612
1621 Ga0500616_0013338
1622 Ga0500619_003726
1623 Ga0501084_0000234
1624 Ga0501084_0069303
1625 Ga0501084_0087990
1626 Ga0590074_006728
1627 Ga0590075_004026
1628 Ga0590075_016712
1629 Ga0501082_0017108
1630 Ga0501082_0017151
1631 Ga0501082_0030808
1632 Ga0530510_0196755
1633 2509380352
1634 2511180339
1635 2512328703
1636 2523102757
1637 2555258593
1638 2595091378
1639 2599408997
1640 2600401724
1641 2601522485
1642 2601527512
1643 2601614342
1644 2601619063
1645 2601642325
1646 2601647179
1647 2601652489
1648 2601657816
1649 2601662148
1650 2601695106
1651 2601699778
1652 2601706335
1653 2601710641
1654 2601715655
1655 2601720129
1656 2601726060
1657 2601730601
1658 2601735618
1659 2601740887
1660 2601750817
1661 2602018071
1662 2603642730
1663 2603659511
1664 2603664787
1665 2603703331
1666 2603837993
1667 2603843071
1668 2603848144
1669 2603853215
1670 2603867150
1671 2603871270
1672 2603876192
1673 2606048463
1674 2606069214
1675 2606145030
1676 2606175864
1677 2609912190
1678 2609914142
1679 2616550830
1680 2637224901
1681 2644724222
1682 2671103257
1683 2671693840
1684 2676406137
1685 2681997605
1686 2682006883
1687 2688065515
1688 2739269064
1689 2745166031
1690 2753855684
1691 2765588668
1692 2775538672
1693 2777022071
1694 2777761910
1695 2777839577
1696 2791212505
1697 2817620822
1698 2819626102
1699 2819709379
1700 2821119487
1701 2823374455
1702 2834579536
1703 2841964569
1704 2844427226
1705 2852675098
1706 2857460768
1707 2857471243
1708 2857588011
1709 2857595433
1710 2881644282
1711 2904514224
1712 2904606772
1713 2915597836
1714 2915610581
1715 2919110462
1716 2919139565
1717 2919140319
1718 2919414354
1719 2919723097
1720 2923634548
1721 2927834395
1722 2928511811
1723 2929006248
1724 2929189345
1725 2936345166
1726 2937540260
1727 2939573629
1728 2939593417
1729 2945876230
1730 2945877976
1731 2960319997
1732 2969081884
1733 2971821821
1734 2984564313
1735 2984597045
1736 3000376911
1737 3007856383
1738 8018408444
1739 8022949707
1740 8054845071
1741 8055533182
1742 8057305068

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00108

Thiolase_N

Thiolase, N-terminal domain

57

316

0.99

PF02803

Thiolase_C

Thiolase, C-terminal domain

323

445

0.98

PF00109

ketoacyl-synt

Beta-ketoacyl synthase, N-terminal domain

122

187

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1m3k-assembly1.cif.gz_A biosynthetic thiolase, inactive c89a mutant 0.9929 2 392
1dlu-assembly1.cif.gz_A unliganded biosynthetic thiolase from zoogloea ramigera 0.9923 4 392
7lcl-assembly1.cif.gz_D zoogloea ramigera biosynthetic thiolase q183y mutant 0.9921 3 392
2wkt-assembly1.cif.gz_C biosynthetic thiolase from z. ramigera. complex of the n316a mutant with coenzyme a. 0.992 4 392
1m4s-assembly1.cif.gz_A biosynthetic thiolase, cys89 acetylated, unliganded form 0.9917 1 392
ID Description Score Start End Superfamily
af_A0A096MJY8_281_393_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 1.001 278 388 3.40.47.10
af_O53871_287_399_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9911 278 388 3.40.47.10
af_P76461_265_393_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9908 266 393 3.40.47.10
af_Q8CAY6_6_396_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9903 2 393 3.40.47.10
af_Q8CAY6_6_396_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9877 2 393 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A7X6WFA2-F1-model_v4 Acetyl-CoA C-acyltransferase (EC 2.3.1.9) 1.001 284 393 GO:0003985
GO:0006635
GO:0010124
AF-M5BJ77-F1-model_v4 Acetyl-CoA C-acetyltransferase (EC 2.3.1.9) 0.9971 2 122 GO:0003985
GO:0005739
GO:0006635
AF-A0A3D6CKC3-F1-model_v4 Acetyl-CoA C-acetyltransferase (EC 2.3.1.9) 0.9965 1 107 GO:0003985
GO:0006635
AF-X1NTI0-F1-model_v4 Electron transfer flavoprotein alpha/beta-subunit N-terminal domain-containing protein 0.996 275 393 GO:0016747
AF-A0A098ME79-F1-model_v4 Thiolase C-terminal domain-containing protein 0.9956 277 393 GO:0003988
GO:0006635
GO:0010124

Map