F484187

General Info

Members Datasets Scaffolds Average Seq Length
871 244 1742 261

Family's Representative Sequence

Representative Sequence 3300025933|Ga0207706_10107453|Ga0207706_101074531
Length 274
Sequence MILAIDAGNTNLVFALVDKGEIKARWRIATDPRRTADQYSVWLHQLLELEGFSRDQIDGVIIGTVVPRALHNLEVLSEKYFRKTPVIAGQGAAEWPLQLDVDEPHNVGADRALNAIAAHAKYPGDLLIIDFGTATTFDVVSASGAYTGGIIAPGINLSLDALVNAAAKLPRIAIETPATNSVIGRTTASQMIIGIYWGYVAMLEGLTERIKSEVGRPVTVVATGLGHGDDVTRICVEHTDPAKHESSVIDCKTARVVKKLLRSPDAHDSGVNTT

Samples

Sample ID Description Type Environment
1 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
82 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
180 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
181 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
182 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
183 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
184 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
185 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
186 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
187 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
188 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
189 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
220 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
221 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
222 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
227 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
228 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
229 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
230 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
231 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
232 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
233 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
234 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
235 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
236 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
237 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
238 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
239 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
240 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
241 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
242 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
243 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 4.59
Rhizosphere 93.92
Stem 0
Stem Tuber 0
Unclassified 0.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207706_10107453 3300025933 Bacteria 2456
2 SwRhRL2b_contig_3748052 2162886007 Bacteria 1346
3 JGI24741J21665_1000692 3300001915 Bacteria 10187
4 JGI24740J21852_10002149 3300001979 Bacteria 9011
5 JGI24740J21852_10003759 3300001979 Bacteria 6608
6 JGI24740J21852_10021057 3300001979 Bacteria 2265
7 JGI24739J22299_10000252 3300001989 Bacteria 18058
8 JGI24739J22299_10001180 3300001989 Bacteria 9776
9 JGI24737J22298_10002295 3300001990 Bacteria 6798
10 JGI24737J22298_10005205 3300001990 Bacteria 4500
11 JGI24737J22298_10006259 3300001990 Bacteria 4074
12 JGI24737J22298_10022606 3300001990 Bacteria 1999
13 JGI24735J21928_10001159 3300002067 Bacteria 9419
14 JGI24735J21928_10012860 3300002067 Bacteria 2642
15 JGI24738J21930_10000674 3300002075 Bacteria 9899
16 JGI24738J21930_10001019 3300002075 Bacteria 8002
17 JGI24744J21845_10001866 3300002077 Bacteria 4234
18 Ga0065704_10073918 3300005289 Bacteria 6672
19 Ga0065707_10010189 3300005295 Bacteria 2281
20 Ga0070658_10069755 3300005327 Bacteria 2876
21 Ga0070658_10079929 3300005327 Bacteria 2685
22 Ga0070658_10133947 3300005327 Bacteria 2066
23 Ga0070658_10146879 3300005327 Bacteria 1972
24 Ga0070658_10159219 3300005327 Bacteria 1894
25 Ga0070658_10206277 3300005327 Bacteria 1660
26 Ga0070658_10240928 3300005327 Bacteria 1533
27 Ga0070658_10344516 3300005327 Bacteria 1275
28 Ga0070658_10377692 3300005327 Bacteria 1215
29 Ga0070676_10003269 3300005328 Bacteria 8417
30 Ga0070676_10196259 3300005328 Bacteria 1321
31 Ga0070676_10240914 3300005328 Bacteria 1203
32 Ga0070676_10245316 3300005328 Bacteria 1193
33 Ga0070676_10405803 3300005328 Bacteria 949
34 Ga0070676_10442032 3300005328 Bacteria 913
35 Ga0070683_100019454 3300005329 Bacteria 6031
36 Ga0070683_100024802 3300005329 Bacteria 5377
37 Ga0070683_100141403 3300005329 Bacteria 2280
38 Ga0070683_100255802 3300005329 Bacteria 1666
39 Ga0070690_100015646 3300005330 Bacteria 4531
40 Ga0070690_100025806 3300005330 Bacteria 3620
41 Ga0070690_100096383 3300005330 Bacteria 1955
42 Ga0070670_100000807 3300005331 Bacteria 24382
43 Ga0070670_100008121 3300005331 Bacteria 8932
44 Ga0070670_100014557 3300005331 Bacteria 6754
45 Ga0070670_100031408 3300005331 Bacteria 4573
46 Ga0070670_100031539 3300005331 Bacteria 4565
47 Ga0070677_10023752 3300005333 Bacteria 2273
48 Ga0070677_10088434 3300005333 Bacteria 1342
49 Ga0068869_100024538 3300005334 Bacteria 4176
50 Ga0070666_10002658 3300005335 Bacteria 10780
51 Ga0070666_10003092 3300005335 Bacteria 10102
52 Ga0070666_10013352 3300005335 Bacteria 5208
53 Ga0070666_10032530 3300005335 Bacteria 3445
54 Ga0070666_10246778 3300005335 Bacteria 1263
55 Ga0070680_100003695 3300005336 Bacteria 11429
56 Ga0070680_100012588 3300005336 Bacteria 6577
57 Ga0070682_100013647 3300005337 Bacteria 4680
58 Ga0070682_100145211 3300005337 Bacteria 1622
59 Ga0068868_100001893 3300005338 Bacteria 14366
60 Ga0068868_100009974 3300005338 Bacteria 6861
61 Ga0068868_100013938 3300005338 Bacteria 5913
62 Ga0068868_100169491 3300005338 Bacteria 1807
63 Ga0068868_100560811 3300005338 Bacteria 1008
64 Ga0070660_100006064 3300005339 Bacteria 8358
65 Ga0070660_100014880 3300005339 Bacteria 5615
66 Ga0070660_100021606 3300005339 Bacteria 4749
67 Ga0070660_100029285 3300005339 Bacteria 4125
68 Ga0070660_100035865 3300005339 Bacteria 3754
69 Ga0070660_100038635 3300005339 Bacteria 3624
70 Ga0070660_100042108 3300005339 Bacteria 3484
71 Ga0070660_100093260 3300005339 Bacteria 2377
72 Ga0070660_100134033 3300005339 Bacteria 1984
73 Ga0070660_100393123 3300005339 Bacteria 1146
74 Ga0070689_100006805 3300005340 Bacteria 7951
75 Ga0070689_100247015 3300005340 Bacteria 1471
76 Ga0070691_10098103 3300005341 Bacteria 1452
77 Ga0070661_100009704 3300005344 Bacteria 6676
78 Ga0070661_100014744 3300005344 Bacteria 5512
79 Ga0070661_100037391 3300005344 Bacteria 3531
80 Ga0070661_100094213 3300005344 Bacteria 2219
81 Ga0070661_100105175 3300005344 Bacteria 2103
82 Ga0070661_100120518 3300005344 Bacteria 1964
83 Ga0070661_100122744 3300005344 Bacteria 1946
84 Ga0070661_100182420 3300005344 Bacteria 1597
85 Ga0070661_100361200 3300005344 Bacteria 1141
86 Ga0070668_100124876 3300005347 Bacteria 2061
87 Ga0070668_100148459 3300005347 Bacteria 1894
88 Ga0070669_100001260 3300005353 Bacteria 18380
89 Ga0070675_100104855 3300005354 Bacteria 2385
90 Ga0070675_100163269 3300005354 Bacteria 1917
91 Ga0070671_100000927 3300005355 Bacteria 21442
92 Ga0070671_100002825 3300005355 Bacteria 13490
93 Ga0070671_100011596 3300005355 Bacteria 7092
94 Ga0070671_100012260 3300005355 Bacteria 6897
95 Ga0070671_100028280 3300005355 Bacteria 4616
96 Ga0070671_100089917 3300005355 Bacteria 2570
97 Ga0070671_100273666 3300005355 Bacteria 1435
98 Ga0070671_100328366 3300005355 Bacteria 1304
99 Ga0070674_100023242 3300005356 Bacteria 4010
100 Ga0070674_100041914 3300005356 Bacteria 3106
101 Ga0070674_100179089 3300005356 Bacteria 1622
102 Ga0070673_100001674 3300005364 Bacteria 13140
103 Ga0070673_100002345 3300005364 Bacteria 11503
104 Ga0070673_100020014 3300005364 Bacteria 4819
105 Ga0070673_100049184 3300005364 Bacteria 3291
106 Ga0070673_100054226 3300005364 Bacteria 3153
107 Ga0070673_100076667 3300005364 Bacteria 2700
108 Ga0070673_100455939 3300005364 Bacteria 1151
109 Ga0070659_100001267 3300005366 Bacteria 18320
110 Ga0070659_100018346 3300005366 Bacteria 5281
111 Ga0070659_100039254 3300005366 Bacteria 3695
112 Ga0070659_100044004 3300005366 Bacteria 3494
113 Ga0070659_100045903 3300005366 Bacteria 3424
114 Ga0070659_100250544 3300005366 Bacteria 1468
115 Ga0070659_100268103 3300005366 Bacteria 1418
116 Ga0070667_100004545 3300005367 Bacteria 11676
117 Ga0070667_100005246 3300005367 Bacteria 10834
118 Ga0070667_100021218 3300005367 Bacteria 5397
119 Ga0070667_100192796 3300005367 Bacteria 1806
120 Ga0070667_100233717 3300005367 Bacteria 1640
121 Ga0070667_100401331 3300005367 Bacteria 1248
122 Ga0070667_100411854 3300005367 Bacteria 1231
123 Ga0070714_100020265 3300005435 Bacteria 5428
124 Ga0070714_100098350 3300005435 Bacteria 2574
125 Ga0070714_100374956 3300005435 Bacteria 1340
126 Ga0070714_100401194 3300005435 Bacteria 1296
127 Ga0070714_100857313 3300005435 Bacteria 881
128 Ga0070663_100014152 3300005455 Bacteria 5113
129 Ga0070663_100029638 3300005455 Bacteria 3742
130 Ga0070663_100089109 3300005455 Bacteria 2282
131 Ga0070663_100153030 3300005455 Bacteria 1770
132 Ga0070678_100009697 3300005456 Bacteria 5851
133 Ga0070678_100053016 3300005456 Bacteria 2948
134 Ga0070678_100098312 3300005456 Bacteria 2263
135 Ga0070678_100202114 3300005456 Bacteria 1641
136 Ga0070678_100554340 3300005456 Bacteria 1021
137 Ga0070662_100001203 3300005457 Bacteria 15912
138 Ga0070662_100034885 3300005457 Bacteria 3549
139 Ga0070662_100078224 3300005457 Bacteria 2456
140 Ga0070662_100135123 3300005457 Bacteria 1906
141 Ga0070662_100140977 3300005457 Bacteria 1868
142 Ga0070662_100165462 3300005457 Bacteria 1733
143 Ga0070662_100336784 3300005457 Bacteria 1233
144 Ga0070681_10044346 3300005458 Bacteria 4451
145 Ga0070681_10303661 3300005458 Bacteria 1505
146 Ga0068867_100005599 3300005459 Bacteria 8900
147 Ga0068867_100018721 3300005459 Bacteria 4924
148 Ga0068867_100052268 3300005459 Bacteria 3015
149 Ga0070685_10461159 3300005466 Bacteria 892
150 Ga0070679_100022016 3300005530 Bacteria 6226
151 Ga0070679_100071652 3300005530 Bacteria 3456
152 Ga0070684_100002726 3300005535 Bacteria 13054
153 Ga0070684_100011882 3300005535 Bacteria 6952
154 Ga0070684_100225611 3300005535 Bacteria 1710
155 Ga0068853_100002144 3300005539 Bacteria 14696
156 Ga0068853_100119051 3300005539 Bacteria 2353
157 Ga0068853_100137438 3300005539 Bacteria 2191
158 Ga0068853_100217507 3300005539 Bacteria 1743
159 Ga0068853_100251837 3300005539 Bacteria 1621
160 Ga0070672_100015078 3300005543 Bacteria 5493
161 Ga0070672_100015719 3300005543 Bacteria 5404
162 Ga0070672_100096027 3300005543 Bacteria 2397
163 Ga0070672_100350488 3300005543 Bacteria 1258
164 Ga0070696_100007378 3300005546 Bacteria 7345
165 Ga0070665_100001208 3300005548 Bacteria 31486
166 Ga0070665_100004742 3300005548 Bacteria 14155
167 Ga0070665_100012842 3300005548 Bacteria 8431
168 Ga0070665_100034005 3300005548 Bacteria 5126
169 Ga0068855_100002638 3300005563 Bacteria 22114
170 Ga0068855_100113573 3300005563 Bacteria 3107
171 Ga0068855_100193123 3300005563 Bacteria 2295
172 Ga0068855_100199919 3300005563 Bacteria 2250
173 Ga0068855_100353041 3300005563 Bacteria 1619
174 Ga0070664_100000446 3300005564 Bacteria 31189
175 Ga0070664_100003398 3300005564 Bacteria 12850
176 Ga0070664_100012233 3300005564 Bacteria 6974
177 Ga0070664_100048375 3300005564 Bacteria 3594
178 Ga0070664_100074362 3300005564 Bacteria 2916
179 Ga0070664_100076084 3300005564 Bacteria 2883
180 Ga0070664_100097431 3300005564 Bacteria 2553
181 Ga0070664_100146716 3300005564 Bacteria 2081
182 Ga0070664_100573006 3300005564 Bacteria 1045
183 Ga0068857_100001517 3300005577 Bacteria 18537
184 Ga0068857_100003065 3300005577 Bacteria 13816
185 Ga0068857_100004069 3300005577 Bacteria 12310
186 Ga0068857_100304739 3300005577 Bacteria 1469
187 Ga0068854_100003147 3300005578 Bacteria 10280
188 Ga0068854_100008221 3300005578 Bacteria 6697
189 Ga0068854_100023884 3300005578 Bacteria 4179
190 Ga0068854_100080461 3300005578 Bacteria 2404
191 Ga0068854_100106470 3300005578 Bacteria 2110
192 Ga0068854_100144622 3300005578 Bacteria 1828
193 Ga0068854_100343546 3300005578 Bacteria 1219
194 Ga0068854_100520284 3300005578 Bacteria 1005
195 Ga0068854_100674101 3300005578 Bacteria 890
196 Ga0068856_100015113 3300005614 Bacteria 7458
197 Ga0068856_100040080 3300005614 Bacteria 4599
198 Ga0068856_100050336 3300005614 Bacteria 4107
199 Ga0068856_100078153 3300005614 Bacteria 3280
200 Ga0070702_100269258 3300005615 Bacteria 1164
201 Ga0068852_100000461 3300005616 Bacteria 26890
202 Ga0068852_100019867 3300005616 Bacteria 5329
203 Ga0068852_100029627 3300005616 Bacteria 4499
204 Ga0068852_100116814 3300005616 Bacteria 2435
205 Ga0068852_100126481 3300005616 Bacteria 2348
206 Ga0068852_100494035 3300005616 Bacteria 1218
207 Ga0068852_101081768 3300005616 Bacteria 822
208 Ga0068859_100008534 3300005617 Bacteria 10365
209 Ga0068859_100009839 3300005617 Bacteria 9652
210 Ga0068859_100050360 3300005617 Bacteria 4184
211 Ga0068859_100243805 3300005617 Bacteria 1887
212 Ga0068864_100003315 3300005618 Bacteria 13307
213 Ga0068864_100020883 3300005618 Bacteria 5481
214 Ga0068864_100064482 3300005618 Bacteria 3177
215 Ga0068864_100118776 3300005618 Bacteria 2361
216 Ga0068864_100254766 3300005618 Bacteria 1631
217 Ga0068866_10056715 3300005718 Bacteria 2015
218 Ga0068861_100000052 3300005719 Bacteria 54577
219 Ga0068861_100216662 3300005719 Bacteria 1616
220 Ga0068851_10006913 3300005834 Bacteria 5202
221 Ga0068851_10018291 3300005834 Bacteria 3375
222 Ga0068851_10215039 3300005834 Bacteria 1078
223 Ga0068851_10230068 3300005834 Bacteria 1045
224 Ga0068870_10136484 3300005840 Bacteria 1431
225 Ga0068863_100003487 3300005841 Bacteria 15520
226 Ga0068863_100008185 3300005841 Bacteria 10213
227 Ga0068863_100009190 3300005841 Bacteria 9642
228 Ga0068863_100012720 3300005841 Bacteria 8116
229 Ga0068863_100036906 3300005841 Bacteria 4653
230 Ga0068863_100057339 3300005841 Bacteria 3686
231 Ga0068858_100008071 3300005842 Bacteria 10138
232 Ga0068858_100017583 3300005842 Bacteria 6704
233 Ga0068858_100136500 3300005842 Bacteria 2301
234 Ga0068858_100157035 3300005842 Bacteria 2140
235 Ga0068860_100003073 3300005843 Bacteria 17251
236 Ga0068860_100036352 3300005843 Bacteria 4720
237 Ga0068860_100064032 3300005843 Bacteria 3492
238 Ga0068862_100018707 3300005844 Bacteria 5770
239 Ga0068862_100492483 3300005844 Bacteria 1162
240 Ga0081539_10188094 3300005985 Bacteria 963
241 Ga0070716_100084000 3300006173 Bacteria 1908
242 Ga0097621_100003754 3300006237 Bacteria 10526
243 Ga0097621_100080112 3300006237 Bacteria 2716
244 Ga0097621_100558030 3300006237 Bacteria 1043
245 Ga0068871_100019567 3300006358 Bacteria 5171
246 Ga0068871_100373963 3300006358 Bacteria 1264
247 Ga0068865_100005997 3300006881 Bacteria 7401
248 Ga0068865_100025297 3300006881 Bacteria 3903
249 Ga0068865_100078208 3300006881 Bacteria 2366
250 Ga0097620_100008534 3300006931 Bacteria 10365
251 Ga0097620_100009839 3300006931 Bacteria 9652
252 Ga0097620_100050361 3300006931 Bacteria 4184
253 Ga0097620_100243789 3300006931 Bacteria 1887
254 Ga0105251_10026917 3300009011 Bacteria 2922
255 Ga0105251_10104757 3300009011 Bacteria 1291
256 Ga0105240_10044466 3300009093 Bacteria 5643
257 Ga0105240_10460880 3300009093 Bacteria 1420
258 Ga0105240_10584971 3300009093 Bacteria 1231
259 Ga0105240_10867517 3300009093 Bacteria 973
260 Ga0105245_10001667 3300009098 Bacteria 20219
261 Ga0105247_10450826 3300009101 Bacteria 927
262 Ga0105241_10007878 3300009174 Bacteria 7831
263 Ga0105241_10041880 3300009174 Bacteria 3462
264 Ga0105242_10012800 3300009176 Bacteria 6463
265 Ga0105248_10000096 3300009177 Bacteria 97519
266 Ga0105248_10001577 3300009177 Bacteria 25361
267 Ga0105248_10006141 3300009177 Bacteria 13173
268 Ga0105248_10006863 3300009177 Bacteria 12484
269 Ga0105248_10006890 3300009177 Bacteria 12456
270 Ga0105248_10332047 3300009177 Bacteria 1712
271 Ga0105248_10681055 3300009177 Bacteria 1160
272 Ga0105237_10015281 3300009545 Bacteria 7996
273 Ga0105237_10079942 3300009545 Bacteria 3259
274 Ga0105237_10149808 3300009545 Bacteria 2329
275 Ga0105237_10151641 3300009545 Bacteria 2314
276 Ga0105238_10039716 3300009551 Bacteria 4772
277 Ga0105238_10191208 3300009551 Bacteria 2023
278 Ga0105238_10226369 3300009551 Bacteria 1847
279 Ga0105249_10198579 3300009553 Bacteria 1962
280 Ga0105148_100202 3300009978 Bacteria 8692
281 Ga0105147_105299 3300009982 Bacteria 1083
282 Ga0105239_10117373 3300010375 Bacteria 2953
283 Ga0105246_10022077 3300011119 Bacteria 4104
284 Ga0105246_10040645 3300011119 Bacteria 3140
285 Ga0105246_10275590 3300011119 Bacteria 1347
286 Ga0157373_10007215 3300013100 Bacteria 8288
287 Ga0157373_10017921 3300013100 Bacteria 5156
288 Ga0157373_10039257 3300013100 Bacteria 3390
289 Ga0157373_10081485 3300013100 Bacteria 2281
290 Ga0157373_10122166 3300013100 Bacteria 1830
291 Ga0157373_10129123 3300013100 Bacteria 1777
292 Ga0157373_10155107 3300013100 Bacteria 1611
293 Ga0157371_10003770 3300013102 Bacteria 13565
294 Ga0157371_10022992 3300013102 Bacteria 4558
295 Ga0157371_10040657 3300013102 Bacteria 3320
296 Ga0157371_10076634 3300013102 Bacteria 2368
297 Ga0157371_10114766 3300013102 Bacteria 1913
298 Ga0157371_10132648 3300013102 Bacteria 1773
299 Ga0157371_10135588 3300013102 Bacteria 1753
300 Ga0157371_10197728 3300013102 Bacteria 1441
301 Ga0157370_10102505 3300013104 Bacteria 2680
302 Ga0157370_10382552 3300013104 Bacteria 1296
303 Ga0157370_10532422 3300013104 Bacteria 1078
304 Ga0157369_10122804 3300013105 Bacteria 2755
305 Ga0157369_10139262 3300013105 Bacteria 2568
306 Ga0157369_10193603 3300013105 Bacteria 2136
307 Ga0157369_10214579 3300013105 Bacteria 2016
308 Ga0157369_10980573 3300013105 Bacteria 865
309 Ga0157374_10009229 3300013296 Bacteria 8456
310 Ga0157374_10117607 3300013296 Bacteria 2562
311 Ga0157378_10001776 3300013297 Bacteria 19365
312 Ga0157378_10142034 3300013297 Bacteria 2230
313 Ga0163162_10048501 3300013306 Bacteria 4255
314 Ga0163162_10158044 3300013306 Bacteria 2388
315 Ga0157372_10068574 3300013307 Bacteria 3988
316 Ga0157372_10103884 3300013307 Bacteria 3247
317 Ga0157372_10230095 3300013307 Bacteria 2149
318 Ga0157372_10269475 3300013307 Bacteria 1978
319 Ga0157372_10302866 3300013307 Bacteria 1859
320 Ga0157372_10795999 3300013307 Bacteria 1098
321 Ga0157372_10853167 3300013307 Bacteria 1057
322 Ga0157375_10003831 3300013308 Bacteria 13044
323 Ga0157375_10026239 3300013308 Bacteria 5426
324 Ga0163163_10019009 3300014325 Bacteria 6446
325 Ga0163163_10034122 3300014325 Bacteria 4926
326 Ga0163163_10120482 3300014325 Bacteria 2658
327 Ga0163163_10721089 3300014325 Bacteria 1061
328 Ga0157379_10006317 3300014968 Bacteria 10205
329 Ga0157379_10368662 3300014968 Bacteria 1317
330 Ga0163161_10013697 3300017792 Bacteria 5647
331 Ga0207673_1019010 3300025290 Bacteria 922
332 Ga0207697_10001060 3300025315 Bacteria 15193
333 Ga0207697_10003608 3300025315 Bacteria 7588
334 Ga0207697_10013963 3300025315 Bacteria 3343
335 Ga0207697_10015837 3300025315 Bacteria 3110
336 Ga0207656_10011903 3300025321 Bacteria 3296
337 Ga0207656_10028906 3300025321 Bacteria 2279
338 Ga0207656_10086913 3300025321 Bacteria 1414
339 Ga0207656_10151540 3300025321 Bacteria 1098
340 Ga0207682_10028455 3300025893 Bacteria 2230
341 Ga0207642_10253517 3300025899 Bacteria 1000
342 Ga0207688_10002178 3300025901 Bacteria 10550
343 Ga0207688_10005414 3300025901 Bacteria 6938
344 Ga0207680_10007785 3300025903 Bacteria 5236
345 Ga0207680_10008339 3300025903 Bacteria 5080
346 Ga0207680_10028080 3300025903 Bacteria 3143
347 Ga0207680_10101677 3300025903 Bacteria 1848
348 Ga0207680_10165735 3300025903 Bacteria 1485
349 Ga0207647_10000153 3300025904 Bacteria 54496
350 Ga0207647_10001078 3300025904 Bacteria 21029
351 Ga0207647_10005438 3300025904 Bacteria 9335
352 Ga0207647_10007591 3300025904 Bacteria 7815
353 Ga0207647_10009600 3300025904 Bacteria 6869
354 Ga0207647_10020279 3300025904 Bacteria 4459
355 Ga0207647_10237091 3300025904 Bacteria 1048
356 Ga0207645_10003786 3300025907 Bacteria 11356
357 Ga0207645_10019133 3300025907 Bacteria 4496
358 Ga0207645_10066206 3300025907 Bacteria 2309
359 Ga0207645_10192331 3300025907 Bacteria 1341
360 Ga0207645_10252235 3300025907 Bacteria 1167
361 Ga0207645_10395103 3300025907 Bacteria 929
362 Ga0207643_10016175 3300025908 Bacteria 4067
363 Ga0207705_10007304 3300025909 Bacteria 8125
364 Ga0207705_10009311 3300025909 Bacteria 7143
365 Ga0207705_10041020 3300025909 Bacteria 3320
366 Ga0207705_10071335 3300025909 Bacteria 2518
367 Ga0207705_10073108 3300025909 Bacteria 2487
368 Ga0207705_10105175 3300025909 Bacteria 2080
369 Ga0207705_10299638 3300025909 Bacteria 1233
370 Ga0207705_10382995 3300025909 Bacteria 1086
371 Ga0207654_10021779 3300025911 Bacteria 3412
372 Ga0207654_10084466 3300025911 Bacteria 1919
373 Ga0207654_10132718 3300025911 Bacteria 1578
374 Ga0207654_10147794 3300025911 Bacteria 1505
375 Ga0207707_10130129 3300025912 Bacteria 2201
376 Ga0207707_10413934 3300025912 Bacteria 1156
377 Ga0207695_10014240 3300025913 Bacteria 9433
378 Ga0207695_10089367 3300025913 Bacteria 3098
379 Ga0207695_10489827 3300025913 Bacteria 1112
380 Ga0207695_10581297 3300025913 Bacteria 1001
381 Ga0207695_10604420 3300025913 Bacteria 978
382 Ga0207671_10016290 3300025914 Bacteria 5782
383 Ga0207671_10430501 3300025914 Bacteria 1050
384 Ga0207693_10043480 3300025915 Bacteria 3534
385 Ga0207660_10040596 3300025917 Bacteria 3258
386 Ga0207660_10153568 3300025917 Bacteria 1771
387 Ga0207660_10164361 3300025917 Bacteria 1715
388 Ga0207657_10000924 3300025919 Bacteria 31097
389 Ga0207657_10002827 3300025919 Bacteria 18655
390 Ga0207657_10005125 3300025919 Bacteria 13731
391 Ga0207657_10005183 3300025919 Bacteria 13672
392 Ga0207657_10008828 3300025919 Bacteria 10195
393 Ga0207657_10010444 3300025919 Bacteria 9266
394 Ga0207657_10025691 3300025919 Bacteria 5425
395 Ga0207657_10027595 3300025919 Bacteria 5198
396 Ga0207657_10042191 3300025919 Bacteria 4027
397 Ga0207657_10047659 3300025919 Bacteria 3745
398 Ga0207657_10048576 3300025919 Bacteria 3704
399 Ga0207657_10064335 3300025919 Bacteria 3131
400 Ga0207657_10082175 3300025919 Bacteria 2705
401 Ga0207657_10157225 3300025919 Bacteria 1848
402 Ga0207657_10190417 3300025919 Bacteria 1655
403 Ga0207657_10377541 3300025919 Bacteria 1116
404 Ga0207649_10008713 3300025920 Bacteria 5538
405 Ga0207649_10032395 3300025920 Bacteria 3116
406 Ga0207649_10068043 3300025920 Bacteria 2263
407 Ga0207649_10077508 3300025920 Bacteria 2142
408 Ga0207649_10107548 3300025920 Bacteria 1857
409 Ga0207649_10249720 3300025920 Bacteria 1277
410 Ga0207649_10398560 3300025920 Bacteria 1029
411 Ga0207652_10028892 3300025921 Bacteria 4629
412 Ga0207681_10009549 3300025923 Bacteria 5927
413 Ga0207681_10030101 3300025923 Bacteria 3536
414 Ga0207681_10538046 3300025923 Bacteria 960
415 Ga0207694_10063156 3300025924 Bacteria 2885
416 Ga0207694_10146573 3300025924 Bacteria 1900
417 Ga0207694_10170950 3300025924 Bacteria 1759
418 Ga0207650_10017927 3300025925 Bacteria 4961
419 Ga0207650_10020206 3300025925 Bacteria 4694
420 Ga0207659_10014238 3300025926 Bacteria 5120
421 Ga0207659_10016588 3300025926 Bacteria 4796
422 Ga0207659_10115517 3300025926 Bacteria 2047
423 Ga0207659_10243662 3300025926 Bacteria 1456
424 Ga0207687_10009029 3300025927 Bacteria 6515
425 Ga0207700_10033241 3300025928 Bacteria 3689
426 Ga0207664_10082708 3300025929 Bacteria 2616
427 Ga0207664_10109568 3300025929 Bacteria 2294
428 Ga0207644_10000235 3300025931 Bacteria 38139
429 Ga0207644_10002554 3300025931 Bacteria 11714
430 Ga0207644_10002568 3300025931 Bacteria 11682
431 Ga0207644_10005217 3300025931 Bacteria 8482
432 Ga0207644_10005419 3300025931 Bacteria 8320
433 Ga0207644_10005961 3300025931 Bacteria 7946
434 Ga0207644_10283154 3300025931 Bacteria 1331
435 Ga0207644_10485879 3300025931 Bacteria 1017
436 Ga0207690_10003079 3300025932 Bacteria 10047
437 Ga0207690_10008443 3300025932 Bacteria 6115
438 Ga0207690_10084295 3300025932 Bacteria 2227
439 Ga0207690_10087872 3300025932 Bacteria 2188
440 Ga0207690_10145420 3300025932 Bacteria 1752
441 Ga0207690_10349098 3300025932 Bacteria 1169
442 Ga0207706_10000194 3300025933 Bacteria 67452
443 Ga0207706_10001656 3300025933 Bacteria 22037
444 Ga0207706_10002630 3300025933 Bacteria 17485
445 Ga0207706_10004866 3300025933 Bacteria 12574
446 Ga0207706_10039419 3300025933 Bacteria 4188
447 Ga0207706_10040372 3300025933 Bacteria 4136
448 Ga0207706_10073264 3300025933 Bacteria 3012
449 Ga0207706_10109764 3300025933 Bacteria 2428
450 Ga0207706_10166146 3300025933 Bacteria 1939
451 Ga0207706_10178117 3300025933 Bacteria 1867
452 Ga0207706_10191207 3300025933 Bacteria 1797
453 Ga0207706_10440076 3300025933 Bacteria 1128
454 Ga0207686_10094562 3300025934 Bacteria 1981
455 Ga0207709_10040229 3300025935 Bacteria 2798
456 Ga0207670_10025140 3300025936 Bacteria 3734
457 Ga0207669_10018762 3300025937 Bacteria 3585
458 Ga0207669_10063789 3300025937 Bacteria 2276
459 Ga0207669_10161006 3300025937 Bacteria 1585
460 Ga0207669_10241389 3300025937 Bacteria 1339
461 Ga0207704_10007493 3300025938 Bacteria 5160
462 Ga0207704_10039589 3300025938 Bacteria 2747
463 Ga0207704_10052721 3300025938 Bacteria 2467
464 Ga0207665_10007628 3300025939 Bacteria 7145
465 Ga0207665_10082057 3300025939 Bacteria 2221
466 Ga0207691_10002330 3300025940 Bacteria 18590
467 Ga0207691_10003389 3300025940 Bacteria 15500
468 Ga0207691_10003584 3300025940 Bacteria 15103
469 Ga0207691_10009649 3300025940 Bacteria 9260
470 Ga0207691_10015795 3300025940 Bacteria 7175
471 Ga0207691_10114565 3300025940 Bacteria 2395
472 Ga0207711_10001137 3300025941 Bacteria 25387
473 Ga0207711_10002848 3300025941 Bacteria 15174
474 Ga0207711_10006288 3300025941 Bacteria 10020
475 Ga0207711_10038127 3300025941 Bacteria 4086
476 Ga0207711_10052245 3300025941 Bacteria 3502
477 Ga0207711_10054929 3300025941 Bacteria 3418
478 Ga0207711_10069349 3300025941 Bacteria 3056
479 Ga0207711_10333410 3300025941 Bacteria 1403
480 Ga0207689_10000094 3300025942 Bacteria 71733
481 Ga0207689_10033567 3300025942 Bacteria 4264
482 Ga0207689_10046212 3300025942 Bacteria 3599
483 Ga0207661_10009081 3300025944 Bacteria 7123
484 Ga0207661_10043473 3300025944 Bacteria 3545
485 Ga0207661_10296046 3300025944 Bacteria 1449
486 Ga0207679_10003846 3300025945 Bacteria 9310
487 Ga0207679_10021663 3300025945 Bacteria 4362
488 Ga0207679_10021775 3300025945 Bacteria 4353
489 Ga0207679_10030202 3300025945 Bacteria 3782
490 Ga0207679_10042727 3300025945 Bacteria 3259
491 Ga0207679_10043122 3300025945 Bacteria 3246
492 Ga0207679_10092676 3300025945 Bacteria 2341
493 Ga0207679_10100608 3300025945 Bacteria 2259
494 Ga0207679_10375934 3300025945 Bacteria 1244
495 Ga0207679_10410373 3300025945 Bacteria 1193
496 Ga0207667_10008988 3300025949 Bacteria 11821
497 Ga0207667_10077422 3300025949 Bacteria 3449
498 Ga0207667_10089753 3300025949 Bacteria 3176
499 Ga0207667_10092395 3300025949 Bacteria 3125
500 Ga0207667_10111308 3300025949 Bacteria 2824
501 Ga0207667_10128792 3300025949 Bacteria 2607
502 Ga0207667_10361204 3300025949 Bacteria 1481
503 Ga0207651_10002269 3300025960 Bacteria 9129
504 Ga0207651_10003286 3300025960 Bacteria 7914
505 Ga0207651_10008767 3300025960 Bacteria 5487
506 Ga0207651_10304423 3300025960 Bacteria 1327
507 Ga0207668_10134838 3300025972 Bacteria 1890
508 Ga0207668_10544855 3300025972 Bacteria 1004
509 Ga0207640_10095937 3300025981 Bacteria 2066
510 Ga0207640_10128274 3300025981 Bacteria 1829
511 Ga0207640_10237090 3300025981 Bacteria 1407
512 Ga0207640_10443266 3300025981 Bacteria 1068
513 Ga0207640_10468516 3300025981 Bacteria 1042
514 Ga0207640_10595373 3300025981 Bacteria 935
515 Ga0207658_10006765 3300025986 Bacteria 7807
516 Ga0207658_10020303 3300025986 Bacteria 4600
517 Ga0207658_10257990 3300025986 Bacteria 1484
518 Ga0207658_10353296 3300025986 Bacteria 1280
519 Ga0207658_10384618 3300025986 Bacteria 1230
520 Ga0207658_10548157 3300025986 Bacteria 1034
521 Ga0207677_10004013 3300026023 Bacteria 7853
522 Ga0207677_10004145 3300026023 Bacteria 7757
523 Ga0207677_10006879 3300026023 Bacteria 6251
524 Ga0207677_10036404 3300026023 Bacteria 3207
525 Ga0207677_10119855 3300026023 Bacteria 1977
526 Ga0207677_10141931 3300026023 Bacteria 1840
527 Ga0207677_10431258 3300026023 Bacteria 1125
528 Ga0207703_10003160 3300026035 Bacteria 13896
529 Ga0207703_10023759 3300026035 Bacteria 4821
530 Ga0207703_10032326 3300026035 Bacteria 4141
531 Ga0207703_10101622 3300026035 Bacteria 2438
532 Ga0207703_10356362 3300026035 Bacteria 1348
533 Ga0207639_10001213 3300026041 Bacteria 17498
534 Ga0207639_10007329 3300026041 Bacteria 7515
535 Ga0207639_10097249 3300026041 Bacteria 2370
536 Ga0207639_10227943 3300026041 Bacteria 1613
537 Ga0207639_10254757 3300026041 Bacteria 1532
538 Ga0207639_10278082 3300026041 Bacteria 1471
539 Ga0207639_10483742 3300026041 Bacteria 1129
540 Ga0207678_10000716 3300026067 Bacteria 30304
541 Ga0207678_10007209 3300026067 Bacteria 9857
542 Ga0207678_10019180 3300026067 Bacteria 6004
543 Ga0207678_10020789 3300026067 Bacteria 5753
544 Ga0207678_10034705 3300026067 Bacteria 4393
545 Ga0207678_10051209 3300026067 Bacteria 3565
546 Ga0207678_10177581 3300026067 Bacteria 1818
547 Ga0207678_10338726 3300026067 Bacteria 1296
548 Ga0207678_10382268 3300026067 Bacteria 1217
549 Ga0207678_10395635 3300026067 Bacteria 1196
550 Ga0207678_10579443 3300026067 Bacteria 983
551 Ga0207702_10015322 3300026078 Bacteria 6355
552 Ga0207702_10016918 3300026078 Bacteria 6035
553 Ga0207702_10130877 3300026078 Bacteria 2258
554 Ga0207702_10819984 3300026078 Bacteria 920
555 Ga0207641_10012223 3300026088 Bacteria 7045
556 Ga0207641_10042134 3300026088 Bacteria 3828
557 Ga0207641_10043133 3300026088 Bacteria 3786
558 Ga0207641_10165150 3300026088 Bacteria 2015
559 Ga0207641_10279949 3300026088 Bacteria 1568
560 Ga0207648_10000104 3300026089 Bacteria 81717
561 Ga0207648_10003117 3300026089 Bacteria 17506
562 Ga0207648_10013745 3300026089 Bacteria 7514
563 Ga0207648_10058958 3300026089 Bacteria 3348
564 Ga0207648_10264045 3300026089 Bacteria 1537
565 Ga0207676_10004148 3300026095 Bacteria 10231
566 Ga0207676_10010419 3300026095 Bacteria 6617
567 Ga0207676_10026266 3300026095 Bacteria 4330
568 Ga0207676_10033212 3300026095 Bacteria 3897
569 Ga0207676_10035753 3300026095 Bacteria 3773
570 Ga0207676_10319868 3300026095 Bacteria 1424
571 Ga0207674_10000345 3300026116 Bacteria 59803
572 Ga0207674_10001057 3300026116 Bacteria 35856
573 Ga0207674_10001571 3300026116 Bacteria 29407
574 Ga0207674_10003098 3300026116 Bacteria 20546
575 Ga0207674_10003125 3300026116 Bacteria 20421
576 Ga0207674_10016803 3300026116 Bacteria 7998
577 Ga0207674_10049649 3300026116 Bacteria 4290
578 Ga0207675_100000035 3300026118 Bacteria 95190
579 Ga0207675_100346828 3300026118 Bacteria 1454
580 Ga0207683_10001980 3300026121 Bacteria 18118
581 Ga0207683_10004221 3300026121 Bacteria 12412
582 Ga0207683_10011385 3300026121 Bacteria 7591
583 Ga0207683_10086278 3300026121 Bacteria 2790
584 Ga0207698_10003964 3300026142 Bacteria 8973
585 Ga0207698_10005650 3300026142 Bacteria 7743
586 Ga0207698_10010338 3300026142 Bacteria 5987
587 Ga0207698_10014787 3300026142 Bacteria 5201
588 Ga0207698_10035580 3300026142 Bacteria 3645
589 Ga0207698_10066036 3300026142 Bacteria 2846
590 Ga0207698_10073695 3300026142 Bacteria 2720
591 Ga0207698_10086869 3300026142 Bacteria 2545
592 Ga0207698_10184453 3300026142 Bacteria 1852
593 Ga0207698_10615438 3300026142 Bacteria 1072
594 Ga0209970_1013361 3300027614 Bacteria 1361
595 Ga0209974_10000337 3300027876 Bacteria 15344
596 Ga0268266_10000133 3300028379 Bacteria 143210
597 Ga0268266_10004030 3300028379 Bacteria 14202
598 Ga0268266_10162059 3300028379 Bacteria 2024
599 Ga0268266_10805455 3300028379 Bacteria 907
600 Ga0268265_10107245 3300028380 Bacteria 2271
601 Ga0268265_10179747 3300028380 Bacteria 1816
602 Ga0268264_10072608 3300028381 Bacteria 2918
603 Ga0268264_10224758 3300028381 Bacteria 1730
604 Ga0268264_10353904 3300028381 Bacteria 1399
605 Ga0307408_100090974 3300031548 Bacteria 2303
606 Ga0307408_100265206 3300031548 Bacteria 1423
607 Ga0307408_100360594 3300031548 Bacteria 1236
608 Ga0307408_100620507 3300031548 Bacteria 963
609 Ga0307405_10044659 3300031731 Bacteria 2711
610 Ga0307405_10160507 3300031731 Bacteria 1591
611 Ga0307405_10183488 3300031731 Bacteria 1504
612 Ga0307405_10189402 3300031731 Bacteria 1484
613 Ga0307405_10405255 3300031731 Bacteria 1069
614 Ga0307413_10077439 3300031824 Bacteria 2117
615 Ga0307413_10102054 3300031824 Bacteria 1898
616 Ga0307413_10296963 3300031824 Bacteria 1223
617 Ga0307410_10004817 3300031852 Bacteria 7047
618 Ga0307410_10012174 3300031852 Bacteria 4959
619 Ga0307410_10012813 3300031852 Bacteria 4866
620 Ga0307410_10048944 3300031852 Bacteria 2835
621 Ga0307410_10057491 3300031852 Bacteria 2649
622 Ga0307410_10255265 3300031852 Bacteria 1365
623 Ga0307410_10359737 3300031852 Bacteria 1165
624 Ga0307406_10012522 3300031901 Bacteria 4835
625 Ga0307406_10151833 3300031901 Bacteria 1653
626 Ga0307406_10180289 3300031901 Bacteria 1537
627 Ga0307406_10246744 3300031901 Bacteria 1342
628 Ga0307407_10008669 3300031903 Bacteria 4682
629 Ga0307407_10037907 3300031903 Bacteria 2667
630 Ga0307407_10052099 3300031903 Bacteria 2349
631 Ga0307407_10140408 3300031903 Bacteria 1558
632 Ga0307407_10151008 3300031903 Bacteria 1509
633 Ga0307412_10001044 3300031911 Bacteria 15823
634 Ga0307412_10043424 3300031911 Bacteria 2927
635 Ga0307412_10245438 3300031911 Bacteria 1387
636 Ga0307412_10265673 3300031911 Bacteria 1340
637 Ga0307409_100016559 3300031995 Bacteria 4881
638 Ga0307409_100102146 3300031995 Bacteria 2381
639 Ga0307409_100133004 3300031995 Bacteria 2129
640 Ga0307409_100162156 3300031995 Bacteria 1957
641 Ga0307409_100196810 3300031995 Bacteria 1799
642 Ga0307409_100275523 3300031995 Bacteria 1552
643 Ga0307416_100001404 3300032002 Bacteria 13051
644 Ga0307416_100047175 3300032002 Bacteria 3407
645 Ga0307416_100108083 3300032002 Bacteria 2443
646 Ga0307416_100113208 3300032002 Bacteria 2397
647 Ga0307416_100121541 3300032002 Bacteria 2329
648 Ga0307414_10000144 3300032004 Bacteria 48442
649 Ga0307414_10045909 3300032004 Bacteria 2994
650 Ga0307414_10046156 3300032004 Bacteria 2988
651 Ga0307414_10050673 3300032004 Bacteria 2877
652 Ga0307414_10061562 3300032004 Bacteria 2659
653 Ga0307411_10013445 3300032005 Bacteria 4517
654 Ga0307411_10031954 3300032005 Bacteria 3246
655 Ga0307411_10077934 3300032005 Bacteria 2270
656 Ga0307411_10399639 3300032005 Bacteria 1135
657 Ga0307411_10558978 3300032005 Bacteria 977
658 Ga0307415_100008803 3300032126 Bacteria 5618
659 Ga0307415_100207401 3300032126 Bacteria 1560
660 Ga0307415_100402528 3300032126 Bacteria 1169
661 Ga0373943_0029968 3300035170 Bacteria 2573
662 Ga0395899_0000225 3300037312 Bacteria 76673
663 Ga0395899_0000804 3300037312 Bacteria 30745
664 Ga0395899_0000911 3300037312 Bacteria 27806
665 Ga0395899_0001269 3300037312 Bacteria 21956
666 Ga0395899_0002669 3300037312 Bacteria 14380
667 Ga0395899_0012431 3300037312 Bacteria 6522
668 Ga0395899_0029775 3300037312 Bacteria 4106
669 Ga0395899_0059726 3300037312 Bacteria 2811
670 Ga0395899_0064303 3300037312 Bacteria 2697
671 Ga0395899_0109598 3300037312 Bacteria 1986
672 Ga0395899_0189680 3300037312 Bacteria 1439
673 Ga0395899_0204422 3300037312 Bacteria 1375
674 Ga0395899_0223569 3300037312 Bacteria 1303
675 Ga0395899_0233151 3300037312 Bacteria 1270
676 Ga0395899_0245653 3300037312 Bacteria 1230
677 Ga0395899_0308089 3300037312 Bacteria 1070
678 Ga0395900_0000911 3300037418 Bacteria 38912
679 Ga0395900_0001255 3300037418 Bacteria 31098
680 Ga0395900_0002300 3300037418 Bacteria 21222
681 Ga0395900_0002356 3300037418 Bacteria 20915
682 Ga0395900_0009730 3300037418 Bacteria 9846
683 Ga0395900_0012076 3300037418 Bacteria 8825
684 Ga0395900_0013567 3300037418 Bacteria 8324
685 Ga0395900_0048295 3300037418 Bacteria 4384
686 Ga0395900_0056921 3300037418 Bacteria 4025
687 Ga0395900_0066499 3300037418 Bacteria 3703
688 Ga0395900_0098392 3300037418 Bacteria 3006
689 Ga0395900_0118616 3300037418 Bacteria 2715
690 Ga0395900_0147207 3300037418 Bacteria 2408
691 Ga0395900_0150794 3300037418 Bacteria 2375
692 Ga0395900_0165283 3300037418 Bacteria 2255
693 Ga0395900_0424005 3300037418 Bacteria 1291
694 Ga0395900_0489819 3300037418 Bacteria 1181
695 Ga0395900_0544508 3300037418 Bacteria 1106
696 Ga0395898_0000021 3300037466 Bacteria 393971
697 Ga0395898_0001464 3300037466 Bacteria 33283
698 Ga0395898_0001496 3300037466 Bacteria 32433
699 Ga0395898_0007069 3300037466 Bacteria 11922
700 Ga0395898_0027288 3300037466 Bacteria 5734
701 Ga0395898_0036361 3300037466 Bacteria 4889
702 Ga0395898_0111649 3300037466 Bacteria 2620
703 Ga0395898_0342748 3300037466 Bacteria 1425
704 Ga0395898_0782832 3300037466 Bacteria 894
705 Ga0395905_0000006 3300037471 Bacteria 549428
706 Ga0395905_0000193 3300037471 Bacteria 96667
707 Ga0395905_0000546 3300037471 Bacteria 51378
708 Ga0395905_0001063 3300037471 Bacteria 34650
709 Ga0395905_0001765 3300037471 Bacteria 25140
710 Ga0395905_0003104 3300037471 Bacteria 17940
711 Ga0395905_0005749 3300037471 Bacteria 12610
712 Ga0395905_0005835 3300037471 Bacteria 12513
713 Ga0395905_0008283 3300037471 Bacteria 10263
714 Ga0395905_0013279 3300037471 Bacteria 7901
715 Ga0395905_0015356 3300037471 Bacteria 7278
716 Ga0395905_0021076 3300037471 Bacteria 6171
717 Ga0395905_0046031 3300037471 Bacteria 4091
718 Ga0395905_0048606 3300037471 Bacteria 3975
719 Ga0395905_0048956 3300037471 Bacteria 3960
720 Ga0395905_0050664 3300037471 Bacteria 3889
721 Ga0395905_0053660 3300037471 Bacteria 3772
722 Ga0395905_0055189 3300037471 Bacteria 3718
723 Ga0395905_0055532 3300037471 Bacteria 3706
724 Ga0395905_0078477 3300037471 Bacteria 3094
725 Ga0395905_0093819 3300037471 Bacteria 2815
726 Ga0395905_0188729 3300037471 Bacteria 1934
727 Ga0395905_0200783 3300037471 Bacteria 1869
728 Ga0395905_0201534 3300037471 Bacteria 1866
729 Ga0395905_0203973 3300037471 Bacteria 1853
730 Ga0395905_0219816 3300037471 Bacteria 1778
731 Ga0395905_0223035 3300037471 Bacteria 1764
732 Ga0395905_0231094 3300037471 Bacteria 1729
733 Ga0395905_0271373 3300037471 Bacteria 1582
734 Ga0395905_0337631 3300037471 Bacteria 1397
735 Ga0395905_0386152 3300037471 Bacteria 1294
736 Ga0395905_0492578 3300037471 Bacteria 1125
737 Ga0395905_0512240 3300037471 Bacteria 1100
738 Ga0395901_0000681 3300038443 Bacteria 39074
739 Ga0395901_0005736 3300038443 Bacteria 12573
740 Ga0395901_0008542 3300038443 Bacteria 10349
741 Ga0395901_0015982 3300038443 Bacteria 7647
742 Ga0395901_0028300 3300038443 Bacteria 5764
743 Ga0395901_0033758 3300038443 Bacteria 5283
744 Ga0395901_0042606 3300038443 Bacteria 4707
745 Ga0395901_0074461 3300038443 Bacteria 3542
746 Ga0395901_0080587 3300038443 Bacteria 3399
747 Ga0395901_0130958 3300038443 Bacteria 2636
748 Ga0395901_0137581 3300038443 Bacteria 2567
749 Ga0395901_0154848 3300038443 Bacteria 2407
750 Ga0395901_0174454 3300038443 Bacteria 2255
751 Ga0395901_0353907 3300038443 Bacteria 1515
752 Ga0395901_0394821 3300038443 Bacteria 1422
753 Ga0395901_0585738 3300038443 Bacteria 1126
754 Ga0436365_1429874 3300039437 Bacteria 7327
755 Ga0436363_0375547 3300039450 Bacteria 1144
756 Ga0439465_0040698 3300041413 Bacteria 1503
757 Ga0439448_0024486 3300042005 Bacteria 1888
758 Ga0439432_002187 3300042006 Bacteria 7386
759 Ga0439432_087363 3300042006 Bacteria 940
760 Ga0439449_0009979 3300042007 Bacteria 3593
761 Ga0439455_0022907 3300042012 Bacteria 1501
762 Ga0439458_0000485 3300042157 Bacteria 10187
763 Ga0439458_0000555 3300042157 Bacteria 9619
764 Ga0466969_0010344 3300044656 Bacteria 4947
765 Ga0466965_0219959 3300044683 Bacteria 1012
766 Ga0466966_0020358 3300044684 Bacteria 4364
767 Ga0466966_0041616 3300044684 Bacteria 2952
768 Ga0466966_0134013 3300044684 Bacteria 1515
769 Ga0466961_0041219 3300044693 Bacteria 2960
770 Ga0466961_0157766 3300044693 Bacteria 1415
771 Ga0466961_0212996 3300044693 Bacteria 1192
772 Ga0466964_0026443 3300044706 Bacteria 2271
773 Ga0466971_0021142 3300044719 Bacteria 2895
774 Ga0466970_0073946 3300044765 Bacteria 1834
775 Ga0466957_0152655 3300044842 Bacteria 1495
776 Ga0466957_0234604 3300044842 Bacteria 1216
777 Ga0466960_0036388 3300044901 Bacteria 2305
778 Ga0466960_0115483 3300044901 Bacteria 1400
779 Ga0466959_0033313 3300045049 Bacteria 3810
780 Ga0466959_0052324 3300045049 Bacteria 2991
781 Ga0466959_0115492 3300045049 Bacteria 1912
782 Ga0466959_0145087 3300045049 Bacteria 1675
783 Ga0466959_0200741 3300045049 Bacteria 1388
784 Ga0466959_0206900 3300045049 Bacteria 1365
785 Ga0466958_0108300 3300045836 Bacteria 1733
786 Ga0466958_0141047 3300045836 Bacteria 1517
787 Ga0466958_0152369 3300045836 Bacteria 1458
788 Ga0466958_0221850 3300045836 Bacteria 1206
789 Ga0466958_0301766 3300045836 Bacteria 1028
790 Ga0466967_0132961 3300045976 Bacteria 2311
791 Ga0495627_000617 3300046453 Bacteria 28261
792 Ga0495629_0131801 3300046459 Bacteria 1741
793 Ga0495648_0005005 3300046524 Bacteria 11134
794 Ga0495621_0007156 3300046539 Bacteria 3292
795 Ga0495633_0099960 3300046558 Bacteria 1346
796 Ga0495669_0006980 3300046684 Bacteria 4730
797 Ga0495669_0091413 3300046684 Bacteria 1405
798 Ga0495671_0043469 3300046692 Bacteria 2255
799 Ga0496100_0116257 3300048903 Bacteria 1866
800 Ga0496100_0273315 3300048903 Bacteria 1257
801 Ga0496101_0001762 3300048904 Bacteria 12986
802 Ga0496102_0057117 3300048905 Bacteria 3562
803 Ga0496102_0310938 3300048905 Bacteria 1485
804 Ga0496102_0457590 3300048905 Bacteria 1197
805 Ga0496103_0072289 3300048906 Bacteria 2160
806 Ga0496103_0455452 3300048906 Unclassified 820
807 Ga0496104_0603531 3300048907 Bacteria 1008
808 Ga0496105_0024862 3300048908 Bacteria 4868
809 Ga0496106_0019188 3300048909 Bacteria 5070
810 Ga0496106_0087328 3300048909 Bacteria 2403
811 Ga0496107_0014597 3300048910 Bacteria 5498
812 Ga0496107_0071018 3300048910 Bacteria 2529
813 Ga0496107_0215234 3300048910 Bacteria 1429
814 Ga0496107_0566249 3300048910 Bacteria 841
815 Ga0496108_0003987 3300048911 Bacteria 11847
816 Ga0496108_0007034 3300048911 Bacteria 9111
817 Ga0496108_0031482 3300048911 Bacteria 4402
818 Ga0496108_0067422 3300048911 Bacteria 3018
819 Ga0496108_0127890 3300048911 Bacteria 2182
820 Ga0496109_0005615 3300048912 Bacteria 10497
821 Ga0496109_0007592 3300048912 Bacteria 9193
822 Ga0496109_0044858 3300048912 Bacteria 4011
823 Ga0496109_0117395 3300048912 Bacteria 2477
824 Ga0496110_0016179 3300048913 Bacteria 6221
825 Ga0496110_0023577 3300048913 Bacteria 5236
826 Ga0496111_0027369 3300048914 Bacteria 4033
827 Ga0496111_0036464 3300048914 Bacteria 3516
828 Ga0496111_0037180 3300048914 Bacteria 3484
829 Ga0496111_0052175 3300048914 Bacteria 2952
830 Ga0496112_0019765 3300048915 Bacteria 6367
831 Ga0496112_0020281 3300048915 Bacteria 6297
832 Ga0496112_0040436 3300048915 Bacteria 4558
833 Ga0496112_0074840 3300048915 Bacteria 3349
834 Ga0496113_0006306 3300048916 Bacteria 7502
835 Ga0496113_0013166 3300048916 Bacteria 5590
836 Ga0496113_0177204 3300048916 Bacteria 1689
837 Ga0496114_0000130 3300048917 Bacteria 54437
838 Ga0496114_0466878 3300048917 Bacteria 1117
839 Ga0496116_0044039 3300048919 Bacteria 3035
840 Ga0496121_0006069 3300048924 Bacteria 15210
841 Ga0496122_0006730 3300048925 Bacteria 13083
842 Ga0496123_0005339 3300048926 Bacteria 12988
843 Ga0496124_0007058 3300048927 Bacteria 12033
844 Ga0496124_0042588 3300048927 Bacteria 3908
845 Ga0496125_0002768 3300048928 Bacteria 22192
846 Ga0496125_0010066 3300048928 Bacteria 9595
847 Ga0496126_0015740 3300048929 Bacteria 7600
848 Ga0501298_022284 3300049521 Bacteria 1193
849 Ga0501216_004767 3300049660 Bacteria 2023
850 Ga0501223_000066 3300049663 Bacteria 33567
851 Ga0501223_013803 3300049663 Bacteria 1606
852 Ga0501233_023952 3300049668 Bacteria 1331
853 Ga0501235_007871 3300049669 Bacteria 2323
854 Ga0501235_023392 3300049669 Bacteria 1377
855 Ga0501257_054131 3300049686 Bacteria 1005
856 Ga0501258_005296 3300049687 Bacteria 1247
857 Ga0501221_014696 3300049704 Bacteria 1459
858 Ga0501225_0000137 3300049705 Bacteria 22173
859 Ga0501225_0001770 3300049705 Bacteria 6756
860 Ga0501225_0030860 3300049705 Bacteria 1475
861 Ga0501225_0044171 3300049705 Bacteria 1232
862 Ga0501229_003871 3300049706 Bacteria 1809
863 Ga0501262_005207 3300049759 Bacteria 1531
864 Ga0501263_002869 3300049760 Bacteria 1799
865 Ga0501268_001988 3300049765 Bacteria 2629
866 Ga0501272_003433 3300049769 Bacteria 1611
867 Ga0501273_001227 3300049770 Bacteria 2386
868 Ga0495655_0005326 3300053083 Bacteria 2267
869 Ga0500594_0001515 3300053118 Bacteria 5051
870 Ga0500559_0013126 3300053136 Bacteria 3512
871 Ga0466962_0108377 3300061719 Bacteria 1336
872 Ga0207706_10107453
873 SwRhRL2b_contig_3748052
874 JGI24741J21665_1000692
875 JGI24740J21852_10002149
876 JGI24740J21852_10003759
877 JGI24740J21852_10021057
878 JGI24739J22299_10000252
879 JGI24739J22299_10001180
880 JGI24737J22298_10002295
881 JGI24737J22298_10005205
882 JGI24737J22298_10006259
883 JGI24737J22298_10022606
884 JGI24735J21928_10001159
885 JGI24735J21928_10012860
886 JGI24738J21930_10000674
887 JGI24738J21930_10001019
888 JGI24744J21845_10001866
889 Ga0065704_10073918
890 Ga0065707_10010189
891 Ga0070658_10069755
892 Ga0070658_10079929
893 Ga0070658_10133947
894 Ga0070658_10146879
895 Ga0070658_10159219
896 Ga0070658_10206277
897 Ga0070658_10240928
898 Ga0070658_10344516
899 Ga0070658_10377692
900 Ga0070676_10003269
901 Ga0070676_10196259
902 Ga0070676_10240914
903 Ga0070676_10245316
904 Ga0070676_10405803
905 Ga0070676_10442032
906 Ga0070683_100019454
907 Ga0070683_100024802
908 Ga0070683_100141403
909 Ga0070683_100255802
910 Ga0070690_100015646
911 Ga0070690_100025806
912 Ga0070690_100096383
913 Ga0070670_100000807
914 Ga0070670_100008121
915 Ga0070670_100014557
916 Ga0070670_100031408
917 Ga0070670_100031539
918 Ga0070677_10023752
919 Ga0070677_10088434
920 Ga0068869_100024538
921 Ga0070666_10002658
922 Ga0070666_10003092
923 Ga0070666_10013352
924 Ga0070666_10032530
925 Ga0070666_10246778
926 Ga0070680_100003695
927 Ga0070680_100012588
928 Ga0070682_100013647
929 Ga0070682_100145211
930 Ga0068868_100001893
931 Ga0068868_100009974
932 Ga0068868_100013938
933 Ga0068868_100169491
934 Ga0068868_100560811
935 Ga0070660_100006064
936 Ga0070660_100014880
937 Ga0070660_100021606
938 Ga0070660_100029285
939 Ga0070660_100035865
940 Ga0070660_100038635
941 Ga0070660_100042108
942 Ga0070660_100093260
943 Ga0070660_100134033
944 Ga0070660_100393123
945 Ga0070689_100006805
946 Ga0070689_100247015
947 Ga0070691_10098103
948 Ga0070661_100009704
949 Ga0070661_100014744
950 Ga0070661_100037391
951 Ga0070661_100094213
952 Ga0070661_100105175
953 Ga0070661_100120518
954 Ga0070661_100122744
955 Ga0070661_100182420
956 Ga0070661_100361200
957 Ga0070668_100124876
958 Ga0070668_100148459
959 Ga0070669_100001260
960 Ga0070675_100104855
961 Ga0070675_100163269
962 Ga0070671_100000927
963 Ga0070671_100002825
964 Ga0070671_100011596
965 Ga0070671_100012260
966 Ga0070671_100028280
967 Ga0070671_100089917
968 Ga0070671_100273666
969 Ga0070671_100328366
970 Ga0070674_100023242
971 Ga0070674_100041914
972 Ga0070674_100179089
973 Ga0070673_100001674
974 Ga0070673_100002345
975 Ga0070673_100020014
976 Ga0070673_100049184
977 Ga0070673_100054226
978 Ga0070673_100076667
979 Ga0070673_100455939
980 Ga0070659_100001267
981 Ga0070659_100018346
982 Ga0070659_100039254
983 Ga0070659_100044004
984 Ga0070659_100045903
985 Ga0070659_100250544
986 Ga0070659_100268103
987 Ga0070667_100004545
988 Ga0070667_100005246
989 Ga0070667_100021218
990 Ga0070667_100192796
991 Ga0070667_100233717
992 Ga0070667_100401331
993 Ga0070667_100411854
994 Ga0070714_100020265
995 Ga0070714_100098350
996 Ga0070714_100374956
997 Ga0070714_100401194
998 Ga0070714_100857313
999 Ga0070663_100014152
1000 Ga0070663_100029638
1001 Ga0070663_100089109
1002 Ga0070663_100153030
1003 Ga0070678_100009697
1004 Ga0070678_100053016
1005 Ga0070678_100098312
1006 Ga0070678_100202114
1007 Ga0070678_100554340
1008 Ga0070662_100001203
1009 Ga0070662_100034885
1010 Ga0070662_100078224
1011 Ga0070662_100135123
1012 Ga0070662_100140977
1013 Ga0070662_100165462
1014 Ga0070662_100336784
1015 Ga0070681_10044346
1016 Ga0070681_10303661
1017 Ga0068867_100005599
1018 Ga0068867_100018721
1019 Ga0068867_100052268
1020 Ga0070685_10461159
1021 Ga0070679_100022016
1022 Ga0070679_100071652
1023 Ga0070684_100002726
1024 Ga0070684_100011882
1025 Ga0070684_100225611
1026 Ga0068853_100002144
1027 Ga0068853_100119051
1028 Ga0068853_100137438
1029 Ga0068853_100217507
1030 Ga0068853_100251837
1031 Ga0070672_100015078
1032 Ga0070672_100015719
1033 Ga0070672_100096027
1034 Ga0070672_100350488
1035 Ga0070696_100007378
1036 Ga0070665_100001208
1037 Ga0070665_100004742
1038 Ga0070665_100012842
1039 Ga0070665_100034005
1040 Ga0068855_100002638
1041 Ga0068855_100113573
1042 Ga0068855_100193123
1043 Ga0068855_100199919
1044 Ga0068855_100353041
1045 Ga0070664_100000446
1046 Ga0070664_100003398
1047 Ga0070664_100012233
1048 Ga0070664_100048375
1049 Ga0070664_100074362
1050 Ga0070664_100076084
1051 Ga0070664_100097431
1052 Ga0070664_100146716
1053 Ga0070664_100573006
1054 Ga0068857_100001517
1055 Ga0068857_100003065
1056 Ga0068857_100004069
1057 Ga0068857_100304739
1058 Ga0068854_100003147
1059 Ga0068854_100008221
1060 Ga0068854_100023884
1061 Ga0068854_100080461
1062 Ga0068854_100106470
1063 Ga0068854_100144622
1064 Ga0068854_100343546
1065 Ga0068854_100520284
1066 Ga0068854_100674101
1067 Ga0068856_100015113
1068 Ga0068856_100040080
1069 Ga0068856_100050336
1070 Ga0068856_100078153
1071 Ga0070702_100269258
1072 Ga0068852_100000461
1073 Ga0068852_100019867
1074 Ga0068852_100029627
1075 Ga0068852_100116814
1076 Ga0068852_100126481
1077 Ga0068852_100494035
1078 Ga0068852_101081768
1079 Ga0068859_100008534
1080 Ga0068859_100009839
1081 Ga0068859_100050360
1082 Ga0068859_100243805
1083 Ga0068864_100003315
1084 Ga0068864_100020883
1085 Ga0068864_100064482
1086 Ga0068864_100118776
1087 Ga0068864_100254766
1088 Ga0068866_10056715
1089 Ga0068861_100000052
1090 Ga0068861_100216662
1091 Ga0068851_10006913
1092 Ga0068851_10018291
1093 Ga0068851_10215039
1094 Ga0068851_10230068
1095 Ga0068870_10136484
1096 Ga0068863_100003487
1097 Ga0068863_100008185
1098 Ga0068863_100009190
1099 Ga0068863_100012720
1100 Ga0068863_100036906
1101 Ga0068863_100057339
1102 Ga0068858_100008071
1103 Ga0068858_100017583
1104 Ga0068858_100136500
1105 Ga0068858_100157035
1106 Ga0068860_100003073
1107 Ga0068860_100036352
1108 Ga0068860_100064032
1109 Ga0068862_100018707
1110 Ga0068862_100492483
1111 Ga0081539_10188094
1112 Ga0070716_100084000
1113 Ga0097621_100003754
1114 Ga0097621_100080112
1115 Ga0097621_100558030
1116 Ga0068871_100019567
1117 Ga0068871_100373963
1118 Ga0068865_100005997
1119 Ga0068865_100025297
1120 Ga0068865_100078208
1121 Ga0097620_100008534
1122 Ga0097620_100009839
1123 Ga0097620_100050361
1124 Ga0097620_100243789
1125 Ga0105251_10026917
1126 Ga0105251_10104757
1127 Ga0105240_10044466
1128 Ga0105240_10460880
1129 Ga0105240_10584971
1130 Ga0105240_10867517
1131 Ga0105245_10001667
1132 Ga0105247_10450826
1133 Ga0105241_10007878
1134 Ga0105241_10041880
1135 Ga0105242_10012800
1136 Ga0105248_10000096
1137 Ga0105248_10001577
1138 Ga0105248_10006141
1139 Ga0105248_10006863
1140 Ga0105248_10006890
1141 Ga0105248_10332047
1142 Ga0105248_10681055
1143 Ga0105237_10015281
1144 Ga0105237_10079942
1145 Ga0105237_10149808
1146 Ga0105237_10151641
1147 Ga0105238_10039716
1148 Ga0105238_10191208
1149 Ga0105238_10226369
1150 Ga0105249_10198579
1151 Ga0105148_100202
1152 Ga0105147_105299
1153 Ga0105239_10117373
1154 Ga0105246_10022077
1155 Ga0105246_10040645
1156 Ga0105246_10275590
1157 Ga0157373_10007215
1158 Ga0157373_10017921
1159 Ga0157373_10039257
1160 Ga0157373_10081485
1161 Ga0157373_10122166
1162 Ga0157373_10129123
1163 Ga0157373_10155107
1164 Ga0157371_10003770
1165 Ga0157371_10022992
1166 Ga0157371_10040657
1167 Ga0157371_10076634
1168 Ga0157371_10114766
1169 Ga0157371_10132648
1170 Ga0157371_10135588
1171 Ga0157371_10197728
1172 Ga0157370_10102505
1173 Ga0157370_10382552
1174 Ga0157370_10532422
1175 Ga0157369_10122804
1176 Ga0157369_10139262
1177 Ga0157369_10193603
1178 Ga0157369_10214579
1179 Ga0157369_10980573
1180 Ga0157374_10009229
1181 Ga0157374_10117607
1182 Ga0157378_10001776
1183 Ga0157378_10142034
1184 Ga0163162_10048501
1185 Ga0163162_10158044
1186 Ga0157372_10068574
1187 Ga0157372_10103884
1188 Ga0157372_10230095
1189 Ga0157372_10269475
1190 Ga0157372_10302866
1191 Ga0157372_10795999
1192 Ga0157372_10853167
1193 Ga0157375_10003831
1194 Ga0157375_10026239
1195 Ga0163163_10019009
1196 Ga0163163_10034122
1197 Ga0163163_10120482
1198 Ga0163163_10721089
1199 Ga0157379_10006317
1200 Ga0157379_10368662
1201 Ga0163161_10013697
1202 Ga0207673_1019010
1203 Ga0207697_10001060
1204 Ga0207697_10003608
1205 Ga0207697_10013963
1206 Ga0207697_10015837
1207 Ga0207656_10011903
1208 Ga0207656_10028906
1209 Ga0207656_10086913
1210 Ga0207656_10151540
1211 Ga0207682_10028455
1212 Ga0207642_10253517
1213 Ga0207688_10002178
1214 Ga0207688_10005414
1215 Ga0207680_10007785
1216 Ga0207680_10008339
1217 Ga0207680_10028080
1218 Ga0207680_10101677
1219 Ga0207680_10165735
1220 Ga0207647_10000153
1221 Ga0207647_10001078
1222 Ga0207647_10005438
1223 Ga0207647_10007591
1224 Ga0207647_10009600
1225 Ga0207647_10020279
1226 Ga0207647_10237091
1227 Ga0207645_10003786
1228 Ga0207645_10019133
1229 Ga0207645_10066206
1230 Ga0207645_10192331
1231 Ga0207645_10252235
1232 Ga0207645_10395103
1233 Ga0207643_10016175
1234 Ga0207705_10007304
1235 Ga0207705_10009311
1236 Ga0207705_10041020
1237 Ga0207705_10071335
1238 Ga0207705_10073108
1239 Ga0207705_10105175
1240 Ga0207705_10299638
1241 Ga0207705_10382995
1242 Ga0207654_10021779
1243 Ga0207654_10084466
1244 Ga0207654_10132718
1245 Ga0207654_10147794
1246 Ga0207707_10130129
1247 Ga0207707_10413934
1248 Ga0207695_10014240
1249 Ga0207695_10089367
1250 Ga0207695_10489827
1251 Ga0207695_10581297
1252 Ga0207695_10604420
1253 Ga0207671_10016290
1254 Ga0207671_10430501
1255 Ga0207693_10043480
1256 Ga0207660_10040596
1257 Ga0207660_10153568
1258 Ga0207660_10164361
1259 Ga0207657_10000924
1260 Ga0207657_10002827
1261 Ga0207657_10005125
1262 Ga0207657_10005183
1263 Ga0207657_10008828
1264 Ga0207657_10010444
1265 Ga0207657_10025691
1266 Ga0207657_10027595
1267 Ga0207657_10042191
1268 Ga0207657_10047659
1269 Ga0207657_10048576
1270 Ga0207657_10064335
1271 Ga0207657_10082175
1272 Ga0207657_10157225
1273 Ga0207657_10190417
1274 Ga0207657_10377541
1275 Ga0207649_10008713
1276 Ga0207649_10032395
1277 Ga0207649_10068043
1278 Ga0207649_10077508
1279 Ga0207649_10107548
1280 Ga0207649_10249720
1281 Ga0207649_10398560
1282 Ga0207652_10028892
1283 Ga0207681_10009549
1284 Ga0207681_10030101
1285 Ga0207681_10538046
1286 Ga0207694_10063156
1287 Ga0207694_10146573
1288 Ga0207694_10170950
1289 Ga0207650_10017927
1290 Ga0207650_10020206
1291 Ga0207659_10014238
1292 Ga0207659_10016588
1293 Ga0207659_10115517
1294 Ga0207659_10243662
1295 Ga0207687_10009029
1296 Ga0207700_10033241
1297 Ga0207664_10082708
1298 Ga0207664_10109568
1299 Ga0207644_10000235
1300 Ga0207644_10002554
1301 Ga0207644_10002568
1302 Ga0207644_10005217
1303 Ga0207644_10005419
1304 Ga0207644_10005961
1305 Ga0207644_10283154
1306 Ga0207644_10485879
1307 Ga0207690_10003079
1308 Ga0207690_10008443
1309 Ga0207690_10084295
1310 Ga0207690_10087872
1311 Ga0207690_10145420
1312 Ga0207690_10349098
1313 Ga0207706_10000194
1314 Ga0207706_10001656
1315 Ga0207706_10002630
1316 Ga0207706_10004866
1317 Ga0207706_10039419
1318 Ga0207706_10040372
1319 Ga0207706_10073264
1320 Ga0207706_10109764
1321 Ga0207706_10166146
1322 Ga0207706_10178117
1323 Ga0207706_10191207
1324 Ga0207706_10440076
1325 Ga0207686_10094562
1326 Ga0207709_10040229
1327 Ga0207670_10025140
1328 Ga0207669_10018762
1329 Ga0207669_10063789
1330 Ga0207669_10161006
1331 Ga0207669_10241389
1332 Ga0207704_10007493
1333 Ga0207704_10039589
1334 Ga0207704_10052721
1335 Ga0207665_10007628
1336 Ga0207665_10082057
1337 Ga0207691_10002330
1338 Ga0207691_10003389
1339 Ga0207691_10003584
1340 Ga0207691_10009649
1341 Ga0207691_10015795
1342 Ga0207691_10114565
1343 Ga0207711_10001137
1344 Ga0207711_10002848
1345 Ga0207711_10006288
1346 Ga0207711_10038127
1347 Ga0207711_10052245
1348 Ga0207711_10054929
1349 Ga0207711_10069349
1350 Ga0207711_10333410
1351 Ga0207689_10000094
1352 Ga0207689_10033567
1353 Ga0207689_10046212
1354 Ga0207661_10009081
1355 Ga0207661_10043473
1356 Ga0207661_10296046
1357 Ga0207679_10003846
1358 Ga0207679_10021663
1359 Ga0207679_10021775
1360 Ga0207679_10030202
1361 Ga0207679_10042727
1362 Ga0207679_10043122
1363 Ga0207679_10092676
1364 Ga0207679_10100608
1365 Ga0207679_10375934
1366 Ga0207679_10410373
1367 Ga0207667_10008988
1368 Ga0207667_10077422
1369 Ga0207667_10089753
1370 Ga0207667_10092395
1371 Ga0207667_10111308
1372 Ga0207667_10128792
1373 Ga0207667_10361204
1374 Ga0207651_10002269
1375 Ga0207651_10003286
1376 Ga0207651_10008767
1377 Ga0207651_10304423
1378 Ga0207668_10134838
1379 Ga0207668_10544855
1380 Ga0207640_10095937
1381 Ga0207640_10128274
1382 Ga0207640_10237090
1383 Ga0207640_10443266
1384 Ga0207640_10468516
1385 Ga0207640_10595373
1386 Ga0207658_10006765
1387 Ga0207658_10020303
1388 Ga0207658_10257990
1389 Ga0207658_10353296
1390 Ga0207658_10384618
1391 Ga0207658_10548157
1392 Ga0207677_10004013
1393 Ga0207677_10004145
1394 Ga0207677_10006879
1395 Ga0207677_10036404
1396 Ga0207677_10119855
1397 Ga0207677_10141931
1398 Ga0207677_10431258
1399 Ga0207703_10003160
1400 Ga0207703_10023759
1401 Ga0207703_10032326
1402 Ga0207703_10101622
1403 Ga0207703_10356362
1404 Ga0207639_10001213
1405 Ga0207639_10007329
1406 Ga0207639_10097249
1407 Ga0207639_10227943
1408 Ga0207639_10254757
1409 Ga0207639_10278082
1410 Ga0207639_10483742
1411 Ga0207678_10000716
1412 Ga0207678_10007209
1413 Ga0207678_10019180
1414 Ga0207678_10020789
1415 Ga0207678_10034705
1416 Ga0207678_10051209
1417 Ga0207678_10177581
1418 Ga0207678_10338726
1419 Ga0207678_10382268
1420 Ga0207678_10395635
1421 Ga0207678_10579443
1422 Ga0207702_10015322
1423 Ga0207702_10016918
1424 Ga0207702_10130877
1425 Ga0207702_10819984
1426 Ga0207641_10012223
1427 Ga0207641_10042134
1428 Ga0207641_10043133
1429 Ga0207641_10165150
1430 Ga0207641_10279949
1431 Ga0207648_10000104
1432 Ga0207648_10003117
1433 Ga0207648_10013745
1434 Ga0207648_10058958
1435 Ga0207648_10264045
1436 Ga0207676_10004148
1437 Ga0207676_10010419
1438 Ga0207676_10026266
1439 Ga0207676_10033212
1440 Ga0207676_10035753
1441 Ga0207676_10319868
1442 Ga0207674_10000345
1443 Ga0207674_10001057
1444 Ga0207674_10001571
1445 Ga0207674_10003098
1446 Ga0207674_10003125
1447 Ga0207674_10016803
1448 Ga0207674_10049649
1449 Ga0207675_100000035
1450 Ga0207675_100346828
1451 Ga0207683_10001980
1452 Ga0207683_10004221
1453 Ga0207683_10011385
1454 Ga0207683_10086278
1455 Ga0207698_10003964
1456 Ga0207698_10005650
1457 Ga0207698_10010338
1458 Ga0207698_10014787
1459 Ga0207698_10035580
1460 Ga0207698_10066036
1461 Ga0207698_10073695
1462 Ga0207698_10086869
1463 Ga0207698_10184453
1464 Ga0207698_10615438
1465 Ga0209970_1013361
1466 Ga0209974_10000337
1467 Ga0268266_10000133
1468 Ga0268266_10004030
1469 Ga0268266_10162059
1470 Ga0268266_10805455
1471 Ga0268265_10107245
1472 Ga0268265_10179747
1473 Ga0268264_10072608
1474 Ga0268264_10224758
1475 Ga0268264_10353904
1476 Ga0307408_100090974
1477 Ga0307408_100265206
1478 Ga0307408_100360594
1479 Ga0307408_100620507
1480 Ga0307405_10044659
1481 Ga0307405_10160507
1482 Ga0307405_10183488
1483 Ga0307405_10189402
1484 Ga0307405_10405255
1485 Ga0307413_10077439
1486 Ga0307413_10102054
1487 Ga0307413_10296963
1488 Ga0307410_10004817
1489 Ga0307410_10012174
1490 Ga0307410_10012813
1491 Ga0307410_10048944
1492 Ga0307410_10057491
1493 Ga0307410_10255265
1494 Ga0307410_10359737
1495 Ga0307406_10012522
1496 Ga0307406_10151833
1497 Ga0307406_10180289
1498 Ga0307406_10246744
1499 Ga0307407_10008669
1500 Ga0307407_10037907
1501 Ga0307407_10052099
1502 Ga0307407_10140408
1503 Ga0307407_10151008
1504 Ga0307412_10001044
1505 Ga0307412_10043424
1506 Ga0307412_10245438
1507 Ga0307412_10265673
1508 Ga0307409_100016559
1509 Ga0307409_100102146
1510 Ga0307409_100133004
1511 Ga0307409_100162156
1512 Ga0307409_100196810
1513 Ga0307409_100275523
1514 Ga0307416_100001404
1515 Ga0307416_100047175
1516 Ga0307416_100108083
1517 Ga0307416_100113208
1518 Ga0307416_100121541
1519 Ga0307414_10000144
1520 Ga0307414_10045909
1521 Ga0307414_10046156
1522 Ga0307414_10050673
1523 Ga0307414_10061562
1524 Ga0307411_10013445
1525 Ga0307411_10031954
1526 Ga0307411_10077934
1527 Ga0307411_10399639
1528 Ga0307411_10558978
1529 Ga0307415_100008803
1530 Ga0307415_100207401
1531 Ga0307415_100402528
1532 Ga0373943_0029968
1533 Ga0395899_0000225
1534 Ga0395899_0000804
1535 Ga0395899_0000911
1536 Ga0395899_0001269
1537 Ga0395899_0002669
1538 Ga0395899_0012431
1539 Ga0395899_0029775
1540 Ga0395899_0059726
1541 Ga0395899_0064303
1542 Ga0395899_0109598
1543 Ga0395899_0189680
1544 Ga0395899_0204422
1545 Ga0395899_0223569
1546 Ga0395899_0233151
1547 Ga0395899_0245653
1548 Ga0395899_0308089
1549 Ga0395900_0000911
1550 Ga0395900_0001255
1551 Ga0395900_0002300
1552 Ga0395900_0002356
1553 Ga0395900_0009730
1554 Ga0395900_0012076
1555 Ga0395900_0013567
1556 Ga0395900_0048295
1557 Ga0395900_0056921
1558 Ga0395900_0066499
1559 Ga0395900_0098392
1560 Ga0395900_0118616
1561 Ga0395900_0147207
1562 Ga0395900_0150794
1563 Ga0395900_0165283
1564 Ga0395900_0424005
1565 Ga0395900_0489819
1566 Ga0395900_0544508
1567 Ga0395898_0000021
1568 Ga0395898_0001464
1569 Ga0395898_0001496
1570 Ga0395898_0007069
1571 Ga0395898_0027288
1572 Ga0395898_0036361
1573 Ga0395898_0111649
1574 Ga0395898_0342748
1575 Ga0395898_0782832
1576 Ga0395905_0000006
1577 Ga0395905_0000193
1578 Ga0395905_0000546
1579 Ga0395905_0001063
1580 Ga0395905_0001765
1581 Ga0395905_0003104
1582 Ga0395905_0005749
1583 Ga0395905_0005835
1584 Ga0395905_0008283
1585 Ga0395905_0013279
1586 Ga0395905_0015356
1587 Ga0395905_0021076
1588 Ga0395905_0046031
1589 Ga0395905_0048606
1590 Ga0395905_0048956
1591 Ga0395905_0050664
1592 Ga0395905_0053660
1593 Ga0395905_0055189
1594 Ga0395905_0055532
1595 Ga0395905_0078477
1596 Ga0395905_0093819
1597 Ga0395905_0188729
1598 Ga0395905_0200783
1599 Ga0395905_0201534
1600 Ga0395905_0203973
1601 Ga0395905_0219816
1602 Ga0395905_0223035
1603 Ga0395905_0231094
1604 Ga0395905_0271373
1605 Ga0395905_0337631
1606 Ga0395905_0386152
1607 Ga0395905_0492578
1608 Ga0395905_0512240
1609 Ga0395901_0000681
1610 Ga0395901_0005736
1611 Ga0395901_0008542
1612 Ga0395901_0015982
1613 Ga0395901_0028300
1614 Ga0395901_0033758
1615 Ga0395901_0042606
1616 Ga0395901_0074461
1617 Ga0395901_0080587
1618 Ga0395901_0130958
1619 Ga0395901_0137581
1620 Ga0395901_0154848
1621 Ga0395901_0174454
1622 Ga0395901_0353907
1623 Ga0395901_0394821
1624 Ga0395901_0585738
1625 Ga0436365_1429874
1626 Ga0436363_0375547
1627 Ga0439465_0040698
1628 Ga0439448_0024486
1629 Ga0439432_002187
1630 Ga0439432_087363
1631 Ga0439449_0009979
1632 Ga0439455_0022907
1633 Ga0439458_0000485
1634 Ga0439458_0000555
1635 Ga0466969_0010344
1636 Ga0466965_0219959
1637 Ga0466966_0020358
1638 Ga0466966_0041616
1639 Ga0466966_0134013
1640 Ga0466961_0041219
1641 Ga0466961_0157766
1642 Ga0466961_0212996
1643 Ga0466964_0026443
1644 Ga0466971_0021142
1645 Ga0466970_0073946
1646 Ga0466957_0152655
1647 Ga0466957_0234604
1648 Ga0466960_0036388
1649 Ga0466960_0115483
1650 Ga0466959_0033313
1651 Ga0466959_0052324
1652 Ga0466959_0115492
1653 Ga0466959_0145087
1654 Ga0466959_0200741
1655 Ga0466959_0206900
1656 Ga0466958_0108300
1657 Ga0466958_0141047
1658 Ga0466958_0152369
1659 Ga0466958_0221850
1660 Ga0466958_0301766
1661 Ga0466967_0132961
1662 Ga0495627_000617
1663 Ga0495629_0131801
1664 Ga0495648_0005005
1665 Ga0495621_0007156
1666 Ga0495633_0099960
1667 Ga0495669_0006980
1668 Ga0495669_0091413
1669 Ga0495671_0043469
1670 Ga0496100_0116257
1671 Ga0496100_0273315
1672 Ga0496101_0001762
1673 Ga0496102_0057117
1674 Ga0496102_0310938
1675 Ga0496102_0457590
1676 Ga0496103_0072289
1677 Ga0496103_0455452
1678 Ga0496104_0603531
1679 Ga0496105_0024862
1680 Ga0496106_0019188
1681 Ga0496106_0087328
1682 Ga0496107_0014597
1683 Ga0496107_0071018
1684 Ga0496107_0215234
1685 Ga0496107_0566249
1686 Ga0496108_0003987
1687 Ga0496108_0007034
1688 Ga0496108_0031482
1689 Ga0496108_0067422
1690 Ga0496108_0127890
1691 Ga0496109_0005615
1692 Ga0496109_0007592
1693 Ga0496109_0044858
1694 Ga0496109_0117395
1695 Ga0496110_0016179
1696 Ga0496110_0023577
1697 Ga0496111_0027369
1698 Ga0496111_0036464
1699 Ga0496111_0037180
1700 Ga0496111_0052175
1701 Ga0496112_0019765
1702 Ga0496112_0020281
1703 Ga0496112_0040436
1704 Ga0496112_0074840
1705 Ga0496113_0006306
1706 Ga0496113_0013166
1707 Ga0496113_0177204
1708 Ga0496114_0000130
1709 Ga0496114_0466878
1710 Ga0496116_0044039
1711 Ga0496121_0006069
1712 Ga0496122_0006730
1713 Ga0496123_0005339
1714 Ga0496124_0007058
1715 Ga0496124_0042588
1716 Ga0496125_0002768
1717 Ga0496125_0010066
1718 Ga0496126_0015740
1719 Ga0501298_022284
1720 Ga0501216_004767
1721 Ga0501223_000066
1722 Ga0501223_013803
1723 Ga0501233_023952
1724 Ga0501235_007871
1725 Ga0501235_023392
1726 Ga0501257_054131
1727 Ga0501258_005296
1728 Ga0501221_014696
1729 Ga0501225_0000137
1730 Ga0501225_0001770
1731 Ga0501225_0030860
1732 Ga0501225_0044171
1733 Ga0501229_003871
1734 Ga0501262_005207
1735 Ga0501263_002869
1736 Ga0501268_001988
1737 Ga0501272_003433
1738 Ga0501273_001227
1739 Ga0495655_0005326
1740 Ga0500594_0001515
1741 Ga0500559_0013126
1742 Ga0466962_0108377

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03309

Pan_kinase

Type III pantothenate kinase

2

209

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xb3-assembly2.cif.gz_D structure of acnpv poxin in post-reactive state with gp[2'-5']ap[3'] 0.9661 3 29
3djc-assembly1.cif.gz_L crystal structure of pantothenate kinase from legionella pneumophila 0.9329 1 259
2h3g-assembly1.cif.gz_X-2 structure of the type iii pantothenate kinase (coax) from bacillus anthracis 0.9327 1 255
7wn7-assembly1.cif.gz_A crystal structure of hearnpv p26 0.932 3 29
3djc-assembly1.cif.gz_L crystal structure of pantothenate kinase from legionella pneumophila 0.9293 1 259
ID Description Score Start End Superfamily
2h3gX02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9472 90 255 3.30.420.40
2h3gX01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9454 1 88 3.30.420.40
2h3gX01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9353 1 88 3.30.420.40
3djcB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9303 2 88 3.30.420.40
2h3gX02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9301 90 255 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A846M789-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) (PanK-III) (Pantothenic acid kinase) 0.9833 1 259 GO:0004594
GO:0005524
GO:0005737
GO:0015937
GO:0046872
AF-A0A2E8LTB3-F1-model_v4 deleted 0.9812 1 256
AF-A0A520I6S4-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) 0.9778 146 256 GO:0004594
GO:0005524
GO:0005737
GO:0015937
AF-A0A520I383-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) 0.9771 60 259 GO:0004594
GO:0005524
GO:0005737
GO:0015937
AF-A0A2E8LTB3-F1-model_v4 deleted 0.9737 1 256

Map