F484199

General Info

Members Datasets Scaffolds Average Seq Length
871 457 1742 201

Family's Representative Sequence

Representative Sequence 3300046513|Ga0495616_0001804|Ga0495616_0001804_8504_9103
Length 199
Sequence MKLYYAPQACSLAPHIVLRELQLPFVLIRVDNRSKRTTSGEDFLAINPKGYVAALQLENGEVLTEGPAILQYLADLQPQSGLAPAPAPGSFERVRLQEWLNFVSSEIHGGLGALFDERMPAEVIKEKLFKRFAVLVAVLEQQDYLLPSGFSVADALLFVVLRWAGLFGIELERWPALARFQDRIGKRPTVIAALTAEAA

Samples

Sample ID Description Type Environment
1 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
22 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
86 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
87 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
88 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
89 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
90 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
91 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
100 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
102 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
141 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
143 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
148 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
149 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
157 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
158 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
159 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
160 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
161 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
162 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
163 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
164 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
165 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
166 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
167 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
168 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
171 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
180 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
183 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
190 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
191 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
192 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
195 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
196 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
199 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
202 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
203 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
204 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
205 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
206 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
207 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
208 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
209 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
212 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
215 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
216 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
222 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
223 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
224 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
225 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
226 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
227 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
231 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
232 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
233 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
234 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
237 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
238 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
239 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
244 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
245 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
246 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
247 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
248 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
249 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
250 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
251 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
252 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
253 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
254 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
266 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
267 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
268 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
269 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
270 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
271 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
272 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
277 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
278 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
287 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
288 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
289 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
290 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
291 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
292 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
293 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
294 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
295 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
296 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
297 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
298 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
299 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
300 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
301 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
302 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
303 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
304 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
305 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
306 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
307 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
308 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
309 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
313 2506520008 Serratia plymuthica AS12 Isolate Unclassified
314 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
315 2511231006 Pseudomonas sp. GM17 Isolate Nodule
316 2511231007 Pseudomonas sp. GM18 Isolate Nodule
317 2511231011 Pseudomonas sp. GM30 Isolate Nodule
318 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
319 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
320 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
321 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
322 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
323 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
324 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
325 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
326 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
327 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
328 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
329 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
330 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
331 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
332 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
333 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
334 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
335 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
336 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
337 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
338 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
339 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
340 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
341 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
342 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
343 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
344 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
345 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
346 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
347 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
348 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
349 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
350 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
351 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
352 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
353 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
354 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
355 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
356 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
357 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
358 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
359 2636415599 Klebsiella variicola DX120E Isolate Unclassified
360 2643221556 Massilia sp. Root1485 Isolate Unclassified
361 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
362 2643221684 Massilia sp. Root133 Isolate Unclassified
363 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
364 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
365 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
366 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
367 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
368 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
369 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
370 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
371 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
372 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
373 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
374 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
375 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
376 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
377 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
378 2734482264 Dyella sp. AD052 Isolate Unclassified
379 2738541307 Variovorax sp. GV008 Isolate Unclassified
380 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
381 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
382 2751185917 Enterobacter sp. HK169 Isolate Unclassified
383 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
384 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
385 2773857670 Pseudomonas sp. 478 Isolate Unclassified
386 2773857673 Pseudomonas sp. 443 Isolate Unclassified
387 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
388 2775507074 Klebsiella sp. D5A Isolate Unclassified
389 2784132063 Pseudomonas sp. 424 Isolate Unclassified
390 2784132072 Pseudomonas sp. 460 Isolate Unclassified
391 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
392 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
393 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
394 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
395 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
396 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
397 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
398 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
399 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
400 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
401 2818991436 Collimonas arenae 515 Isolate Unclassified
402 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
403 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
404 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
405 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
406 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
407 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
408 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
409 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
410 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
411 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
412 2858950400 Achromobacter sp. K91 Isolate Unclassified
413 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
414 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
415 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
416 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
417 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
418 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
419 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
420 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
421 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
422 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
423 2919150387 Rahnella aceris 1817 Isolate Unclassified
424 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
425 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
426 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
427 2927143783 Rahnella sp. 2050 Isolate Unclassified
428 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
429 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
430 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
431 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
432 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
433 2937539931 Pantoea sp. LS15 Isolate Unclassified
434 2941479691
435 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
436 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
437 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
438 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
439 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
440 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
441 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
442 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
443 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
444 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
445 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
446 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
447 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
448 640753048 Serratia proteamaculans 568 Isolate Endosphere
449 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
450 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
451 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
452 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
453 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
454 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
455 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
456 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
457 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.24
Metatranscriptomes 0
Isolates 16.76

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 8.27
Nodule 1.26
Rhizoplane 7.81
Rhizosphere 62.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495616_0001804 3300046513 Bacteria 14520
2 MRS2a_Contig_1351 2124908027 Bacteria 1291
3 MRS2a_Contig_27077 2124908027 Bacteria 761
4 MRS2a_Contig_339 2124908027 Bacteria 17793
5 SwRhRL2b_contig_783059 2162886007 Bacteria 3887
6 JGI24739J22299_10097095 3300001989 Bacteria 892
7 JGI25162J39368_1000038 3300002737 Bacteria 179049
8 JGI25162J39368_1000092 3300002737 Bacteria 100905
9 JGI25162J39368_1000231 3300002737 Bacteria 56968
10 JGI25162J39368_1002383 3300002737 Bacteria 7411
11 JGI25163J39215_1000013 3300002771 Bacteria 86331
12 JGI25163J39215_1000504 3300002771 Bacteria 11627
13 JGI25164J39214_1000071 3300002772 Bacteria 100905
14 JGI25164J39214_1000179 3300002772 Bacteria 56968
15 JGI25151J46595_10000559 3300003187 Bacteria 33736
16 JGI25151J46595_10000719 3300003187 Bacteria 27557
17 JGI25165J46597_1000045 3300003214 Bacteria 257539
18 JGI25165J46597_1000327 3300003214 Bacteria 56968
19 JGI25153J46596_10039030 3300003215 Bacteria 1488
20 rootH2_10110653 3300003320 Bacteria 1386
21 rootL2_10018643 3300003322 Bacteria 2411
22 rootL2_10155604 3300003322 Bacteria 4673
23 JGI25160J50197_1004440 3300003354 Bacteria 6068
24 Ga0055538_1000022 3300003751 Bacteria 257539
25 Ga0055538_1000064 3300003751 Bacteria 100905
26 Ga0055539_1000028 3300003752 Bacteria 257539
27 Ga0055539_1000098 3300003752 Bacteria 100905
28 Ga0055533_1000036 3300003756 Bacteria 257539
29 Ga0055533_1000108 3300003756 Bacteria 100905
30 Ga0055525_1000071 3300003759 Bacteria 182624
31 Ga0055525_1000141 3300003759 Bacteria 100905
32 Ga0055525_1007489 3300003759 Bacteria 921
33 Ga0055530_10000105 3300003791 Bacteria 71978
34 Ga0055530_10000256 3300003791 Bacteria 47915
35 Ga0055540_1001478 3300003792 Bacteria 13987
36 Ga0055541_1000037 3300003841 Bacteria 182624
37 Ga0055541_1000065 3300003841 Bacteria 100905
38 Ga0058692_1000135 3300003856 Bacteria 46715
39 Ga0058692_1014160 3300003856 Bacteria 1835
40 Ga0065703_1021008 3300005272 Bacteria 1395
41 Ga0065714_10000495 3300005288 Bacteria 4231
42 Ga0065714_10069538 3300005288 Bacteria 4188
43 Ga0065704_10000285 3300005289 Bacteria 54664
44 Ga0065704_10004692 3300005289 Bacteria 3244
45 Ga0065712_10006415 3300005290 Bacteria 3365
46 Ga0065715_10028109 3300005293 Bacteria 2147
47 Ga0070658_10190676 3300005327 Bacteria 1727
48 Ga0070676_10097935 3300005328 Bacteria 1807
49 Ga0070690_100724861 3300005330 Bacteria 765
50 Ga0070670_100000161 3300005331 Bacteria 60718
51 Ga0070670_100000221 3300005331 Bacteria 52485
52 Ga0070670_100325150 3300005331 Bacteria 1348
53 Ga0068869_100466195 3300005334 Bacteria 1049
54 Ga0070666_10248026 3300005335 Bacteria 1260
55 Ga0068868_100355727 3300005338 Bacteria 1255
56 Ga0070661_100000640 3300005344 Bacteria 25992
57 Ga0070668_100034128 3300005347 Bacteria 3877
58 Ga0070669_100000299 3300005353 Bacteria 38931
59 Ga0070675_100216966 3300005354 Bacteria 1665
60 Ga0070673_100177993 3300005364 Bacteria 1819
61 Ga0070688_100428084 3300005365 Bacteria 985
62 Ga0070667_100321849 3300005367 Bacteria 1395
63 Ga0070662_100001026 3300005457 Bacteria 17077
64 Ga0070662_100098528 3300005457 Bacteria 2208
65 Ga0070662_100207068 3300005457 Bacteria 1559
66 Ga0070684_100414485 3300005535 Bacteria 1243
67 Ga0068853_100033799 3300005539 Bacteria 4338
68 Ga0068853_100472424 3300005539 Bacteria 1181
69 Ga0070672_100045412 3300005543 Bacteria 3398
70 Ga0070693_100096092 3300005547 Bacteria 1795
71 Ga0070665_100039980 3300005548 Bacteria 4715
72 Ga0068855_100059616 3300005563 Bacteria 4465
73 Ga0070664_100000489 3300005564 Bacteria 29977
74 Ga0070664_100146767 3300005564 Bacteria 2081
75 Ga0068857_100667298 3300005577 Bacteria 986
76 Ga0068854_100008186 3300005578 Bacteria 6707
77 Ga0068856_100057337 3300005614 Bacteria 3845
78 Ga0068856_100192049 3300005614 Bacteria 2056
79 Ga0068859_100556123 3300005617 Bacteria 1242
80 Ga0068851_10000036 3300005834 Bacteria 105179
81 Ga0068870_10402166 3300005840 Bacteria 891
82 Ga0068860_100551405 3300005843 Bacteria 1155
83 Ga0081540_1049520 3300005983 Bacteria 2095
84 Ga0070717_10085800 3300006028 Bacteria 2650
85 Ga0075364_10009886 3300006051 Bacteria 5739
86 Ga0075364_10062388 3300006051 Bacteria 2445
87 Ga0075432_10000389 3300006058 Bacteria 12729
88 Ga0075432_10084063 3300006058 Bacteria 1157
89 Ga0075369_10028270 3300006186 Bacteria 2350
90 Ga0068865_100017011 3300006881 Bacteria 4668
91 Ga0097620_100556117 3300006931 Bacteria 1242
92 Ga0079104_1005087 3300006946 Bacteria 5358
93 Ga0079104_1057562 3300006946 Bacteria 847
94 Ga0099794_10000054 3300007265 Bacteria 43801
95 Ga0105251_10000109 3300009011 Bacteria 81396
96 Ga0105251_10000632 3300009011 Bacteria 32332
97 Ga0105251_10002446 3300009011 Bacteria 14593
98 Ga0105251_10002477 3300009011 Bacteria 14465
99 Ga0105251_10004209 3300009011 Bacteria 9956
100 Ga0105251_10005496 3300009011 Bacteria 8258
101 Ga0105251_10007551 3300009011 Bacteria 6676
102 Ga0105251_10112568 3300009011 Bacteria 1239
103 Ga0105251_10138322 3300009011 Bacteria 1102
104 Ga0105251_10232389 3300009011 Bacteria 830
105 Ga0105244_10000690 3300009036 Bacteria 29348
106 Ga0105244_10001260 3300009036 Bacteria 20753
107 Ga0105244_10001623 3300009036 Bacteria 17821
108 Ga0105244_10002664 3300009036 Bacteria 13380
109 Ga0105244_10006790 3300009036 Bacteria 7362
110 Ga0105244_10007221 3300009036 Bacteria 7084
111 Ga0105244_10036931 3300009036 Bacteria 2556
112 Ga0105244_10051389 3300009036 Bacteria 2100
113 Ga0105244_10052630 3300009036 Bacteria 2072
114 Ga0105244_10161982 3300009036 Bacteria 1068
115 Ga0105250_10000980 3300009092 Bacteria 16633
116 Ga0105250_10001610 3300009092 Bacteria 12083
117 Ga0105250_10003840 3300009092 Bacteria 7046
118 Ga0105250_10020674 3300009092 Bacteria 2659
119 Ga0105240_10021162 3300009093 Bacteria 8659
120 Ga0105240_10040554 3300009093 Bacteria 5953
121 Ga0105240_10076396 3300009093 Bacteria 4129
122 Ga0105247_10000025 3300009101 Bacteria 208459
123 Ga0105243_10006244 3300009148 Bacteria 9208
124 Ga0105243_10135564 3300009148 Bacteria 2094
125 Ga0105241_10000005 3300009174 Bacteria 384203
126 Ga0105242_10000238 3300009176 Bacteria 43389
127 Ga0105242_10566113 3300009176 Bacteria 1092
128 Ga0105239_10001431 3300010375 Bacteria 31823
129 Ga0105239_10770933 3300010375 Bacteria 1101
130 Ga0105246_10210134 3300011119 Bacteria 1518
131 Ga0105246_10684597 3300011119 Bacteria 897
132 Ga0157373_10004421 3300013100 Bacteria 10589
133 Ga0157373_10005271 3300013100 Bacteria 9710
134 Ga0157373_10005861 3300013100 Bacteria 9191
135 Ga0157373_10007988 3300013100 Bacteria 7867
136 Ga0157373_10179482 3300013100 Bacteria 1490
137 Ga0157371_10003359 3300013102 Bacteria 14572
138 Ga0157371_10259645 3300013102 Bacteria 1252
139 Ga0157371_10264236 3300013102 Bacteria 1241
140 Ga0157370_10024387 3300013104 Bacteria 5991
141 Ga0157370_10060151 3300013104 Bacteria 3608
142 Ga0157370_10070146 3300013104 Bacteria 3309
143 Ga0157370_10100182 3300013104 Bacteria 2715
144 Ga0157370_10204410 3300013104 Bacteria 1831
145 Ga0157370_10238850 3300013104 Bacteria 1681
146 Ga0157370_10250296 3300013104 Bacteria 1639
147 Ga0157370_10272285 3300013104 Bacteria 1564
148 Ga0157370_10451491 3300013104 Bacteria 1182
149 Ga0157370_10981132 3300013104 Bacteria 765
150 Ga0157369_10000646 3300013105 Bacteria 45033
151 Ga0157369_10005544 3300013105 Bacteria 14663
152 Ga0157369_10007554 3300013105 Bacteria 12507
153 Ga0157369_10009657 3300013105 Bacteria 11032
154 Ga0157369_10064490 3300013105 Bacteria 3945
155 Ga0157369_10093023 3300013105 Bacteria 3218
156 Ga0157369_10249118 3300013105 Bacteria 1854
157 Ga0157374_10035668 3300013296 Bacteria 4551
158 Ga0157372_10003765 3300013307 Bacteria 16290
159 Ga0157372_10008148 3300013307 Bacteria 11138
160 Ga0157372_10141186 3300013307 Bacteria 2775
161 Ga0157372_10205989 3300013307 Bacteria 2279
162 Ga0157372_10664017 3300013307 Bacteria 1214
163 Ga0157375_10000979 3300013308 Bacteria 24702
164 Ga0157375_10011925 3300013308 Bacteria 7690
165 Ga0157375_10186611 3300013308 Bacteria 2227
166 Ga0163163_10829545 3300014325 Bacteria 988
167 Ga0182008_10000753 3300014497 Bacteria 22750
168 Ga0182008_10001764 3300014497 Bacteria 14173
169 Ga0182008_10002169 3300014497 Bacteria 12486
170 Ga0182008_10002354 3300014497 Bacteria 11896
171 Ga0182008_10016078 3300014497 Bacteria 3893
172 Ga0157376_10035314 3300014969 Bacteria 4043
173 Ga0182006_1002148 3300015261 Bacteria 10942
174 Ga0182006_1007173 3300015261 Bacteria 5123
175 Ga0182006_1007195 3300015261 Bacteria 5112
176 Ga0182007_10002918 3300015262 Bacteria 8307
177 Ga0182007_10003477 3300015262 Bacteria 7415
178 Ga0182005_1000928 3300015265 Bacteria 12791
179 Ga0182005_1002531 3300015265 Bacteria 6489
180 Ga0183366_1001 3300015679 Bacteria 2743932
181 Ga0183370_1001 3300015680 Bacteria 2743932
182 Ga0183369_1001 3300015685 Bacteria 2743932
183 Ga0183368_1001 3300015687 Bacteria 2743932
184 Ga0163161_10000001 3300017792 Bacteria 2041488
185 Ga0163161_10037352 3300017792 Bacteria 3482
186 Ga0163161_10057629 3300017792 Bacteria 2822
187 Ga0163161_10136388 3300017792 Bacteria 1855
188 Ga0163161_10365862 3300017792 Bacteria 1149
189 Ga0209760_100189 3300025207 Bacteria 30616
190 Ga0209760_100257 3300025207 Bacteria 21351
191 Ga0209760_102005 3300025207 Bacteria 1981
192 Ga0209784_100001 3300025224 Bacteria 3600592
193 Ga0209784_100036 3300025224 Bacteria 263689
194 Ga0209566_100001 3300025225 Bacteria 3600765
195 Ga0209566_100044 3300025225 Bacteria 263689
196 Ga0209674_100002 3300025226 Bacteria 3600592
197 Ga0209674_100065 3300025226 Bacteria 263689
198 Ga0209563_100002 3300025230 Bacteria 2045675
199 Ga0209563_100063 3300025230 Bacteria 263689
200 Ga0209563_101321 3300025230 Bacteria 6766
201 Ga0207427_100008 3300025231 Bacteria 740731
202 Ga0207427_100020 3300025231 Bacteria 507515
203 Ga0207427_100664 3300025231 Bacteria 16489
204 Ga0209437_100001 3300025233 Bacteria 2045675
205 Ga0209437_100014 3300025233 Bacteria 740714
206 Ga0209437_100032 3300025233 Bacteria 520075
207 Ga0209437_100082 3300025233 Bacteria 263689
208 Ga0209677_100002 3300025253 Bacteria 2045675
209 Ga0209677_100038 3300025253 Bacteria 263689
210 Ga0209233_1000008 3300025261 Bacteria 1356712
211 Ga0209233_1000109 3300025261 Bacteria 263689
212 Ga0209130_1000436 3300025284 Bacteria 44714
213 Ga0209676_1000006 3300025292 Bacteria 1039588
214 Ga0209025_1000099 3300025294 Bacteria 231353
215 Ga0209758_1001714 3300025297 Bacteria 24545
216 Ga0209050_1000070 3300025298 Bacteria 296366
217 Ga0207426_1000065 3300025302 Bacteria 353625
218 Ga0209051_1000093 3300025303 Bacteria 169092
219 Ga0207697_10133950 3300025315 Bacteria 1072
220 Ga0207656_10000021 3300025321 Bacteria 113329
221 Ga0207696_1000001 3300025711 Bacteria 2579611
222 Ga0207696_1000073 3300025711 Bacteria 215388
223 Ga0207696_1002951 3300025711 Bacteria 7969
224 Ga0207696_1026790 3300025711 Bacteria 1781
225 Ga0207655_1000021 3300025728 Bacteria 518596
226 Ga0207655_1000060 3300025728 Bacteria 260572
227 Ga0207655_1000595 3300025728 Bacteria 44227
228 Ga0207655_1000679 3300025728 Bacteria 39682
229 Ga0207655_1001849 3300025728 Bacteria 18288
230 Ga0207655_1001923 3300025728 Bacteria 17778
231 Ga0207655_1002280 3300025728 Bacteria 15795
232 Ga0207655_1002998 3300025728 Bacteria 12932
233 Ga0207655_1010672 3300025728 Bacteria 5553
234 Ga0207655_1019953 3300025728 Bacteria 3474
235 Ga0207655_1023432 3300025728 Bacteria 3062
236 Ga0207713_1000003 3300025735 Bacteria 860698
237 Ga0207713_1000011 3300025735 Bacteria 507224
238 Ga0207713_1000092 3300025735 Bacteria 148309
239 Ga0207713_1000142 3300025735 Bacteria 107313
240 Ga0207713_1000671 3300025735 Bacteria 32337
241 Ga0207713_1002192 3300025735 Bacteria 14482
242 Ga0207713_1010307 3300025735 Bacteria 5185
243 Ga0207713_1014047 3300025735 Bacteria 4182
244 Ga0207713_1014492 3300025735 Bacteria 4092
245 Ga0207713_1014499 3300025735 Bacteria 4091
246 Ga0207713_1015037 3300025735 Bacteria 3988
247 Ga0207713_1017844 3300025735 Bacteria 3536
248 Ga0207713_1033314 3300025735 Bacteria 2252
249 Ga0207710_10000074 3300025900 Bacteria 147390
250 Ga0207645_10128755 3300025907 Bacteria 1647
251 Ga0207643_10277292 3300025908 Bacteria 1039
252 Ga0207705_10265352 3300025909 Bacteria 1312
253 Ga0207654_10000007 3300025911 Bacteria 384211
254 Ga0207695_10065987 3300025913 Bacteria 3719
255 Ga0207671_10000263 3300025914 Bacteria 78721
256 Ga0207649_10000288 3300025920 Bacteria 39325
257 Ga0207681_10001287 3300025923 Bacteria 16196
258 Ga0207650_10000191 3300025925 Bacteria 71126
259 Ga0207650_10000194 3300025925 Bacteria 70396
260 Ga0207650_10259019 3300025925 Bacteria 1410
261 Ga0207650_10351626 3300025925 Bacteria 1212
262 Ga0207659_10096672 3300025926 Bacteria 2217
263 Ga0207706_10000493 3300025933 Bacteria 42224
264 Ga0207706_10012239 3300025933 Bacteria 7819
265 Ga0207706_10259521 3300025933 Bacteria 1517
266 Ga0207686_10011944 3300025934 Bacteria 4767
267 Ga0207709_10027877 3300025935 Bacteria 3259
268 Ga0207709_10193879 3300025935 Bacteria 1445
269 Ga0207704_10102824 3300025938 Bacteria 1909
270 Ga0207691_10028446 3300025940 Bacteria 5234
271 Ga0207689_10245149 3300025942 Bacteria 1481
272 Ga0207679_10000226 3300025945 Bacteria 44414
273 Ga0207679_10164444 3300025945 Bacteria 1820
274 Ga0207667_10071345 3300025949 Bacteria 3612
275 Ga0207640_10035714 3300025981 Bacteria 3113
276 Ga0207658_10546123 3300025986 Bacteria 1036
277 Ga0207639_10014082 3300026041 Bacteria 5614
278 Ga0207639_10699654 3300026041 Bacteria 940
279 Ga0207702_10001503 3300026078 Bacteria 23056
280 Ga0207702_10586018 3300026078 Bacteria 1093
281 Ga0207648_10332758 3300026089 Bacteria 1366
282 Ga0207674_10001166 3300026116 Bacteria 34125
283 Ga0207698_10194869 3300026142 Bacteria 1809
284 Ga0209281_1000027 3300027111 Bacteria 463409
285 Ga0209281_1001505 3300027111 Bacteria 13289
286 Ga0209371_1000001 3300027312 Bacteria 2771503
287 Ga0209371_1000471 3300027312 Bacteria 39614
288 Ga0209371_1017128 3300027312 Bacteria 1887
289 Ga0209282_1000093 3300027666 Bacteria 62036
290 Ga0209588_1000017 3300027671 Bacteria 97342
291 Ga0207428_10115187 3300027907 Bacteria 2065
292 Ga0207428_10134967 3300027907 Bacteria 1887
293 Ga0207428_10400031 3300027907 Bacteria 1006
294 Ga0268266_10206371 3300028379 Bacteria 1800
295 Ga0268264_11014095 3300028381 Bacteria 837
296 Ga0307517_10067934 3300028786 Bacteria 3255
297 Ga0268256_1000001 3300030500 Bacteria 2771065
298 Ga0268256_1000057 3300030500 Bacteria 229991
299 Ga0268256_1000398 3300030500 Bacteria 39614
300 Ga0268256_1019079 3300030500 Bacteria 1886
301 Ga0265328_10082971 3300031239 Bacteria 1182
302 Ga0307509_10151367 3300031507 Bacteria 2234
303 Ga0307516_10030996 3300031730 Bacteria 5393
304 Ga0307412_10005500 3300031911 Bacteria 7116
305 Ga0395899_0004173 3300037312 Bacteria 11345
306 Ga0395900_0013792 3300037418 Bacteria 8247
307 Ga0436365_1060686 3300039437 Bacteria 2203
308 Ga0439438_036176 3300041405 Bacteria 1295
309 Ga0439447_001156 3300041407 Bacteria 9608
310 Ga0439447_023131 3300041407 Bacteria 1621
311 Ga0439466_0000953 3300041411 Bacteria 11092
312 Ga0439466_0002095 3300041411 Bacteria 7815
313 Ga0439466_0078346 3300041411 Bacteria 1044
314 Ga0439451_000970 3300042009 Bacteria 5544
315 Ga0439451_046280 3300042009 Bacteria 871
316 Ga0439452_000126 3300042010 Bacteria 59072
317 Ga0439452_015882 3300042010 Bacteria 2055
318 Ga0439456_016540 3300042013 Bacteria 1542
319 Ga0439463_000047 3300042016 Bacteria 25575
320 Ga0450903_008180 3300042138 Bacteria 1713
321 Ga0450889_002580 3300042144 Bacteria 1797
322 Ga0439464_0016738 3300042439 Bacteria 1985
323 Ga0439460_0040485 3300042461 Bacteria 1365
324 Ga0450893_0003281 3300042532 Bacteria 2545
325 Ga0439440_0010531 3300042993 Bacteria 1935
326 Ga0466972_0006635 3300044658 Bacteria 5810
327 Ga0466989_0173783 3300044663 Bacteria 1286
328 Ga0466965_0093015 3300044683 Bacteria 1535
329 Ga0466961_0101325 3300044693 Bacteria 1814
330 Ga0466963_0275197 3300044694 Bacteria 1183
331 Ga0466964_0002273 3300044706 Bacteria 6814
332 Ga0453684_0421915 3300044712 Bacteria 1490
333 Ga0466968_0138534 3300044735 Bacteria 1111
334 Ga0466970_0190841 3300044765 Bacteria 1138
335 Ga0466960_0028244 3300044901 Bacteria 2566
336 Ga0495617_000028 3300046452 Bacteria 156686
337 Ga0495617_000408 3300046452 Bacteria 23783
338 Ga0495617_002126 3300046452 Bacteria 8151
339 Ga0495617_018492 3300046452 Bacteria 2356
340 Ga0495617_023670 3300046452 Bacteria 2074
341 Ga0495627_000018 3300046453 Bacteria 315125
342 Ga0495627_021434 3300046453 Bacteria 2142
343 Ga0495603_0399956 3300046455 Bacteria 787
344 Ga0495590_0000901 3300046457 Bacteria 13287
345 Ga0495590_0009751 3300046457 Bacteria 3637
346 Ga0495590_0035907 3300046457 Bacteria 1729
347 Ga0495591_003722 3300046458 Bacteria 7724
348 Ga0495591_112969 3300046458 Bacteria 666
349 Ga0495638_0012816 3300046460 Bacteria 5728
350 Ga0495638_0020181 3300046460 Bacteria 4403
351 Ga0495638_0197554 3300046460 Bacteria 1137
352 Ga0495651_0167561 3300046462 Bacteria 1567
353 Ga0495653_0006143 3300046463 Bacteria 9851
354 Ga0495650_0000043 3300046471 Bacteria 357197
355 Ga0495650_0002158 3300046471 Bacteria 16702
356 Ga0495650_0002618 3300046471 Bacteria 14099
357 Ga0495650_0004589 3300046471 Bacteria 9394
358 Ga0495650_0005525 3300046471 Bacteria 8171
359 Ga0495580_0244028 3300046472 Bacteria 1231
360 Ga0495605_0004566 3300046474 Bacteria 8108
361 Ga0495605_0022108 3300046474 Bacteria 3362
362 Ga0495605_0055809 3300046474 Bacteria 1906
363 Ga0495605_0069888 3300046474 Bacteria 1661
364 Ga0495639_0000633 3300046475 Bacteria 16236
365 Ga0495639_0013803 3300046475 Bacteria 3493
366 Ga0495584_0001297 3300046491 Bacteria 15204
367 Ga0495584_0001499 3300046491 Bacteria 13928
368 Ga0495584_0019448 3300046491 Bacteria 3449
369 Ga0495585_0022219 3300046492 Bacteria 3642
370 Ga0495585_0065684 3300046492 Bacteria 1987
371 Ga0495585_0306652 3300046492 Bacteria 779
372 Ga0495594_0016635 3300046499 Bacteria 3877
373 Ga0495594_0022850 3300046499 Bacteria 3348
374 Ga0495596_0006155 3300046500 Bacteria 5572
375 Ga0495607_0000411 3300046501 Bacteria 43380
376 Ga0495607_0002094 3300046501 Bacteria 16666
377 Ga0495607_0003292 3300046501 Bacteria 12409
378 Ga0495607_0007091 3300046501 Bacteria 7793
379 Ga0495607_0008369 3300046501 Bacteria 7075
380 Ga0495607_0333335 3300046501 Bacteria 704
381 Ga0495583_0003439 3300046506 Bacteria 12048
382 Ga0495583_0012803 3300046506 Bacteria 4721
383 Ga0495606_0002737 3300046507 Bacteria 19840
384 Ga0495606_0024403 3300046507 Bacteria 4357
385 Ga0495606_0043657 3300046507 Bacteria 2987
386 Ga0495606_0174073 3300046507 Bacteria 1246
387 Ga0495606_0212949 3300046507 Bacteria 1093
388 Ga0495610_0006447 3300046512 Bacteria 8072
389 Ga0495610_0012908 3300046512 Bacteria 4996
390 Ga0495610_0050457 3300046512 Bacteria 2031
391 Ga0495610_0108460 3300046512 Bacteria 1233
392 Ga0495610_0114039 3300046512 Bacteria 1193
393 Ga0495616_0021597 3300046513 Bacteria 3481
394 Ga0495620_0000046 3300046515 Bacteria 108205
395 Ga0495628_0010287 3300046516 Bacteria 7950
396 Ga0495631_0000955 3300046518 Bacteria 18003
397 Ga0495631_0013652 3300046518 Bacteria 3937
398 Ga0495631_0179313 3300046518 Bacteria 908
399 Ga0495632_0001104 3300046519 Bacteria 23112
400 Ga0495632_0001282 3300046519 Bacteria 21263
401 Ga0495637_0006805 3300046520 Bacteria 5720
402 Ga0495637_0022452 3300046520 Bacteria 2877
403 Ga0495637_0024071 3300046520 Bacteria 2756
404 Ga0495637_0056948 3300046520 Bacteria 1616
405 Ga0495643_0014773 3300046522 Bacteria 4635
406 Ga0495644_0012139 3300046523 Bacteria 3311
407 Ga0495648_0015363 3300046524 Bacteria 5560
408 Ga0495648_0019072 3300046524 Bacteria 4836
409 Ga0495648_0021049 3300046524 Bacteria 4528
410 Ga0495648_0021473 3300046524 Bacteria 4468
411 Ga0495648_0038353 3300046524 Bacteria 3065
412 Ga0495648_0042482 3300046524 Bacteria 2859
413 Ga0495666_0033975 3300046526 Bacteria 2489
414 Ga0495666_0076812 3300046526 Bacteria 1583
415 Ga0495666_0102266 3300046526 Bacteria 1349
416 Ga0495666_0112604 3300046526 Bacteria 1277
417 Ga0495642_0006583 3300046528 Bacteria 4457
418 Ga0495642_0089350 3300046528 Bacteria 1303
419 Ga0495654_0002150 3300046530 Bacteria 12852
420 Ga0495654_0002557 3300046530 Bacteria 11635
421 Ga0495654_0006797 3300046530 Bacteria 6459
422 Ga0495654_0008007 3300046530 Bacteria 5868
423 Ga0495654_0044893 3300046530 Bacteria 2182
424 Ga0495654_0059304 3300046530 Bacteria 1843
425 Ga0495654_0061363 3300046530 Bacteria 1805
426 Ga0495587_0021564 3300046536 Bacteria 3972
427 Ga0495609_0007194 3300046538 Bacteria 5586
428 Ga0495609_0169133 3300046538 Bacteria 923
429 Ga0495597_0028178 3300046542 Bacteria 2571
430 Ga0495597_0130342 3300046542 Bacteria 1043
431 Ga0495645_0066398 3300046543 Bacteria 2607
432 Ga0495622_0001748 3300046557 Bacteria 10746
433 Ga0495622_0002064 3300046557 Bacteria 9813
434 Ga0495622_0024138 3300046557 Bacteria 2839
435 Ga0495633_0017145 3300046558 Bacteria 3712
436 Ga0495656_0000711 3300046615 Bacteria 10742
437 Ga0495656_0047448 3300046615 Bacteria 1821
438 Ga0495634_0001752 3300046642 Bacteria 18797
439 Ga0495634_0051353 3300046642 Bacteria 2766
440 Ga0495611_0012475 3300046648 Bacteria 3612
441 Ga0495625_0004335 3300046660 Bacteria 13472
442 Ga0495635_0003099 3300046663 Bacteria 11436
443 Ga0495659_0000475 3300046664 Bacteria 14814
444 Ga0495659_0036981 3300046664 Bacteria 1727
445 Ga0495659_0081086 3300046664 Bacteria 1231
446 Ga0495661_0001671 3300046665 Bacteria 18076
447 Ga0495661_0006087 3300046665 Bacteria 8502
448 Ga0495661_0030769 3300046665 Bacteria 3415
449 Ga0495661_0219835 3300046665 Bacteria 985
450 Ga0495661_0255204 3300046665 Bacteria 893
451 Ga0495588_0007357 3300046674 Bacteria 5005
452 Ga0495588_0014823 3300046674 Bacteria 3739
453 Ga0495588_0019900 3300046674 Bacteria 3293
454 Ga0495588_0079503 3300046674 Bacteria 1711
455 Ga0495588_0181880 3300046674 Bacteria 1111
456 Ga0495657_0021569 3300046675 Bacteria 4622
457 Ga0495599_0004928 3300046678 Bacteria 7931
458 Ga0495623_0039302 3300046679 Bacteria 3025
459 Ga0495646_0019001 3300046680 Bacteria 4352
460 Ga0495646_0086198 3300046680 Bacteria 1821
461 Ga0495669_0004695 3300046684 Bacteria 5666
462 Ga0495613_0047415 3300046689 Bacteria 3174
463 Ga0495613_0186496 3300046689 Bacteria 1467
464 Ga0495624_0001741 3300046690 Bacteria 16628
465 Ga0495624_0006025 3300046690 Bacteria 8645
466 Ga0495670_0003382 3300046691 Bacteria 7847
467 Ga0495670_0008205 3300046691 Bacteria 5135
468 Ga0495670_0252554 3300046691 Bacteria 940
469 Ga0495670_0320234 3300046691 Bacteria 832
470 Ga0495671_0001718 3300046692 Bacteria 14225
471 Ga0495671_0004099 3300046692 Bacteria 8788
472 Ga0495671_0112379 3300046692 Bacteria 1330
473 Ga0495649_0004079 3300046694 Bacteria 9610
474 Ga0495649_0014473 3300046694 Bacteria 4519
475 Ga0495649_0019636 3300046694 Bacteria 3796
476 Ga0495649_0095766 3300046694 Bacteria 1580
477 Ga0495649_0154753 3300046694 Bacteria 1203
478 Ga0495589_0000002 3300046794 Bacteria 758846
479 Ga0495589_0000316 3300046794 Bacteria 38558
480 Ga0495589_0010734 3300046794 Bacteria 4760
481 Ga0495589_0017529 3300046794 Bacteria 3674
482 Ga0495589_0022296 3300046794 Bacteria 3231
483 Ga0495589_0037035 3300046794 Bacteria 2444
484 Ga0495589_0076528 3300046794 Bacteria 1631
485 Ga0495600_0001683 3300046809 Bacteria 12350
486 Ga0495600_0050069 3300046809 Bacteria 2725
487 Ga0495660_0000014 3300046810 Bacteria 337328
488 Ga0495660_0044853 3300046810 Bacteria 2430
489 Ga0495660_0051843 3300046810 Bacteria 2231
490 Ga0495660_0080886 3300046810 Bacteria 1704
491 Ga0495581_0018253 3300047315 Bacteria 4074
492 Ga0495604_0009622 3300047317 Bacteria 7645
493 Ga0495604_0085933 3300047317 Bacteria 2346
494 Ga0495604_0129159 3300047317 Bacteria 1818
495 Ga0495636_0001719 3300047318 Bacteria 8354
496 Ga0495636_0380132 3300047318 Bacteria 670
497 Ga0495674_0048328 3300047319 Bacteria 3765
498 Ga0495672_0000466 3300047320 Bacteria 47885
499 Ga0495672_0002548 3300047320 Bacteria 16615
500 Ga0495672_0002855 3300047320 Bacteria 15357
501 Ga0495672_0012988 3300047320 Bacteria 5768
502 Ga0495672_0014231 3300047320 Bacteria 5458
503 Ga0495672_0067189 3300047320 Bacteria 2042
504 Ga0495672_0088478 3300047320 Bacteria 1706
505 Ga0495672_0122834 3300047320 Bacteria 1377
506 Ga0495680_0021857 3300047322 Bacteria 5345
507 Ga0495680_0065001 3300047322 Bacteria 2796
508 Ga0495683_0001064 3300047323 Bacteria 18983
509 Ga0495683_0012748 3300047323 Bacteria 4411
510 Ga0495683_0020550 3300047323 Bacteria 3404
511 Ga0495683_0038618 3300047323 Bacteria 2416
512 Ga0495683_0077943 3300047323 Bacteria 1619
513 Ga0495687_001366 3300047443 Bacteria 22552
514 Ga0495687_002446 3300047443 Bacteria 14911
515 Ga0495687_005004 3300047443 Bacteria 8659
516 Ga0495675_0095401 3300047444 Bacteria 1865
517 Ga0495677_0002912 3300047445 Bacteria 6661
518 Ga0495679_018277 3300047446 Bacteria 2492
519 Ga0495679_128422 3300047446 Bacteria 689
520 Ga0495685_018729 3300047447 Bacteria 2377
521 Ga0495673_0001574 3300047469 Bacteria 17893
522 Ga0495673_0005451 3300047469 Bacteria 7689
523 Ga0495673_0005619 3300047469 Bacteria 7537
524 Ga0495673_0007416 3300047469 Bacteria 6307
525 Ga0495673_0020954 3300047469 Bacteria 3241
526 Ga0495673_0031003 3300047469 Bacteria 2506
527 Ga0495681_0001637 3300047470 Bacteria 16631
528 Ga0495681_0001661 3300047470 Bacteria 16502
529 Ga0495681_0042081 3300047470 Bacteria 2213
530 Ga0495684_0063662 3300047471 Bacteria 2803
531 Ga0495593_0008934 3300047673 Bacteria 5817
532 Ga0495593_0047716 3300047673 Bacteria 2277
533 Ga0495602_0010257 3300048088 Bacteria 9723
534 Ga0495602_0192465 3300048088 Bacteria 1562
535 Ga0495602_0308645 3300048088 Bacteria 1155
536 Ga0495626_0002000 3300048091 Bacteria 15046
537 Ga0495626_0002125 3300048091 Bacteria 14354
538 Ga0495626_0002657 3300048091 Bacteria 12129
539 Ga0495626_0019589 3300048091 Bacteria 3383
540 Ga0495626_0041491 3300048091 Bacteria 2166
541 Ga0496100_0193749 3300048903 Bacteria 1477
542 Ga0496102_0000428 3300048905 Bacteria 48609
543 Ga0496102_0005158 3300048905 Bacteria 11085
544 Ga0496102_0007116 3300048905 Bacteria 9554
545 Ga0496102_0475249 3300048905 Bacteria 1171
546 Ga0496103_0003929 3300048906 Bacteria 9035
547 Ga0496103_0016491 3300048906 Bacteria 4407
548 Ga0496103_0033664 3300048906 Bacteria 3131
549 Ga0496103_0088032 3300048906 Bacteria 1958
550 Ga0496104_0011766 3300048907 Bacteria 7850
551 Ga0496104_0086195 3300048907 Bacteria 2998
552 Ga0496104_0729289 3300048907 Bacteria 898
553 Ga0496105_0050594 3300048908 Bacteria 3432
554 Ga0496105_0300328 3300048908 Bacteria 1291
555 Ga0496106_0083839 3300048909 Bacteria 2452
556 Ga0496106_0133176 3300048909 Bacteria 1950
557 Ga0496106_0233265 3300048909 Bacteria 1470
558 Ga0496110_0241174 3300048913 Bacteria 1645
559 Ga0496112_0330103 3300048915 Bacteria 1469
560 Ga0496114_0265119 3300048917 Bacteria 1513
561 Ga0496114_0519237 3300048917 Bacteria 1053
562 Ga0496115_0000002 3300048918 Bacteria 365286
563 Ga0496115_0060537 3300048918 Bacteria 3051
564 Ga0496116_0000023 3300048919 Bacteria 475792
565 Ga0496116_0000288 3300048919 Bacteria 85510
566 Ga0496116_0001134 3300048919 Bacteria 31693
567 Ga0496116_0001634 3300048919 Bacteria 24666
568 Ga0496116_0001773 3300048919 Bacteria 23475
569 Ga0496116_0011727 3300048919 Bacteria 7221
570 Ga0496116_0013358 3300048919 Bacteria 6627
571 Ga0496116_0016138 3300048919 Bacteria 5862
572 Ga0496116_0032950 3300048919 Bacteria 3684
573 Ga0496116_0044660 3300048919 Bacteria 3007
574 Ga0496116_0110437 3300048919 Bacteria 1617
575 Ga0496117_0000017 3300048920 Bacteria 490421
576 Ga0496117_0000100 3300048920 Bacteria 194307
577 Ga0496117_0000881 3300048920 Bacteria 46286
578 Ga0496117_0001508 3300048920 Bacteria 33364
579 Ga0496117_0004279 3300048920 Bacteria 15907
580 Ga0496117_0004461 3300048920 Bacteria 15424
581 Ga0496117_0011254 3300048920 Bacteria 8030
582 Ga0496117_0015201 3300048920 Bacteria 6582
583 Ga0496117_0018488 3300048920 Bacteria 5766
584 Ga0496117_0094879 3300048920 Bacteria 1908
585 Ga0496117_0133557 3300048920 Bacteria 1499
586 Ga0496117_0156476 3300048920 Bacteria 1341
587 Ga0496117_0166625 3300048920 Bacteria 1284
588 Ga0496118_0000018 3300048921 Bacteria 490421
589 Ga0496118_0000446 3300048921 Bacteria 68504
590 Ga0496118_0006957 3300048921 Bacteria 12221
591 Ga0496118_0009591 3300048921 Bacteria 9744
592 Ga0496118_0010834 3300048921 Bacteria 8978
593 Ga0496118_0013425 3300048921 Bacteria 7749
594 Ga0496118_0018094 3300048921 Bacteria 6376
595 Ga0496118_0034507 3300048921 Bacteria 4125
596 Ga0496118_0040586 3300048921 Bacteria 3698
597 Ga0496118_0065795 3300048921 Bacteria 2650
598 Ga0496118_0075574 3300048921 Bacteria 2401
599 Ga0496118_0087713 3300048921 Bacteria 2156
600 Ga0496118_0092549 3300048921 Bacteria 2074
601 Ga0496119_0001520 3300048922 Bacteria 27728
602 Ga0496119_0004367 3300048922 Bacteria 14110
603 Ga0496119_0012369 3300048922 Bacteria 6938
604 Ga0496119_0018312 3300048922 Bacteria 5223
605 Ga0496119_0032896 3300048922 Bacteria 3449
606 Ga0496119_0046911 3300048922 Bacteria 2692
607 Ga0496119_0052103 3300048922 Bacteria 2509
608 Ga0496119_0063357 3300048922 Bacteria 2199
609 Ga0496120_0000756 3300048923 Bacteria 46775
610 Ga0496120_0000801 3300048923 Bacteria 45287
611 Ga0496120_0001475 3300048923 Bacteria 28007
612 Ga0496120_0005017 3300048923 Bacteria 10738
613 Ga0496120_0014607 3300048923 Bacteria 5223
614 Ga0496120_0024408 3300048923 Bacteria 3770
615 Ga0496120_0096834 3300048923 Bacteria 1566
616 Ga0496121_0000211 3300048924 Bacteria 127602
617 Ga0496121_0000492 3300048924 Bacteria 75747
618 Ga0496121_0003591 3300048924 Bacteria 21895
619 Ga0496121_0005934 3300048924 Bacteria 15449
620 Ga0496121_0010805 3300048924 Bacteria 10226
621 Ga0496121_0037631 3300048924 Bacteria 4295
622 Ga0496121_0054729 3300048924 Bacteria 3331
623 Ga0496121_0087045 3300048924 Bacteria 2453
624 Ga0496121_0102898 3300048924 Bacteria 2198
625 Ga0496121_0136054 3300048924 Bacteria 1830
626 Ga0496122_0000021 3300048925 Bacteria 391363
627 Ga0496122_0000545 3300048925 Bacteria 77927
628 Ga0496122_0000562 3300048925 Bacteria 75980
629 Ga0496122_0004076 3300048925 Bacteria 18525
630 Ga0496122_0004697 3300048925 Bacteria 16777
631 Ga0496122_0006570 3300048925 Bacteria 13285
632 Ga0496122_0006988 3300048925 Bacteria 12706
633 Ga0496122_0008314 3300048925 Bacteria 11239
634 Ga0496122_0010774 3300048925 Bacteria 9376
635 Ga0496122_0011919 3300048925 Bacteria 8730
636 Ga0496122_0035536 3300048925 Bacteria 4050
637 Ga0496122_0055189 3300048925 Bacteria 2975
638 Ga0496122_0266583 3300048925 Bacteria 946
639 Ga0496122_0298673 3300048925 Bacteria 870
640 Ga0496122_0382034 3300048925 Bacteria 722
641 Ga0496123_0000174 3300048926 Bacteria 130310
642 Ga0496123_0000189 3300048926 Bacteria 124719
643 Ga0496123_0000200 3300048926 Bacteria 122026
644 Ga0496123_0000422 3300048926 Bacteria 76364
645 Ga0496123_0002636 3300048926 Bacteria 21745
646 Ga0496123_0003370 3300048926 Bacteria 18067
647 Ga0496123_0007219 3300048926 Bacteria 10543
648 Ga0496123_0012939 3300048926 Bacteria 7055
649 Ga0496123_0055453 3300048926 Bacteria 2600
650 Ga0496123_0082051 3300048926 Bacteria 1956
651 Ga0496123_0084639 3300048926 Bacteria 1911
652 Ga0496123_0105772 3300048926 Bacteria 1623
653 Ga0496123_0182337 3300048926 Bacteria 1095
654 Ga0496124_0000017 3300048927 Bacteria 444389
655 Ga0496124_0000066 3300048927 Bacteria 222815
656 Ga0496124_0001331 3300048927 Bacteria 37099
657 Ga0496124_0003122 3300048927 Bacteria 20551
658 Ga0496124_0019070 3300048927 Bacteria 6400
659 Ga0496124_0042147 3300048927 Bacteria 3932
660 Ga0496124_0047710 3300048927 Bacteria 3663
661 Ga0496124_0057366 3300048927 Bacteria 3281
662 Ga0496124_0141951 3300048927 Bacteria 1894
663 Ga0496124_0669032 3300048927 Bacteria 663
664 Ga0496125_0000005 3300048928 Bacteria 827598
665 Ga0496125_0000033 3300048928 Bacteria 351850
666 Ga0496125_0000355 3300048928 Bacteria 86577
667 Ga0496125_0002571 3300048928 Bacteria 23376
668 Ga0496125_0003383 3300048928 Bacteria 19409
669 Ga0496125_0005826 3300048928 Bacteria 13538
670 Ga0496125_0011365 3300048928 Bacteria 8912
671 Ga0496125_0013660 3300048928 Bacteria 7970
672 Ga0496125_0014405 3300048928 Bacteria 7703
673 Ga0496125_0018498 3300048928 Bacteria 6617
674 Ga0496125_0028466 3300048928 Bacteria 5046
675 Ga0496125_0049392 3300048928 Bacteria 3496
676 Ga0496125_0082792 3300048928 Bacteria 2444
677 Ga0496125_0098545 3300048928 Bacteria 2162
678 Ga0496126_0000052 3300048929 Bacteria 312383
679 Ga0496126_0003448 3300048929 Bacteria 19958
680 Ga0496126_0004528 3300048929 Bacteria 16534
681 Ga0496126_0048458 3300048929 Bacteria 3882
682 Ga0496126_0053397 3300048929 Bacteria 3667
683 Ga0496126_0193057 3300048929 Bacteria 1724
684 Ga0496126_0882501 3300048929 Bacteria 679
685 Ga0496126_0959556 3300048929 Bacteria 644
686 Ga0495678_001326 3300049459 Bacteria 19844
687 Ga0495678_007820 3300049459 Bacteria 5497
688 Ga0495678_022628 3300049459 Bacteria 2745
689 Ga0495682_0004466 3300049460 Bacteria 5976
690 Ga0495682_0044143 3300049460 Bacteria 1631
691 Ga0501032_0245916 3300049569 Bacteria 1162
692 Ga0501038_0170851 3300049574 Bacteria 1760
693 Ga0501039_0035498 3300049575 Bacteria 3847
694 Ga0501040_0003234 3300049576 Bacteria 10542
695 Ga0501041_0008304 3300049577 Bacteria 6112
696 Ga0501046_0072609 3300049580 Bacteria 2671
697 Ga0501048_0073813 3300049582 Bacteria 2407
698 Ga0501071_0146295 3300049587 Bacteria 1762
699 Ga0501072_0002188 3300049588 Bacteria 14605
700 Ga0501073_0041080 3300049589 Bacteria 3269
701 Ga0501074_0016923 3300049590 Bacteria 5290
702 Ga0501075_0042153 3300049591 Bacteria 3421
703 Ga0501076_0030268 3300049592 Bacteria 4215
704 Ga0501077_0000947 3300049593 Bacteria 17478
705 Ga0501249_005345 3300049679 Bacteria 2627
706 Ga0501079_0078556 3300049741 Bacteria 2552
707 Ga0501080_0008005 3300049742 Bacteria 9579
708 Ga0501080_0372279 3300049742 Bacteria 1288
709 Ga0501081_0206530 3300049743 Bacteria 1425
710 Ga0501083_0031956 3300049744 Bacteria 3611
711 Ga0501269_000165 3300049766 Bacteria 20359
712 Ga0501045_0015814 3300049824 Bacteria 5351
713 nmdc:mga03683_105454_c1 3300050489 Bacteria 1242
714 nmdc:mga00v17_368287_c1 3300050491 Bacteria 934
715 nmdc:mga0sz30_12993_c1 3300050516 Bacteria 3251
716 Ga0495601_0001480 3300053077 Bacteria 12956
717 Ga0500595_005107 3300053119 Bacteria 5761
718 Ga0500618_005498 3300053125 Bacteria 3839
719 Ga0500573_0230181 3300053140 Bacteria 967
720 Ga0500616_0139173 3300053153 Bacteria 1137
721 Ga0500619_003223 3300053154 Bacteria 3301
722 Ga0500634_0000240 3300053161 Bacteria 17898
723 Ga0500567_022233 3300053723 Bacteria 3037
724 Ga0501084_0008006 3300054114 Bacteria 8702
725 Ga0501082_0008685 3300060353 Bacteria 8760
726 2506577717 2506520007 Bacteria 5442880
727 2506582855 2506520008 Bacteria 5443009
728 2508851648 2508501071 Bacteria 5454741
729 2511265187 2511231006 Bacteria 6794709
730 2511270056 2511231007 Bacteria 6306603
731 2511298565 2511231011 Bacteria 6149768
732 2512329022 2512047018 Bacteria 6663241
733 2555258092 2554235234 Bacteria 5762085
734 2583794086 2582580891 Bacteria 6800976
735 2597859679 2597489887 Bacteria 6666321
736 2599335378 2599185156 Bacteria 5403036
737 2599400058 2599185167 Bacteria 6353609
738 2599452878 2599185179 Bacteria 6611171
739 2599482508 2599185185 Bacteria 6652270
740 2599514512 2599185190 Bacteria 6285678
741 2599520594 2599185191 Bacteria 6297582
742 2599611734 2599185212 Bacteria 6765997
743 2599803771 2599185257 Bacteria 6492581
744 2599884669 2599185289 Bacteria 6778765
745 2599893888 2599185290 Bacteria 6289611
746 2599896152 2599185291 Bacteria 6775623
747 2599905578 2599185292 Bacteria 6290804
748 2599958038 2599185305 Bacteria 6748700
749 2599968839 2599185306 Bacteria 6637356
750 2599980039 2599185308 Bacteria 6621546
751 2599992753 2599185311 Bacteria 6354990
752 2600003876 2599185313 Bacteria 6658188
753 2600013919 2599185314 Bacteria 6621749
754 2600015761 2599185315 Bacteria 6771107
755 2600028150 2599185317 Bacteria 6435722
756 2600034052 2599185318 Bacteria 6961590
757 2600040429 2599185319 Bacteria 6637840
758 2600050968 2599185321 Bacteria 6764560
759 2600058586 2599185322 Bacteria 6763055
760 2600063433 2599185323 Bacteria 6688755
761 2600069044 2599185324 Bacteria 6590677
762 2600357401 2600254930 Bacteria 6431253
763 2600364581 2600254931 Bacteria 6734225
764 2601533053 2600255256 Bacteria 5597742
765 2601538420 2600255257 Bacteria 5597196
766 2601612987 2600255279 Bacteria 5605316
767 2601749721 2600255308 Bacteria 5611129
768 2601756766 2600255310 Bacteria 5600903
769 2601761779 2600255311 Bacteria 5598766
770 2603641395 2602042046 Bacteria 5483348
771 2603643466 2602042047 Bacteria 4697674
772 2624490643 2623620446 Bacteria 6500345
773 2637225200 2636415599 Bacteria 5718434
774 2643802664 2643221556 Bacteria 7251154
775 2644281169 2643221650 Bacteria 7029547
776 2644472169 2643221684 Bacteria 7145183
777 2652546449 2651869719 Bacteria 6047974
778 2656278600 2654587920 Bacteria 5475511
779 2671088846 2667528170 Bacteria 6786960
780 2671102355 2667528172 Bacteria 5170840
781 2671110503 2667528173 Bacteria 5375747
782 2671118275 2667528175 Bacteria 7532676
783 2671124894 2667528176 Bacteria 6724917
784 2671584465 2671180115 Bacteria 5353919
785 2671770660 2671180172 Bacteria 6495783
786 2677897741 2675903420 Bacteria 6247433
787 2681995800 2681812866 Bacteria 4552357
788 2682007628 2681812869 Bacteria 5014465
789 2689444252 2687453601 Bacteria 5546041
790 2715752637 2713897148 Bacteria 5883533
791 2718634927 2718217725 Bacteria 5758958
792 2735835141 2734482264 Unclassified 5014763
793 2738879425 2738541307 Bacteria 8606193
794 2739196790 2738543004 Bacteria 6381073
795 2743739217 2740892503 Bacteria 6855563
796 2753855020 2751185917 Bacteria 4551186
797 2765579663 2765235840 Bacteria 4663337
798 2765587908 2765235842 Bacteria 4799256
799 2774122336 2773857670 Bacteria 6407454
800 2774133196 2773857673 Bacteria 6513460
801 2775541728 2775506706 Bacteria 4873073
802 2777022792 2775507074 Bacteria 5532402
803 2784262943 2784132063 Bacteria 6262788
804 2784316174 2784132072 Bacteria 6596533
805 2808857763 2808606361 Bacteria 6136259
806 2808921601 2808606376 Bacteria 6248667
807 2808937956 2808606378 Bacteria 6177535
808 2808943722 2808606380 Bacteria 6248705
809 2808966270 2808606383 Bacteria 6138645
810 2808979555 2808606385 Bacteria 6711065
811 2808995175 2808606388 Bacteria 6706662
812 2809001162 2808606389 Bacteria 6138126
813 2813727256 2811995292 Bacteria 5303342
814 2814694789 2814123068 Bacteria 5687681
815 2819544164 2818991436 Bacteria 5376622
816 2819655989 2818991456 Bacteria 6123676
817 2821446389 2821443989 Bacteria 7658172
818 2823376996 2823373977 Bacteria 4779415
819 2825652174 2825651385 Bacteria 6715909
820 2834031470 2834028612 Bacteria 6354979
821 2842846999 2842843487 Bacteria 6004777
822 2842928210 2842922631 Bacteria 5824079
823 2844539383 2844533157 Bacteria 7517899
824 2852612684 2852612431 Bacteria 6885235
825 2852669580 2852667396 Bacteria 6885555
826 2858951784 2858950400 Bacteria 6783797
827 2860341167 2860339153 Bacteria 6846989
828 2869553562 2869551831 Bacteria 5474685
829 2880234866 2880230671 Bacteria 6140320
830 2888368316 2888366609 Bacteria 5155009
831 2904477000 2904474040 Bacteria 5504324
832 2904513911 2904513164 Bacteria 5476410
833 2904522282 2904518522 Bacteria 6068986
834 2908451503 2908446538 Bacteria 6829095
835 2908670262 2908669403 Bacteria 5740494
836 2919109335 2919108558 Bacteria 5897419
837 2919153167 2919150387 Bacteria 5500879
838 2919492759 2919487758 Bacteria 5929766
839 2919701839 2919697872 Bacteria 6553725
840 2923158299 2923153595 Bacteria 6870622
841 2927143793 2927143783 Bacteria 5504251
842 2927835063 2927833300 Bacteria 4923934
843 2929194086 2929189879 Bacteria 5930554
844 2931374990 2931369376 Bacteria 6847892
845 2931395381 2931390751 Bacteria 6273349
846 2931396902 2931396565 Bacteria 7251677
847 2937542991 2937539931 Bacteria 4639830
848 2941483403
849 2945965484 2945961074 Bacteria 7342064
850 2969082196 2969079654 Bacteria 5439582
851 2971823893 2971820967 Bacteria 5823634
852 2974313170 2974310843 Bacteria 4947816
853 2984287880 2984286254 Bacteria 6702062
854 2984564638 2984559226 Bacteria 5683096
855 2984597367 2984595703 Bacteria 5682994
856 2988730314 2988728565 Bacteria 6124362
857 3007397591 3007395558 Bacteria 6755444
858 3007424742 3007419365 Bacteria 7026924
859 3007516080 3007511990 Bacteria 6481491
860 3007615091 3007614139 Bacteria 6053559
861 3007861673 3007861166 Bacteria 6045338
862 640937211 640753048 Bacteria 5495657
863 8002290929 8002285264 Bacteria 6717907
864 8015692386 8015687852 Bacteria 6613826
865 8019780637 8019775933 Bacteria 6858656
866 8054291053 8054285046 Bacteria 6919322
867 8055775605 8055770955 Bacteria 6827675
868 8055822859 8055817908 Bacteria 6609162
869 8056136272 8056131705 Bacteria 6107031
870 8056174661 8056172158 Bacteria 6133900
871 8056692367 8056689827 Bacteria 6712655
872 Ga0495616_0001804
873 MRS2a_Contig_1351
874 MRS2a_Contig_27077
875 MRS2a_Contig_339
876 SwRhRL2b_contig_783059
877 JGI24739J22299_10097095
878 JGI25162J39368_1000038
879 JGI25162J39368_1000092
880 JGI25162J39368_1000231
881 JGI25162J39368_1002383
882 JGI25163J39215_1000013
883 JGI25163J39215_1000504
884 JGI25164J39214_1000071
885 JGI25164J39214_1000179
886 JGI25151J46595_10000559
887 JGI25151J46595_10000719
888 JGI25165J46597_1000045
889 JGI25165J46597_1000327
890 JGI25153J46596_10039030
891 rootH2_10110653
892 rootL2_10018643
893 rootL2_10155604
894 JGI25160J50197_1004440
895 Ga0055538_1000022
896 Ga0055538_1000064
897 Ga0055539_1000028
898 Ga0055539_1000098
899 Ga0055533_1000036
900 Ga0055533_1000108
901 Ga0055525_1000071
902 Ga0055525_1000141
903 Ga0055525_1007489
904 Ga0055530_10000105
905 Ga0055530_10000256
906 Ga0055540_1001478
907 Ga0055541_1000037
908 Ga0055541_1000065
909 Ga0058692_1000135
910 Ga0058692_1014160
911 Ga0065703_1021008
912 Ga0065714_10000495
913 Ga0065714_10069538
914 Ga0065704_10000285
915 Ga0065704_10004692
916 Ga0065712_10006415
917 Ga0065715_10028109
918 Ga0070658_10190676
919 Ga0070676_10097935
920 Ga0070690_100724861
921 Ga0070670_100000161
922 Ga0070670_100000221
923 Ga0070670_100325150
924 Ga0068869_100466195
925 Ga0070666_10248026
926 Ga0068868_100355727
927 Ga0070661_100000640
928 Ga0070668_100034128
929 Ga0070669_100000299
930 Ga0070675_100216966
931 Ga0070673_100177993
932 Ga0070688_100428084
933 Ga0070667_100321849
934 Ga0070662_100001026
935 Ga0070662_100098528
936 Ga0070662_100207068
937 Ga0070684_100414485
938 Ga0068853_100033799
939 Ga0068853_100472424
940 Ga0070672_100045412
941 Ga0070693_100096092
942 Ga0070665_100039980
943 Ga0068855_100059616
944 Ga0070664_100000489
945 Ga0070664_100146767
946 Ga0068857_100667298
947 Ga0068854_100008186
948 Ga0068856_100057337
949 Ga0068856_100192049
950 Ga0068859_100556123
951 Ga0068851_10000036
952 Ga0068870_10402166
953 Ga0068860_100551405
954 Ga0081540_1049520
955 Ga0070717_10085800
956 Ga0075364_10009886
957 Ga0075364_10062388
958 Ga0075432_10000389
959 Ga0075432_10084063
960 Ga0075369_10028270
961 Ga0068865_100017011
962 Ga0097620_100556117
963 Ga0079104_1005087
964 Ga0079104_1057562
965 Ga0099794_10000054
966 Ga0105251_10000109
967 Ga0105251_10000632
968 Ga0105251_10002446
969 Ga0105251_10002477
970 Ga0105251_10004209
971 Ga0105251_10005496
972 Ga0105251_10007551
973 Ga0105251_10112568
974 Ga0105251_10138322
975 Ga0105251_10232389
976 Ga0105244_10000690
977 Ga0105244_10001260
978 Ga0105244_10001623
979 Ga0105244_10002664
980 Ga0105244_10006790
981 Ga0105244_10007221
982 Ga0105244_10036931
983 Ga0105244_10051389
984 Ga0105244_10052630
985 Ga0105244_10161982
986 Ga0105250_10000980
987 Ga0105250_10001610
988 Ga0105250_10003840
989 Ga0105250_10020674
990 Ga0105240_10021162
991 Ga0105240_10040554
992 Ga0105240_10076396
993 Ga0105247_10000025
994 Ga0105243_10006244
995 Ga0105243_10135564
996 Ga0105241_10000005
997 Ga0105242_10000238
998 Ga0105242_10566113
999 Ga0105239_10001431
1000 Ga0105239_10770933
1001 Ga0105246_10210134
1002 Ga0105246_10684597
1003 Ga0157373_10004421
1004 Ga0157373_10005271
1005 Ga0157373_10005861
1006 Ga0157373_10007988
1007 Ga0157373_10179482
1008 Ga0157371_10003359
1009 Ga0157371_10259645
1010 Ga0157371_10264236
1011 Ga0157370_10024387
1012 Ga0157370_10060151
1013 Ga0157370_10070146
1014 Ga0157370_10100182
1015 Ga0157370_10204410
1016 Ga0157370_10238850
1017 Ga0157370_10250296
1018 Ga0157370_10272285
1019 Ga0157370_10451491
1020 Ga0157370_10981132
1021 Ga0157369_10000646
1022 Ga0157369_10005544
1023 Ga0157369_10007554
1024 Ga0157369_10009657
1025 Ga0157369_10064490
1026 Ga0157369_10093023
1027 Ga0157369_10249118
1028 Ga0157374_10035668
1029 Ga0157372_10003765
1030 Ga0157372_10008148
1031 Ga0157372_10141186
1032 Ga0157372_10205989
1033 Ga0157372_10664017
1034 Ga0157375_10000979
1035 Ga0157375_10011925
1036 Ga0157375_10186611
1037 Ga0163163_10829545
1038 Ga0182008_10000753
1039 Ga0182008_10001764
1040 Ga0182008_10002169
1041 Ga0182008_10002354
1042 Ga0182008_10016078
1043 Ga0157376_10035314
1044 Ga0182006_1002148
1045 Ga0182006_1007173
1046 Ga0182006_1007195
1047 Ga0182007_10002918
1048 Ga0182007_10003477
1049 Ga0182005_1000928
1050 Ga0182005_1002531
1051 Ga0183366_1001
1052 Ga0183370_1001
1053 Ga0183369_1001
1054 Ga0183368_1001
1055 Ga0163161_10000001
1056 Ga0163161_10037352
1057 Ga0163161_10057629
1058 Ga0163161_10136388
1059 Ga0163161_10365862
1060 Ga0209760_100189
1061 Ga0209760_100257
1062 Ga0209760_102005
1063 Ga0209784_100001
1064 Ga0209784_100036
1065 Ga0209566_100001
1066 Ga0209566_100044
1067 Ga0209674_100002
1068 Ga0209674_100065
1069 Ga0209563_100002
1070 Ga0209563_100063
1071 Ga0209563_101321
1072 Ga0207427_100008
1073 Ga0207427_100020
1074 Ga0207427_100664
1075 Ga0209437_100001
1076 Ga0209437_100014
1077 Ga0209437_100032
1078 Ga0209437_100082
1079 Ga0209677_100002
1080 Ga0209677_100038
1081 Ga0209233_1000008
1082 Ga0209233_1000109
1083 Ga0209130_1000436
1084 Ga0209676_1000006
1085 Ga0209025_1000099
1086 Ga0209758_1001714
1087 Ga0209050_1000070
1088 Ga0207426_1000065
1089 Ga0209051_1000093
1090 Ga0207697_10133950
1091 Ga0207656_10000021
1092 Ga0207696_1000001
1093 Ga0207696_1000073
1094 Ga0207696_1002951
1095 Ga0207696_1026790
1096 Ga0207655_1000021
1097 Ga0207655_1000060
1098 Ga0207655_1000595
1099 Ga0207655_1000679
1100 Ga0207655_1001849
1101 Ga0207655_1001923
1102 Ga0207655_1002280
1103 Ga0207655_1002998
1104 Ga0207655_1010672
1105 Ga0207655_1019953
1106 Ga0207655_1023432
1107 Ga0207713_1000003
1108 Ga0207713_1000011
1109 Ga0207713_1000092
1110 Ga0207713_1000142
1111 Ga0207713_1000671
1112 Ga0207713_1002192
1113 Ga0207713_1010307
1114 Ga0207713_1014047
1115 Ga0207713_1014492
1116 Ga0207713_1014499
1117 Ga0207713_1015037
1118 Ga0207713_1017844
1119 Ga0207713_1033314
1120 Ga0207710_10000074
1121 Ga0207645_10128755
1122 Ga0207643_10277292
1123 Ga0207705_10265352
1124 Ga0207654_10000007
1125 Ga0207695_10065987
1126 Ga0207671_10000263
1127 Ga0207649_10000288
1128 Ga0207681_10001287
1129 Ga0207650_10000191
1130 Ga0207650_10000194
1131 Ga0207650_10259019
1132 Ga0207650_10351626
1133 Ga0207659_10096672
1134 Ga0207706_10000493
1135 Ga0207706_10012239
1136 Ga0207706_10259521
1137 Ga0207686_10011944
1138 Ga0207709_10027877
1139 Ga0207709_10193879
1140 Ga0207704_10102824
1141 Ga0207691_10028446
1142 Ga0207689_10245149
1143 Ga0207679_10000226
1144 Ga0207679_10164444
1145 Ga0207667_10071345
1146 Ga0207640_10035714
1147 Ga0207658_10546123
1148 Ga0207639_10014082
1149 Ga0207639_10699654
1150 Ga0207702_10001503
1151 Ga0207702_10586018
1152 Ga0207648_10332758
1153 Ga0207674_10001166
1154 Ga0207698_10194869
1155 Ga0209281_1000027
1156 Ga0209281_1001505
1157 Ga0209371_1000001
1158 Ga0209371_1000471
1159 Ga0209371_1017128
1160 Ga0209282_1000093
1161 Ga0209588_1000017
1162 Ga0207428_10115187
1163 Ga0207428_10134967
1164 Ga0207428_10400031
1165 Ga0268266_10206371
1166 Ga0268264_11014095
1167 Ga0307517_10067934
1168 Ga0268256_1000001
1169 Ga0268256_1000057
1170 Ga0268256_1000398
1171 Ga0268256_1019079
1172 Ga0265328_10082971
1173 Ga0307509_10151367
1174 Ga0307516_10030996
1175 Ga0307412_10005500
1176 Ga0395899_0004173
1177 Ga0395900_0013792
1178 Ga0436365_1060686
1179 Ga0439438_036176
1180 Ga0439447_001156
1181 Ga0439447_023131
1182 Ga0439466_0000953
1183 Ga0439466_0002095
1184 Ga0439466_0078346
1185 Ga0439451_000970
1186 Ga0439451_046280
1187 Ga0439452_000126
1188 Ga0439452_015882
1189 Ga0439456_016540
1190 Ga0439463_000047
1191 Ga0450903_008180
1192 Ga0450889_002580
1193 Ga0439464_0016738
1194 Ga0439460_0040485
1195 Ga0450893_0003281
1196 Ga0439440_0010531
1197 Ga0466972_0006635
1198 Ga0466989_0173783
1199 Ga0466965_0093015
1200 Ga0466961_0101325
1201 Ga0466963_0275197
1202 Ga0466964_0002273
1203 Ga0453684_0421915
1204 Ga0466968_0138534
1205 Ga0466970_0190841
1206 Ga0466960_0028244
1207 Ga0495617_000028
1208 Ga0495617_000408
1209 Ga0495617_002126
1210 Ga0495617_018492
1211 Ga0495617_023670
1212 Ga0495627_000018
1213 Ga0495627_021434
1214 Ga0495603_0399956
1215 Ga0495590_0000901
1216 Ga0495590_0009751
1217 Ga0495590_0035907
1218 Ga0495591_003722
1219 Ga0495591_112969
1220 Ga0495638_0012816
1221 Ga0495638_0020181
1222 Ga0495638_0197554
1223 Ga0495651_0167561
1224 Ga0495653_0006143
1225 Ga0495650_0000043
1226 Ga0495650_0002158
1227 Ga0495650_0002618
1228 Ga0495650_0004589
1229 Ga0495650_0005525
1230 Ga0495580_0244028
1231 Ga0495605_0004566
1232 Ga0495605_0022108
1233 Ga0495605_0055809
1234 Ga0495605_0069888
1235 Ga0495639_0000633
1236 Ga0495639_0013803
1237 Ga0495584_0001297
1238 Ga0495584_0001499
1239 Ga0495584_0019448
1240 Ga0495585_0022219
1241 Ga0495585_0065684
1242 Ga0495585_0306652
1243 Ga0495594_0016635
1244 Ga0495594_0022850
1245 Ga0495596_0006155
1246 Ga0495607_0000411
1247 Ga0495607_0002094
1248 Ga0495607_0003292
1249 Ga0495607_0007091
1250 Ga0495607_0008369
1251 Ga0495607_0333335
1252 Ga0495583_0003439
1253 Ga0495583_0012803
1254 Ga0495606_0002737
1255 Ga0495606_0024403
1256 Ga0495606_0043657
1257 Ga0495606_0174073
1258 Ga0495606_0212949
1259 Ga0495610_0006447
1260 Ga0495610_0012908
1261 Ga0495610_0050457
1262 Ga0495610_0108460
1263 Ga0495610_0114039
1264 Ga0495616_0021597
1265 Ga0495620_0000046
1266 Ga0495628_0010287
1267 Ga0495631_0000955
1268 Ga0495631_0013652
1269 Ga0495631_0179313
1270 Ga0495632_0001104
1271 Ga0495632_0001282
1272 Ga0495637_0006805
1273 Ga0495637_0022452
1274 Ga0495637_0024071
1275 Ga0495637_0056948
1276 Ga0495643_0014773
1277 Ga0495644_0012139
1278 Ga0495648_0015363
1279 Ga0495648_0019072
1280 Ga0495648_0021049
1281 Ga0495648_0021473
1282 Ga0495648_0038353
1283 Ga0495648_0042482
1284 Ga0495666_0033975
1285 Ga0495666_0076812
1286 Ga0495666_0102266
1287 Ga0495666_0112604
1288 Ga0495642_0006583
1289 Ga0495642_0089350
1290 Ga0495654_0002150
1291 Ga0495654_0002557
1292 Ga0495654_0006797
1293 Ga0495654_0008007
1294 Ga0495654_0044893
1295 Ga0495654_0059304
1296 Ga0495654_0061363
1297 Ga0495587_0021564
1298 Ga0495609_0007194
1299 Ga0495609_0169133
1300 Ga0495597_0028178
1301 Ga0495597_0130342
1302 Ga0495645_0066398
1303 Ga0495622_0001748
1304 Ga0495622_0002064
1305 Ga0495622_0024138
1306 Ga0495633_0017145
1307 Ga0495656_0000711
1308 Ga0495656_0047448
1309 Ga0495634_0001752
1310 Ga0495634_0051353
1311 Ga0495611_0012475
1312 Ga0495625_0004335
1313 Ga0495635_0003099
1314 Ga0495659_0000475
1315 Ga0495659_0036981
1316 Ga0495659_0081086
1317 Ga0495661_0001671
1318 Ga0495661_0006087
1319 Ga0495661_0030769
1320 Ga0495661_0219835
1321 Ga0495661_0255204
1322 Ga0495588_0007357
1323 Ga0495588_0014823
1324 Ga0495588_0019900
1325 Ga0495588_0079503
1326 Ga0495588_0181880
1327 Ga0495657_0021569
1328 Ga0495599_0004928
1329 Ga0495623_0039302
1330 Ga0495646_0019001
1331 Ga0495646_0086198
1332 Ga0495669_0004695
1333 Ga0495613_0047415
1334 Ga0495613_0186496
1335 Ga0495624_0001741
1336 Ga0495624_0006025
1337 Ga0495670_0003382
1338 Ga0495670_0008205
1339 Ga0495670_0252554
1340 Ga0495670_0320234
1341 Ga0495671_0001718
1342 Ga0495671_0004099
1343 Ga0495671_0112379
1344 Ga0495649_0004079
1345 Ga0495649_0014473
1346 Ga0495649_0019636
1347 Ga0495649_0095766
1348 Ga0495649_0154753
1349 Ga0495589_0000002
1350 Ga0495589_0000316
1351 Ga0495589_0010734
1352 Ga0495589_0017529
1353 Ga0495589_0022296
1354 Ga0495589_0037035
1355 Ga0495589_0076528
1356 Ga0495600_0001683
1357 Ga0495600_0050069
1358 Ga0495660_0000014
1359 Ga0495660_0044853
1360 Ga0495660_0051843
1361 Ga0495660_0080886
1362 Ga0495581_0018253
1363 Ga0495604_0009622
1364 Ga0495604_0085933
1365 Ga0495604_0129159
1366 Ga0495636_0001719
1367 Ga0495636_0380132
1368 Ga0495674_0048328
1369 Ga0495672_0000466
1370 Ga0495672_0002548
1371 Ga0495672_0002855
1372 Ga0495672_0012988
1373 Ga0495672_0014231
1374 Ga0495672_0067189
1375 Ga0495672_0088478
1376 Ga0495672_0122834
1377 Ga0495680_0021857
1378 Ga0495680_0065001
1379 Ga0495683_0001064
1380 Ga0495683_0012748
1381 Ga0495683_0020550
1382 Ga0495683_0038618
1383 Ga0495683_0077943
1384 Ga0495687_001366
1385 Ga0495687_002446
1386 Ga0495687_005004
1387 Ga0495675_0095401
1388 Ga0495677_0002912
1389 Ga0495679_018277
1390 Ga0495679_128422
1391 Ga0495685_018729
1392 Ga0495673_0001574
1393 Ga0495673_0005451
1394 Ga0495673_0005619
1395 Ga0495673_0007416
1396 Ga0495673_0020954
1397 Ga0495673_0031003
1398 Ga0495681_0001637
1399 Ga0495681_0001661
1400 Ga0495681_0042081
1401 Ga0495684_0063662
1402 Ga0495593_0008934
1403 Ga0495593_0047716
1404 Ga0495602_0010257
1405 Ga0495602_0192465
1406 Ga0495602_0308645
1407 Ga0495626_0002000
1408 Ga0495626_0002125
1409 Ga0495626_0002657
1410 Ga0495626_0019589
1411 Ga0495626_0041491
1412 Ga0496100_0193749
1413 Ga0496102_0000428
1414 Ga0496102_0005158
1415 Ga0496102_0007116
1416 Ga0496102_0475249
1417 Ga0496103_0003929
1418 Ga0496103_0016491
1419 Ga0496103_0033664
1420 Ga0496103_0088032
1421 Ga0496104_0011766
1422 Ga0496104_0086195
1423 Ga0496104_0729289
1424 Ga0496105_0050594
1425 Ga0496105_0300328
1426 Ga0496106_0083839
1427 Ga0496106_0133176
1428 Ga0496106_0233265
1429 Ga0496110_0241174
1430 Ga0496112_0330103
1431 Ga0496114_0265119
1432 Ga0496114_0519237
1433 Ga0496115_0000002
1434 Ga0496115_0060537
1435 Ga0496116_0000023
1436 Ga0496116_0000288
1437 Ga0496116_0001134
1438 Ga0496116_0001634
1439 Ga0496116_0001773
1440 Ga0496116_0011727
1441 Ga0496116_0013358
1442 Ga0496116_0016138
1443 Ga0496116_0032950
1444 Ga0496116_0044660
1445 Ga0496116_0110437
1446 Ga0496117_0000017
1447 Ga0496117_0000100
1448 Ga0496117_0000881
1449 Ga0496117_0001508
1450 Ga0496117_0004279
1451 Ga0496117_0004461
1452 Ga0496117_0011254
1453 Ga0496117_0015201
1454 Ga0496117_0018488
1455 Ga0496117_0094879
1456 Ga0496117_0133557
1457 Ga0496117_0156476
1458 Ga0496117_0166625
1459 Ga0496118_0000018
1460 Ga0496118_0000446
1461 Ga0496118_0006957
1462 Ga0496118_0009591
1463 Ga0496118_0010834
1464 Ga0496118_0013425
1465 Ga0496118_0018094
1466 Ga0496118_0034507
1467 Ga0496118_0040586
1468 Ga0496118_0065795
1469 Ga0496118_0075574
1470 Ga0496118_0087713
1471 Ga0496118_0092549
1472 Ga0496119_0001520
1473 Ga0496119_0004367
1474 Ga0496119_0012369
1475 Ga0496119_0018312
1476 Ga0496119_0032896
1477 Ga0496119_0046911
1478 Ga0496119_0052103
1479 Ga0496119_0063357
1480 Ga0496120_0000756
1481 Ga0496120_0000801
1482 Ga0496120_0001475
1483 Ga0496120_0005017
1484 Ga0496120_0014607
1485 Ga0496120_0024408
1486 Ga0496120_0096834
1487 Ga0496121_0000211
1488 Ga0496121_0000492
1489 Ga0496121_0003591
1490 Ga0496121_0005934
1491 Ga0496121_0010805
1492 Ga0496121_0037631
1493 Ga0496121_0054729
1494 Ga0496121_0087045
1495 Ga0496121_0102898
1496 Ga0496121_0136054
1497 Ga0496122_0000021
1498 Ga0496122_0000545
1499 Ga0496122_0000562
1500 Ga0496122_0004076
1501 Ga0496122_0004697
1502 Ga0496122_0006570
1503 Ga0496122_0006988
1504 Ga0496122_0008314
1505 Ga0496122_0010774
1506 Ga0496122_0011919
1507 Ga0496122_0035536
1508 Ga0496122_0055189
1509 Ga0496122_0266583
1510 Ga0496122_0298673
1511 Ga0496122_0382034
1512 Ga0496123_0000174
1513 Ga0496123_0000189
1514 Ga0496123_0000200
1515 Ga0496123_0000422
1516 Ga0496123_0002636
1517 Ga0496123_0003370
1518 Ga0496123_0007219
1519 Ga0496123_0012939
1520 Ga0496123_0055453
1521 Ga0496123_0082051
1522 Ga0496123_0084639
1523 Ga0496123_0105772
1524 Ga0496123_0182337
1525 Ga0496124_0000017
1526 Ga0496124_0000066
1527 Ga0496124_0001331
1528 Ga0496124_0003122
1529 Ga0496124_0019070
1530 Ga0496124_0042147
1531 Ga0496124_0047710
1532 Ga0496124_0057366
1533 Ga0496124_0141951
1534 Ga0496124_0669032
1535 Ga0496125_0000005
1536 Ga0496125_0000033
1537 Ga0496125_0000355
1538 Ga0496125_0002571
1539 Ga0496125_0003383
1540 Ga0496125_0005826
1541 Ga0496125_0011365
1542 Ga0496125_0013660
1543 Ga0496125_0014405
1544 Ga0496125_0018498
1545 Ga0496125_0028466
1546 Ga0496125_0049392
1547 Ga0496125_0082792
1548 Ga0496125_0098545
1549 Ga0496126_0000052
1550 Ga0496126_0003448
1551 Ga0496126_0004528
1552 Ga0496126_0048458
1553 Ga0496126_0053397
1554 Ga0496126_0193057
1555 Ga0496126_0882501
1556 Ga0496126_0959556
1557 Ga0495678_001326
1558 Ga0495678_007820
1559 Ga0495678_022628
1560 Ga0495682_0004466
1561 Ga0495682_0044143
1562 Ga0501032_0245916
1563 Ga0501038_0170851
1564 Ga0501039_0035498
1565 Ga0501040_0003234
1566 Ga0501041_0008304
1567 Ga0501046_0072609
1568 Ga0501048_0073813
1569 Ga0501071_0146295
1570 Ga0501072_0002188
1571 Ga0501073_0041080
1572 Ga0501074_0016923
1573 Ga0501075_0042153
1574 Ga0501076_0030268
1575 Ga0501077_0000947
1576 Ga0501249_005345
1577 Ga0501079_0078556
1578 Ga0501080_0008005
1579 Ga0501080_0372279
1580 Ga0501081_0206530
1581 Ga0501083_0031956
1582 Ga0501269_000165
1583 Ga0501045_0015814
1584 nmdc:mga03683_105454_c1
1585 nmdc:mga00v17_368287_c1
1586 nmdc:mga0sz30_12993_c1
1587 Ga0495601_0001480
1588 Ga0500595_005107
1589 Ga0500618_005498
1590 Ga0500573_0230181
1591 Ga0500616_0139173
1592 Ga0500619_003223
1593 Ga0500634_0000240
1594 Ga0500567_022233
1595 Ga0501084_0008006
1596 Ga0501082_0008685
1597 2506577717
1598 2506582855
1599 2508851648
1600 2511265187
1601 2511270056
1602 2511298565
1603 2512329022
1604 2555258092
1605 2583794086
1606 2597859679
1607 2599335378
1608 2599400058
1609 2599452878
1610 2599482508
1611 2599514512
1612 2599520594
1613 2599611734
1614 2599803771
1615 2599884669
1616 2599893888
1617 2599896152
1618 2599905578
1619 2599958038
1620 2599968839
1621 2599980039
1622 2599992753
1623 2600003876
1624 2600013919
1625 2600015761
1626 2600028150
1627 2600034052
1628 2600040429
1629 2600050968
1630 2600058586
1631 2600063433
1632 2600069044
1633 2600357401
1634 2600364581
1635 2601533053
1636 2601538420
1637 2601612987
1638 2601749721
1639 2601756766
1640 2601761779
1641 2603641395
1642 2603643466
1643 2624490643
1644 2637225200
1645 2643802664
1646 2644281169
1647 2644472169
1648 2652546449
1649 2656278600
1650 2671088846
1651 2671102355
1652 2671110503
1653 2671118275
1654 2671124894
1655 2671584465
1656 2671770660
1657 2677897741
1658 2681995800
1659 2682007628
1660 2689444252
1661 2715752637
1662 2718634927
1663 2735835141
1664 2738879425
1665 2739196790
1666 2743739217
1667 2753855020
1668 2765579663
1669 2765587908
1670 2774122336
1671 2774133196
1672 2775541728
1673 2777022792
1674 2784262943
1675 2784316174
1676 2808857763
1677 2808921601
1678 2808937956
1679 2808943722
1680 2808966270
1681 2808979555
1682 2808995175
1683 2809001162
1684 2813727256
1685 2814694789
1686 2819544164
1687 2819655989
1688 2821446389
1689 2823376996
1690 2825652174
1691 2834031470
1692 2842846999
1693 2842928210
1694 2844539383
1695 2852612684
1696 2852669580
1697 2858951784
1698 2860341167
1699 2869553562
1700 2880234866
1701 2888368316
1702 2904477000
1703 2904513911
1704 2904522282
1705 2908451503
1706 2908670262
1707 2919109335
1708 2919153167
1709 2919492759
1710 2919701839
1711 2923158299
1712 2927143793
1713 2927835063
1714 2929194086
1715 2931374990
1716 2931395381
1717 2931396902
1718 2937542991
1719 2941483403
1720 2945965484
1721 2969082196
1722 2971823893
1723 2974313170
1724 2984287880
1725 2984564638
1726 2984597367
1727 2988730314
1728 3007397591
1729 3007424742
1730 3007516080
1731 3007615091
1732 3007861673
1733 640937211
1734 8002290929
1735 8015692386
1736 8019780637
1737 8054291053
1738 8055775605
1739 8055822859
1740 8056136272
1741 8056174661
1742 8056692367

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

1

75

0.95

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

9

76

0.95

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

113

188

0.93

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

11

81

0.88

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

110

197

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3uap-assembly1.cif.gz_A crystal structure of glutathione transferase (target efi-501774) from methylococcus capsulatus str. bath 0.9819 2 199
1pmt-assembly1.cif.gz_A glutathione transferase from proteus mirabilis 0.9816 1 198
2dsa-assembly2.cif.gz_C ternary complex of bphk, a bacterial gst 0.9815 1 200
1f2e-assembly1.cif.gz_A structure of sphingomonad, glutathione s-transferase complexed with glutathione 0.9725 1 199
4gci-assembly1.cif.gz_B crystal structure of glutahtione s-transferase homolog from yersinia pestis, target efi-501894, with bound glutathione, monoclinic form 0.9707 2 200
ID Description Score Start End Superfamily
2dsaC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9922 1 82 3.40.30.10
2dsaD02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9789 83 188 1.20.1050.10
2gdrB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9749 83 188 1.20.1050.10
2dsaC02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9727 83 188 1.20.1050.10
2gdrF02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9726 83 188 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A2J4XVA0-F1-model_v4 Glutathione transferase GstA 0.9939 1 108 GO:0016740
AF-A0A1I1I7F4-F1-model_v4 Glutathione S-transferase 0.9913 1 199 GO:0016740
AF-A0A1I3YP29-F1-model_v4 deleted 0.9912 2 200
AF-A0A1T4LTD2-F1-model_v4 Glutathione S-transferase 0.9902 1 200 GO:0016740
AF-A0A011N0X2-F1-model_v4 Glutathione S-transferase GstA (EC 2.5.1.18) 0.9887 2 198 GO:0004364

Map