F484204

General Info

Members Datasets Scaffolds Average Seq Length
871 416 805 229

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0046679|Ga0501035_0046679_2914_3705
Length 263
Sequence VIAHPFPRPHHLRVTLDLKLGRGRTIDGMTITEQRTQTYGYSDLPGLMGLMTGDEKHGPAATSTLDVLWVLYDRVLRVGPDSADAPGRDRFLLSKGHGPMAYYAVLAAKGFLPADWLPGFSSYDSPLGHHPDRTLVPGVEIGSGSLGHGLPIAVGTALGLRAQGLHDPAVWTLIGDAELDEGSNHEAIAFAGPAGLDRLHTVVVDNSSASYARPGGIAARFEAAGWAARTVDGRDHDALYAAFTAPHPGRPHVVVARVEPKNA

Samples

Sample ID Description Type Environment
1 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
2 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
3 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
4 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
5 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
6 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
7 2643221548 Streptomyces sp. Root55 Isolate Unclassified
8 2643221578 Streptomyces sp. Root63 Isolate Unclassified
9 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
10 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
11 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
12 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
13 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
14 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
15 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
16 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
17 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
18 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
19 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
20 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
21 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
22 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
23 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
24 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
25 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
26 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
27 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
28 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
29 2862574272 Streptomyces sp. AcE210 Isolate Nodule
30 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
31 2867369537 Streptomyces sp. Z26 Isolate Unclassified
32 2867428634 Streptomyces sp. RP5T Isolate Unclassified
33 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
34 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
35 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
36 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
37 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
38 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
39 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
40 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
41 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
42 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
43 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
44 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
45 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
46 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
47 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
48 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
49 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
50 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
51 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
52 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
53 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
54 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
55 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
56 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
57 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
58 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
60 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
61 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
62 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
63 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
64 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
65 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
66 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
67 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
70 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
71 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
72 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
73 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
74 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
75 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
76 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
77 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
78 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
79 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
80 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
81 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
82 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
83 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
84 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
85 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
86 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
87 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
99 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
100 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
101 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
102 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
103 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
104 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
107 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
108 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
109 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
110 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
113 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
136 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
182 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
183 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
184 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
185 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
186 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
187 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
188 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
191 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
192 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
193 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
194 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
195 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
200 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
201 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
202 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
203 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
210 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
223 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
224 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
225 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
226 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
227 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
228 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
229 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
230 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
231 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
232 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
233 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
234 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
235 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
236 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
237 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
238 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
239 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
240 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
241 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
242 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
243 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
244 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
245 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
246 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
247 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
248 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
249 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
250 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
251 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
252 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
253 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
254 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
255 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
256 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
257 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
260 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
261 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
262 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
263 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
264 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
265 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
266 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
267 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
268 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
269 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
270 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
271 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
272 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
273 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
276 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
277 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
278 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
279 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
280 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
281 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
282 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
283 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
284 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
285 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
286 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
287 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
288 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
289 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
290 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
291 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
292 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
293 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
294 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
295 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
296 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
297 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
298 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
299 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
300 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
301 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
302 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
303 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
304 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
305 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
306 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
307 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
308 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
309 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
310 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
311 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
312 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
313 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
314 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
315 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
316 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
317 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
318 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
319 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
320 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
321 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
322 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
323 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
324 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
325 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
326 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
327 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
328 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
329 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
330 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
331 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
332 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
333 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
334 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
335 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
336 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
337 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
338 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
339 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
340 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
341 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
342 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
343 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
344 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
345 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
346 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
347 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
348 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
349 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
350 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
364 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
365 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
366 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
367 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
368 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
369 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
370 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
371 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
372 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
373 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
374 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
375 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
376 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
377 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
378 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
381 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
382 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
383 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
384 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
385 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
386 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
387 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
388 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
389 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
390 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
391 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
392 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
393 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
394 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
395 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
396 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
397 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
398 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
399 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
400 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
401 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
402 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
403 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
404 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
405 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
406 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
407 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
408 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
409 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
410 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
411 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
412 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
413 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
414 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
415 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
416 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.39
Metatranscriptomes 0.8
Isolates 7.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.92
Nodule 0.34
Rhizoplane 3.67
Rhizosphere 86.8
Stem 0
Stem Tuber 0
Unclassified 8.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10041079 3300003316 Bacteria 2974
2 rootH1_10041079 3300003323 Bacteria 7321
3 rootH2_10014028 3300003320 Bacteria 5668
4 rootH2_10125902 3300003320 Bacteria 2570
5 rootH1_10000628 3300003323 Bacteria 10860
6 rootH1_10039347 3300003316 Bacteria 17782
7 rootH1_10039347 3300003323 Bacteria 1765
8 rootH1_10093147 3300003323 Bacteria 2461
9 JGI25160J50197_1017047 3300003354 Bacteria 2317
10 JGI25407J50210_10007407 3300003373 Bacteria 2748
11 Ga0070658_10127072 3300005327 Bacteria 2122
12 Ga0070683_100078557 3300005329 Bacteria 3087
13 Ga0070683_100098482 3300005329 Bacteria 2752
14 Ga0070683_100415034 3300005329 Bacteria 1284
15 Ga0068868_100220600 3300005338 Bacteria 1587
16 Ga0070660_100085794 3300005339 Bacteria 2477
17 Ga0070660_100277059 3300005339 Bacteria 1372
18 Ga0070661_100156503 3300005344 Bacteria 1724
19 Ga0070661_100231090 3300005344 Bacteria 1421
20 Ga0070661_100252855 3300005344 Bacteria 1360
21 Ga0070661_100350152 3300005344 Bacteria 1159
22 Ga0070692_10061483 3300005345 Bacteria 1980
23 Ga0070692_10151247 3300005345 Bacteria 1322
24 Ga0070668_100000654 3300005347 Bacteria 23449
25 Ga0070675_100510288 3300005354 Bacteria 1084
26 Ga0070674_100287931 3300005356 Bacteria 1305
27 Ga0070659_100575541 3300005366 Bacteria 966
28 Ga0070709_10020372 3300005434 Bacteria 3847
29 Ga0070709_10061975 3300005434 Bacteria 2383
30 Ga0070709_10088572 3300005434 Bacteria 2036
31 Ga0070709_10443303 3300005434 Bacteria 977
32 Ga0070709_10570442 3300005434 Bacteria 868
33 Ga0070714_100003898 3300005435 Bacteria 11212
34 Ga0070714_100004647 3300005435 Bacteria 10363
35 Ga0070714_100004987 3300005435 Bacteria 10091
36 Ga0070714_100046062 3300005435 Bacteria 3698
37 Ga0070714_100097787 3300005435 Bacteria 2581
38 Ga0070714_100297154 3300005435 Bacteria 1504
39 Ga0070714_100411550 3300005435 Bacteria 1280
40 Ga0070714_100648059 3300005435 Bacteria 1017
41 Ga0070714_101164355 3300005435 Bacteria 752
42 Ga0070713_100010129 3300005436 Bacteria 6798
43 Ga0070713_100017234 3300005436 Bacteria 5457
44 Ga0070713_100291471 3300005436 Bacteria 1500
45 Ga0070710_10000044 3300005437 Bacteria 58112
46 Ga0070710_10000818 3300005437 Bacteria 14979
47 Ga0070710_10026061 3300005437 Bacteria 3102
48 Ga0070711_100007336 3300005439 Bacteria 6709
49 Ga0070711_100198319 3300005439 Bacteria 1547
50 Ga0070711_100471871 3300005439 Bacteria 1030
51 Ga0070705_100273482 3300005440 Bacteria 1197
52 Ga0070705_100517345 3300005440 Bacteria 909
53 Ga0070694_100024596 3300005444 Bacteria 3888
54 Ga0070694_100146697 3300005444 Bacteria 1719
55 Ga0070708_100022119 3300005445 Bacteria 5389
56 Ga0070708_100203359 3300005445 Bacteria 1854
57 Ga0070663_100000249 3300005455 Bacteria 27248
58 Ga0070663_100109548 3300005455 Bacteria 2073
59 Ga0070678_100221563 3300005456 Bacteria 1573
60 Ga0070678_100386459 3300005456 Bacteria 1212
61 Ga0070678_100499511 3300005456 Bacteria 1073
62 Ga0070681_10012815 3300005458 Bacteria 8322
63 Ga0070681_10075300 3300005458 Bacteria 3335
64 Ga0070681_10235076 3300005458 Bacteria 1747
65 Ga0070681_10398382 3300005458 Bacteria 1288
66 Ga0070685_10476091 3300005466 Bacteria 879
67 Ga0070706_100007732 3300005467 Bacteria 10053
68 Ga0070707_100007169 3300005468 Bacteria 10338
69 Ga0070707_100042733 3300005468 Bacteria 4339
70 Ga0070707_100124832 3300005468 Bacteria 2500
71 Ga0070698_100003266 3300005471 Bacteria 17815
72 Ga0070699_100374721 3300005518 Bacteria 1284
73 Ga0070699_100402406 3300005518 Bacteria 1238
74 Ga0070679_100029541 3300005530 Bacteria 5409
75 Ga0070679_100060535 3300005530 Bacteria 3773
76 Ga0070679_100173536 3300005530 Bacteria 2128
77 Ga0070679_100270356 3300005530 Bacteria 1654
78 Ga0070684_100179038 3300005535 Bacteria 1927
79 Ga0070697_100017778 3300005536 Bacteria 5599
80 Ga0068853_100149931 3300005539 Bacteria 2099
81 Ga0068853_100271296 3300005539 Bacteria 1562
82 Ga0070686_100150353 3300005544 Bacteria 1630
83 Ga0070686_100193517 3300005544 Bacteria 1453
84 Ga0070686_100255985 3300005544 Bacteria 1281
85 Ga0070665_100001537 3300005548 Bacteria 26667
86 Ga0070665_100058138 3300005548 Bacteria 3877
87 Ga0070704_100007703 3300005549 Bacteria 6418
88 Ga0068855_100039742 3300005563 Bacteria 5585
89 Ga0068857_100073213 3300005577 Bacteria 3052
90 Ga0068854_100101835 3300005578 Bacteria 2154
91 Ga0068854_100114116 3300005578 Bacteria 2042
92 Ga0068854_100143513 3300005578 Bacteria 1834
93 Ga0068854_100216504 3300005578 Bacteria 1513
94 Ga0068854_100436146 3300005578 Bacteria 1091
95 Ga0068856_100024430 3300005614 Bacteria 5883
96 Ga0068856_100145850 3300005614 Bacteria 2374
97 Ga0068856_100163980 3300005614 Bacteria 2233
98 Ga0068856_100201100 3300005614 Bacteria 2007
99 Ga0068856_100529393 3300005614 Bacteria 1200
100 Ga0070702_100125197 3300005615 Bacteria 1615
101 Ga0068863_100253152 3300005841 Bacteria 1701
102 Ga0068863_100358061 3300005841 Bacteria 1422
103 Ga0081455_10000155 3300005937 Bacteria 82490
104 Ga0081455_10012770 3300005937 Bacteria 8351
105 Ga0081455_10061058 3300005937 Bacteria 3174
106 Ga0081455_10108634 3300005937 Bacteria 2209
107 Ga0081455_10181745 3300005937 Bacteria 1591
108 Ga0081538_10000092 3300005981 Bacteria 87123
109 Ga0081540_1011819 3300005983 Bacteria 5800
110 Ga0070717_10191264 3300006028 Bacteria 1788
111 Ga0070717_10274218 3300006028 Bacteria 1494
112 Ga0070717_10405128 3300006028 Bacteria 1226
113 Ga0070715_10000604 3300006163 Bacteria 9491
114 Ga0070715_10067979 3300006163 Bacteria 1583
115 Ga0070715_10250047 3300006163 Bacteria 926
116 Ga0070716_100014234 3300006173 Bacteria 4072
117 Ga0070716_100135036 3300006173 Bacteria 1565
118 Ga0070712_100001324 3300006175 Bacteria 15011
119 Ga0070712_100170326 3300006175 Bacteria 1689
120 Ga0097621_100026603 3300006237 Bacteria 4541
121 Ga0068871_100549039 3300006358 Bacteria 1046
122 Ga0075428_100105427 3300006844 Bacteria 3074
123 Ga0075430_100021727 3300006846 Bacteria 5454
124 Ga0075431_100001884 3300006847 Bacteria 19894
125 Ga0075431_100167210 3300006847 Bacteria 2260
126 Ga0075434_100080611 3300006871 Bacteria 3252
127 Ga0075434_100086392 3300006871 Bacteria 3136
128 Ga0075434_100587729 3300006871 Bacteria 1133
129 Ga0075429_100045340 3300006880 Bacteria 3825
130 Ga0075435_100026088 3300007076 Bacteria 4555
131 Ga0075435_100037406 3300007076 Bacteria 3864
132 Ga0075435_100277727 3300007076 Bacteria 1430
133 Ga0105250_10136370 3300009092 Bacteria 1015
134 Ga0105240_10296540 3300009093 Bacteria 1851
135 Ga0105240_10430336 3300009093 Bacteria 1481
136 Ga0111539_10041947 3300009094 Bacteria 5498
137 Ga0105245_10066020 3300009098 Bacteria 3274
138 Ga0105245_10329610 3300009098 Bacteria 1506
139 Ga0114129_10020245 3300009147 Bacteria 9469
140 Ga0114129_10037757 3300009147 Bacteria 6818
141 Ga0105243_10076132 3300009148 Bacteria 2725
142 Ga0105237_10138217 3300009545 Bacteria 2431
143 Ga0105237_10378399 3300009545 Bacteria 1420
144 Ga0105238_10047445 3300009551 Bacteria 4330
145 Ga0105238_10201226 3300009551 Bacteria 1967
146 Ga0105249_10004292 3300009553 Bacteria 12323
147 Ga0105249_10252720 3300009553 Bacteria 1748
148 Ga0105239_10048937 3300010375 Bacteria 4634
149 Ga0105239_10767357 3300010375 Bacteria 1104
150 Ga0105239_11177322 3300010375 Bacteria 883
151 Ga0105246_10457669 3300011119 Bacteria 1074
152 Ga0157371_10328289 3300013102 Bacteria 1111
153 Ga0157370_10025062 3300013104 Bacteria 5904
154 Ga0157370_10155952 3300013104 Bacteria 2124
155 Ga0157370_10325871 3300013104 Bacteria 1416
156 Ga0157369_10065615 3300013105 Bacteria 3906
157 Ga0157369_10232162 3300013105 Bacteria 1929
158 Ga0157369_10311976 3300013105 Bacteria 1635
159 Ga0157369_10404040 3300013105 Bacteria 1417
160 Ga0157369_10482019 3300013105 Bacteria 1284
161 Ga0157374_10017252 3300013296 Bacteria 6355
162 Ga0157374_10054840 3300013296 Bacteria 3719
163 Ga0157374_10482444 3300013296 Bacteria 1243
164 Ga0163162_10144977 3300013306 Bacteria 2490
165 Ga0163162_11237451 3300013306 Bacteria 848
166 Ga0157372_10153346 3300013307 Bacteria 2660
167 Ga0157372_10160400 3300013307 Bacteria 2599
168 Ga0157372_10592947 3300013307 Bacteria 1292
169 Ga0157372_10695616 3300013307 Bacteria 1183
170 Ga0157372_10733129 3300013307 Bacteria 1149
171 Ga0157372_10760570 3300013307 Bacteria 1126
172 Ga0157379_10008723 3300014968 Bacteria 8835
173 Ga0157376_10138658 3300014969 Bacteria 2179
174 Ga0206356_10181501 3300020070 Bacteria 928
175 Ga0206356_11179862 3300020070 Bacteria 2627
176 Ga0206350_11409316 3300020080 Bacteria 1538
177 Ga0206353_11671143 3300020082 Bacteria 1706
178 Ga0206353_11785731 3300020082 Bacteria 890
179 Ga0213875_10028304 3300021388 Bacteria 2663
180 Ga0224712_10046583 3300022467 Bacteria 1665
181 Ga0224712_10118669 3300022467 Bacteria 1143
182 Ga0207692_10000357 3300025898 Bacteria 15729
183 Ga0207692_10001795 3300025898 Bacteria 8137
184 Ga0207692_10054028 3300025898 Bacteria 2049
185 Ga0207692_10129548 3300025898 Bacteria 1423
186 Ga0207688_10017141 3300025901 Bacteria 3936
187 Ga0207647_10157646 3300025904 Bacteria 1325
188 Ga0207685_10000722 3300025905 Bacteria 5998
189 Ga0207685_10026039 3300025905 Bacteria 2028
190 Ga0207699_10001097 3300025906 Bacteria 12779
191 Ga0207699_10022227 3300025906 Bacteria 3433
192 Ga0207699_10044847 3300025906 Bacteria 2576
193 Ga0207699_10107805 3300025906 Bacteria 1780
194 Ga0207699_10443580 3300025906 Bacteria 930
195 Ga0207705_10081584 3300025909 Bacteria 2357
196 Ga0207684_10009868 3300025910 Bacteria 8426
197 Ga0207707_10046648 3300025912 Bacteria 3774
198 Ga0207707_10191122 3300025912 Bacteria 1786
199 Ga0207707_10362648 3300025912 Bacteria 1247
200 Ga0207695_10150512 3300025913 Bacteria 2266
201 Ga0207695_10425500 3300025913 Bacteria 1212
202 Ga0207671_10081911 3300025914 Bacteria 2421
203 Ga0207693_10001115 3300025915 Bacteria 24125
204 Ga0207663_10005008 3300025916 Bacteria 6646
205 Ga0207660_10015308 3300025917 Bacteria 5059
206 Ga0207660_10203761 3300025917 Bacteria 1546
207 Ga0207657_10011831 3300025919 Bacteria 8637
208 Ga0207649_10195361 3300025920 Bacteria 1426
209 Ga0207652_10011230 3300025921 Bacteria 7214
210 Ga0207652_10072444 3300025921 Bacteria 2996
211 Ga0207652_10243452 3300025921 Bacteria 1621
212 Ga0207652_10265087 3300025921 Bacteria 1550
213 Ga0207646_10000787 3300025922 Bacteria 41124
214 Ga0207646_10002366 3300025922 Bacteria 22286
215 Ga0207646_10003767 3300025922 Bacteria 16897
216 Ga0207646_10021628 3300025922 Bacteria 5938
217 Ga0207646_10182500 3300025922 Bacteria 1895
218 Ga0207646_10249254 3300025922 Bacteria 1604
219 Ga0207694_10105778 3300025924 Bacteria 2234
220 Ga0207694_10274510 3300025924 Bacteria 1383
221 Ga0207659_10238186 3300025926 Bacteria 1471
222 Ga0207687_10013714 3300025927 Bacteria 5291
223 Ga0207687_10171008 3300025927 Bacteria 1676
224 Ga0207687_10192374 3300025927 Bacteria 1589
225 Ga0207700_10000376 3300025928 Bacteria 26077
226 Ga0207700_10013007 3300025928 Bacteria 5394
227 Ga0207700_10140318 3300025928 Bacteria 1985
228 Ga0207700_10162732 3300025928 Bacteria 1854
229 Ga0207664_10000616 3300025929 Bacteria 24677
230 Ga0207664_10002754 3300025929 Bacteria 11668
231 Ga0207664_10009185 3300025929 Bacteria 6927
232 Ga0207664_10017979 3300025929 Bacteria 5194
233 Ga0207664_10078835 3300025929 Bacteria 2672
234 Ga0207664_10123149 3300025929 Bacteria 2173
235 Ga0207664_10534646 3300025929 Bacteria 1051
236 Ga0207644_10206426 3300025931 Bacteria 1552
237 Ga0207690_10013385 3300025932 Bacteria 4929
238 Ga0207690_10046792 3300025932 Bacteria 2867
239 Ga0207709_10278680 3300025935 Bacteria 1234
240 Ga0207665_10001058 3300025939 Bacteria 18527
241 Ga0207665_10006091 3300025939 Bacteria 8010
242 Ga0207665_10075499 3300025939 Bacteria 2309
243 Ga0207661_10024764 3300025944 Bacteria 4553
244 Ga0207661_10066131 3300025944 Bacteria 2936
245 Ga0207661_10119079 3300025944 Bacteria 2246
246 Ga0207661_10661363 3300025944 Bacteria 960
247 Ga0207667_10048763 3300025949 Bacteria 4476
248 Ga0207712_10013163 3300025961 Bacteria 5302
249 Ga0207668_10047899 3300025972 Bacteria 2929
250 Ga0207640_10177664 3300025981 Bacteria 1593
251 Ga0207640_10208579 3300025981 Bacteria 1486
252 Ga0207640_10565608 3300025981 Bacteria 957
253 Ga0207640_10667565 3300025981 Bacteria 887
254 Ga0207677_10466142 3300026023 Bacteria 1085
255 Ga0207677_10495280 3300026023 Bacteria 1055
256 Ga0207639_10262899 3300026041 Bacteria 1510
257 Ga0207639_10581040 3300026041 Bacteria 1031
258 Ga0207639_10622121 3300026041 Bacteria 997
259 Ga0207678_10000065 3300026067 Bacteria 83028
260 Ga0207678_10062607 3300026067 Bacteria 3197
261 Ga0207678_10064141 3300026067 Bacteria 3156
262 Ga0207702_10123146 3300026078 Bacteria 2323
263 Ga0207702_10179579 3300026078 Bacteria 1948
264 Ga0207702_10432098 3300026078 Bacteria 1275
265 Ga0207702_10760291 3300026078 Bacteria 957
266 Ga0207702_10904689 3300026078 Bacteria 874
267 Ga0207641_10042899 3300026088 Bacteria 3797
268 Ga0207648_11080995 3300026089 Bacteria 752
269 Ga0207676_10102595 3300026095 Bacteria 2375
270 Ga0207674_10032175 3300026116 Bacteria 5502
271 Ga0207674_10060394 3300026116 Bacteria 3834
272 Ga0207675_100608683 3300026118 Bacteria 1096
273 Ga0207683_10187873 3300026121 Bacteria 1875
274 Ga0207683_10290806 3300026121 Bacteria 1494
275 Ga0207698_10431311 3300026142 Bacteria 1267
276 Ga0268266_10003180 3300028379 Bacteria 16659
277 Ga0268266_10071603 3300028379 Bacteria 3005
278 Ga0268266_10272672 3300028379 Bacteria 1571
279 Ga0268266_10700459 3300028379 Bacteria 976
280 Ga0268266_10722210 3300028379 Bacteria 961
281 Ga0268264_10485720 3300028381 Bacteria 1202
282 Ga0265336_10005555 3300028666 Bacteria 4640
283 Ga0307517_10012612 3300028786 Bacteria 11575
284 Ga0307515_10000287 3300028794 Bacteria 123976
285 Ga0307515_10057382 3300028794 Bacteria 5635
286 Ga0307515_10285340 3300028794 Bacteria 1353
287 Ga0265338_10008871 3300028800 Bacteria 12124
288 Ga0307511_10001720 3300030521 Bacteria 23047
289 Ga0307511_10065316 3300030521 Bacteria 2725
290 Ga0307512_10031261 3300030522 Bacteria 4614
291 Ga0307512_10073303 3300030522 Bacteria 2523
292 Ga0307512_10116505 3300030522 Bacteria 1736
293 Ga0307512_10164737 3300030522 Bacteria 1288
294 Ga0314311_1039871 3300030733 Bacteria 9000
295 Ga0316180_1027963 3300030736 Bacteria 2277
296 Ga0307513_10004055 3300031456 Bacteria 19633
297 Ga0307513_10222279 3300031456 Bacteria 1708
298 Ga0307513_10279780 3300031456 Bacteria 1446
299 Ga0307509_10050413 3300031507 Bacteria 4457
300 Ga0307509_10373441 3300031507 Bacteria 1141
301 Ga0307508_10036278 3300031616 Bacteria 4439
302 Ga0307514_10027128 3300031649 Bacteria 4628
303 Ga0307514_10130321 3300031649 Bacteria 1733
304 Ga0307516_10035339 3300031730 Bacteria 5015
305 Ga0307516_10044287 3300031730 Bacteria 4404
306 Ga0307518_10000187 3300031838 Bacteria 47022
307 Ga0307518_10016155 3300031838 Bacteria 5346
308 Ga0307407_10063280 3300031903 Bacteria 2170
309 Ga0307409_100025807 3300031995 Bacteria 4130
310 Ga0307409_100501832 3300031995 Bacteria 1182
311 Ga0307416_100215184 3300032002 Bacteria 1837
312 Ga0307415_100154126 3300032126 Bacteria 1772
313 Ga0307415_100158083 3300032126 Bacteria 1753
314 Ga0307507_10010287 3300033179 Bacteria 12137
315 Ga0307507_10031670 3300033179 Bacteria 5544
316 Ga0307507_10047750 3300033179 Bacteria 4175
317 Ga0307510_10000644 3300033180 Bacteria 35417
318 Ga0307510_10112929 3300033180 Bacteria 2452
319 Ga0373934_0010252 3300035086 Bacteria 3518
320 Ga0373934_0137327 3300035086 Bacteria 999
321 Ga0373944_0006890 3300035089 Bacteria 3033
322 Ga0373936_0212412 3300035113 Bacteria 856
323 Ga0373953_0019808 3300035117 Bacteria 2508
324 Ga0373954_0054426 3300035118 Bacteria 1882
325 Ga0373956_0011043 3300035119 Bacteria 3719
326 Ga0373956_0122307 3300035119 Bacteria 1216
327 Ga0373957_0041995 3300035120 Bacteria 1724
328 Ga0373943_0019277 3300035170 Bacteria 3136
329 Ga0373955_0359489 3300035172 Bacteria 882
330 Ga0373924_0024459 3300035410 Bacteria 2380
331 Ga0373935_0087985 3300035692 Bacteria 2029
332 Ga0373933_0077075 3300035724 Bacteria 2037
333 Ga0373947_0371043 3300035725 Bacteria 962
334 Ga0373937_0009708 3300036401 Bacteria 8389
335 Ga0373937_0024043 3300036401 Bacteria 5493
336 Ga0373937_0135353 3300036401 Bacteria 2304
337 Ga0373925_0004007 3300037068 Bacteria 11206
338 Ga0373925_0118650 3300037068 Bacteria 2051
339 Ga0395899_0323570 3300037312 Bacteria 1038
340 Ga0395900_0528046 3300037418 Bacteria 1127
341 Ga0395898_0007795 3300037466 Bacteria 11365
342 Ga0395898_0194689 3300037466 Bacteria 1937
343 Ga0395898_0247181 3300037466 Bacteria 1701
344 Ga0436364_1360402 3300037853 Bacteria 2658
345 Ga0395901_0186849 3300038443 Bacteria 2173
346 Ga0395901_0235728 3300038443 Bacteria 1910
347 Ga0436365_0278358 3300039437 Bacteria 4336
348 Ga0439436_0004403 3300041404 Bacteria 4312
349 Ga0439436_0016465 3300041404 Bacteria 2217
350 Ga0439436_0032644 3300041404 Bacteria 1509
351 Ga0439438_042727 3300041405 Bacteria 1172
352 Ga0439439_0003198 3300041406 Bacteria 3588
353 Ga0439439_0010488 3300041406 Bacteria 2216
354 Ga0451802_1162497 3300041460 Bacteria 831
355 Ga0451837_1577462 3300041494 Bacteria 2969
356 Ga0451853_1404968 3300041512 Bacteria 3970
357 Ga0451853_2550968 3300041512 Bacteria 2847
358 Ga0439433_0001272 3300041999 Bacteria 5209
359 Ga0439442_009247 3300042002 Bacteria 1993
360 Ga0439442_023112 3300042002 Bacteria 1292
361 Ga0439442_039778 3300042002 Bacteria 986
362 Ga0439448_0041472 3300042005 Bacteria 1489
363 Ga0439432_085318 3300042006 Bacteria 953
364 Ga0439449_0093824 3300042007 Bacteria 1108
365 Ga0439457_001153 3300042014 Bacteria 7949
366 Ga0439462_0095769 3300042015 Bacteria 816
367 Ga0450900_023064 3300042136 Bacteria 877
368 Ga0450903_000178 3300042138 Bacteria 13985
369 Ga0439446_0023092 3300042156 Bacteria 1767
370 Ga0439458_0000694 3300042157 Bacteria 8705
371 Ga0466969_0017309 3300044656 Bacteria 3765
372 Ga0466972_0007816 3300044658 Bacteria 5365
373 Ga0466972_0012228 3300044658 Bacteria 4315
374 Ga0466972_0014301 3300044658 Bacteria 3976
375 Ga0466972_0023889 3300044658 Bacteria 3037
376 Ga0466965_0000544 3300044683 Bacteria 13582
377 Ga0466965_0027756 3300044683 Bacteria 2748
378 Ga0466965_0071861 3300044683 Bacteria 1741
379 Ga0466965_0081301 3300044683 Bacteria 1638
380 Ga0466966_0010560 3300044684 Bacteria 6138
381 Ga0466966_0012306 3300044684 Bacteria 5669
382 Ga0466966_0118121 3300044684 Unclassified 1631
383 Ga0466961_0016316 3300044693 Bacteria 4770
384 Ga0466961_0107037 3300044693 Bacteria 1760
385 Ga0466961_0370172 3300044693 Unclassified 871
386 Ga0466961_0388562 3300044693 Bacteria 847
387 Ga0466963_0026338 3300044694 Bacteria 3718
388 Ga0466963_0036762 3300044694 Bacteria 3194
389 Ga0466963_0057304 3300044694 Bacteria 2595
390 Ga0466963_0117072 3300044694 Bacteria 1831
391 Ga0466964_0052239 3300044706 Bacteria 1680
392 Ga0466964_0134798 3300044706 Bacteria 1129
393 Ga0466971_0002653 3300044719 Bacteria 7553
394 Ga0466971_0009135 3300044719 Bacteria 4334
395 Ga0466968_0001070 3300044735 Bacteria 9698
396 Ga0466968_0005233 3300044735 Bacteria 4860
397 Ga0466968_0083235 3300044735 Bacteria 1409
398 Ga0466968_0124218 3300044735 Bacteria 1170
399 Ga0466970_0001010 3300044765 Bacteria 13557
400 Ga0466970_0017784 3300044765 Bacteria 3675
401 Ga0466970_0066150 3300044765 Bacteria 1940
402 Ga0466970_0119208 3300044765 Bacteria 1445
403 Ga0466970_0119308 3300044765 Bacteria 1444
404 Ga0466970_0143464 3300044765 Bacteria 1316
405 Ga0466970_0221070 3300044765 Bacteria 1057
406 Ga0466970_0252014 3300044765 Bacteria 989
407 Ga0466957_0006437 3300044842 Bacteria 6631
408 Ga0466957_0042974 3300044842 Bacteria 2735
409 Ga0466957_0065104 3300044842 Bacteria 2244
410 Ga0466957_0110442 3300044842 Bacteria 1743
411 Ga0466957_0198397 3300044842 Bacteria 1317
412 Ga0466960_0003032 3300044901 Bacteria 6411
413 Ga0466960_0008740 3300044901 Bacteria 4157
414 Ga0466959_0107109 3300045049 Bacteria 1998
415 Ga0466958_0000718 3300045836 Bacteria 14480
416 Ga0466958_0033825 3300045836 Bacteria 3047
417 Ga0466958_0049358 3300045836 Bacteria 2546
418 Ga0466958_0104637 3300045836 Bacteria 1763
419 Ga0466958_0109359 3300045836 Bacteria 1725
420 Ga0466958_0156201 3300045836 Bacteria 1440
421 Ga0466958_0226848 3300045836 Bacteria 1192
422 Ga0466967_0026337 3300045976 Bacteria 4815
423 Ga0466967_0076001 3300045976 Bacteria 3020
424 Ga0466967_0206357 3300045976 Bacteria 1863
425 Ga0466967_0231742 3300045976 Bacteria 1758
426 Ga0466967_0233958 3300045976 Bacteria 1750
427 Ga0466967_0272735 3300045976 Bacteria 1621
428 Ga0466967_0345556 3300045976 Bacteria 1439
429 Ga0466967_0899349 3300045976 Bacteria 880
430 Ga0495617_049616 3300046452 Bacteria 1396
431 Ga0495592_0013138 3300046454 Bacteria 6302
432 Ga0495592_0017645 3300046454 Bacteria 5424
433 Ga0495592_0032833 3300046454 Bacteria 3915
434 Ga0495592_0168274 3300046454 Bacteria 1502
435 Ga0495592_0278936 3300046454 Bacteria 1094
436 Ga0495603_0000038 3300046455 Bacteria 56885
437 Ga0495603_0005963 3300046455 Bacteria 7286
438 Ga0495603_0033390 3300046455 Bacteria 3096
439 Ga0495603_0055304 3300046455 Bacteria 2351
440 Ga0495629_0005692 3300046459 Bacteria 9307
441 Ga0495629_0006176 3300046459 Bacteria 8897
442 Ga0495629_0020835 3300046459 Bacteria 4679
443 Ga0495629_0040143 3300046459 Bacteria 3292
444 Ga0495629_0125586 3300046459 Bacteria 1787
445 Ga0495629_0174973 3300046459 Bacteria 1489
446 Ga0495629_0335109 3300046459 Bacteria 1033
447 Ga0495638_0073293 3300046460 Bacteria 2090
448 Ga0495638_0197410 3300046460 Bacteria 1138
449 Ga0495651_0002692 3300046462 Bacteria 13787
450 Ga0495651_0007293 3300046462 Bacteria 8453
451 Ga0495651_0248148 3300046462 Bacteria 1217
452 Ga0495653_0077176 3300046463 Bacteria 2474
453 Ga0495650_0023768 3300046471 Bacteria 2910
454 Ga0495580_0069800 3300046472 Bacteria 2455
455 Ga0495580_0101543 3300046472 Bacteria 2000
456 Ga0495582_0039185 3300046473 Bacteria 2609
457 Ga0495605_0107843 3300046474 Bacteria 1274
458 Ga0495639_0021326 3300046475 Bacteria 2834
459 Ga0495662_0000436 3300046476 Bacteria 18733
460 Ga0495662_0022526 3300046476 Bacteria 3041
461 Ga0495662_0095002 3300046476 Bacteria 1456
462 Ga0495662_0099497 3300046476 Bacteria 1422
463 Ga0495662_0101616 3300046476 Bacteria 1406
464 Ga0495664_0013903 3300046477 Bacteria 4562
465 Ga0495664_0193671 3300046477 Bacteria 1232
466 Ga0495664_0378265 3300046477 Bacteria 851
467 Ga0495584_0114125 3300046491 Bacteria 1367
468 Ga0495594_0310521 3300046499 Bacteria 898
469 Ga0495594_0439404 3300046499 Bacteria 742
470 Ga0495596_0102831 3300046500 Bacteria 1110
471 Ga0495607_0037006 3300046501 Bacteria 2934
472 Ga0495583_0056746 3300046506 Bacteria 1764
473 Ga0495583_0100817 3300046506 Bacteria 1232
474 Ga0495606_0004135 3300046507 Bacteria 14728
475 Ga0495608_0000081 3300046511 Bacteria 69898
476 Ga0495608_0076379 3300046511 Bacteria 2182
477 Ga0495608_0187339 3300046511 Bacteria 1307
478 Ga0495608_0299594 3300046511 Bacteria 995
479 Ga0495610_0034625 3300046512 Bacteria 2600
480 Ga0495616_0020462 3300046513 Bacteria 3598
481 Ga0495618_0006775 3300046514 Bacteria 6939
482 Ga0495618_0043697 3300046514 Bacteria 2827
483 Ga0495618_0048910 3300046514 Bacteria 2670
484 Ga0495618_0172146 3300046514 Bacteria 1377
485 Ga0495620_0007810 3300046515 Bacteria 5778
486 Ga0495620_0007954 3300046515 Bacteria 5717
487 Ga0495628_0020871 3300046516 Bacteria 5396
488 Ga0495628_0022627 3300046516 Bacteria 5162
489 Ga0495628_0148447 3300046516 Bacteria 1786
490 Ga0495628_0470603 3300046516 Bacteria 910
491 Ga0495628_0537511 3300046516 Bacteria 840
492 Ga0495630_0081592 3300046517 Bacteria 2440
493 Ga0495631_0007379 3300046518 Bacteria 5593
494 Ga0495637_0061409 3300046520 Bacteria 1541
495 Ga0495643_0039751 3300046522 Bacteria 2571
496 Ga0495648_0078830 3300046524 Bacteria 1882
497 Ga0495666_0017841 3300046526 Bacteria 3535
498 Ga0495666_0073113 3300046526 Bacteria 1627
499 Ga0495666_0088084 3300046526 Bacteria 1466
500 Ga0495652_0006178 3300046529 Bacteria 11176
501 Ga0495652_0056716 3300046529 Bacteria 3325
502 Ga0495652_0181027 3300046529 Bacteria 1617
503 Ga0495652_0219301 3300046529 Bacteria 1430
504 Ga0495652_0282800 3300046529 Bacteria 1214
505 Ga0495652_0415896 3300046529 Bacteria 949
506 Ga0495665_0126182 3300046531 Bacteria 1340
507 Ga0495640_0003158 3300046533 Bacteria 13271
508 Ga0495640_0072507 3300046533 Bacteria 2307
509 Ga0495586_0059691 3300046535 Bacteria 2073
510 Ga0495586_0200905 3300046535 Bacteria 1130
511 Ga0495587_0020823 3300046536 Bacteria 4045
512 Ga0495587_0021932 3300046536 Bacteria 3937
513 Ga0495587_0051104 3300046536 Bacteria 2444
514 Ga0495587_0092203 3300046536 Bacteria 1749
515 Ga0495609_0079300 3300046538 Bacteria 1436
516 Ga0495597_0048292 3300046542 Bacteria 1883
517 Ga0495645_0012603 3300046543 Bacteria 5961
518 Ga0495645_0014612 3300046543 Bacteria 5574
519 Ga0495645_0014842 3300046543 Bacteria 5535
520 Ga0495645_0043465 3300046543 Bacteria 3277
521 Ga0495633_0045184 3300046558 Bacteria 2086
522 Ga0495667_0001808 3300046559 Bacteria 14207
523 Ga0495667_0047219 3300046559 Bacteria 2845
524 Ga0495667_0094568 3300046559 Bacteria 1935
525 Ga0495667_0119439 3300046559 Bacteria 1702
526 Ga0495667_0163470 3300046559 Bacteria 1431
527 Ga0495668_0062572 3300046616 Bacteria 2050
528 Ga0495668_0269848 3300046616 Bacteria 932
529 Ga0495634_0017179 3300046642 Bacteria 5167
530 Ga0495634_0022096 3300046642 Bacteria 4485
531 Ga0495634_0090584 3300046642 Bacteria 1986
532 Ga0495634_0369246 3300046642 Bacteria 856
533 Ga0495625_0007591 3300046660 Bacteria 9415
534 Ga0495625_0069062 3300046660 Bacteria 2483
535 Ga0495625_0139481 3300046660 Bacteria 1636
536 Ga0495635_0018440 3300046663 Bacteria 4869
537 Ga0495635_0031036 3300046663 Bacteria 3712
538 Ga0495635_0034588 3300046663 Bacteria 3505
539 Ga0495659_0144150 3300046664 Bacteria 953
540 Ga0495661_0005397 3300046665 Bacteria 9088
541 Ga0495588_0030614 3300046674 Bacteria 2705
542 Ga0495588_0279310 3300046674 Bacteria 880
543 Ga0495657_0018127 3300046675 Bacteria 5100
544 Ga0495657_0020166 3300046675 Bacteria 4795
545 Ga0495657_0118079 3300046675 Bacteria 1673
546 Ga0495599_0004232 3300046678 Bacteria 8481
547 Ga0495599_0394306 3300046678 Bacteria 825
548 Ga0495623_0013779 3300046679 Bacteria 5241
549 Ga0495623_0055675 3300046679 Bacteria 2492
550 Ga0495623_0091737 3300046679 Bacteria 1863
551 Ga0495623_0109229 3300046679 Bacteria 1678
552 Ga0495623_0112950 3300046679 Bacteria 1644
553 Ga0495646_0001725 3300046680 Bacteria 13115
554 Ga0495646_0045970 3300046680 Bacteria 2664
555 Ga0495646_0104388 3300046680 Bacteria 1620
556 Ga0495646_0213872 3300046680 Bacteria 1045
557 Ga0495647_0127657 3300046681 Bacteria 1075
558 Ga0495658_0060078 3300046683 Bacteria 2179
559 Ga0495658_0193310 3300046683 Bacteria 1266
560 Ga0495613_0003220 3300046689 Bacteria 12219
561 Ga0495613_0006178 3300046689 Bacteria 8964
562 Ga0495613_0006739 3300046689 Bacteria 8578
563 Ga0495624_0014308 3300046690 Bacteria 5387
564 Ga0495624_0075002 3300046690 Bacteria 2101
565 Ga0495624_0263790 3300046690 Bacteria 1041
566 Ga0495624_0362501 3300046690 Bacteria 871
567 Ga0495670_0135427 3300046691 Bacteria 1286
568 Ga0495649_0165816 3300046694 Bacteria 1157
569 Ga0495589_0052307 3300046794 Bacteria 2018
570 Ga0495589_0058130 3300046794 Bacteria 1902
571 Ga0495589_0227350 3300046794 Bacteria 875
572 Ga0495600_0014821 3300046809 Bacteria 4917
573 Ga0495600_0053305 3300046809 Bacteria 2641
574 Ga0495600_0054859 3300046809 Bacteria 2603
575 Ga0495600_0076318 3300046809 Bacteria 2188
576 Ga0495600_0110322 3300046809 Bacteria 1791
577 Ga0495660_0132716 3300046810 Bacteria 1247
578 Ga0495581_0025349 3300047315 Bacteria 3438
579 Ga0495604_0001681 3300047317 Bacteria 18210
580 Ga0495604_0008372 3300047317 Bacteria 8177
581 Ga0495604_0016027 3300047317 Bacteria 5985
582 Ga0495604_0016764 3300047317 Bacteria 5860
583 Ga0495604_0020734 3300047317 Bacteria 5248
584 Ga0495604_0082937 3300047317 Bacteria 2396
585 Ga0495604_0167809 3300047317 Bacteria 1546
586 Ga0495636_0000492 3300047318 Bacteria 14555
587 Ga0495674_0037074 3300047319 Bacteria 4383
588 Ga0495674_0120604 3300047319 Bacteria 2215
589 Ga0495674_0179803 3300047319 Bacteria 1762
590 Ga0495674_0619876 3300047319 Bacteria 855
591 Ga0495672_0238441 3300047320 Bacteria 889
592 Ga0495676_0001378 3300047321 Bacteria 20945
593 Ga0495676_0016397 3300047321 Bacteria 6579
594 Ga0495676_0026048 3300047321 Bacteria 5039
595 Ga0495676_0055392 3300047321 Bacteria 3144
596 Ga0495676_0063378 3300047321 Bacteria 2881
597 Ga0495680_0002145 3300047322 Bacteria 20477
598 Ga0495680_0010272 3300047322 Bacteria 8351
599 Ga0495680_0027595 3300047322 Bacteria 4662
600 Ga0495680_0300721 3300047322 Bacteria 1126
601 Ga0495683_0057405 3300047323 Bacteria 1935
602 Ga0495683_0081415 3300047323 Bacteria 1578
603 Ga0495687_001283 3300047443 Bacteria 23656
604 Ga0495687_016780 3300047443 Bacteria 3672
605 Ga0495687_023981 3300047443 Bacteria 2907
606 Ga0495687_073012 3300047443 Bacteria 1368
607 Ga0495675_0004402 3300047444 Bacteria 8523
608 Ga0495675_0011001 3300047444 Bacteria 5671
609 Ga0495675_0027857 3300047444 Bacteria 3601
610 Ga0495675_0031352 3300047444 Bacteria 3393
611 Ga0495675_0254291 3300047444 Bacteria 1054
612 Ga0495677_0094727 3300047445 Bacteria 1127
613 Ga0495685_009381 3300047447 Bacteria 3266
614 Ga0495685_038671 3300047447 Bacteria 1634
615 Ga0495685_092965 3300047447 Bacteria 998
616 Ga0495681_0016334 3300047470 Bacteria 4164
617 Ga0495684_0002552 3300047471 Bacteria 14487
618 Ga0495684_0030858 3300047471 Bacteria 4114
619 Ga0495684_0067917 3300047471 Bacteria 2711
620 Ga0495593_0021941 3300047673 Bacteria 3562
621 Ga0495593_0026111 3300047673 Bacteria 3228
622 Ga0495593_0048634 3300047673 Bacteria 2253
623 Ga0495593_0061116 3300047673 Bacteria 1971
624 Ga0495602_0036878 3300048088 Bacteria 4544
625 Ga0495602_0039724 3300048088 Bacteria 4328
626 Ga0495602_0091463 3300048088 Bacteria 2523
627 Ga0495602_0096673 3300048088 Bacteria 2435
628 Ga0495602_0248473 3300048088 Bacteria 1327
629 Ga0495602_0297058 3300048088 Bacteria 1183
630 Ga0495614_0003869 3300048089 Bacteria 6729
631 Ga0495614_0018379 3300048089 Bacteria 3028
632 Ga0495614_0021021 3300048089 Bacteria 2821
633 Ga0495614_0060964 3300048089 Bacteria 1620
634 Ga0495614_0076287 3300048089 Bacteria 1449
635 Ga0495614_0172222 3300048089 Bacteria 971
636 Ga0496100_0119412 3300048903 Bacteria 1842
637 Ga0496101_0030634 3300048904 Bacteria 3774
638 Ga0496102_0031505 3300048905 Bacteria 4757
639 Ga0496102_0048348 3300048905 Bacteria 3868
640 Ga0496103_0176207 3300048906 Bacteria 1374
641 Ga0496104_0026135 3300048907 Bacteria 5386
642 Ga0496104_0056091 3300048907 Bacteria 3725
643 Ga0496104_0595854 3300048907 Bacteria 1015
644 Ga0496105_0004683 3300048908 Bacteria 10311
645 Ga0496105_0017025 3300048908 Bacteria 5818
646 Ga0496105_0019234 3300048908 Bacteria 5507
647 Ga0496106_0009222 3300048909 Bacteria 7289
648 Ga0496106_0172434 3300048909 Bacteria 1715
649 Ga0496107_0025625 3300048910 Bacteria 4176
650 Ga0496107_0077109 3300048910 Bacteria 2427
651 Ga0496107_0301326 3300048910 Bacteria 1193
652 Ga0496107_0484911 3300048910 Bacteria 917
653 Ga0496108_0002269 3300048911 Bacteria 15405
654 Ga0496108_0026052 3300048911 Bacteria 4823
655 Ga0496109_0065271 3300048912 Bacteria 3332
656 Ga0496110_0035945 3300048913 Bacteria 4301
657 Ga0496110_0075328 3300048913 Bacteria 2998
658 Ga0496111_0100586 3300048914 Bacteria 2123
659 Ga0496111_0405477 3300048914 Bacteria 1007
660 Ga0496113_0002886 3300048916 Bacteria 10118
661 Ga0496114_0055660 3300048917 Bacteria 3299
662 Ga0496114_0293925 3300048917 Bacteria 1434
663 Ga0496114_0333909 3300048917 Bacteria 1340
664 Ga0496115_0088219 3300048918 Bacteria 2532
665 Ga0496115_0172067 3300048918 Bacteria 1791
666 Ga0496126_0039141 3300048929 Bacteria 4403
667 Ga0496126_0072955 3300048929 Bacteria 3052
668 Ga0495678_026140 3300049459 Bacteria 2496
669 Ga0501031_0000271 3300049568 Bacteria 29369
670 Ga0501031_0143497 3300049568 Bacteria 1560
671 Ga0501031_0148210 3300049568 Bacteria 1533
672 Ga0501031_0220787 3300049568 Bacteria 1234
673 Ga0501031_0271846 3300049568 Bacteria 1100
674 Ga0501031_0278914 3300049568 Bacteria 1084
675 Ga0501031_0550610 3300049568 Bacteria 743
676 Ga0501032_0000877 3300049569 Bacteria 24422
677 Ga0501032_0211538 3300049569 Bacteria 1264
678 Ga0501033_0001027 3300049570 Bacteria 25391
679 Ga0501033_0007592 3300049570 Bacteria 8432
680 Ga0501033_0007870 3300049570 Bacteria 8259
681 Ga0501034_0001799 3300049571 Bacteria 27362
682 Ga0501034_0005247 3300049571 Bacteria 14221
683 Ga0501034_0031993 3300049571 Bacteria 5344
684 Ga0501034_0110403 3300049571 Bacteria 2741
685 Ga0501034_0179654 3300049571 Bacteria 2081
686 Ga0501036_0001507 3300049572 Bacteria 17961
687 Ga0501036_0010404 3300049572 Bacteria 7681
688 Ga0501036_0089159 3300049572 Bacteria 2606
689 Ga0501036_0172628 3300049572 Bacteria 1821
690 Ga0501036_0207761 3300049572 Bacteria 1646
691 Ga0501037_0002088 3300049573 Bacteria 14486
692 Ga0501037_0100295 3300049573 Bacteria 2091
693 Ga0501037_0226531 3300049573 Bacteria 1313
694 Ga0501038_0003094 3300049574 Bacteria 15506
695 Ga0501038_0117244 3300049574 Bacteria 2199
696 Ga0501039_0049390 3300049575 Bacteria 3252
697 Ga0501039_0051266 3300049575 Bacteria 3194
698 Ga0501039_0103658 3300049575 Bacteria 2221
699 Ga0501039_0118948 3300049575 Bacteria 2069
700 Ga0501039_0238244 3300049575 Bacteria 1431
701 Ga0501039_0287137 3300049575 Bacteria 1293
702 Ga0501041_0039450 3300049577 Bacteria 2866
703 Ga0501041_0225661 3300049577 Bacteria 1176
704 Ga0501042_0008013 3300049578 Bacteria 6952
705 Ga0501042_0036140 3300049578 Bacteria 3504
706 Ga0501042_0074520 3300049578 Bacteria 2429
707 Ga0501043_0002492 3300049579 Bacteria 15571
708 Ga0501043_0005810 3300049579 Bacteria 9924
709 Ga0501043_0174209 3300049579 Bacteria 1678
710 Ga0501047_0000118 3300049581 Bacteria 96347
711 Ga0501047_0011932 3300049581 Bacteria 8223
712 Ga0501047_0188943 3300049581 Bacteria 1924
713 Ga0501047_0364334 3300049581 Bacteria 1281
714 Ga0501048_0000654 3300049582 Bacteria 24940
715 Ga0501048_0073926 3300049582 Bacteria 2405
716 Ga0501067_0005406 3300049583 Bacteria 7092
717 Ga0501067_0009506 3300049583 Bacteria 5384
718 Ga0501067_0011887 3300049583 Bacteria 4825
719 Ga0501067_0032541 3300049583 Bacteria 2895
720 Ga0501067_0180442 3300049583 Bacteria 1176
721 Ga0501068_0142532 3300049584 Bacteria 1502
722 Ga0501068_0289115 3300049584 Bacteria 1048
723 Ga0501069_0001722 3300049585 Bacteria 10900
724 Ga0501069_0002785 3300049585 Bacteria 8935
725 Ga0501069_0115925 3300049585 Bacteria 1528
726 Ga0501070_0002795 3300049586 Bacteria 15236
727 Ga0501070_0004372 3300049586 Bacteria 12143
728 Ga0501070_0007168 3300049586 Bacteria 9473
729 Ga0501070_0007465 3300049586 Bacteria 9288
730 Ga0501070_0433413 3300049586 Bacteria 1061
731 Ga0501070_0593863 3300049586 Unclassified 883
732 Ga0501071_0020808 3300049587 Bacteria 4563
733 Ga0501071_0041076 3300049587 Bacteria 3312
734 Ga0501071_0058236 3300049587 Bacteria 2793
735 Ga0501071_0220168 3300049587 Bacteria 1428
736 Ga0501072_0014056 3300049588 Bacteria 6135
737 Ga0501072_0273549 3300049588 Bacteria 1344
738 Ga0501073_0027549 3300049589 Bacteria 4063
739 Ga0501074_0001645 3300049590 Bacteria 15150
740 Ga0501074_0007423 3300049590 Bacteria 7931
741 Ga0501074_0074161 3300049590 Bacteria 2443
742 Ga0501074_0089998 3300049590 Bacteria 2198
743 Ga0501074_0439644 3300049590 Bacteria 925
744 Ga0501075_0027122 3300049591 Bacteria 4220
745 Ga0501075_0432365 3300049591 Bacteria 1004
746 Ga0501076_0019494 3300049592 Bacteria 5186
747 Ga0501076_0189270 3300049592 Bacteria 1679
748 Ga0501076_0385777 3300049592 Bacteria 1151
749 Ga0501077_0159263 3300049593 Bacteria 1433
750 Ga0501079_0079936 3300049741 Bacteria 2528
751 Ga0501079_0291744 3300049741 Bacteria 1276
752 Ga0501079_0490860 3300049741 Bacteria 965
753 Ga0501080_0000361 3300049742 Bacteria 35108
754 Ga0501080_0001246 3300049742 Bacteria 21206
755 Ga0501080_0121439 3300049742 Bacteria 2421
756 Ga0501080_0345719 3300049742 Bacteria 1344
757 Ga0501081_0155505 3300049743 Bacteria 1645
758 Ga0501081_0484341 3300049743 Bacteria 921
759 Ga0501083_0176851 3300049744 Bacteria 1394
760 Ga0501035_0003465 3300049822 Bacteria 15106
761 Ga0501035_0022357 3300049822 Bacteria 5807
762 Ga0501035_0046679 3300049822 Bacteria 3896
763 Ga0501035_0051954 3300049822 Bacteria 3667
764 Ga0501035_0239367 3300049822 Bacteria 1544
765 Ga0501044_0005136 3300049823 Bacteria 14600
766 Ga0501044_0078132 3300049823 Bacteria 3354
767 Ga0501044_0288623 3300049823 Bacteria 1572
768 Ga0501045_0111206 3300049824 Bacteria 2031
769 Ga0501045_0179760 3300049824 Bacteria 1576
770 Ga0501045_0221421 3300049824 Bacteria 1409
771 Ga0501045_0228208 3300049824 Bacteria 1386
772 Ga0501045_0294743 3300049824 Bacteria 1207
773 nmdc:mga00v17_80174_c1 3300050491 Bacteria 2037
774 nmdc:mga05p37_193583_c1 3300050507 Bacteria 2467
775 nmdc:mga05p37_815_c1 3300050507 Bacteria 34870
776 nmdc:mga09592_879_c1 3300050508 Bacteria 23524
777 nmdc:mga0qj67_20070_c1 3300050509 Bacteria 5114
778 nmdc:mga06r32_106_c1 3300050510 Bacteria 58645
779 nmdc:mga06r32_1482_c1 3300050510 Bacteria 21098
780 nmdc:mga08y16_2869_c1 3300050511 Bacteria 17731
781 nmdc:mga0n895_166739_c1 3300050512 Bacteria 2234
782 nmdc:mga0n895_199314_c1 3300050512 Bacteria 2033
783 nmdc:mga0rr50_162160_c1 3300050513 Bacteria 1815
784 Ga0495601_0023504 3300053077 Bacteria 3787
785 Ga0495601_0105853 3300053077 Bacteria 1819
786 Ga0495612_0164914 3300053078 Bacteria 968
787 Ga0495655_0137651 3300053083 Bacteria 757
788 Ga0495619_0651134 3300053085 Bacteria 718
789 Ga0500644_0035803 3300053088 Bacteria 1611
790 Ga0500644_0056149 3300053088 Bacteria 1370
791 Ga0500583_0089994 3300053092 Bacteria 1493
792 Ga0500560_003768 3300053107 Bacteria 3118
793 Ga0500572_018074 3300053111 Bacteria 1820
794 Ga0500573_0018878 3300053140 Bacteria 3939
795 Ga0501084_0016029 3300054114 Bacteria 6219
796 Ga0501084_0025730 3300054114 Bacteria 4907
797 Ga0501084_0277760 3300054114 Bacteria 1414
798 Ga0590075_033303 3300059424 Bacteria 1308
799 Ga0501082_0163367 3300060353 Bacteria 1935
800 Ga0501082_0851232 3300060353 Bacteria 798
801 Ga0466962_0010345 3300061719 Bacteria 4482
802 Ga0466962_0035839 3300061719 Bacteria 2374
803 Ga0466962_0131269 3300061719 Unclassified 1211
804 Ga0530510_0085728 3300061734 Bacteria 2295
805 Ga0530510_0094201 3300061734 Bacteria 2187

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044684 Ga0466966_0118121 Ga0466966_0118121_1058_1612 184
2 3300005436 Ga0070713_100291471 Ga0070713_1002914711 189
3 3300053083 Ga0495655_0137651 Ga0495655_0137651_52_633 191
4 3300006871 Ga0075434_100080611 Ga0075434_1000806111 196
5 3300007076 Ga0075435_100026088 Ga0075435_1000260885 196
6 3300009147 Ga0114129_10020245 Ga0114129_100202454 196
7 3300050507 nmdc:mga05p37_193583_c1 nmdc:mga05p37_193583_c1_672_1364 196
8 3300050512 nmdc:mga0n895_166739_c1 nmdc:mga0n895_166739_c1_25_717 196
9 3300050513 nmdc:mga0rr50_162160_c1 nmdc:mga0rr50_162160_c1_636_1328 196
10 3300005548 Ga0070665_100001537 Ga0070665_10000153717 206
11 3300028379 Ga0268266_10003180 Ga0268266_100031805 206
12 3300045976 Ga0466967_0233958 Ga0466967_0233958_808_1443 207
13 3300005445 Ga0070708_100022119 Ga0070708_1000221193 208
14 3300005468 Ga0070707_100007169 Ga0070707_1000071696 208
15 3300005518 Ga0070699_100402406 Ga0070699_1004024061 208
16 3300025922 Ga0207646_10002366 Ga0207646_1000236610 208
17 3300005434 Ga0070709_10020372 Ga0070709_100203724 209
18 3300005435 Ga0070714_100003898 Ga0070714_1000038983 209
19 3300005436 Ga0070713_100017234 Ga0070713_1000172342 209
20 3300005437 Ga0070710_10000818 Ga0070710_100008182 209
21 3300005439 Ga0070711_100007336 Ga0070711_1000073363 209
22 3300006028 Ga0070717_10191264 Ga0070717_101912641 209
23 3300006163 Ga0070715_10067979 Ga0070715_100679793 209
24 3300006173 Ga0070716_100014234 Ga0070716_1000142343 209
25 3300006175 Ga0070712_100001324 Ga0070712_1000013243 209
26 3300025898 Ga0207692_10000357 Ga0207692_1000035719 209
27 3300025898 Ga0207692_10001795 Ga0207692_100017958 209
28 3300025905 Ga0207685_10000722 Ga0207685_100007223 209
29 3300025906 Ga0207699_10001097 Ga0207699_1000109711 209
30 3300025915 Ga0207693_10001115 Ga0207693_1000111513 209
31 3300025916 Ga0207663_10005008 Ga0207663_100050087 209
32 3300025928 Ga0207700_10000376 Ga0207700_1000037611 209
33 3300025929 Ga0207664_10000616 Ga0207664_1000061617 209
34 3300025939 Ga0207665_10001058 Ga0207665_100010588 209
35 3300030733 Ga0314311_1039871 Ga0314311_10398718 209
36 3300030736 Ga0316180_1027963 Ga0316180_10279632 209
37 3300031456 Ga0307513_10222279 Ga0307513_102222792 209
38 3300044683 Ga0466965_0027756 Ga0466965_0027756_1966_2595 209
39 3300044683 Ga0466965_0081301 Ga0466965_0081301_32_664 209
40 3300046471 Ga0495650_0023768 Ga0495650_0023768_351_986 209
41 3300005530 Ga0070679_100060535 Ga0070679_1000605354 210
42 3300045976 Ga0466967_0272735 Ga0466967_0272735_232_912 210
43 3300046476 Ga0495662_0101616 Ga0495662_0101616_444_1079 211
44 3300046526 Ga0495666_0073113 Ga0495666_0073113_129_794 211
45 3300046683 Ga0495658_0193310 Ga0495658_0193310_139_804 211
46 3300048917 Ga0496114_0293925 Ga0496114_0293925_59_724 211
47 3300005327 Ga0070658_10127072 Ga0070658_101270722 212
48 3300005329 Ga0070683_100078557 Ga0070683_1000785574 212
49 3300005329 Ga0070683_100098482 Ga0070683_1000984823 212
50 3300005339 Ga0070660_100085794 Ga0070660_1000857943 212
51 3300005344 Ga0070661_100156503 Ga0070661_1001565032 212
52 3300005344 Ga0070661_100231090 Ga0070661_1002310903 212
53 3300005344 Ga0070661_100252855 Ga0070661_1002528552 212
54 3300005344 Ga0070661_100350152 Ga0070661_1003501522 212
55 3300005458 Ga0070681_10012815 Ga0070681_100128154 212
56 3300005458 Ga0070681_10075300 Ga0070681_100753003 212
57 3300005458 Ga0070681_10235076 Ga0070681_102350763 212
58 3300005530 Ga0070679_100029541 Ga0070679_1000295414 212
59 3300005530 Ga0070679_100173536 Ga0070679_1001735363 212
60 3300005539 Ga0068853_100149931 Ga0068853_1001499314 212
61 3300005548 Ga0070665_100058138 Ga0070665_1000581383 212
62 3300005577 Ga0068857_100073213 Ga0068857_1000732132 212
63 3300005578 Ga0068854_100101835 Ga0068854_1001018353 212
64 3300005578 Ga0068854_100114116 Ga0068854_1001141163 212
65 3300005578 Ga0068854_100143513 Ga0068854_1001435133 212
66 3300005614 Ga0068856_100024430 Ga0068856_1000244304 212
67 3300005614 Ga0068856_100145850 Ga0068856_1001458502 212
68 3300005614 Ga0068856_100529393 Ga0068856_1005293932 212
69 3300009093 Ga0105240_10296540 Ga0105240_102965403 212
70 3300009093 Ga0105240_10430336 Ga0105240_104303363 212
71 3300009545 Ga0105237_10138217 Ga0105237_101382173 212
72 3300009545 Ga0105237_10378399 Ga0105237_103783992 212
73 3300009551 Ga0105238_10047445 Ga0105238_100474454 212
74 3300009551 Ga0105238_10201226 Ga0105238_102012262 212
75 3300010375 Ga0105239_10767357 Ga0105239_107673572 212
76 3300013102 Ga0157371_10328289 Ga0157371_103282891 212
77 3300013104 Ga0157370_10025062 Ga0157370_100250624 212
78 3300013104 Ga0157370_10155952 Ga0157370_101559523 212
79 3300013105 Ga0157369_10065615 Ga0157369_100656154 212
80 3300013105 Ga0157369_10232162 Ga0157369_102321621 212
81 3300013105 Ga0157369_10404040 Ga0157369_104040402 212
82 3300013296 Ga0157374_10054840 Ga0157374_100548403 212
83 3300013296 Ga0157374_10482444 Ga0157374_104824442 212
84 3300013307 Ga0157372_10153346 Ga0157372_101533463 212
85 3300013307 Ga0157372_10160400 Ga0157372_101604003 212
86 3300020070 Ga0206356_11179862 Ga0206356_111798623 212
87 3300025909 Ga0207705_10081584 Ga0207705_100815842 212
88 3300025912 Ga0207707_10046648 Ga0207707_100466484 212
89 3300025912 Ga0207707_10191122 Ga0207707_101911222 212
90 3300025912 Ga0207707_10362648 Ga0207707_103626482 212
91 3300025913 Ga0207695_10150512 Ga0207695_101505122 212
92 3300025913 Ga0207695_10425500 Ga0207695_104255002 212
93 3300025914 Ga0207671_10081911 Ga0207671_100819112 212
94 3300025917 Ga0207660_10015308 Ga0207660_100153084 212
95 3300025917 Ga0207660_10203761 Ga0207660_102037612 212
96 3300025919 Ga0207657_10011831 Ga0207657_100118318 212
97 3300025920 Ga0207649_10195361 Ga0207649_101953612 212
98 3300025921 Ga0207652_10011230 Ga0207652_100112304 212
99 3300025921 Ga0207652_10265087 Ga0207652_102650873 212
100 3300025924 Ga0207694_10105778 Ga0207694_101057782 212
101 3300025924 Ga0207694_10274510 Ga0207694_102745102 212
102 3300025929 Ga0207664_10534646 Ga0207664_105346462 212
103 3300025932 Ga0207690_10013385 Ga0207690_100133853 212
104 3300025944 Ga0207661_10024764 Ga0207661_100247644 212
105 3300025944 Ga0207661_10066131 Ga0207661_100661313 212
106 3300025944 Ga0207661_10119079 Ga0207661_101190791 212
107 3300025981 Ga0207640_10177664 Ga0207640_101776642 212
108 3300025981 Ga0207640_10208579 Ga0207640_102085792 212
109 3300025981 Ga0207640_10667565 Ga0207640_106675652 212
110 3300026041 Ga0207639_10581040 Ga0207639_105810402 212
111 3300026041 Ga0207639_10622121 Ga0207639_106221212 212
112 3300026067 Ga0207678_10062607 Ga0207678_100626073 212
113 3300026078 Ga0207702_10123146 Ga0207702_101231462 212
114 3300026078 Ga0207702_10432098 Ga0207702_104320982 212
115 3300026078 Ga0207702_10904689 Ga0207702_109046892 212
116 3300026116 Ga0207674_10032175 Ga0207674_100321753 212
117 3300026116 Ga0207674_10060394 Ga0207674_100603944 212
118 3300026142 Ga0207698_10431311 Ga0207698_104313112 212
119 3300028379 Ga0268266_10071603 Ga0268266_100716033 212
120 3300032126 Ga0307415_100154126 Ga0307415_1001541262 212
121 3300037466 Ga0395898_0194689 Ga0395898_0194689_797_1435 212
122 3300045976 Ga0466967_0231742 Ga0466967_0231742_57_695 212
123 3300049571 Ga0501034_0031993 Ga0501034_0031993_1588_2262 212
124 3300049581 Ga0501047_0364334 Ga0501047_0364334_386_1060 212
125 3300049583 Ga0501067_0005406 Ga0501067_0005406_5762_6436 212
126 3300049583 Ga0501067_0009506 Ga0501067_0009506_3769_4407 212
127 3300049584 Ga0501068_0142532 Ga0501068_0142532_487_1161 212
128 3300049585 Ga0501069_0002785 Ga0501069_0002785_4498_5136 212
129 3300049586 Ga0501070_0007465 Ga0501070_0007465_6167_6841 212
130 3300049586 Ga0501070_0593863 Ga0501070_0593863_57_695 212
131 3300049587 Ga0501071_0020808 Ga0501071_0020808_986_1660 212
132 3300049589 Ga0501073_0027549 Ga0501073_0027549_2733_3407 212
133 3300049590 Ga0501074_0007423 Ga0501074_0007423_22_696 212
134 3300049742 Ga0501080_0000361 Ga0501080_0000361_6041_6715 212
135 3300049744 Ga0501083_0176851 Ga0501083_0176851_389_1063 212
136 3300054114 Ga0501084_0025730 Ga0501084_0025730_3549_4223 212
137 3300005440 Ga0070705_100517345 Ga0070705_1005173451 213
138 3300049568 Ga0501031_0550610 Ga0501031_0550610_48_692 213
139 3300049572 Ga0501036_0089159 Ga0501036_0089159_491_1135 213
140 3300049575 Ga0501039_0049390 Ga0501039_0049390_1346_1990 213
141 3300049577 Ga0501041_0039450 Ga0501041_0039450_1045_1689 213
142 3300049582 Ga0501048_0073926 Ga0501048_0073926_1480_2124 213
143 3300049592 Ga0501076_0385777 Ga0501076_0385777_297_941 213
144 3300049593 Ga0501077_0159263 Ga0501077_0159263_285_929 213
145 3300049742 Ga0501080_0345719 Ga0501080_0345719_178_831 213
146 3300049743 Ga0501081_0155505 Ga0501081_0155505_495_1139 213
147 3300049824 Ga0501045_0179760 Ga0501045_0179760_741_1385 213
148 3300061734 Ga0530510_0085728 Ga0530510_0085728_1206_1850 213
149 3300007076 Ga0075435_100277727 Ga0075435_1002777271 214
150 3300009098 Ga0105245_10066020 Ga0105245_100660202 214
151 3300009553 Ga0105249_10252720 Ga0105249_102527202 214
152 3300010375 Ga0105239_10048937 Ga0105239_100489373 214
153 3300011119 Ga0105246_10457669 Ga0105246_104576691 214
154 3300013104 Ga0157370_10325871 Ga0157370_103258712 214
155 3300013105 Ga0157369_10482019 Ga0157369_104820192 214
156 3300013296 Ga0157374_10017252 Ga0157374_100172524 214
157 3300013306 Ga0163162_10144977 Ga0163162_101449772 214
158 3300013307 Ga0157372_10760570 Ga0157372_107605701 214
159 3300014968 Ga0157379_10008723 Ga0157379_100087234 214
160 3300014969 Ga0157376_10138658 Ga0157376_101386583 214
161 3300025906 Ga0207699_10443580 Ga0207699_104435802 214
162 3300035086 Ga0373934_0137327 Ga0373934_0137327_226_900 214
163 3300035089 Ga0373944_0006890 Ga0373944_0006890_2160_2834 214
164 3300035113 Ga0373936_0212412 Ga0373936_0212412_13_687 214
165 3300035172 Ga0373955_0359489 Ga0373955_0359489_136_810 214
166 3300044693 Ga0466961_0388562 Ga0466961_0388562_37_723 214
167 3300046454 Ga0495592_0168274 Ga0495592_0168274_656_1330 214
168 3300046455 Ga0495603_0033390 Ga0495603_0033390_2053_2703 214
169 3300046459 Ga0495629_0005692 Ga0495629_0005692_106_813 214
170 3300046459 Ga0495629_0174973 Ga0495629_0174973_635_1309 214
171 3300046462 Ga0495651_0007293 Ga0495651_0007293_1031_1705 214
172 3300046473 Ga0495582_0039185 Ga0495582_0039185_609_1283 214
173 3300046474 Ga0495605_0107843 Ga0495605_0107843_230_880 214
174 3300046476 Ga0495662_0095002 Ga0495662_0095002_509_1183 214
175 3300046499 Ga0495594_0310521 Ga0495594_0310521_210_860 214
176 3300046499 Ga0495594_0439404 Ga0495594_0439404_62_712 214
177 3300046511 Ga0495608_0299594 Ga0495608_0299594_309_983 214
178 3300046514 Ga0495618_0006775 Ga0495618_0006775_5308_6015 214
179 3300046514 Ga0495618_0172146 Ga0495618_0172146_82_756 214
180 3300046515 Ga0495620_0007810 Ga0495620_0007810_23_673 214
181 3300046516 Ga0495628_0022627 Ga0495628_0022627_375_1049 214
182 3300046516 Ga0495628_0148447 Ga0495628_0148447_39_689 214
183 3300046516 Ga0495628_0470603 Ga0495628_0470603_124_831 214
184 3300046516 Ga0495628_0537511 Ga0495628_0537511_40_684 214
185 3300046517 Ga0495630_0081592 Ga0495630_0081592_712_1386 214
186 3300046518 Ga0495631_0007379 Ga0495631_0007379_22_672 214
187 3300046526 Ga0495666_0088084 Ga0495666_0088084_773_1423 214
188 3300046529 Ga0495652_0056716 Ga0495652_0056716_1402_2076 214
189 3300046529 Ga0495652_0219301 Ga0495652_0219301_630_1337 214
190 3300046529 Ga0495652_0415896 Ga0495652_0415896_135_809 214
191 3300046531 Ga0495665_0126182 Ga0495665_0126182_174_848 214
192 3300046533 Ga0495640_0072507 Ga0495640_0072507_1393_2100 214
193 3300046535 Ga0495586_0059691 Ga0495586_0059691_214_888 214
194 3300046536 Ga0495587_0020823 Ga0495587_0020823_1315_1989 214
195 3300046543 Ga0495645_0014612 Ga0495645_0014612_375_1049 214
196 3300046559 Ga0495667_0119439 Ga0495667_0119439_775_1449 214
197 3300046559 Ga0495667_0163470 Ga0495667_0163470_651_1358 214
198 3300046616 Ga0495668_0269848 Ga0495668_0269848_132_782 214
199 3300046642 Ga0495634_0017179 Ga0495634_0017179_3077_3784 214
200 3300046642 Ga0495634_0022096 Ga0495634_0022096_3662_4336 214
201 3300046663 Ga0495635_0034588 Ga0495635_0034588_562_1236 214
202 3300046664 Ga0495659_0144150 Ga0495659_0144150_219_869 214
203 3300046675 Ga0495657_0018127 Ga0495657_0018127_229_936 214
204 3300046675 Ga0495657_0118079 Ga0495657_0118079_275_949 214
205 3300046678 Ga0495599_0004232 Ga0495599_0004232_307_981 214
206 3300046678 Ga0495599_0394306 Ga0495599_0394306_39_812 214
207 3300046679 Ga0495623_0112950 Ga0495623_0112950_711_1385 214
208 3300046680 Ga0495646_0104388 Ga0495646_0104388_259_933 214
209 3300046680 Ga0495646_0213872 Ga0495646_0213872_41_685 214
210 3300046690 Ga0495624_0075002 Ga0495624_0075002_938_1645 214
211 3300046794 Ga0495589_0052307 Ga0495589_0052307_946_1596 214
212 3300046809 Ga0495600_0054859 Ga0495600_0054859_509_1216 214
213 3300047317 Ga0495604_0008372 Ga0495604_0008372_5688_6395 214
214 3300047317 Ga0495604_0082937 Ga0495604_0082937_247_921 214
215 3300047319 Ga0495674_0619876 Ga0495674_0619876_165_839 214
216 3300047321 Ga0495676_0063378 Ga0495676_0063378_799_1506 214
217 3300047322 Ga0495680_0300721 Ga0495680_0300721_78_752 214
218 3300047323 Ga0495683_0057405 Ga0495683_0057405_304_954 214
219 3300047323 Ga0495683_0081415 Ga0495683_0081415_905_1555 214
220 3300047444 Ga0495675_0011001 Ga0495675_0011001_21_728 214
221 3300047471 Ga0495684_0002552 Ga0495684_0002552_3722_4396 214
222 3300047673 Ga0495593_0061116 Ga0495593_0061116_100_774 214
223 3300048088 Ga0495602_0297058 Ga0495602_0297058_22_696 214
224 3300048089 Ga0495614_0076287 Ga0495614_0076287_649_1356 214
225 3300048907 Ga0496104_0026135 Ga0496104_0026135_3954_4628 214
226 3300048908 Ga0496105_0017025 Ga0496105_0017025_441_1115 214
227 3300048910 Ga0496107_0301326 Ga0496107_0301326_215_889 214
228 3300048910 Ga0496107_0484911 Ga0496107_0484911_173_844 214
229 3300048911 Ga0496108_0026052 Ga0496108_0026052_2988_3662 214
230 3300048912 Ga0496109_0065271 Ga0496109_0065271_278_952 214
231 3300048913 Ga0496110_0035945 Ga0496110_0035945_2367_3041 214
232 3300048914 Ga0496111_0405477 Ga0496111_0405477_298_972 214
233 3300049573 Ga0501037_0226531 Ga0501037_0226531_371_1015 214
234 3300049578 Ga0501042_0074520 Ga0501042_0074520_1111_1755 214
235 3300049581 Ga0501047_0000118 Ga0501047_0000118_91222_91866 214
236 3300050512 nmdc:mga0n895_199314_c1 nmdc:mga0n895_199314_c1_587_1261 214
237 3300053077 Ga0495601_0023504 Ga0495601_0023504_530_1204 214
238 3300053078 Ga0495612_0164914 Ga0495612_0164914_275_949 214
239 3300053085 Ga0495619_0651134 Ga0495619_0651134_30_704 214
240 3300053088 Ga0500644_0035803 Ga0500644_0035803_934_1584 214
241 3300053092 Ga0500583_0089994 Ga0500583_0089994_441_1091 214
242 3300041512 Ga0451853_2550968 Ga0451853_2550968_355_1047 215
243 3300005445 Ga0070708_100203359 Ga0070708_1002033592 216
244 3300005468 Ga0070707_100124832 Ga0070707_1001248323 216
245 3300005471 Ga0070698_100003266 Ga0070698_10000326612 216
246 3300005518 Ga0070699_100374721 Ga0070699_1003747212 216
247 3300005536 Ga0070697_100017778 Ga0070697_1000177785 216
248 3300025922 Ga0207646_10003767 Ga0207646_1000376710 216
249 3300025922 Ga0207646_10249254 Ga0207646_102492542 216
250 3300005435 Ga0070714_101164355 Ga0070714_1011643551 217
251 3300006358 Ga0068871_100549039 Ga0068871_1005490392 217
252 3300025905 Ga0207685_10026039 Ga0207685_100260392 217
253 3300048903 Ga0496100_0119412 Ga0496100_0119412_377_1057 217
254 3300048907 Ga0496104_0056091 Ga0496104_0056091_2857_3537 217
255 3300048908 Ga0496105_0019234 Ga0496105_0019234_1079_1759 217
256 3300048909 Ga0496106_0172434 Ga0496106_0172434_344_1024 217
257 3300048910 Ga0496107_0025625 Ga0496107_0025625_1723_2403 217
258 3300048913 Ga0496110_0075328 Ga0496110_0075328_430_1110 217
259 3300048914 Ga0496111_0100586 Ga0496111_0100586_516_1196 217
260 3300048917 Ga0496114_0055660 Ga0496114_0055660_57_737 217
261 3300048918 Ga0496115_0172067 Ga0496115_0172067_622_1302 217
262 iso_pu_bacteria 2738543034 2739367211 217
263 iso_pu_bacteria 2818991472 2819743381 217
264 3300005434 Ga0070709_10570442 Ga0070709_105704422 218
265 3300031456 Ga0307513_10004055 Ga0307513_1000405519 218
266 iso_pu_bacteria 2791354901 2791913488 218
267 3300005437 Ga0070710_10000044 Ga0070710_1000004449 219
268 3300025928 Ga0207700_10013007 Ga0207700_100130075 219
269 3300044658 Ga0466972_0014301 Ga0466972_0014301_1918_2580 219
270 3300044683 Ga0466965_0000544 Ga0466965_0000544_2984_3646 219
271 3300044694 Ga0466963_0057304 Ga0466963_0057304_1023_1730 219
272 3300044706 Ga0466964_0052239 Ga0466964_0052239_900_1607 219
273 3300044735 Ga0466968_0083235 Ga0466968_0083235_645_1352 219
274 3300044901 Ga0466960_0003032 Ga0466960_0003032_3655_4317 219
275 3300045836 Ga0466958_0049358 Ga0466958_0049358_378_1085 219
276 3300049741 Ga0501079_0291744 Ga0501079_0291744_379_1041 219
277 3300005338 Ga0068868_100220600 Ga0068868_1002206003 220
278 3300005339 Ga0070660_100277059 Ga0070660_1002770591 220
279 3300005345 Ga0070692_10151247 Ga0070692_101512472 220
280 3300005356 Ga0070674_100287931 Ga0070674_1002879312 220
281 3300005366 Ga0070659_100575541 Ga0070659_1005755411 220
282 3300005435 Ga0070714_100097787 Ga0070714_1000977872 220
283 3300005456 Ga0070678_100499511 Ga0070678_1004995112 220
284 3300005535 Ga0070684_100179038 Ga0070684_1001790383 220
285 3300005544 Ga0070686_100255985 Ga0070686_1002559851 220
286 3300005615 Ga0070702_100125197 Ga0070702_1001251973 220
287 3300005937 Ga0081455_10181745 Ga0081455_101817452 220
288 3300006871 Ga0075434_100587729 Ga0075434_1005877292 220
289 3300007076 Ga0075435_100037406 Ga0075435_1000374063 220
290 3300009098 Ga0105245_10329610 Ga0105245_103296102 220
291 3300009148 Ga0105243_10076132 Ga0105243_100761322 220
292 3300025901 Ga0207688_10017141 Ga0207688_100171411 220
293 3300025927 Ga0207687_10192374 Ga0207687_101923742 220
294 3300025929 Ga0207664_10009185 Ga0207664_100091855 220
295 3300025935 Ga0207709_10278680 Ga0207709_102786802 220
296 3300025939 Ga0207665_10075499 Ga0207665_100754993 220
297 3300026023 Ga0207677_10495280 Ga0207677_104952802 220
298 3300026089 Ga0207648_11080995 Ga0207648_110809951 220
299 3300038443 Ga0395901_0235728 Ga0395901_0235728_1124_1789 220
300 3300041405 Ga0439438_042727 Ga0439438_042727_115_780 220
301 3300048904 Ga0496101_0030634 Ga0496101_0030634_1467_2132 220
302 3300048905 Ga0496102_0031505 Ga0496102_0031505_2871_3542 220
303 3300048909 Ga0496106_0009222 Ga0496106_0009222_4623_5288 220
304 3300048910 Ga0496107_0077109 Ga0496107_0077109_758_1423 220
305 3300050491 nmdc:mga00v17_80174_c1 nmdc:mga00v17_80174_c1_198_872 220
306 iso_pu_bacteria 2891326441 2891330896 220
307 iso_pu_bacteria 2904765812 2904768701 220
308 iso_pu_bacteria 2904770941 2904772027 220
309 iso_pu_bacteria 2908811453 2908812679 220
310 iso_pu_bacteria 8003314358 8003323040 220
311 3300026118 Ga0207675_100608683 Ga0207675_1006086831 221
312 3300041404 Ga0439436_0032644 Ga0439436_0032644_13_693 221
313 3300042002 Ga0439442_009247 Ga0439442_009247_361_1041 221
314 3300042015 Ga0439462_0095769 Ga0439462_0095769_32_712 221
315 3300042156 Ga0439446_0023092 Ga0439446_0023092_144_824 221
316 3300044658 Ga0466972_0012228 Ga0466972_0012228_673_1347 221
317 3300044765 Ga0466970_0066150 Ga0466970_0066150_550_1224 221
318 3300046674 Ga0495588_0279310 Ga0495588_0279310_118_789 221
319 3300049568 Ga0501031_0000271 Ga0501031_0000271_927_1604 221
320 3300049569 Ga0501032_0000877 Ga0501032_0000877_846_1523 221
321 3300049570 Ga0501033_0001027 Ga0501033_0001027_814_1491 221
322 3300049571 Ga0501034_0005247 Ga0501034_0005247_11019_11696 221
323 3300049572 Ga0501036_0010404 Ga0501036_0010404_4173_4850 221
324 3300049573 Ga0501037_0002088 Ga0501037_0002088_13064_13741 221
325 3300049574 Ga0501038_0003094 Ga0501038_0003094_13876_14553 221
326 3300049575 Ga0501039_0118948 Ga0501039_0118948_1118_1795 221
327 3300049579 Ga0501043_0002492 Ga0501043_0002492_955_1632 221
328 3300049582 Ga0501048_0000654 Ga0501048_0000654_11737_12414 221
329 3300049583 Ga0501067_0011887 Ga0501067_0011887_3054_3731 221
330 3300049584 Ga0501068_0289115 Ga0501068_0289115_66_743 221
331 3300049585 Ga0501069_0001722 Ga0501069_0001722_9381_10058 221
332 3300049586 Ga0501070_0007168 Ga0501070_0007168_918_1595 221
333 3300049587 Ga0501071_0220168 Ga0501071_0220168_609_1286 221
334 3300049590 Ga0501074_0074161 Ga0501074_0074161_812_1489 221
335 3300049591 Ga0501075_0432365 Ga0501075_0432365_64_765 221
336 3300049741 Ga0501079_0490860 Ga0501079_0490860_28_705 221
337 3300049742 Ga0501080_0001246 Ga0501080_0001246_19365_20042 221
338 3300049822 Ga0501035_0003465 Ga0501035_0003465_12600_13277 221
339 3300049823 Ga0501044_0288623 Ga0501044_0288623_644_1321 221
340 3300054114 Ga0501084_0277760 Ga0501084_0277760_510_1187 221
341 iso_pu_bacteria 8047710418 8047713570 221
342 3300005937 Ga0081455_10108634 Ga0081455_101086342 222
343 3300020080 Ga0206350_11409316 Ga0206350_114093162 222
344 3300028379 Ga0268266_10700459 Ga0268266_107004591 222
345 3300030522 Ga0307512_10031261 Ga0307512_100312612 222
346 3300031730 Ga0307516_10044287 Ga0307516_100442873 222
347 3300044694 Ga0466963_0036762 Ga0466963_0036762_1684_2403 222
348 3300044842 Ga0466957_0006437 Ga0466957_0006437_4244_4963 222
349 3300045836 Ga0466958_0033825 Ga0466958_0033825_2297_3016 222
350 3300005544 Ga0070686_100193517 Ga0070686_1001935172 223
351 3300044693 Ga0466961_0370172 Ga0466961_0370172_185_859 223
352 3300045976 Ga0466967_0076001 Ga0466967_0076001_2195_2866 223
353 3300046679 Ga0495623_0013779 Ga0495623_0013779_3965_4789 223
354 3300047317 Ga0495604_0016764 Ga0495604_0016764_1247_2071 223
355 3300047444 Ga0495675_0027857 Ga0495675_0027857_2309_3133 223
356 3300061719 Ga0466962_0131269 Ga0466962_0131269_425_1099 223
357 iso_pu_bacteria 2863404153 2863410267 223
358 iso_pu_bacteria 8056060235 8056062542 223
359 3300005530 Ga0070679_100270356 Ga0070679_1002703562 224
360 3300025921 Ga0207652_10243452 Ga0207652_102434522 224
361 3300044694 Ga0466963_0117072 Ga0466963_0117072_67_759 224
362 3300044706 Ga0466964_0134798 Ga0466964_0134798_260_979 224
363 3300044765 Ga0466970_0143464 Ga0466970_0143464_63_752 224
364 3300044765 Ga0466970_0252014 Ga0466970_0252014_131_823 224
365 3300045836 Ga0466958_0109359 Ga0466958_0109359_976_1668 224
366 3300045976 Ga0466967_0899349 Ga0466967_0899349_95_787 224
367 3300049583 Ga0501067_0032541 Ga0501067_0032541_730_1410 224
368 3300049586 Ga0501070_0002795 Ga0501070_0002795_7188_7874 224
369 3300060353 Ga0501082_0851232 Ga0501082_0851232_44_766 224
370 iso_pu_bacteria 2585427649 2586059570 224
371 iso_pu_bacteria 2784746763 2785339753 224
372 iso_pu_bacteria 2802429296 2804849158 224
373 iso_pu_bacteria 2808606522 2809591667 224
374 iso_pu_bacteria 2811994879 2812354380 224
375 iso_pu_bacteria 2852635781 2852636002 224
376 iso_pu_bacteria 2862382967 2862383911 224
377 iso_pu_bacteria 2899359706 2899364011 224
378 iso_pu_bacteria 2946064051 2946071323 224
379 iso_pu_bacteria 8003314358 8003322282 224
380 iso_pu_bacteria 8008558824 8008564263 224
381 iso_pu_bacteria 8048406513 8048411911 224
382 iso_pu_bacteria 8056207758 8056212381 224
383 3300005329 Ga0070683_100415034 Ga0070683_1004150341 225
384 3300005434 Ga0070709_10443303 Ga0070709_104433031 225
385 3300005435 Ga0070714_100004647 Ga0070714_1000046476 225
386 3300005436 Ga0070713_100010129 Ga0070713_1000101293 225
387 3300005455 Ga0070663_100109548 Ga0070663_1001095482 225
388 3300005466 Ga0070685_10476091 Ga0070685_104760911 225
389 3300005578 Ga0068854_100436146 Ga0068854_1004361462 225
390 3300006028 Ga0070717_10405128 Ga0070717_104051282 225
391 3300020082 Ga0206353_11785731 Ga0206353_117857311 225
392 3300025927 Ga0207687_10171008 Ga0207687_101710083 225
393 3300025928 Ga0207700_10162732 Ga0207700_101627321 225
394 3300026067 Ga0207678_10064141 Ga0207678_100641412 225
395 3300026078 Ga0207702_10760291 Ga0207702_107602911 225
396 3300031616 Ga0307508_10036278 Ga0307508_100362783 225
397 3300039437 Ga0436365_0278358 Ga0436365_0278358_1607_2305 225
398 3300044656 Ga0466969_0017309 Ga0466969_0017309_519_1259 225
399 3300044658 Ga0466972_0007816 Ga0466972_0007816_3563_4303 225
400 3300044684 Ga0466966_0012306 Ga0466966_0012306_1088_1828 225
401 3300044693 Ga0466961_0016316 Ga0466961_0016316_1132_1872 225
402 3300044719 Ga0466971_0009135 Ga0466971_0009135_3081_3821 225
403 3300044735 Ga0466968_0005233 Ga0466968_0005233_3494_4234 225
404 3300044735 Ga0466968_0124218 Ga0466968_0124218_12_698 225
405 3300044765 Ga0466970_0221070 Ga0466970_0221070_131_871 225
406 3300045049 Ga0466959_0107109 Ga0466959_0107109_427_1167 225
407 3300045976 Ga0466967_0206357 Ga0466967_0206357_133_828 225
408 3300048929 Ga0496126_0072955 Ga0496126_0072955_1639_2358 225
409 3300049588 Ga0501072_0273549 Ga0501072_0273549_433_1116 225
410 3300061719 Ga0466962_0035839 Ga0466962_0035839_1272_2012 225
411 iso_pu_bacteria 2616644814 2616698931 225
412 iso_pu_bacteria 2643221601 2644014129 225
413 iso_pu_bacteria 2643221631 2644175477 225
414 iso_pu_bacteria 2997600082 2997605220 225
415 3300005467 Ga0070706_100007732 Ga0070706_1000077325 226
416 3300005468 Ga0070707_100042733 Ga0070707_1000427332 226
417 3300025910 Ga0207684_10009868 Ga0207684_100098684 226
418 3300025922 Ga0207646_10000787 Ga0207646_100007876 226
419 3300025922 Ga0207646_10021628 Ga0207646_100216283 226
420 3300031995 Ga0307409_100501832 Ga0307409_1005018322 226
421 3300035086 Ga0373934_0010252 Ga0373934_0010252_1260_1952 226
422 3300035117 Ga0373953_0019808 Ga0373953_0019808_336_1028 226
423 3300035118 Ga0373954_0054426 Ga0373954_0054426_356_1048 226
424 3300035119 Ga0373956_0011043 Ga0373956_0011043_1447_2139 226
425 3300035120 Ga0373957_0041995 Ga0373957_0041995_176_868 226
426 3300035410 Ga0373924_0024459 Ga0373924_0024459_307_999 226
427 3300035724 Ga0373933_0077075 Ga0373933_0077075_52_744 226
428 3300036401 Ga0373937_0009708 Ga0373937_0009708_3195_3887 226
429 3300046454 Ga0495592_0278936 Ga0495592_0278936_296_988 226
430 3300046511 Ga0495608_0076379 Ga0495608_0076379_704_1396 226
431 3300046529 Ga0495652_0181027 Ga0495652_0181027_188_880 226
432 3300046536 Ga0495587_0092203 Ga0495587_0092203_888_1580 226
433 3300046559 Ga0495667_0047219 Ga0495667_0047219_324_1016 226
434 3300046679 Ga0495623_0091737 Ga0495623_0091737_333_1025 226
435 3300046679 Ga0495623_0109229 Ga0495623_0109229_329_1021 226
436 3300046809 Ga0495600_0076318 Ga0495600_0076318_704_1396 226
437 3300047317 Ga0495604_0167809 Ga0495604_0167809_259_951 226
438 3300047322 Ga0495680_0027595 Ga0495680_0027595_1374_2066 226
439 3300047444 Ga0495675_0254291 Ga0495675_0254291_305_997 226
440 3300047471 Ga0495684_0067917 Ga0495684_0067917_1681_2373 226
441 3300048088 Ga0495602_0036878 Ga0495602_0036878_799_1491 226
442 3300048088 Ga0495602_0096673 Ga0495602_0096673_1586_2278 226
443 3300049568 Ga0501031_0271846 Ga0501031_0271846_210_911 226
444 3300049572 Ga0501036_0207761 Ga0501036_0207761_59_760 226
445 3300049575 Ga0501039_0103658 Ga0501039_0103658_955_1656 226
446 3300049590 Ga0501074_0439644 Ga0501074_0439644_190_891 226
447 3300049824 Ga0501045_0228208 Ga0501045_0228208_33_734 226
448 iso_pu_bacteria 2582581312 2585300794 226
449 iso_pu_bacteria 2582581313 2585304110 226
450 iso_pu_bacteria 2582581314 2585312103 226
451 iso_pu_bacteria 2616644941 2616905667 226
452 iso_pu_bacteria 2643221548 2643761299 226
453 iso_pu_bacteria 2643221578 2643901655 226
454 iso_pu_bacteria 2643221673 2644407801 226
455 iso_pu_bacteria 2643221682 2644459299 226
456 iso_pu_bacteria 2784746768 2785373192 226
457 iso_pu_bacteria 2786546132 2786674811 226
458 iso_pu_bacteria 2811994917 2812482827 226
459 iso_pu_bacteria 2818991463 2819696155 226
460 iso_pu_bacteria 2862507626 2862507646 226
461 iso_pu_bacteria 2867428634 2867436385 226
462 iso_pu_bacteria 2912715099 2912716000 226
463 iso_pu_bacteria 2912723979 2912728958 226
464 iso_pu_bacteria 2946045630 2946046537 226
465 iso_pu_bacteria 2954673503 2954680591 226
466 iso_pu_bacteria 2954682443 2954683562 226
467 iso_pu_bacteria 3006493962 3006494607 226
468 iso_pu_bacteria 8008574985 8008575866 226
469 3300005435 Ga0070714_100046062 Ga0070714_1000460626 227
470 3300005435 Ga0070714_100297154 Ga0070714_1002971542 227
471 3300005444 Ga0070694_100024596 Ga0070694_1000245964 227
472 3300005937 Ga0081455_10061058 Ga0081455_100610585 227
473 3300013306 Ga0163162_11237451 Ga0163162_112374511 227
474 3300025929 Ga0207664_10002754 Ga0207664_100027548 227
475 3300025944 Ga0207661_10661363 Ga0207661_106613631 227
476 3300028379 Ga0268266_10722210 Ga0268266_107222101 227
477 3300028794 Ga0307515_10285340 Ga0307515_102853403 227
478 3300030522 Ga0307512_10164737 Ga0307512_101647372 227
479 3300041404 Ga0439436_0004403 Ga0439436_0004403_2585_3289 227
480 3300041406 Ga0439439_0003198 Ga0439439_0003198_452_1156 227
481 3300041999 Ga0439433_0001272 Ga0439433_0001272_1613_2317 227
482 3300042002 Ga0439442_023112 Ga0439442_023112_178_882 227
483 3300044765 Ga0466970_0119208 Ga0466970_0119208_88_816 227
484 3300044842 Ga0466957_0110442 Ga0466957_0110442_404_1132 227
485 3300045836 Ga0466958_0104637 Ga0466958_0104637_182_910 227
486 3300046511 Ga0495608_0000081 Ga0495608_0000081_36870_37583 227
487 3300046680 Ga0495646_0001725 Ga0495646_0001725_5134_5847 227
488 iso_pu_bacteria 2791355406 2793981130 227
489 iso_pu_bacteria 2935390628 2935392967 227
490 iso_pu_bacteria 2954002825 2954009638 227
491 iso_pu_bacteria 3006393351 3006397002 227
492 iso_pu_bacteria 3006486233 3006488811 227
493 iso_pu_bacteria 8025530807 8025535316 227
494 iso_pu_bacteria 8047893842 8047900180 227
495 iso_pu_bacteria 8048127548 8048133994 227
496 iso_pu_bacteria 8048356638 8048358747 227
497 iso_pu_bacteria 8048369669 8048377127 227
498 iso_pu_bacteria 8048379754 8048386182 227
499 3300003320 rootH2_10014028 rootH2_100140282 228
500 3300005345 Ga0070692_10061483 Ga0070692_100614832 228
501 3300005347 Ga0070668_100000654 Ga0070668_10000065412 228
502 3300005354 Ga0070675_100510288 Ga0070675_1005102881 228
503 3300005435 Ga0070714_100004987 Ga0070714_1000049874 228
504 3300005440 Ga0070705_100273482 Ga0070705_1002734822 228
505 3300005444 Ga0070694_100146697 Ga0070694_1001466972 228
506 3300005455 Ga0070663_100000249 Ga0070663_10000024913 228
507 3300005456 Ga0070678_100221563 Ga0070678_1002215632 228
508 3300005456 Ga0070678_100386459 Ga0070678_1003864591 228
509 3300005539 Ga0068853_100271296 Ga0068853_1002712962 228
510 3300005544 Ga0070686_100150353 Ga0070686_1001503532 228
511 3300005549 Ga0070704_100007703 Ga0070704_1000077035 228
512 3300005563 Ga0068855_100039742 Ga0068855_1000397426 228
513 3300005578 Ga0068854_100216504 Ga0068854_1002165042 228
514 3300005614 Ga0068856_100163980 Ga0068856_1001639802 228
515 3300005841 Ga0068863_100253152 Ga0068863_1002531522 228
516 3300005937 Ga0081455_10000155 Ga0081455_1000015563 228
517 3300005937 Ga0081455_10012770 Ga0081455_1001277010 228
518 3300006163 Ga0070715_10250047 Ga0070715_102500471 228
519 3300006237 Ga0097621_100026603 Ga0097621_1000266034 228
520 3300006844 Ga0075428_100105427 Ga0075428_1001054273 228
521 3300006846 Ga0075430_100021727 Ga0075430_1000217275 228
522 3300006847 Ga0075431_100001884 Ga0075431_1000018847 228
523 3300006847 Ga0075431_100167210 Ga0075431_1001672102 228
524 3300006871 Ga0075434_100086392 Ga0075434_1000863923 228
525 3300006880 Ga0075429_100045340 Ga0075429_1000453404 228
526 3300009092 Ga0105250_10136370 Ga0105250_101363702 228
527 3300009094 Ga0111539_10041947 Ga0111539_100419476 228
528 3300009147 Ga0114129_10037757 Ga0114129_1003775711 228
529 3300009553 Ga0105249_10004292 Ga0105249_100042923 228
530 3300010375 Ga0105239_11177322 Ga0105239_111773222 228
531 3300025898 Ga0207692_10054028 Ga0207692_100540283 228
532 3300025904 Ga0207647_10157646 Ga0207647_101576462 228
533 3300025906 Ga0207699_10022227 Ga0207699_100222274 228
534 3300025921 Ga0207652_10072444 Ga0207652_100724443 228
535 3300025922 Ga0207646_10182500 Ga0207646_101825003 228
536 3300025926 Ga0207659_10238186 Ga0207659_102381862 228
537 3300025927 Ga0207687_10013714 Ga0207687_100137145 228
538 3300025928 Ga0207700_10140318 Ga0207700_101403182 228
539 3300025929 Ga0207664_10017979 Ga0207664_100179794 228
540 3300025929 Ga0207664_10078835 Ga0207664_100788352 228
541 3300025931 Ga0207644_10206426 Ga0207644_102064261 228
542 3300025949 Ga0207667_10048763 Ga0207667_100487633 228
543 3300025961 Ga0207712_10013163 Ga0207712_100131635 228
544 3300025972 Ga0207668_10047899 Ga0207668_100478992 228
545 3300025981 Ga0207640_10565608 Ga0207640_105656081 228
546 3300026023 Ga0207677_10466142 Ga0207677_104661421 228
547 3300026041 Ga0207639_10262899 Ga0207639_102628992 228
548 3300026067 Ga0207678_10000065 Ga0207678_1000006536 228
549 3300026078 Ga0207702_10179579 Ga0207702_101795791 228
550 3300026088 Ga0207641_10042899 Ga0207641_100428993 228
551 3300026095 Ga0207676_10102595 Ga0207676_101025952 228
552 3300026121 Ga0207683_10187873 Ga0207683_101878732 228
553 3300026121 Ga0207683_10290806 Ga0207683_102908061 228
554 3300028379 Ga0268266_10272672 Ga0268266_102726722 228
555 3300028381 Ga0268264_10485720 Ga0268264_104857202 228
556 3300028794 Ga0307515_10057382 Ga0307515_100573824 228
557 3300031838 Ga0307518_10000187 Ga0307518_1000018744 228
558 3300033179 Ga0307507_10031670 Ga0307507_100316702 228
559 3300035725 Ga0373947_0371043 Ga0373947_0371043_218_946 228
560 3300041404 Ga0439436_0016465 Ga0439436_0016465_829_1548 228
561 3300041406 Ga0439439_0010488 Ga0439439_0010488_165_884 228
562 3300042007 Ga0439449_0093824 Ga0439449_0093824_286_1005 228
563 3300042014 Ga0439457_001153 Ga0439457_001153_4505_5224 228
564 3300044683 Ga0466965_0071861 Ga0466965_0071861_524_1216 228
565 3300044765 Ga0466970_0017784 Ga0466970_0017784_1182_1925 228
566 3300046472 Ga0495580_0069800 Ga0495580_0069800_144_872 228
567 3300046543 Ga0495645_0043465 Ga0495645_0043465_2131_2844 228
568 3300047444 Ga0495675_0031352 Ga0495675_0031352_540_1253 228
569 3300048906 Ga0496103_0176207 Ga0496103_0176207_412_1119 228
570 3300049568 Ga0501031_0143497 Ga0501031_0143497_469_1173 228
571 3300049571 Ga0501034_0110403 Ga0501034_0110403_1237_1941 228
572 3300049572 Ga0501036_0172628 Ga0501036_0172628_189_893 228
573 3300049573 Ga0501037_0100295 Ga0501037_0100295_780_1484 228
574 3300049574 Ga0501038_0117244 Ga0501038_0117244_798_1502 228
575 3300049575 Ga0501039_0051266 Ga0501039_0051266_681_1388 228
576 3300049575 Ga0501039_0238244 Ga0501039_0238244_67_771 228
577 3300049578 Ga0501042_0008013 Ga0501042_0008013_4562_5269 228
578 3300049579 Ga0501043_0174209 Ga0501043_0174209_260_967 228
579 3300049581 Ga0501047_0188943 Ga0501047_0188943_1124_1828 228
580 3300049585 Ga0501069_0115925 Ga0501069_0115925_210_917 228
581 3300049586 Ga0501070_0433413 Ga0501070_0433413_19_726 228
582 3300049587 Ga0501071_0041076 Ga0501071_0041076_2485_3192 228
583 3300049587 Ga0501071_0058236 Ga0501071_0058236_1400_2113 228
584 3300049588 Ga0501072_0014056 Ga0501072_0014056_4938_5645 228
585 3300049590 Ga0501074_0089998 Ga0501074_0089998_785_1492 228
586 3300049591 Ga0501075_0027122 Ga0501075_0027122_1993_2700 228
587 3300049592 Ga0501076_0019494 Ga0501076_0019494_2720_3427 228
588 3300049592 Ga0501076_0189270 Ga0501076_0189270_236_949 228
589 3300049741 Ga0501079_0079936 Ga0501079_0079936_1713_2420 228
590 3300049742 Ga0501080_0121439 Ga0501080_0121439_61_768 228
591 3300049743 Ga0501081_0484341 Ga0501081_0484341_28_732 228
592 3300049823 Ga0501044_0078132 Ga0501044_0078132_1508_2212 228
593 3300049824 Ga0501045_0111206 Ga0501045_0111206_123_830 228
594 3300049824 Ga0501045_0221421 Ga0501045_0221421_391_1095 228
595 3300050507 nmdc:mga05p37_815_c1 nmdc:mga05p37_815_c1_31881_32597 228
596 3300050508 nmdc:mga09592_879_c1 nmdc:mga09592_879_c1_3706_4422 228
597 3300050509 nmdc:mga0qj67_20070_c1 nmdc:mga0qj67_20070_c1_2024_2740 228
598 3300050510 nmdc:mga06r32_106_c1 nmdc:mga06r32_106_c1_56909_57625 228
599 3300050510 nmdc:mga06r32_1482_c1 nmdc:mga06r32_1482_c1_4279_4995 228
600 3300050511 nmdc:mga08y16_2869_c1 nmdc:mga08y16_2869_c1_12134_12850 228
601 3300054114 Ga0501084_0016029 Ga0501084_0016029_1129_1836 228
602 3300060353 Ga0501082_0163367 Ga0501082_0163367_503_1210 228
603 3300061734 Ga0530510_0094201 Ga0530510_0094201_1258_1965 228
604 iso_pu_bacteria 2827628540 2827634467 228
605 iso_pu_bacteria 2862574272 2862576168 228
606 iso_pu_bacteria 2875391855 2875397942 228
607 iso_pu_bacteria 2995463766 2995470480 228
608 iso_pu_bacteria 8056829672 8056836115 228
609 3300003323 rootH1_10093147 rootH1_100931472 229
610 3300003373 JGI25407J50210_10007407 JGI25407J50210_100074072 229
611 3300005434 Ga0070709_10061975 Ga0070709_100619752 229
612 3300005434 Ga0070709_10088572 Ga0070709_100885722 229
613 3300005435 Ga0070714_100648059 Ga0070714_1006480592 229
614 3300005437 Ga0070710_10026061 Ga0070710_100260612 229
615 3300005439 Ga0070711_100471871 Ga0070711_1004718711 229
616 3300005614 Ga0068856_100201100 Ga0068856_1002011002 229
617 3300005841 Ga0068863_100358061 Ga0068863_1003580612 229
618 3300005981 Ga0081538_10000092 Ga0081538_1000009272 229
619 3300005983 Ga0081540_1011819 Ga0081540_10118196 229
620 3300006028 Ga0070717_10274218 Ga0070717_102742182 229
621 3300006163 Ga0070715_10000604 Ga0070715_100006046 229
622 3300006173 Ga0070716_100135036 Ga0070716_1001350362 229
623 3300006175 Ga0070712_100170326 Ga0070712_1001703262 229
624 3300013105 Ga0157369_10311976 Ga0157369_103119762 229
625 3300013307 Ga0157372_10733129 Ga0157372_107331292 229
626 3300025898 Ga0207692_10129548 Ga0207692_101295482 229
627 3300025906 Ga0207699_10044847 Ga0207699_100448472 229
628 3300025906 Ga0207699_10107805 Ga0207699_101078053 229
629 3300025939 Ga0207665_10006091 Ga0207665_100060915 229
630 3300035119 Ga0373956_0122307 Ga0373956_0122307_373_1143 229
631 3300035170 Ga0373943_0019277 Ga0373943_0019277_781_1500 229
632 3300035692 Ga0373935_0087985 Ga0373935_0087985_503_1222 229
633 3300036401 Ga0373937_0024043 Ga0373937_0024043_1938_2708 229
634 3300036401 Ga0373937_0135353 Ga0373937_0135353_661_1500 229
635 3300037068 Ga0373925_0004007 Ga0373925_0004007_7863_8615 229
636 3300037068 Ga0373925_0118650 Ga0373925_0118650_322_1041 229
637 3300041494 Ga0451837_1577462 Ga0451837_1577462_1728_2426 229
638 3300044842 Ga0466957_0065104 Ga0466957_0065104_15_734 229
639 3300046452 Ga0495617_049616 Ga0495617_049616_585_1289 229
640 3300046454 Ga0495592_0017645 Ga0495592_0017645_4497_5201 229
641 3300046454 Ga0495592_0032833 Ga0495592_0032833_3106_3876 229
642 3300046455 Ga0495603_0000038 Ga0495603_0000038_3854_4555 229
643 3300046455 Ga0495603_0055304 Ga0495603_0055304_469_1173 229
644 3300046459 Ga0495629_0006176 Ga0495629_0006176_4333_5034 229
645 3300046459 Ga0495629_0125586 Ga0495629_0125586_174_878 229
646 3300046460 Ga0495638_0073293 Ga0495638_0073293_409_1119 229
647 3300046460 Ga0495638_0197410 Ga0495638_0197410_77_778 229
648 3300046462 Ga0495651_0002692 Ga0495651_0002692_7394_8164 229
649 3300046462 Ga0495651_0248148 Ga0495651_0248148_337_1041 229
650 3300046463 Ga0495653_0077176 Ga0495653_0077176_1664_2434 229
651 3300046472 Ga0495580_0101543 Ga0495580_0101543_155_859 229
652 3300046476 Ga0495662_0022526 Ga0495662_0022526_1804_2508 229
653 3300046491 Ga0495584_0114125 Ga0495584_0114125_28_732 229
654 3300046500 Ga0495596_0102831 Ga0495596_0102831_347_1051 229
655 3300046501 Ga0495607_0037006 Ga0495607_0037006_706_1410 229
656 3300046506 Ga0495583_0056746 Ga0495583_0056746_393_1097 229
657 3300046506 Ga0495583_0100817 Ga0495583_0100817_479_1183 229
658 3300046507 Ga0495606_0004135 Ga0495606_0004135_6151_6855 229
659 3300046511 Ga0495608_0187339 Ga0495608_0187339_146_850 229
660 3300046512 Ga0495610_0034625 Ga0495610_0034625_242_946 229
661 3300046513 Ga0495616_0020462 Ga0495616_0020462_257_961 229
662 3300046514 Ga0495618_0048910 Ga0495618_0048910_576_1280 229
663 3300046515 Ga0495620_0007954 Ga0495620_0007954_203_907 229
664 3300046516 Ga0495628_0020871 Ga0495628_0020871_3576_4346 229
665 3300046520 Ga0495637_0061409 Ga0495637_0061409_178_882 229
666 3300046522 Ga0495643_0039751 Ga0495643_0039751_1003_1707 229
667 3300046524 Ga0495648_0078830 Ga0495648_0078830_200_904 229
668 3300046526 Ga0495666_0017841 Ga0495666_0017841_2651_3355 229
669 3300046529 Ga0495652_0006178 Ga0495652_0006178_10110_10880 229
670 3300046533 Ga0495640_0003158 Ga0495640_0003158_3109_3813 229
671 3300046535 Ga0495586_0200905 Ga0495586_0200905_167_871 229
672 3300046536 Ga0495587_0021932 Ga0495587_0021932_618_1388 229
673 3300046538 Ga0495609_0079300 Ga0495609_0079300_146_850 229
674 3300046542 Ga0495597_0048292 Ga0495597_0048292_10_714 229
675 3300046543 Ga0495645_0012603 Ga0495645_0012603_4370_5140 229
676 3300046543 Ga0495645_0014842 Ga0495645_0014842_3686_4399 229
677 3300046558 Ga0495633_0045184 Ga0495633_0045184_406_1110 229
678 3300046559 Ga0495667_0001808 Ga0495667_0001808_11271_12041 229
679 3300046616 Ga0495668_0062572 Ga0495668_0062572_1171_1875 229
680 3300046642 Ga0495634_0090584 Ga0495634_0090584_270_974 229
681 3300046660 Ga0495625_0139481 Ga0495625_0139481_750_1454 229
682 3300046663 Ga0495635_0031036 Ga0495635_0031036_294_998 229
683 3300046665 Ga0495661_0005397 Ga0495661_0005397_976_1680 229
684 3300046679 Ga0495623_0055675 Ga0495623_0055675_859_1629 229
685 3300046680 Ga0495646_0045970 Ga0495646_0045970_1079_1849 229
686 3300046681 Ga0495647_0127657 Ga0495647_0127657_167_886 229
687 3300046689 Ga0495613_0003220 Ga0495613_0003220_5207_5908 229
688 3300046689 Ga0495613_0006739 Ga0495613_0006739_5771_6475 229
689 3300046690 Ga0495624_0014308 Ga0495624_0014308_1518_2222 229
690 3300046690 Ga0495624_0362501 Ga0495624_0362501_99_803 229
691 3300046691 Ga0495670_0135427 Ga0495670_0135427_432_1136 229
692 3300046694 Ga0495649_0165816 Ga0495649_0165816_287_991 229
693 3300046794 Ga0495589_0227350 Ga0495589_0227350_154_858 229
694 3300046809 Ga0495600_0014821 Ga0495600_0014821_2053_2823 229
695 3300046809 Ga0495600_0110322 Ga0495600_0110322_826_1530 229
696 3300046810 Ga0495660_0132716 Ga0495660_0132716_112_816 229
697 3300047317 Ga0495604_0016027 Ga0495604_0016027_2386_3156 229
698 3300047317 Ga0495604_0020734 Ga0495604_0020734_2015_2719 229
699 3300047319 Ga0495674_0120604 Ga0495674_0120604_682_1452 229
700 3300047320 Ga0495672_0238441 Ga0495672_0238441_90_794 229
701 3300047321 Ga0495676_0001378 Ga0495676_0001378_19990_20691 229
702 3300047321 Ga0495676_0026048 Ga0495676_0026048_1556_2275 229
703 3300047321 Ga0495676_0055392 Ga0495676_0055392_1676_2380 229
704 3300047322 Ga0495680_0002145 Ga0495680_0002145_2551_3321 229
705 3300047322 Ga0495680_0010272 Ga0495680_0010272_6830_7534 229
706 3300047443 Ga0495687_023981 Ga0495687_023981_1837_2541 229
707 3300047443 Ga0495687_073012 Ga0495687_073012_110_814 229
708 3300047444 Ga0495675_0004402 Ga0495675_0004402_1740_2510 229
709 3300047445 Ga0495677_0094727 Ga0495677_0094727_261_965 229
710 3300047447 Ga0495685_092965 Ga0495685_092965_168_872 229
711 3300047471 Ga0495684_0030858 Ga0495684_0030858_2312_3082 229
712 3300047673 Ga0495593_0021941 Ga0495593_0021941_1394_2098 229
713 3300047673 Ga0495593_0026111 Ga0495593_0026111_1793_2497 229
714 3300048088 Ga0495602_0039724 Ga0495602_0039724_1360_2130 229
715 3300048088 Ga0495602_0248473 Ga0495602_0248473_492_1304 229
716 3300048089 Ga0495614_0021021 Ga0495614_0021021_1700_2401 229
717 3300048089 Ga0495614_0060964 Ga0495614_0060964_295_999 229
718 3300048089 Ga0495614_0172222 Ga0495614_0172222_34_738 229
719 3300048905 Ga0496102_0048348 Ga0496102_0048348_986_1702 229
720 3300048907 Ga0496104_0595854 Ga0496104_0595854_153_869 229
721 3300048908 Ga0496105_0004683 Ga0496105_0004683_6437_7153 229
722 3300048911 Ga0496108_0002269 Ga0496108_0002269_14662_15378 229
723 3300048916 Ga0496113_0002886 Ga0496113_0002886_4774_5490 229
724 3300048917 Ga0496114_0333909 Ga0496114_0333909_601_1317 229
725 3300048918 Ga0496115_0088219 Ga0496115_0088219_794_1510 229
726 3300049459 Ga0495678_026140 Ga0495678_026140_102_806 229
727 3300049568 Ga0501031_0220787 Ga0501031_0220787_284_1018 229
728 3300049577 Ga0501041_0225661 Ga0501041_0225661_117_851 229
729 3300049578 Ga0501042_0036140 Ga0501042_0036140_610_1308 229
730 3300049822 Ga0501035_0022357 Ga0501035_0022357_2114_2974 229
731 3300049824 Ga0501045_0294743 Ga0501045_0294743_369_1103 229
732 iso_pu_bacteria 2966598605 2966599525 229
733 iso_pu_bacteria 2997451912 2997455265 229
734 3300005458 Ga0070681_10398382 Ga0070681_103983822 230
735 3300013307 Ga0157372_10592947 Ga0157372_105929472 230
736 3300013307 Ga0157372_10695616 Ga0157372_106956161 230
737 3300020070 Ga0206356_10181501 Ga0206356_101815011 230
738 3300021388 Ga0213875_10028304 Ga0213875_100283043 230
739 3300022467 Ga0224712_10118669 Ga0224712_101186692 230
740 3300025932 Ga0207690_10046792 Ga0207690_100467921 230
741 3300028666 Ga0265336_10005555 Ga0265336_100055554 230
742 3300028786 Ga0307517_10012612 Ga0307517_100126129 230
743 3300028794 Ga0307515_10000287 Ga0307515_1000028760 230
744 3300028800 Ga0265338_10008871 Ga0265338_100088712 230
745 3300030521 Ga0307511_10001720 Ga0307511_100017205 230
746 3300030521 Ga0307511_10065316 Ga0307511_100653163 230
747 3300030522 Ga0307512_10073303 Ga0307512_100733033 230
748 3300030522 Ga0307512_10116505 Ga0307512_101165052 230
749 3300031456 Ga0307513_10279780 Ga0307513_102797803 230
750 3300031507 Ga0307509_10050413 Ga0307509_100504132 230
751 3300031507 Ga0307509_10373441 Ga0307509_103734412 230
752 3300031649 Ga0307514_10027128 Ga0307514_100271283 230
753 3300031649 Ga0307514_10130321 Ga0307514_101303213 230
754 3300031730 Ga0307516_10035339 Ga0307516_100353397 230
755 3300031838 Ga0307518_10016155 Ga0307518_100161557 230
756 3300031903 Ga0307407_10063280 Ga0307407_100632802 230
757 3300031995 Ga0307409_100025807 Ga0307409_1000258074 230
758 3300032002 Ga0307416_100215184 Ga0307416_1002151843 230
759 3300032126 Ga0307415_100158083 Ga0307415_1001580832 230
760 3300033179 Ga0307507_10010287 Ga0307507_100102873 230
761 3300033179 Ga0307507_10047750 Ga0307507_100477504 230
762 3300033180 Ga0307510_10000644 Ga0307510_1000064419 230
763 3300033180 Ga0307510_10112929 Ga0307510_101129292 230
764 3300037312 Ga0395899_0323570 Ga0395899_0323570_78_785 230
765 3300037418 Ga0395900_0528046 Ga0395900_0528046_178_885 230
766 3300037466 Ga0395898_0007795 Ga0395898_0007795_4508_5215 230
767 3300037853 Ga0436364_1360402 Ga0436364_1360402_561_1277 230
768 3300038443 Ga0395901_0186849 Ga0395901_0186849_481_1188 230
769 3300042002 Ga0439442_039778 Ga0439442_039778_41_748 230
770 3300042005 Ga0439448_0041472 Ga0439448_0041472_185_892 230
771 3300042006 Ga0439432_085318 Ga0439432_085318_147_854 230
772 3300042136 Ga0450900_023064 Ga0450900_023064_150_857 230
773 3300042138 Ga0450903_000178 Ga0450903_000178_1079_1786 230
774 3300042157 Ga0439458_0000694 Ga0439458_0000694_7906_8613 230
775 3300044658 Ga0466972_0023889 Ga0466972_0023889_1408_2115 230
776 3300044684 Ga0466966_0010560 Ga0466966_0010560_5291_6007 230
777 3300044693 Ga0466961_0107037 Ga0466961_0107037_244_951 230
778 3300044694 Ga0466963_0026338 Ga0466963_0026338_63_779 230
779 3300044719 Ga0466971_0002653 Ga0466971_0002653_1146_1862 230
780 3300044735 Ga0466968_0001070 Ga0466968_0001070_3418_4131 230
781 3300044765 Ga0466970_0001010 Ga0466970_0001010_11580_12287 230
782 3300044765 Ga0466970_0119308 Ga0466970_0119308_175_882 230
783 3300044842 Ga0466957_0042974 Ga0466957_0042974_88_804 230
784 3300044842 Ga0466957_0198397 Ga0466957_0198397_337_1125 230
785 3300044901 Ga0466960_0008740 Ga0466960_0008740_2529_3236 230
786 3300045836 Ga0466958_0000718 Ga0466958_0000718_9428_10144 230
787 3300045836 Ga0466958_0156201 Ga0466958_0156201_677_1393 230
788 3300045836 Ga0466958_0226848 Ga0466958_0226848_422_1129 230
789 3300045976 Ga0466967_0026337 Ga0466967_0026337_3660_4367 230
790 3300045976 Ga0466967_0345556 Ga0466967_0345556_474_1181 230
791 3300046454 Ga0495592_0013138 Ga0495592_0013138_2072_2779 230
792 3300046455 Ga0495603_0005963 Ga0495603_0005963_4881_5582 230
793 3300046459 Ga0495629_0020835 Ga0495629_0020835_2085_2795 230
794 3300046459 Ga0495629_0040143 Ga0495629_0040143_1830_2537 230
795 3300046459 Ga0495629_0335109 Ga0495629_0335109_83_784 230
796 3300046475 Ga0495639_0021326 Ga0495639_0021326_1892_2593 230
797 3300046476 Ga0495662_0000436 Ga0495662_0000436_8783_9490 230
798 3300046476 Ga0495662_0099497 Ga0495662_0099497_255_956 230
799 3300046477 Ga0495664_0013903 Ga0495664_0013903_647_1354 230
800 3300046477 Ga0495664_0378265 Ga0495664_0378265_65_781 230
801 3300046514 Ga0495618_0043697 Ga0495618_0043697_223_930 230
802 3300046536 Ga0495587_0051104 Ga0495587_0051104_494_1201 230
803 3300046559 Ga0495667_0094568 Ga0495667_0094568_623_1330 230
804 3300046642 Ga0495634_0369246 Ga0495634_0369246_106_813 230
805 3300046660 Ga0495625_0007591 Ga0495625_0007591_7133_7843 230
806 3300046660 Ga0495625_0069062 Ga0495625_0069062_1121_1834 230
807 3300046663 Ga0495635_0018440 Ga0495635_0018440_3408_4115 230
808 3300046674 Ga0495588_0030614 Ga0495588_0030614_380_1090 230
809 3300046675 Ga0495657_0020166 Ga0495657_0020166_2845_3552 230
810 3300046683 Ga0495658_0060078 Ga0495658_0060078_828_1535 230
811 3300046689 Ga0495613_0006178 Ga0495613_0006178_4009_4716 230
812 3300046794 Ga0495589_0058130 Ga0495589_0058130_260_961 230
813 3300046809 Ga0495600_0053305 Ga0495600_0053305_105_812 230
814 3300047315 Ga0495581_0025349 Ga0495581_0025349_1918_2625 230
815 3300047317 Ga0495604_0001681 Ga0495604_0001681_154_861 230
816 3300047318 Ga0495636_0000492 Ga0495636_0000492_7423_8124 230
817 3300047319 Ga0495674_0179803 Ga0495674_0179803_455_1171 230
818 3300047321 Ga0495676_0016397 Ga0495676_0016397_3627_4334 230
819 3300047443 Ga0495687_001283 Ga0495687_001283_1486_2193 230
820 3300047443 Ga0495687_016780 Ga0495687_016780_2115_2816 230
821 3300047447 Ga0495685_009381 Ga0495685_009381_276_977 230
822 3300047447 Ga0495685_038671 Ga0495685_038671_276_977 230
823 3300047470 Ga0495681_0016334 Ga0495681_0016334_3442_4152 230
824 3300047673 Ga0495593_0048634 Ga0495593_0048634_1480_2187 230
825 3300048088 Ga0495602_0091463 Ga0495602_0091463_707_1414 230
826 3300048089 Ga0495614_0003869 Ga0495614_0003869_3657_4367 230
827 3300048089 Ga0495614_0018379 Ga0495614_0018379_1244_1951 230
828 3300049568 Ga0501031_0148210 Ga0501031_0148210_480_1214 230
829 3300049569 Ga0501032_0211538 Ga0501032_0211538_162_869 230
830 3300049570 Ga0501033_0007592 Ga0501033_0007592_4235_4942 230
831 3300049570 Ga0501033_0007870 Ga0501033_0007870_6509_7216 230
832 3300049571 Ga0501034_0001799 Ga0501034_0001799_4004_4711 230
833 3300049571 Ga0501034_0179654 Ga0501034_0179654_1031_1738 230
834 3300049572 Ga0501036_0001507 Ga0501036_0001507_15156_15863 230
835 3300049575 Ga0501039_0287137 Ga0501039_0287137_171_878 230
836 3300049579 Ga0501043_0005810 Ga0501043_0005810_239_946 230
837 3300049581 Ga0501047_0011932 Ga0501047_0011932_2157_2864 230
838 3300049583 Ga0501067_0180442 Ga0501067_0180442_99_803 230
839 3300049586 Ga0501070_0004372 Ga0501070_0004372_2697_3404 230
840 3300049590 Ga0501074_0001645 Ga0501074_0001645_6056_6763 230
841 3300049822 Ga0501035_0046679 Ga0501035_0046679_2914_3705 230
842 3300049822 Ga0501035_0051954 Ga0501035_0051954_2005_2712 230
843 3300049822 Ga0501035_0239367 Ga0501035_0239367_183_890 230
844 3300049823 Ga0501044_0005136 Ga0501044_0005136_8209_8916 230
845 3300053077 Ga0495601_0105853 Ga0495601_0105853_758_1474 230
846 3300053088 Ga0500644_0056149 Ga0500644_0056149_286_996 230
847 3300053107 Ga0500560_003768 Ga0500560_003768_1231_1941 230
848 3300053111 Ga0500572_018074 Ga0500572_018074_993_1700 230
849 3300053140 Ga0500573_0018878 Ga0500573_0018878_2148_2855 230
850 3300059424 Ga0590075_033303 Ga0590075_033303_159_866 230
851 3300061719 Ga0466962_0010345 Ga0466962_0010345_2842_3558 230
852 3300003316 rootH1_10041079 rootH1_100410791 231
853 3300003320 rootH2_10125902 rootH2_101259021 231
854 3300003323 rootH1_10000628 rootH1_100006287 231
855 3300003323 rootH1_10039347 rootH1_100393472 231
856 3300003354 JGI25160J50197_1017047 JGI25160J50197_10170473 231
857 3300005435 Ga0070714_100411550 Ga0070714_1004115502 231
858 3300005439 Ga0070711_100198319 Ga0070711_1001983192 231
859 3300020082 Ga0206353_11671143 Ga0206353_116711432 231
860 3300022467 Ga0224712_10046583 Ga0224712_100465831 231
861 3300025929 Ga0207664_10123149 Ga0207664_101231492 231
862 3300037466 Ga0395898_0247181 Ga0395898_0247181_211_945 231
863 3300041460 Ga0451802_1162497 Ga0451802_1162497_73_816 231
864 3300041512 Ga0451853_1404968 Ga0451853_1404968_223_948 231
865 3300046477 Ga0495664_0193671 Ga0495664_0193671_356_1150 231
866 3300046529 Ga0495652_0282800 Ga0495652_0282800_111_956 231
867 3300046690 Ga0495624_0263790 Ga0495624_0263790_205_999 231
868 3300047319 Ga0495674_0037074 Ga0495674_0037074_881_1675 231
869 3300048929 Ga0496126_0039141 Ga0496126_0039141_3088_3816 231
870 3300049568 Ga0501031_0278914 Ga0501031_0278914_56_787 231
871 iso_pu_bacteria 2867369537 2867374914 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00456

Transketolase_N

Transketolase, thiamine diphosphate binding domain

51

258

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vrb-assembly1.cif.gz_A crystal structure of a transketolase from neisseria gonorrhoeae 0.8712 12 227
5vrb-assembly3.cif.gz_C crystal structure of a transketolase from neisseria gonorrhoeae 0.8689 13 229
3rim-assembly2.cif.gz_D crystal structure of mycobacterium tuberculosis transketolase (rv1449c) 0.8558 13 227
5i5g-assembly1.cif.gz_A-2 crystal structure of transketolase mutant-r525l from pichia stipitis 0.8498 30 227
5hgx-assembly1.cif.gz_A crystal structure of transketolase mutant - h261f from pichia stipitis 0.8476 26 227
ID Description Score Start End Superfamily
af_Q2FYT8_1_292_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8977 39 228 3.40.50.970
af_Q58094_1_274_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8561 6 227 3.40.50.970
3rimD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8558 13 227 3.40.50.970
af_Q4CW17_1_198_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8454 139 227 3.40.50.970
5hjeA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8451 14 227 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A7W9HBD8-F1-model_v4 Transketolase (EC 2.2.1.1) 0.9803 1 230 GO:0000287
GO:0004802
AF-A0A1C5EZ75-F1-model_v4 Transketolase 0.9787 3 231 GO:0000287
AF-A0A2P8B6X8-F1-model_v4 deleted 0.975 4 231
AF-A0A754B5C4-F1-model_v4 Transketolase 0.9743 12 231
AF-A0A4D4KVS4-F1-model_v4 Transketolase N-terminal domain-containing protein 0.9736 105 231 GO:0000287

Feature Viewer

pLDDT pTM Quality
91.06 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map