F484204
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 871 | 416 | 805 | 229 |
Family's Representative Sequence
| Representative Sequence | 3300049822|Ga0501035_0046679|Ga0501035_0046679_2914_3705 |
| Length | 263 |
| Sequence | VIAHPFPRPHHLRVTLDLKLGRGRTIDGMTITEQRTQTYGYSDLPGLMGLMTGDEKHGPAATSTLDVLWVLYDRVLRVGPDSADAPGRDRFLLSKGHGPMAYYAVLAAKGFLPADWLPGFSSYDSPLGHHPDRTLVPGVEIGSGSLGHGLPIAVGTALGLRAQGLHDPAVWTLIGDAELDEGSNHEAIAFAGPAGLDRLHTVVVDNSSASYARPGGIAARFEAAGWAARTVDGRDHDALYAAFTAPHPGRPHVVVARVEPKNA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 2 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 3 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 4 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 5 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 6 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 7 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 8 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 9 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 10 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 11 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 12 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 13 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 14 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 15 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 16 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 17 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 18 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 19 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 20 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 21 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 22 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 23 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 24 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 25 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 26 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 27 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 28 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 29 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 30 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 31 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 32 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 33 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 34 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 35 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 36 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 37 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 38 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 39 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 40 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 41 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 42 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 43 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 44 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 45 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 46 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 47 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 48 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 49 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 50 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 51 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 52 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 53 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 54 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 55 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 56 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 57 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 58 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 62 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 80 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 89 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 93 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 100 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 101 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 107 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 108 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 109 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 110 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 111 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 112 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 113 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 136 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 183 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 184 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 186 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 187 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 188 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 189 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 190 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 191 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 192 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 193 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 194 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 195 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 196 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 197 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 200 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 201 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 208 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 209 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 211 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 213 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 217 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 218 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 219 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 222 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 223 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 224 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 225 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 227 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 228 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 229 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 230 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 231 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 232 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 233 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 234 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 235 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 236 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 237 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 238 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 239 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 240 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 241 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 242 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 243 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 244 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 245 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 246 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 247 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 248 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 249 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 250 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 251 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 252 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 253 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 254 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 336 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 337 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 338 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 339 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 340 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 341 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 344 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 345 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 346 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 347 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 348 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 349 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 382 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 394 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 395 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 396 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 397 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 398 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 400 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 402 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 403 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 404 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 405 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 406 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 407 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 408 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 409 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 410 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 411 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 412 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 413 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 414 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 415 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 416 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.39 |
| Metatranscriptomes | 0.8 |
| Isolates | 7.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.92 |
| Nodule | 0.34 |
| Rhizoplane | 3.67 |
| Rhizosphere | 86.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10041079 | 3300003316 | Bacteria | 2974 |
| 2 | rootH1_10041079 | 3300003323 | Bacteria | 7321 |
| 3 | rootH2_10014028 | 3300003320 | Bacteria | 5668 |
| 4 | rootH2_10125902 | 3300003320 | Bacteria | 2570 |
| 5 | rootH1_10000628 | 3300003323 | Bacteria | 10860 |
| 6 | rootH1_10039347 | 3300003316 | Bacteria | 17782 |
| 7 | rootH1_10039347 | 3300003323 | Bacteria | 1765 |
| 8 | rootH1_10093147 | 3300003323 | Bacteria | 2461 |
| 9 | JGI25160J50197_1017047 | 3300003354 | Bacteria | 2317 |
| 10 | JGI25407J50210_10007407 | 3300003373 | Bacteria | 2748 |
| 11 | Ga0070658_10127072 | 3300005327 | Bacteria | 2122 |
| 12 | Ga0070683_100078557 | 3300005329 | Bacteria | 3087 |
| 13 | Ga0070683_100098482 | 3300005329 | Bacteria | 2752 |
| 14 | Ga0070683_100415034 | 3300005329 | Bacteria | 1284 |
| 15 | Ga0068868_100220600 | 3300005338 | Bacteria | 1587 |
| 16 | Ga0070660_100085794 | 3300005339 | Bacteria | 2477 |
| 17 | Ga0070660_100277059 | 3300005339 | Bacteria | 1372 |
| 18 | Ga0070661_100156503 | 3300005344 | Bacteria | 1724 |
| 19 | Ga0070661_100231090 | 3300005344 | Bacteria | 1421 |
| 20 | Ga0070661_100252855 | 3300005344 | Bacteria | 1360 |
| 21 | Ga0070661_100350152 | 3300005344 | Bacteria | 1159 |
| 22 | Ga0070692_10061483 | 3300005345 | Bacteria | 1980 |
| 23 | Ga0070692_10151247 | 3300005345 | Bacteria | 1322 |
| 24 | Ga0070668_100000654 | 3300005347 | Bacteria | 23449 |
| 25 | Ga0070675_100510288 | 3300005354 | Bacteria | 1084 |
| 26 | Ga0070674_100287931 | 3300005356 | Bacteria | 1305 |
| 27 | Ga0070659_100575541 | 3300005366 | Bacteria | 966 |
| 28 | Ga0070709_10020372 | 3300005434 | Bacteria | 3847 |
| 29 | Ga0070709_10061975 | 3300005434 | Bacteria | 2383 |
| 30 | Ga0070709_10088572 | 3300005434 | Bacteria | 2036 |
| 31 | Ga0070709_10443303 | 3300005434 | Bacteria | 977 |
| 32 | Ga0070709_10570442 | 3300005434 | Bacteria | 868 |
| 33 | Ga0070714_100003898 | 3300005435 | Bacteria | 11212 |
| 34 | Ga0070714_100004647 | 3300005435 | Bacteria | 10363 |
| 35 | Ga0070714_100004987 | 3300005435 | Bacteria | 10091 |
| 36 | Ga0070714_100046062 | 3300005435 | Bacteria | 3698 |
| 37 | Ga0070714_100097787 | 3300005435 | Bacteria | 2581 |
| 38 | Ga0070714_100297154 | 3300005435 | Bacteria | 1504 |
| 39 | Ga0070714_100411550 | 3300005435 | Bacteria | 1280 |
| 40 | Ga0070714_100648059 | 3300005435 | Bacteria | 1017 |
| 41 | Ga0070714_101164355 | 3300005435 | Bacteria | 752 |
| 42 | Ga0070713_100010129 | 3300005436 | Bacteria | 6798 |
| 43 | Ga0070713_100017234 | 3300005436 | Bacteria | 5457 |
| 44 | Ga0070713_100291471 | 3300005436 | Bacteria | 1500 |
| 45 | Ga0070710_10000044 | 3300005437 | Bacteria | 58112 |
| 46 | Ga0070710_10000818 | 3300005437 | Bacteria | 14979 |
| 47 | Ga0070710_10026061 | 3300005437 | Bacteria | 3102 |
| 48 | Ga0070711_100007336 | 3300005439 | Bacteria | 6709 |
| 49 | Ga0070711_100198319 | 3300005439 | Bacteria | 1547 |
| 50 | Ga0070711_100471871 | 3300005439 | Bacteria | 1030 |
| 51 | Ga0070705_100273482 | 3300005440 | Bacteria | 1197 |
| 52 | Ga0070705_100517345 | 3300005440 | Bacteria | 909 |
| 53 | Ga0070694_100024596 | 3300005444 | Bacteria | 3888 |
| 54 | Ga0070694_100146697 | 3300005444 | Bacteria | 1719 |
| 55 | Ga0070708_100022119 | 3300005445 | Bacteria | 5389 |
| 56 | Ga0070708_100203359 | 3300005445 | Bacteria | 1854 |
| 57 | Ga0070663_100000249 | 3300005455 | Bacteria | 27248 |
| 58 | Ga0070663_100109548 | 3300005455 | Bacteria | 2073 |
| 59 | Ga0070678_100221563 | 3300005456 | Bacteria | 1573 |
| 60 | Ga0070678_100386459 | 3300005456 | Bacteria | 1212 |
| 61 | Ga0070678_100499511 | 3300005456 | Bacteria | 1073 |
| 62 | Ga0070681_10012815 | 3300005458 | Bacteria | 8322 |
| 63 | Ga0070681_10075300 | 3300005458 | Bacteria | 3335 |
| 64 | Ga0070681_10235076 | 3300005458 | Bacteria | 1747 |
| 65 | Ga0070681_10398382 | 3300005458 | Bacteria | 1288 |
| 66 | Ga0070685_10476091 | 3300005466 | Bacteria | 879 |
| 67 | Ga0070706_100007732 | 3300005467 | Bacteria | 10053 |
| 68 | Ga0070707_100007169 | 3300005468 | Bacteria | 10338 |
| 69 | Ga0070707_100042733 | 3300005468 | Bacteria | 4339 |
| 70 | Ga0070707_100124832 | 3300005468 | Bacteria | 2500 |
| 71 | Ga0070698_100003266 | 3300005471 | Bacteria | 17815 |
| 72 | Ga0070699_100374721 | 3300005518 | Bacteria | 1284 |
| 73 | Ga0070699_100402406 | 3300005518 | Bacteria | 1238 |
| 74 | Ga0070679_100029541 | 3300005530 | Bacteria | 5409 |
| 75 | Ga0070679_100060535 | 3300005530 | Bacteria | 3773 |
| 76 | Ga0070679_100173536 | 3300005530 | Bacteria | 2128 |
| 77 | Ga0070679_100270356 | 3300005530 | Bacteria | 1654 |
| 78 | Ga0070684_100179038 | 3300005535 | Bacteria | 1927 |
| 79 | Ga0070697_100017778 | 3300005536 | Bacteria | 5599 |
| 80 | Ga0068853_100149931 | 3300005539 | Bacteria | 2099 |
| 81 | Ga0068853_100271296 | 3300005539 | Bacteria | 1562 |
| 82 | Ga0070686_100150353 | 3300005544 | Bacteria | 1630 |
| 83 | Ga0070686_100193517 | 3300005544 | Bacteria | 1453 |
| 84 | Ga0070686_100255985 | 3300005544 | Bacteria | 1281 |
| 85 | Ga0070665_100001537 | 3300005548 | Bacteria | 26667 |
| 86 | Ga0070665_100058138 | 3300005548 | Bacteria | 3877 |
| 87 | Ga0070704_100007703 | 3300005549 | Bacteria | 6418 |
| 88 | Ga0068855_100039742 | 3300005563 | Bacteria | 5585 |
| 89 | Ga0068857_100073213 | 3300005577 | Bacteria | 3052 |
| 90 | Ga0068854_100101835 | 3300005578 | Bacteria | 2154 |
| 91 | Ga0068854_100114116 | 3300005578 | Bacteria | 2042 |
| 92 | Ga0068854_100143513 | 3300005578 | Bacteria | 1834 |
| 93 | Ga0068854_100216504 | 3300005578 | Bacteria | 1513 |
| 94 | Ga0068854_100436146 | 3300005578 | Bacteria | 1091 |
| 95 | Ga0068856_100024430 | 3300005614 | Bacteria | 5883 |
| 96 | Ga0068856_100145850 | 3300005614 | Bacteria | 2374 |
| 97 | Ga0068856_100163980 | 3300005614 | Bacteria | 2233 |
| 98 | Ga0068856_100201100 | 3300005614 | Bacteria | 2007 |
| 99 | Ga0068856_100529393 | 3300005614 | Bacteria | 1200 |
| 100 | Ga0070702_100125197 | 3300005615 | Bacteria | 1615 |
| 101 | Ga0068863_100253152 | 3300005841 | Bacteria | 1701 |
| 102 | Ga0068863_100358061 | 3300005841 | Bacteria | 1422 |
| 103 | Ga0081455_10000155 | 3300005937 | Bacteria | 82490 |
| 104 | Ga0081455_10012770 | 3300005937 | Bacteria | 8351 |
| 105 | Ga0081455_10061058 | 3300005937 | Bacteria | 3174 |
| 106 | Ga0081455_10108634 | 3300005937 | Bacteria | 2209 |
| 107 | Ga0081455_10181745 | 3300005937 | Bacteria | 1591 |
| 108 | Ga0081538_10000092 | 3300005981 | Bacteria | 87123 |
| 109 | Ga0081540_1011819 | 3300005983 | Bacteria | 5800 |
| 110 | Ga0070717_10191264 | 3300006028 | Bacteria | 1788 |
| 111 | Ga0070717_10274218 | 3300006028 | Bacteria | 1494 |
| 112 | Ga0070717_10405128 | 3300006028 | Bacteria | 1226 |
| 113 | Ga0070715_10000604 | 3300006163 | Bacteria | 9491 |
| 114 | Ga0070715_10067979 | 3300006163 | Bacteria | 1583 |
| 115 | Ga0070715_10250047 | 3300006163 | Bacteria | 926 |
| 116 | Ga0070716_100014234 | 3300006173 | Bacteria | 4072 |
| 117 | Ga0070716_100135036 | 3300006173 | Bacteria | 1565 |
| 118 | Ga0070712_100001324 | 3300006175 | Bacteria | 15011 |
| 119 | Ga0070712_100170326 | 3300006175 | Bacteria | 1689 |
| 120 | Ga0097621_100026603 | 3300006237 | Bacteria | 4541 |
| 121 | Ga0068871_100549039 | 3300006358 | Bacteria | 1046 |
| 122 | Ga0075428_100105427 | 3300006844 | Bacteria | 3074 |
| 123 | Ga0075430_100021727 | 3300006846 | Bacteria | 5454 |
| 124 | Ga0075431_100001884 | 3300006847 | Bacteria | 19894 |
| 125 | Ga0075431_100167210 | 3300006847 | Bacteria | 2260 |
| 126 | Ga0075434_100080611 | 3300006871 | Bacteria | 3252 |
| 127 | Ga0075434_100086392 | 3300006871 | Bacteria | 3136 |
| 128 | Ga0075434_100587729 | 3300006871 | Bacteria | 1133 |
| 129 | Ga0075429_100045340 | 3300006880 | Bacteria | 3825 |
| 130 | Ga0075435_100026088 | 3300007076 | Bacteria | 4555 |
| 131 | Ga0075435_100037406 | 3300007076 | Bacteria | 3864 |
| 132 | Ga0075435_100277727 | 3300007076 | Bacteria | 1430 |
| 133 | Ga0105250_10136370 | 3300009092 | Bacteria | 1015 |
| 134 | Ga0105240_10296540 | 3300009093 | Bacteria | 1851 |
| 135 | Ga0105240_10430336 | 3300009093 | Bacteria | 1481 |
| 136 | Ga0111539_10041947 | 3300009094 | Bacteria | 5498 |
| 137 | Ga0105245_10066020 | 3300009098 | Bacteria | 3274 |
| 138 | Ga0105245_10329610 | 3300009098 | Bacteria | 1506 |
| 139 | Ga0114129_10020245 | 3300009147 | Bacteria | 9469 |
| 140 | Ga0114129_10037757 | 3300009147 | Bacteria | 6818 |
| 141 | Ga0105243_10076132 | 3300009148 | Bacteria | 2725 |
| 142 | Ga0105237_10138217 | 3300009545 | Bacteria | 2431 |
| 143 | Ga0105237_10378399 | 3300009545 | Bacteria | 1420 |
| 144 | Ga0105238_10047445 | 3300009551 | Bacteria | 4330 |
| 145 | Ga0105238_10201226 | 3300009551 | Bacteria | 1967 |
| 146 | Ga0105249_10004292 | 3300009553 | Bacteria | 12323 |
| 147 | Ga0105249_10252720 | 3300009553 | Bacteria | 1748 |
| 148 | Ga0105239_10048937 | 3300010375 | Bacteria | 4634 |
| 149 | Ga0105239_10767357 | 3300010375 | Bacteria | 1104 |
| 150 | Ga0105239_11177322 | 3300010375 | Bacteria | 883 |
| 151 | Ga0105246_10457669 | 3300011119 | Bacteria | 1074 |
| 152 | Ga0157371_10328289 | 3300013102 | Bacteria | 1111 |
| 153 | Ga0157370_10025062 | 3300013104 | Bacteria | 5904 |
| 154 | Ga0157370_10155952 | 3300013104 | Bacteria | 2124 |
| 155 | Ga0157370_10325871 | 3300013104 | Bacteria | 1416 |
| 156 | Ga0157369_10065615 | 3300013105 | Bacteria | 3906 |
| 157 | Ga0157369_10232162 | 3300013105 | Bacteria | 1929 |
| 158 | Ga0157369_10311976 | 3300013105 | Bacteria | 1635 |
| 159 | Ga0157369_10404040 | 3300013105 | Bacteria | 1417 |
| 160 | Ga0157369_10482019 | 3300013105 | Bacteria | 1284 |
| 161 | Ga0157374_10017252 | 3300013296 | Bacteria | 6355 |
| 162 | Ga0157374_10054840 | 3300013296 | Bacteria | 3719 |
| 163 | Ga0157374_10482444 | 3300013296 | Bacteria | 1243 |
| 164 | Ga0163162_10144977 | 3300013306 | Bacteria | 2490 |
| 165 | Ga0163162_11237451 | 3300013306 | Bacteria | 848 |
| 166 | Ga0157372_10153346 | 3300013307 | Bacteria | 2660 |
| 167 | Ga0157372_10160400 | 3300013307 | Bacteria | 2599 |
| 168 | Ga0157372_10592947 | 3300013307 | Bacteria | 1292 |
| 169 | Ga0157372_10695616 | 3300013307 | Bacteria | 1183 |
| 170 | Ga0157372_10733129 | 3300013307 | Bacteria | 1149 |
| 171 | Ga0157372_10760570 | 3300013307 | Bacteria | 1126 |
| 172 | Ga0157379_10008723 | 3300014968 | Bacteria | 8835 |
| 173 | Ga0157376_10138658 | 3300014969 | Bacteria | 2179 |
| 174 | Ga0206356_10181501 | 3300020070 | Bacteria | 928 |
| 175 | Ga0206356_11179862 | 3300020070 | Bacteria | 2627 |
| 176 | Ga0206350_11409316 | 3300020080 | Bacteria | 1538 |
| 177 | Ga0206353_11671143 | 3300020082 | Bacteria | 1706 |
| 178 | Ga0206353_11785731 | 3300020082 | Bacteria | 890 |
| 179 | Ga0213875_10028304 | 3300021388 | Bacteria | 2663 |
| 180 | Ga0224712_10046583 | 3300022467 | Bacteria | 1665 |
| 181 | Ga0224712_10118669 | 3300022467 | Bacteria | 1143 |
| 182 | Ga0207692_10000357 | 3300025898 | Bacteria | 15729 |
| 183 | Ga0207692_10001795 | 3300025898 | Bacteria | 8137 |
| 184 | Ga0207692_10054028 | 3300025898 | Bacteria | 2049 |
| 185 | Ga0207692_10129548 | 3300025898 | Bacteria | 1423 |
| 186 | Ga0207688_10017141 | 3300025901 | Bacteria | 3936 |
| 187 | Ga0207647_10157646 | 3300025904 | Bacteria | 1325 |
| 188 | Ga0207685_10000722 | 3300025905 | Bacteria | 5998 |
| 189 | Ga0207685_10026039 | 3300025905 | Bacteria | 2028 |
| 190 | Ga0207699_10001097 | 3300025906 | Bacteria | 12779 |
| 191 | Ga0207699_10022227 | 3300025906 | Bacteria | 3433 |
| 192 | Ga0207699_10044847 | 3300025906 | Bacteria | 2576 |
| 193 | Ga0207699_10107805 | 3300025906 | Bacteria | 1780 |
| 194 | Ga0207699_10443580 | 3300025906 | Bacteria | 930 |
| 195 | Ga0207705_10081584 | 3300025909 | Bacteria | 2357 |
| 196 | Ga0207684_10009868 | 3300025910 | Bacteria | 8426 |
| 197 | Ga0207707_10046648 | 3300025912 | Bacteria | 3774 |
| 198 | Ga0207707_10191122 | 3300025912 | Bacteria | 1786 |
| 199 | Ga0207707_10362648 | 3300025912 | Bacteria | 1247 |
| 200 | Ga0207695_10150512 | 3300025913 | Bacteria | 2266 |
| 201 | Ga0207695_10425500 | 3300025913 | Bacteria | 1212 |
| 202 | Ga0207671_10081911 | 3300025914 | Bacteria | 2421 |
| 203 | Ga0207693_10001115 | 3300025915 | Bacteria | 24125 |
| 204 | Ga0207663_10005008 | 3300025916 | Bacteria | 6646 |
| 205 | Ga0207660_10015308 | 3300025917 | Bacteria | 5059 |
| 206 | Ga0207660_10203761 | 3300025917 | Bacteria | 1546 |
| 207 | Ga0207657_10011831 | 3300025919 | Bacteria | 8637 |
| 208 | Ga0207649_10195361 | 3300025920 | Bacteria | 1426 |
| 209 | Ga0207652_10011230 | 3300025921 | Bacteria | 7214 |
| 210 | Ga0207652_10072444 | 3300025921 | Bacteria | 2996 |
| 211 | Ga0207652_10243452 | 3300025921 | Bacteria | 1621 |
| 212 | Ga0207652_10265087 | 3300025921 | Bacteria | 1550 |
| 213 | Ga0207646_10000787 | 3300025922 | Bacteria | 41124 |
| 214 | Ga0207646_10002366 | 3300025922 | Bacteria | 22286 |
| 215 | Ga0207646_10003767 | 3300025922 | Bacteria | 16897 |
| 216 | Ga0207646_10021628 | 3300025922 | Bacteria | 5938 |
| 217 | Ga0207646_10182500 | 3300025922 | Bacteria | 1895 |
| 218 | Ga0207646_10249254 | 3300025922 | Bacteria | 1604 |
| 219 | Ga0207694_10105778 | 3300025924 | Bacteria | 2234 |
| 220 | Ga0207694_10274510 | 3300025924 | Bacteria | 1383 |
| 221 | Ga0207659_10238186 | 3300025926 | Bacteria | 1471 |
| 222 | Ga0207687_10013714 | 3300025927 | Bacteria | 5291 |
| 223 | Ga0207687_10171008 | 3300025927 | Bacteria | 1676 |
| 224 | Ga0207687_10192374 | 3300025927 | Bacteria | 1589 |
| 225 | Ga0207700_10000376 | 3300025928 | Bacteria | 26077 |
| 226 | Ga0207700_10013007 | 3300025928 | Bacteria | 5394 |
| 227 | Ga0207700_10140318 | 3300025928 | Bacteria | 1985 |
| 228 | Ga0207700_10162732 | 3300025928 | Bacteria | 1854 |
| 229 | Ga0207664_10000616 | 3300025929 | Bacteria | 24677 |
| 230 | Ga0207664_10002754 | 3300025929 | Bacteria | 11668 |
| 231 | Ga0207664_10009185 | 3300025929 | Bacteria | 6927 |
| 232 | Ga0207664_10017979 | 3300025929 | Bacteria | 5194 |
| 233 | Ga0207664_10078835 | 3300025929 | Bacteria | 2672 |
| 234 | Ga0207664_10123149 | 3300025929 | Bacteria | 2173 |
| 235 | Ga0207664_10534646 | 3300025929 | Bacteria | 1051 |
| 236 | Ga0207644_10206426 | 3300025931 | Bacteria | 1552 |
| 237 | Ga0207690_10013385 | 3300025932 | Bacteria | 4929 |
| 238 | Ga0207690_10046792 | 3300025932 | Bacteria | 2867 |
| 239 | Ga0207709_10278680 | 3300025935 | Bacteria | 1234 |
| 240 | Ga0207665_10001058 | 3300025939 | Bacteria | 18527 |
| 241 | Ga0207665_10006091 | 3300025939 | Bacteria | 8010 |
| 242 | Ga0207665_10075499 | 3300025939 | Bacteria | 2309 |
| 243 | Ga0207661_10024764 | 3300025944 | Bacteria | 4553 |
| 244 | Ga0207661_10066131 | 3300025944 | Bacteria | 2936 |
| 245 | Ga0207661_10119079 | 3300025944 | Bacteria | 2246 |
| 246 | Ga0207661_10661363 | 3300025944 | Bacteria | 960 |
| 247 | Ga0207667_10048763 | 3300025949 | Bacteria | 4476 |
| 248 | Ga0207712_10013163 | 3300025961 | Bacteria | 5302 |
| 249 | Ga0207668_10047899 | 3300025972 | Bacteria | 2929 |
| 250 | Ga0207640_10177664 | 3300025981 | Bacteria | 1593 |
| 251 | Ga0207640_10208579 | 3300025981 | Bacteria | 1486 |
| 252 | Ga0207640_10565608 | 3300025981 | Bacteria | 957 |
| 253 | Ga0207640_10667565 | 3300025981 | Bacteria | 887 |
| 254 | Ga0207677_10466142 | 3300026023 | Bacteria | 1085 |
| 255 | Ga0207677_10495280 | 3300026023 | Bacteria | 1055 |
| 256 | Ga0207639_10262899 | 3300026041 | Bacteria | 1510 |
| 257 | Ga0207639_10581040 | 3300026041 | Bacteria | 1031 |
| 258 | Ga0207639_10622121 | 3300026041 | Bacteria | 997 |
| 259 | Ga0207678_10000065 | 3300026067 | Bacteria | 83028 |
| 260 | Ga0207678_10062607 | 3300026067 | Bacteria | 3197 |
| 261 | Ga0207678_10064141 | 3300026067 | Bacteria | 3156 |
| 262 | Ga0207702_10123146 | 3300026078 | Bacteria | 2323 |
| 263 | Ga0207702_10179579 | 3300026078 | Bacteria | 1948 |
| 264 | Ga0207702_10432098 | 3300026078 | Bacteria | 1275 |
| 265 | Ga0207702_10760291 | 3300026078 | Bacteria | 957 |
| 266 | Ga0207702_10904689 | 3300026078 | Bacteria | 874 |
| 267 | Ga0207641_10042899 | 3300026088 | Bacteria | 3797 |
| 268 | Ga0207648_11080995 | 3300026089 | Bacteria | 752 |
| 269 | Ga0207676_10102595 | 3300026095 | Bacteria | 2375 |
| 270 | Ga0207674_10032175 | 3300026116 | Bacteria | 5502 |
| 271 | Ga0207674_10060394 | 3300026116 | Bacteria | 3834 |
| 272 | Ga0207675_100608683 | 3300026118 | Bacteria | 1096 |
| 273 | Ga0207683_10187873 | 3300026121 | Bacteria | 1875 |
| 274 | Ga0207683_10290806 | 3300026121 | Bacteria | 1494 |
| 275 | Ga0207698_10431311 | 3300026142 | Bacteria | 1267 |
| 276 | Ga0268266_10003180 | 3300028379 | Bacteria | 16659 |
| 277 | Ga0268266_10071603 | 3300028379 | Bacteria | 3005 |
| 278 | Ga0268266_10272672 | 3300028379 | Bacteria | 1571 |
| 279 | Ga0268266_10700459 | 3300028379 | Bacteria | 976 |
| 280 | Ga0268266_10722210 | 3300028379 | Bacteria | 961 |
| 281 | Ga0268264_10485720 | 3300028381 | Bacteria | 1202 |
| 282 | Ga0265336_10005555 | 3300028666 | Bacteria | 4640 |
| 283 | Ga0307517_10012612 | 3300028786 | Bacteria | 11575 |
| 284 | Ga0307515_10000287 | 3300028794 | Bacteria | 123976 |
| 285 | Ga0307515_10057382 | 3300028794 | Bacteria | 5635 |
| 286 | Ga0307515_10285340 | 3300028794 | Bacteria | 1353 |
| 287 | Ga0265338_10008871 | 3300028800 | Bacteria | 12124 |
| 288 | Ga0307511_10001720 | 3300030521 | Bacteria | 23047 |
| 289 | Ga0307511_10065316 | 3300030521 | Bacteria | 2725 |
| 290 | Ga0307512_10031261 | 3300030522 | Bacteria | 4614 |
| 291 | Ga0307512_10073303 | 3300030522 | Bacteria | 2523 |
| 292 | Ga0307512_10116505 | 3300030522 | Bacteria | 1736 |
| 293 | Ga0307512_10164737 | 3300030522 | Bacteria | 1288 |
| 294 | Ga0314311_1039871 | 3300030733 | Bacteria | 9000 |
| 295 | Ga0316180_1027963 | 3300030736 | Bacteria | 2277 |
| 296 | Ga0307513_10004055 | 3300031456 | Bacteria | 19633 |
| 297 | Ga0307513_10222279 | 3300031456 | Bacteria | 1708 |
| 298 | Ga0307513_10279780 | 3300031456 | Bacteria | 1446 |
| 299 | Ga0307509_10050413 | 3300031507 | Bacteria | 4457 |
| 300 | Ga0307509_10373441 | 3300031507 | Bacteria | 1141 |
| 301 | Ga0307508_10036278 | 3300031616 | Bacteria | 4439 |
| 302 | Ga0307514_10027128 | 3300031649 | Bacteria | 4628 |
| 303 | Ga0307514_10130321 | 3300031649 | Bacteria | 1733 |
| 304 | Ga0307516_10035339 | 3300031730 | Bacteria | 5015 |
| 305 | Ga0307516_10044287 | 3300031730 | Bacteria | 4404 |
| 306 | Ga0307518_10000187 | 3300031838 | Bacteria | 47022 |
| 307 | Ga0307518_10016155 | 3300031838 | Bacteria | 5346 |
| 308 | Ga0307407_10063280 | 3300031903 | Bacteria | 2170 |
| 309 | Ga0307409_100025807 | 3300031995 | Bacteria | 4130 |
| 310 | Ga0307409_100501832 | 3300031995 | Bacteria | 1182 |
| 311 | Ga0307416_100215184 | 3300032002 | Bacteria | 1837 |
| 312 | Ga0307415_100154126 | 3300032126 | Bacteria | 1772 |
| 313 | Ga0307415_100158083 | 3300032126 | Bacteria | 1753 |
| 314 | Ga0307507_10010287 | 3300033179 | Bacteria | 12137 |
| 315 | Ga0307507_10031670 | 3300033179 | Bacteria | 5544 |
| 316 | Ga0307507_10047750 | 3300033179 | Bacteria | 4175 |
| 317 | Ga0307510_10000644 | 3300033180 | Bacteria | 35417 |
| 318 | Ga0307510_10112929 | 3300033180 | Bacteria | 2452 |
| 319 | Ga0373934_0010252 | 3300035086 | Bacteria | 3518 |
| 320 | Ga0373934_0137327 | 3300035086 | Bacteria | 999 |
| 321 | Ga0373944_0006890 | 3300035089 | Bacteria | 3033 |
| 322 | Ga0373936_0212412 | 3300035113 | Bacteria | 856 |
| 323 | Ga0373953_0019808 | 3300035117 | Bacteria | 2508 |
| 324 | Ga0373954_0054426 | 3300035118 | Bacteria | 1882 |
| 325 | Ga0373956_0011043 | 3300035119 | Bacteria | 3719 |
| 326 | Ga0373956_0122307 | 3300035119 | Bacteria | 1216 |
| 327 | Ga0373957_0041995 | 3300035120 | Bacteria | 1724 |
| 328 | Ga0373943_0019277 | 3300035170 | Bacteria | 3136 |
| 329 | Ga0373955_0359489 | 3300035172 | Bacteria | 882 |
| 330 | Ga0373924_0024459 | 3300035410 | Bacteria | 2380 |
| 331 | Ga0373935_0087985 | 3300035692 | Bacteria | 2029 |
| 332 | Ga0373933_0077075 | 3300035724 | Bacteria | 2037 |
| 333 | Ga0373947_0371043 | 3300035725 | Bacteria | 962 |
| 334 | Ga0373937_0009708 | 3300036401 | Bacteria | 8389 |
| 335 | Ga0373937_0024043 | 3300036401 | Bacteria | 5493 |
| 336 | Ga0373937_0135353 | 3300036401 | Bacteria | 2304 |
| 337 | Ga0373925_0004007 | 3300037068 | Bacteria | 11206 |
| 338 | Ga0373925_0118650 | 3300037068 | Bacteria | 2051 |
| 339 | Ga0395899_0323570 | 3300037312 | Bacteria | 1038 |
| 340 | Ga0395900_0528046 | 3300037418 | Bacteria | 1127 |
| 341 | Ga0395898_0007795 | 3300037466 | Bacteria | 11365 |
| 342 | Ga0395898_0194689 | 3300037466 | Bacteria | 1937 |
| 343 | Ga0395898_0247181 | 3300037466 | Bacteria | 1701 |
| 344 | Ga0436364_1360402 | 3300037853 | Bacteria | 2658 |
| 345 | Ga0395901_0186849 | 3300038443 | Bacteria | 2173 |
| 346 | Ga0395901_0235728 | 3300038443 | Bacteria | 1910 |
| 347 | Ga0436365_0278358 | 3300039437 | Bacteria | 4336 |
| 348 | Ga0439436_0004403 | 3300041404 | Bacteria | 4312 |
| 349 | Ga0439436_0016465 | 3300041404 | Bacteria | 2217 |
| 350 | Ga0439436_0032644 | 3300041404 | Bacteria | 1509 |
| 351 | Ga0439438_042727 | 3300041405 | Bacteria | 1172 |
| 352 | Ga0439439_0003198 | 3300041406 | Bacteria | 3588 |
| 353 | Ga0439439_0010488 | 3300041406 | Bacteria | 2216 |
| 354 | Ga0451802_1162497 | 3300041460 | Bacteria | 831 |
| 355 | Ga0451837_1577462 | 3300041494 | Bacteria | 2969 |
| 356 | Ga0451853_1404968 | 3300041512 | Bacteria | 3970 |
| 357 | Ga0451853_2550968 | 3300041512 | Bacteria | 2847 |
| 358 | Ga0439433_0001272 | 3300041999 | Bacteria | 5209 |
| 359 | Ga0439442_009247 | 3300042002 | Bacteria | 1993 |
| 360 | Ga0439442_023112 | 3300042002 | Bacteria | 1292 |
| 361 | Ga0439442_039778 | 3300042002 | Bacteria | 986 |
| 362 | Ga0439448_0041472 | 3300042005 | Bacteria | 1489 |
| 363 | Ga0439432_085318 | 3300042006 | Bacteria | 953 |
| 364 | Ga0439449_0093824 | 3300042007 | Bacteria | 1108 |
| 365 | Ga0439457_001153 | 3300042014 | Bacteria | 7949 |
| 366 | Ga0439462_0095769 | 3300042015 | Bacteria | 816 |
| 367 | Ga0450900_023064 | 3300042136 | Bacteria | 877 |
| 368 | Ga0450903_000178 | 3300042138 | Bacteria | 13985 |
| 369 | Ga0439446_0023092 | 3300042156 | Bacteria | 1767 |
| 370 | Ga0439458_0000694 | 3300042157 | Bacteria | 8705 |
| 371 | Ga0466969_0017309 | 3300044656 | Bacteria | 3765 |
| 372 | Ga0466972_0007816 | 3300044658 | Bacteria | 5365 |
| 373 | Ga0466972_0012228 | 3300044658 | Bacteria | 4315 |
| 374 | Ga0466972_0014301 | 3300044658 | Bacteria | 3976 |
| 375 | Ga0466972_0023889 | 3300044658 | Bacteria | 3037 |
| 376 | Ga0466965_0000544 | 3300044683 | Bacteria | 13582 |
| 377 | Ga0466965_0027756 | 3300044683 | Bacteria | 2748 |
| 378 | Ga0466965_0071861 | 3300044683 | Bacteria | 1741 |
| 379 | Ga0466965_0081301 | 3300044683 | Bacteria | 1638 |
| 380 | Ga0466966_0010560 | 3300044684 | Bacteria | 6138 |
| 381 | Ga0466966_0012306 | 3300044684 | Bacteria | 5669 |
| 382 | Ga0466966_0118121 | 3300044684 | Unclassified | 1631 |
| 383 | Ga0466961_0016316 | 3300044693 | Bacteria | 4770 |
| 384 | Ga0466961_0107037 | 3300044693 | Bacteria | 1760 |
| 385 | Ga0466961_0370172 | 3300044693 | Unclassified | 871 |
| 386 | Ga0466961_0388562 | 3300044693 | Bacteria | 847 |
| 387 | Ga0466963_0026338 | 3300044694 | Bacteria | 3718 |
| 388 | Ga0466963_0036762 | 3300044694 | Bacteria | 3194 |
| 389 | Ga0466963_0057304 | 3300044694 | Bacteria | 2595 |
| 390 | Ga0466963_0117072 | 3300044694 | Bacteria | 1831 |
| 391 | Ga0466964_0052239 | 3300044706 | Bacteria | 1680 |
| 392 | Ga0466964_0134798 | 3300044706 | Bacteria | 1129 |
| 393 | Ga0466971_0002653 | 3300044719 | Bacteria | 7553 |
| 394 | Ga0466971_0009135 | 3300044719 | Bacteria | 4334 |
| 395 | Ga0466968_0001070 | 3300044735 | Bacteria | 9698 |
| 396 | Ga0466968_0005233 | 3300044735 | Bacteria | 4860 |
| 397 | Ga0466968_0083235 | 3300044735 | Bacteria | 1409 |
| 398 | Ga0466968_0124218 | 3300044735 | Bacteria | 1170 |
| 399 | Ga0466970_0001010 | 3300044765 | Bacteria | 13557 |
| 400 | Ga0466970_0017784 | 3300044765 | Bacteria | 3675 |
| 401 | Ga0466970_0066150 | 3300044765 | Bacteria | 1940 |
| 402 | Ga0466970_0119208 | 3300044765 | Bacteria | 1445 |
| 403 | Ga0466970_0119308 | 3300044765 | Bacteria | 1444 |
| 404 | Ga0466970_0143464 | 3300044765 | Bacteria | 1316 |
| 405 | Ga0466970_0221070 | 3300044765 | Bacteria | 1057 |
| 406 | Ga0466970_0252014 | 3300044765 | Bacteria | 989 |
| 407 | Ga0466957_0006437 | 3300044842 | Bacteria | 6631 |
| 408 | Ga0466957_0042974 | 3300044842 | Bacteria | 2735 |
| 409 | Ga0466957_0065104 | 3300044842 | Bacteria | 2244 |
| 410 | Ga0466957_0110442 | 3300044842 | Bacteria | 1743 |
| 411 | Ga0466957_0198397 | 3300044842 | Bacteria | 1317 |
| 412 | Ga0466960_0003032 | 3300044901 | Bacteria | 6411 |
| 413 | Ga0466960_0008740 | 3300044901 | Bacteria | 4157 |
| 414 | Ga0466959_0107109 | 3300045049 | Bacteria | 1998 |
| 415 | Ga0466958_0000718 | 3300045836 | Bacteria | 14480 |
| 416 | Ga0466958_0033825 | 3300045836 | Bacteria | 3047 |
| 417 | Ga0466958_0049358 | 3300045836 | Bacteria | 2546 |
| 418 | Ga0466958_0104637 | 3300045836 | Bacteria | 1763 |
| 419 | Ga0466958_0109359 | 3300045836 | Bacteria | 1725 |
| 420 | Ga0466958_0156201 | 3300045836 | Bacteria | 1440 |
| 421 | Ga0466958_0226848 | 3300045836 | Bacteria | 1192 |
| 422 | Ga0466967_0026337 | 3300045976 | Bacteria | 4815 |
| 423 | Ga0466967_0076001 | 3300045976 | Bacteria | 3020 |
| 424 | Ga0466967_0206357 | 3300045976 | Bacteria | 1863 |
| 425 | Ga0466967_0231742 | 3300045976 | Bacteria | 1758 |
| 426 | Ga0466967_0233958 | 3300045976 | Bacteria | 1750 |
| 427 | Ga0466967_0272735 | 3300045976 | Bacteria | 1621 |
| 428 | Ga0466967_0345556 | 3300045976 | Bacteria | 1439 |
| 429 | Ga0466967_0899349 | 3300045976 | Bacteria | 880 |
| 430 | Ga0495617_049616 | 3300046452 | Bacteria | 1396 |
| 431 | Ga0495592_0013138 | 3300046454 | Bacteria | 6302 |
| 432 | Ga0495592_0017645 | 3300046454 | Bacteria | 5424 |
| 433 | Ga0495592_0032833 | 3300046454 | Bacteria | 3915 |
| 434 | Ga0495592_0168274 | 3300046454 | Bacteria | 1502 |
| 435 | Ga0495592_0278936 | 3300046454 | Bacteria | 1094 |
| 436 | Ga0495603_0000038 | 3300046455 | Bacteria | 56885 |
| 437 | Ga0495603_0005963 | 3300046455 | Bacteria | 7286 |
| 438 | Ga0495603_0033390 | 3300046455 | Bacteria | 3096 |
| 439 | Ga0495603_0055304 | 3300046455 | Bacteria | 2351 |
| 440 | Ga0495629_0005692 | 3300046459 | Bacteria | 9307 |
| 441 | Ga0495629_0006176 | 3300046459 | Bacteria | 8897 |
| 442 | Ga0495629_0020835 | 3300046459 | Bacteria | 4679 |
| 443 | Ga0495629_0040143 | 3300046459 | Bacteria | 3292 |
| 444 | Ga0495629_0125586 | 3300046459 | Bacteria | 1787 |
| 445 | Ga0495629_0174973 | 3300046459 | Bacteria | 1489 |
| 446 | Ga0495629_0335109 | 3300046459 | Bacteria | 1033 |
| 447 | Ga0495638_0073293 | 3300046460 | Bacteria | 2090 |
| 448 | Ga0495638_0197410 | 3300046460 | Bacteria | 1138 |
| 449 | Ga0495651_0002692 | 3300046462 | Bacteria | 13787 |
| 450 | Ga0495651_0007293 | 3300046462 | Bacteria | 8453 |
| 451 | Ga0495651_0248148 | 3300046462 | Bacteria | 1217 |
| 452 | Ga0495653_0077176 | 3300046463 | Bacteria | 2474 |
| 453 | Ga0495650_0023768 | 3300046471 | Bacteria | 2910 |
| 454 | Ga0495580_0069800 | 3300046472 | Bacteria | 2455 |
| 455 | Ga0495580_0101543 | 3300046472 | Bacteria | 2000 |
| 456 | Ga0495582_0039185 | 3300046473 | Bacteria | 2609 |
| 457 | Ga0495605_0107843 | 3300046474 | Bacteria | 1274 |
| 458 | Ga0495639_0021326 | 3300046475 | Bacteria | 2834 |
| 459 | Ga0495662_0000436 | 3300046476 | Bacteria | 18733 |
| 460 | Ga0495662_0022526 | 3300046476 | Bacteria | 3041 |
| 461 | Ga0495662_0095002 | 3300046476 | Bacteria | 1456 |
| 462 | Ga0495662_0099497 | 3300046476 | Bacteria | 1422 |
| 463 | Ga0495662_0101616 | 3300046476 | Bacteria | 1406 |
| 464 | Ga0495664_0013903 | 3300046477 | Bacteria | 4562 |
| 465 | Ga0495664_0193671 | 3300046477 | Bacteria | 1232 |
| 466 | Ga0495664_0378265 | 3300046477 | Bacteria | 851 |
| 467 | Ga0495584_0114125 | 3300046491 | Bacteria | 1367 |
| 468 | Ga0495594_0310521 | 3300046499 | Bacteria | 898 |
| 469 | Ga0495594_0439404 | 3300046499 | Bacteria | 742 |
| 470 | Ga0495596_0102831 | 3300046500 | Bacteria | 1110 |
| 471 | Ga0495607_0037006 | 3300046501 | Bacteria | 2934 |
| 472 | Ga0495583_0056746 | 3300046506 | Bacteria | 1764 |
| 473 | Ga0495583_0100817 | 3300046506 | Bacteria | 1232 |
| 474 | Ga0495606_0004135 | 3300046507 | Bacteria | 14728 |
| 475 | Ga0495608_0000081 | 3300046511 | Bacteria | 69898 |
| 476 | Ga0495608_0076379 | 3300046511 | Bacteria | 2182 |
| 477 | Ga0495608_0187339 | 3300046511 | Bacteria | 1307 |
| 478 | Ga0495608_0299594 | 3300046511 | Bacteria | 995 |
| 479 | Ga0495610_0034625 | 3300046512 | Bacteria | 2600 |
| 480 | Ga0495616_0020462 | 3300046513 | Bacteria | 3598 |
| 481 | Ga0495618_0006775 | 3300046514 | Bacteria | 6939 |
| 482 | Ga0495618_0043697 | 3300046514 | Bacteria | 2827 |
| 483 | Ga0495618_0048910 | 3300046514 | Bacteria | 2670 |
| 484 | Ga0495618_0172146 | 3300046514 | Bacteria | 1377 |
| 485 | Ga0495620_0007810 | 3300046515 | Bacteria | 5778 |
| 486 | Ga0495620_0007954 | 3300046515 | Bacteria | 5717 |
| 487 | Ga0495628_0020871 | 3300046516 | Bacteria | 5396 |
| 488 | Ga0495628_0022627 | 3300046516 | Bacteria | 5162 |
| 489 | Ga0495628_0148447 | 3300046516 | Bacteria | 1786 |
| 490 | Ga0495628_0470603 | 3300046516 | Bacteria | 910 |
| 491 | Ga0495628_0537511 | 3300046516 | Bacteria | 840 |
| 492 | Ga0495630_0081592 | 3300046517 | Bacteria | 2440 |
| 493 | Ga0495631_0007379 | 3300046518 | Bacteria | 5593 |
| 494 | Ga0495637_0061409 | 3300046520 | Bacteria | 1541 |
| 495 | Ga0495643_0039751 | 3300046522 | Bacteria | 2571 |
| 496 | Ga0495648_0078830 | 3300046524 | Bacteria | 1882 |
| 497 | Ga0495666_0017841 | 3300046526 | Bacteria | 3535 |
| 498 | Ga0495666_0073113 | 3300046526 | Bacteria | 1627 |
| 499 | Ga0495666_0088084 | 3300046526 | Bacteria | 1466 |
| 500 | Ga0495652_0006178 | 3300046529 | Bacteria | 11176 |
| 501 | Ga0495652_0056716 | 3300046529 | Bacteria | 3325 |
| 502 | Ga0495652_0181027 | 3300046529 | Bacteria | 1617 |
| 503 | Ga0495652_0219301 | 3300046529 | Bacteria | 1430 |
| 504 | Ga0495652_0282800 | 3300046529 | Bacteria | 1214 |
| 505 | Ga0495652_0415896 | 3300046529 | Bacteria | 949 |
| 506 | Ga0495665_0126182 | 3300046531 | Bacteria | 1340 |
| 507 | Ga0495640_0003158 | 3300046533 | Bacteria | 13271 |
| 508 | Ga0495640_0072507 | 3300046533 | Bacteria | 2307 |
| 509 | Ga0495586_0059691 | 3300046535 | Bacteria | 2073 |
| 510 | Ga0495586_0200905 | 3300046535 | Bacteria | 1130 |
| 511 | Ga0495587_0020823 | 3300046536 | Bacteria | 4045 |
| 512 | Ga0495587_0021932 | 3300046536 | Bacteria | 3937 |
| 513 | Ga0495587_0051104 | 3300046536 | Bacteria | 2444 |
| 514 | Ga0495587_0092203 | 3300046536 | Bacteria | 1749 |
| 515 | Ga0495609_0079300 | 3300046538 | Bacteria | 1436 |
| 516 | Ga0495597_0048292 | 3300046542 | Bacteria | 1883 |
| 517 | Ga0495645_0012603 | 3300046543 | Bacteria | 5961 |
| 518 | Ga0495645_0014612 | 3300046543 | Bacteria | 5574 |
| 519 | Ga0495645_0014842 | 3300046543 | Bacteria | 5535 |
| 520 | Ga0495645_0043465 | 3300046543 | Bacteria | 3277 |
| 521 | Ga0495633_0045184 | 3300046558 | Bacteria | 2086 |
| 522 | Ga0495667_0001808 | 3300046559 | Bacteria | 14207 |
| 523 | Ga0495667_0047219 | 3300046559 | Bacteria | 2845 |
| 524 | Ga0495667_0094568 | 3300046559 | Bacteria | 1935 |
| 525 | Ga0495667_0119439 | 3300046559 | Bacteria | 1702 |
| 526 | Ga0495667_0163470 | 3300046559 | Bacteria | 1431 |
| 527 | Ga0495668_0062572 | 3300046616 | Bacteria | 2050 |
| 528 | Ga0495668_0269848 | 3300046616 | Bacteria | 932 |
| 529 | Ga0495634_0017179 | 3300046642 | Bacteria | 5167 |
| 530 | Ga0495634_0022096 | 3300046642 | Bacteria | 4485 |
| 531 | Ga0495634_0090584 | 3300046642 | Bacteria | 1986 |
| 532 | Ga0495634_0369246 | 3300046642 | Bacteria | 856 |
| 533 | Ga0495625_0007591 | 3300046660 | Bacteria | 9415 |
| 534 | Ga0495625_0069062 | 3300046660 | Bacteria | 2483 |
| 535 | Ga0495625_0139481 | 3300046660 | Bacteria | 1636 |
| 536 | Ga0495635_0018440 | 3300046663 | Bacteria | 4869 |
| 537 | Ga0495635_0031036 | 3300046663 | Bacteria | 3712 |
| 538 | Ga0495635_0034588 | 3300046663 | Bacteria | 3505 |
| 539 | Ga0495659_0144150 | 3300046664 | Bacteria | 953 |
| 540 | Ga0495661_0005397 | 3300046665 | Bacteria | 9088 |
| 541 | Ga0495588_0030614 | 3300046674 | Bacteria | 2705 |
| 542 | Ga0495588_0279310 | 3300046674 | Bacteria | 880 |
| 543 | Ga0495657_0018127 | 3300046675 | Bacteria | 5100 |
| 544 | Ga0495657_0020166 | 3300046675 | Bacteria | 4795 |
| 545 | Ga0495657_0118079 | 3300046675 | Bacteria | 1673 |
| 546 | Ga0495599_0004232 | 3300046678 | Bacteria | 8481 |
| 547 | Ga0495599_0394306 | 3300046678 | Bacteria | 825 |
| 548 | Ga0495623_0013779 | 3300046679 | Bacteria | 5241 |
| 549 | Ga0495623_0055675 | 3300046679 | Bacteria | 2492 |
| 550 | Ga0495623_0091737 | 3300046679 | Bacteria | 1863 |
| 551 | Ga0495623_0109229 | 3300046679 | Bacteria | 1678 |
| 552 | Ga0495623_0112950 | 3300046679 | Bacteria | 1644 |
| 553 | Ga0495646_0001725 | 3300046680 | Bacteria | 13115 |
| 554 | Ga0495646_0045970 | 3300046680 | Bacteria | 2664 |
| 555 | Ga0495646_0104388 | 3300046680 | Bacteria | 1620 |
| 556 | Ga0495646_0213872 | 3300046680 | Bacteria | 1045 |
| 557 | Ga0495647_0127657 | 3300046681 | Bacteria | 1075 |
| 558 | Ga0495658_0060078 | 3300046683 | Bacteria | 2179 |
| 559 | Ga0495658_0193310 | 3300046683 | Bacteria | 1266 |
| 560 | Ga0495613_0003220 | 3300046689 | Bacteria | 12219 |
| 561 | Ga0495613_0006178 | 3300046689 | Bacteria | 8964 |
| 562 | Ga0495613_0006739 | 3300046689 | Bacteria | 8578 |
| 563 | Ga0495624_0014308 | 3300046690 | Bacteria | 5387 |
| 564 | Ga0495624_0075002 | 3300046690 | Bacteria | 2101 |
| 565 | Ga0495624_0263790 | 3300046690 | Bacteria | 1041 |
| 566 | Ga0495624_0362501 | 3300046690 | Bacteria | 871 |
| 567 | Ga0495670_0135427 | 3300046691 | Bacteria | 1286 |
| 568 | Ga0495649_0165816 | 3300046694 | Bacteria | 1157 |
| 569 | Ga0495589_0052307 | 3300046794 | Bacteria | 2018 |
| 570 | Ga0495589_0058130 | 3300046794 | Bacteria | 1902 |
| 571 | Ga0495589_0227350 | 3300046794 | Bacteria | 875 |
| 572 | Ga0495600_0014821 | 3300046809 | Bacteria | 4917 |
| 573 | Ga0495600_0053305 | 3300046809 | Bacteria | 2641 |
| 574 | Ga0495600_0054859 | 3300046809 | Bacteria | 2603 |
| 575 | Ga0495600_0076318 | 3300046809 | Bacteria | 2188 |
| 576 | Ga0495600_0110322 | 3300046809 | Bacteria | 1791 |
| 577 | Ga0495660_0132716 | 3300046810 | Bacteria | 1247 |
| 578 | Ga0495581_0025349 | 3300047315 | Bacteria | 3438 |
| 579 | Ga0495604_0001681 | 3300047317 | Bacteria | 18210 |
| 580 | Ga0495604_0008372 | 3300047317 | Bacteria | 8177 |
| 581 | Ga0495604_0016027 | 3300047317 | Bacteria | 5985 |
| 582 | Ga0495604_0016764 | 3300047317 | Bacteria | 5860 |
| 583 | Ga0495604_0020734 | 3300047317 | Bacteria | 5248 |
| 584 | Ga0495604_0082937 | 3300047317 | Bacteria | 2396 |
| 585 | Ga0495604_0167809 | 3300047317 | Bacteria | 1546 |
| 586 | Ga0495636_0000492 | 3300047318 | Bacteria | 14555 |
| 587 | Ga0495674_0037074 | 3300047319 | Bacteria | 4383 |
| 588 | Ga0495674_0120604 | 3300047319 | Bacteria | 2215 |
| 589 | Ga0495674_0179803 | 3300047319 | Bacteria | 1762 |
| 590 | Ga0495674_0619876 | 3300047319 | Bacteria | 855 |
| 591 | Ga0495672_0238441 | 3300047320 | Bacteria | 889 |
| 592 | Ga0495676_0001378 | 3300047321 | Bacteria | 20945 |
| 593 | Ga0495676_0016397 | 3300047321 | Bacteria | 6579 |
| 594 | Ga0495676_0026048 | 3300047321 | Bacteria | 5039 |
| 595 | Ga0495676_0055392 | 3300047321 | Bacteria | 3144 |
| 596 | Ga0495676_0063378 | 3300047321 | Bacteria | 2881 |
| 597 | Ga0495680_0002145 | 3300047322 | Bacteria | 20477 |
| 598 | Ga0495680_0010272 | 3300047322 | Bacteria | 8351 |
| 599 | Ga0495680_0027595 | 3300047322 | Bacteria | 4662 |
| 600 | Ga0495680_0300721 | 3300047322 | Bacteria | 1126 |
| 601 | Ga0495683_0057405 | 3300047323 | Bacteria | 1935 |
| 602 | Ga0495683_0081415 | 3300047323 | Bacteria | 1578 |
| 603 | Ga0495687_001283 | 3300047443 | Bacteria | 23656 |
| 604 | Ga0495687_016780 | 3300047443 | Bacteria | 3672 |
| 605 | Ga0495687_023981 | 3300047443 | Bacteria | 2907 |
| 606 | Ga0495687_073012 | 3300047443 | Bacteria | 1368 |
| 607 | Ga0495675_0004402 | 3300047444 | Bacteria | 8523 |
| 608 | Ga0495675_0011001 | 3300047444 | Bacteria | 5671 |
| 609 | Ga0495675_0027857 | 3300047444 | Bacteria | 3601 |
| 610 | Ga0495675_0031352 | 3300047444 | Bacteria | 3393 |
| 611 | Ga0495675_0254291 | 3300047444 | Bacteria | 1054 |
| 612 | Ga0495677_0094727 | 3300047445 | Bacteria | 1127 |
| 613 | Ga0495685_009381 | 3300047447 | Bacteria | 3266 |
| 614 | Ga0495685_038671 | 3300047447 | Bacteria | 1634 |
| 615 | Ga0495685_092965 | 3300047447 | Bacteria | 998 |
| 616 | Ga0495681_0016334 | 3300047470 | Bacteria | 4164 |
| 617 | Ga0495684_0002552 | 3300047471 | Bacteria | 14487 |
| 618 | Ga0495684_0030858 | 3300047471 | Bacteria | 4114 |
| 619 | Ga0495684_0067917 | 3300047471 | Bacteria | 2711 |
| 620 | Ga0495593_0021941 | 3300047673 | Bacteria | 3562 |
| 621 | Ga0495593_0026111 | 3300047673 | Bacteria | 3228 |
| 622 | Ga0495593_0048634 | 3300047673 | Bacteria | 2253 |
| 623 | Ga0495593_0061116 | 3300047673 | Bacteria | 1971 |
| 624 | Ga0495602_0036878 | 3300048088 | Bacteria | 4544 |
| 625 | Ga0495602_0039724 | 3300048088 | Bacteria | 4328 |
| 626 | Ga0495602_0091463 | 3300048088 | Bacteria | 2523 |
| 627 | Ga0495602_0096673 | 3300048088 | Bacteria | 2435 |
| 628 | Ga0495602_0248473 | 3300048088 | Bacteria | 1327 |
| 629 | Ga0495602_0297058 | 3300048088 | Bacteria | 1183 |
| 630 | Ga0495614_0003869 | 3300048089 | Bacteria | 6729 |
| 631 | Ga0495614_0018379 | 3300048089 | Bacteria | 3028 |
| 632 | Ga0495614_0021021 | 3300048089 | Bacteria | 2821 |
| 633 | Ga0495614_0060964 | 3300048089 | Bacteria | 1620 |
| 634 | Ga0495614_0076287 | 3300048089 | Bacteria | 1449 |
| 635 | Ga0495614_0172222 | 3300048089 | Bacteria | 971 |
| 636 | Ga0496100_0119412 | 3300048903 | Bacteria | 1842 |
| 637 | Ga0496101_0030634 | 3300048904 | Bacteria | 3774 |
| 638 | Ga0496102_0031505 | 3300048905 | Bacteria | 4757 |
| 639 | Ga0496102_0048348 | 3300048905 | Bacteria | 3868 |
| 640 | Ga0496103_0176207 | 3300048906 | Bacteria | 1374 |
| 641 | Ga0496104_0026135 | 3300048907 | Bacteria | 5386 |
| 642 | Ga0496104_0056091 | 3300048907 | Bacteria | 3725 |
| 643 | Ga0496104_0595854 | 3300048907 | Bacteria | 1015 |
| 644 | Ga0496105_0004683 | 3300048908 | Bacteria | 10311 |
| 645 | Ga0496105_0017025 | 3300048908 | Bacteria | 5818 |
| 646 | Ga0496105_0019234 | 3300048908 | Bacteria | 5507 |
| 647 | Ga0496106_0009222 | 3300048909 | Bacteria | 7289 |
| 648 | Ga0496106_0172434 | 3300048909 | Bacteria | 1715 |
| 649 | Ga0496107_0025625 | 3300048910 | Bacteria | 4176 |
| 650 | Ga0496107_0077109 | 3300048910 | Bacteria | 2427 |
| 651 | Ga0496107_0301326 | 3300048910 | Bacteria | 1193 |
| 652 | Ga0496107_0484911 | 3300048910 | Bacteria | 917 |
| 653 | Ga0496108_0002269 | 3300048911 | Bacteria | 15405 |
| 654 | Ga0496108_0026052 | 3300048911 | Bacteria | 4823 |
| 655 | Ga0496109_0065271 | 3300048912 | Bacteria | 3332 |
| 656 | Ga0496110_0035945 | 3300048913 | Bacteria | 4301 |
| 657 | Ga0496110_0075328 | 3300048913 | Bacteria | 2998 |
| 658 | Ga0496111_0100586 | 3300048914 | Bacteria | 2123 |
| 659 | Ga0496111_0405477 | 3300048914 | Bacteria | 1007 |
| 660 | Ga0496113_0002886 | 3300048916 | Bacteria | 10118 |
| 661 | Ga0496114_0055660 | 3300048917 | Bacteria | 3299 |
| 662 | Ga0496114_0293925 | 3300048917 | Bacteria | 1434 |
| 663 | Ga0496114_0333909 | 3300048917 | Bacteria | 1340 |
| 664 | Ga0496115_0088219 | 3300048918 | Bacteria | 2532 |
| 665 | Ga0496115_0172067 | 3300048918 | Bacteria | 1791 |
| 666 | Ga0496126_0039141 | 3300048929 | Bacteria | 4403 |
| 667 | Ga0496126_0072955 | 3300048929 | Bacteria | 3052 |
| 668 | Ga0495678_026140 | 3300049459 | Bacteria | 2496 |
| 669 | Ga0501031_0000271 | 3300049568 | Bacteria | 29369 |
| 670 | Ga0501031_0143497 | 3300049568 | Bacteria | 1560 |
| 671 | Ga0501031_0148210 | 3300049568 | Bacteria | 1533 |
| 672 | Ga0501031_0220787 | 3300049568 | Bacteria | 1234 |
| 673 | Ga0501031_0271846 | 3300049568 | Bacteria | 1100 |
| 674 | Ga0501031_0278914 | 3300049568 | Bacteria | 1084 |
| 675 | Ga0501031_0550610 | 3300049568 | Bacteria | 743 |
| 676 | Ga0501032_0000877 | 3300049569 | Bacteria | 24422 |
| 677 | Ga0501032_0211538 | 3300049569 | Bacteria | 1264 |
| 678 | Ga0501033_0001027 | 3300049570 | Bacteria | 25391 |
| 679 | Ga0501033_0007592 | 3300049570 | Bacteria | 8432 |
| 680 | Ga0501033_0007870 | 3300049570 | Bacteria | 8259 |
| 681 | Ga0501034_0001799 | 3300049571 | Bacteria | 27362 |
| 682 | Ga0501034_0005247 | 3300049571 | Bacteria | 14221 |
| 683 | Ga0501034_0031993 | 3300049571 | Bacteria | 5344 |
| 684 | Ga0501034_0110403 | 3300049571 | Bacteria | 2741 |
| 685 | Ga0501034_0179654 | 3300049571 | Bacteria | 2081 |
| 686 | Ga0501036_0001507 | 3300049572 | Bacteria | 17961 |
| 687 | Ga0501036_0010404 | 3300049572 | Bacteria | 7681 |
| 688 | Ga0501036_0089159 | 3300049572 | Bacteria | 2606 |
| 689 | Ga0501036_0172628 | 3300049572 | Bacteria | 1821 |
| 690 | Ga0501036_0207761 | 3300049572 | Bacteria | 1646 |
| 691 | Ga0501037_0002088 | 3300049573 | Bacteria | 14486 |
| 692 | Ga0501037_0100295 | 3300049573 | Bacteria | 2091 |
| 693 | Ga0501037_0226531 | 3300049573 | Bacteria | 1313 |
| 694 | Ga0501038_0003094 | 3300049574 | Bacteria | 15506 |
| 695 | Ga0501038_0117244 | 3300049574 | Bacteria | 2199 |
| 696 | Ga0501039_0049390 | 3300049575 | Bacteria | 3252 |
| 697 | Ga0501039_0051266 | 3300049575 | Bacteria | 3194 |
| 698 | Ga0501039_0103658 | 3300049575 | Bacteria | 2221 |
| 699 | Ga0501039_0118948 | 3300049575 | Bacteria | 2069 |
| 700 | Ga0501039_0238244 | 3300049575 | Bacteria | 1431 |
| 701 | Ga0501039_0287137 | 3300049575 | Bacteria | 1293 |
| 702 | Ga0501041_0039450 | 3300049577 | Bacteria | 2866 |
| 703 | Ga0501041_0225661 | 3300049577 | Bacteria | 1176 |
| 704 | Ga0501042_0008013 | 3300049578 | Bacteria | 6952 |
| 705 | Ga0501042_0036140 | 3300049578 | Bacteria | 3504 |
| 706 | Ga0501042_0074520 | 3300049578 | Bacteria | 2429 |
| 707 | Ga0501043_0002492 | 3300049579 | Bacteria | 15571 |
| 708 | Ga0501043_0005810 | 3300049579 | Bacteria | 9924 |
| 709 | Ga0501043_0174209 | 3300049579 | Bacteria | 1678 |
| 710 | Ga0501047_0000118 | 3300049581 | Bacteria | 96347 |
| 711 | Ga0501047_0011932 | 3300049581 | Bacteria | 8223 |
| 712 | Ga0501047_0188943 | 3300049581 | Bacteria | 1924 |
| 713 | Ga0501047_0364334 | 3300049581 | Bacteria | 1281 |
| 714 | Ga0501048_0000654 | 3300049582 | Bacteria | 24940 |
| 715 | Ga0501048_0073926 | 3300049582 | Bacteria | 2405 |
| 716 | Ga0501067_0005406 | 3300049583 | Bacteria | 7092 |
| 717 | Ga0501067_0009506 | 3300049583 | Bacteria | 5384 |
| 718 | Ga0501067_0011887 | 3300049583 | Bacteria | 4825 |
| 719 | Ga0501067_0032541 | 3300049583 | Bacteria | 2895 |
| 720 | Ga0501067_0180442 | 3300049583 | Bacteria | 1176 |
| 721 | Ga0501068_0142532 | 3300049584 | Bacteria | 1502 |
| 722 | Ga0501068_0289115 | 3300049584 | Bacteria | 1048 |
| 723 | Ga0501069_0001722 | 3300049585 | Bacteria | 10900 |
| 724 | Ga0501069_0002785 | 3300049585 | Bacteria | 8935 |
| 725 | Ga0501069_0115925 | 3300049585 | Bacteria | 1528 |
| 726 | Ga0501070_0002795 | 3300049586 | Bacteria | 15236 |
| 727 | Ga0501070_0004372 | 3300049586 | Bacteria | 12143 |
| 728 | Ga0501070_0007168 | 3300049586 | Bacteria | 9473 |
| 729 | Ga0501070_0007465 | 3300049586 | Bacteria | 9288 |
| 730 | Ga0501070_0433413 | 3300049586 | Bacteria | 1061 |
| 731 | Ga0501070_0593863 | 3300049586 | Unclassified | 883 |
| 732 | Ga0501071_0020808 | 3300049587 | Bacteria | 4563 |
| 733 | Ga0501071_0041076 | 3300049587 | Bacteria | 3312 |
| 734 | Ga0501071_0058236 | 3300049587 | Bacteria | 2793 |
| 735 | Ga0501071_0220168 | 3300049587 | Bacteria | 1428 |
| 736 | Ga0501072_0014056 | 3300049588 | Bacteria | 6135 |
| 737 | Ga0501072_0273549 | 3300049588 | Bacteria | 1344 |
| 738 | Ga0501073_0027549 | 3300049589 | Bacteria | 4063 |
| 739 | Ga0501074_0001645 | 3300049590 | Bacteria | 15150 |
| 740 | Ga0501074_0007423 | 3300049590 | Bacteria | 7931 |
| 741 | Ga0501074_0074161 | 3300049590 | Bacteria | 2443 |
| 742 | Ga0501074_0089998 | 3300049590 | Bacteria | 2198 |
| 743 | Ga0501074_0439644 | 3300049590 | Bacteria | 925 |
| 744 | Ga0501075_0027122 | 3300049591 | Bacteria | 4220 |
| 745 | Ga0501075_0432365 | 3300049591 | Bacteria | 1004 |
| 746 | Ga0501076_0019494 | 3300049592 | Bacteria | 5186 |
| 747 | Ga0501076_0189270 | 3300049592 | Bacteria | 1679 |
| 748 | Ga0501076_0385777 | 3300049592 | Bacteria | 1151 |
| 749 | Ga0501077_0159263 | 3300049593 | Bacteria | 1433 |
| 750 | Ga0501079_0079936 | 3300049741 | Bacteria | 2528 |
| 751 | Ga0501079_0291744 | 3300049741 | Bacteria | 1276 |
| 752 | Ga0501079_0490860 | 3300049741 | Bacteria | 965 |
| 753 | Ga0501080_0000361 | 3300049742 | Bacteria | 35108 |
| 754 | Ga0501080_0001246 | 3300049742 | Bacteria | 21206 |
| 755 | Ga0501080_0121439 | 3300049742 | Bacteria | 2421 |
| 756 | Ga0501080_0345719 | 3300049742 | Bacteria | 1344 |
| 757 | Ga0501081_0155505 | 3300049743 | Bacteria | 1645 |
| 758 | Ga0501081_0484341 | 3300049743 | Bacteria | 921 |
| 759 | Ga0501083_0176851 | 3300049744 | Bacteria | 1394 |
| 760 | Ga0501035_0003465 | 3300049822 | Bacteria | 15106 |
| 761 | Ga0501035_0022357 | 3300049822 | Bacteria | 5807 |
| 762 | Ga0501035_0046679 | 3300049822 | Bacteria | 3896 |
| 763 | Ga0501035_0051954 | 3300049822 | Bacteria | 3667 |
| 764 | Ga0501035_0239367 | 3300049822 | Bacteria | 1544 |
| 765 | Ga0501044_0005136 | 3300049823 | Bacteria | 14600 |
| 766 | Ga0501044_0078132 | 3300049823 | Bacteria | 3354 |
| 767 | Ga0501044_0288623 | 3300049823 | Bacteria | 1572 |
| 768 | Ga0501045_0111206 | 3300049824 | Bacteria | 2031 |
| 769 | Ga0501045_0179760 | 3300049824 | Bacteria | 1576 |
| 770 | Ga0501045_0221421 | 3300049824 | Bacteria | 1409 |
| 771 | Ga0501045_0228208 | 3300049824 | Bacteria | 1386 |
| 772 | Ga0501045_0294743 | 3300049824 | Bacteria | 1207 |
| 773 | nmdc:mga00v17_80174_c1 | 3300050491 | Bacteria | 2037 |
| 774 | nmdc:mga05p37_193583_c1 | 3300050507 | Bacteria | 2467 |
| 775 | nmdc:mga05p37_815_c1 | 3300050507 | Bacteria | 34870 |
| 776 | nmdc:mga09592_879_c1 | 3300050508 | Bacteria | 23524 |
| 777 | nmdc:mga0qj67_20070_c1 | 3300050509 | Bacteria | 5114 |
| 778 | nmdc:mga06r32_106_c1 | 3300050510 | Bacteria | 58645 |
| 779 | nmdc:mga06r32_1482_c1 | 3300050510 | Bacteria | 21098 |
| 780 | nmdc:mga08y16_2869_c1 | 3300050511 | Bacteria | 17731 |
| 781 | nmdc:mga0n895_166739_c1 | 3300050512 | Bacteria | 2234 |
| 782 | nmdc:mga0n895_199314_c1 | 3300050512 | Bacteria | 2033 |
| 783 | nmdc:mga0rr50_162160_c1 | 3300050513 | Bacteria | 1815 |
| 784 | Ga0495601_0023504 | 3300053077 | Bacteria | 3787 |
| 785 | Ga0495601_0105853 | 3300053077 | Bacteria | 1819 |
| 786 | Ga0495612_0164914 | 3300053078 | Bacteria | 968 |
| 787 | Ga0495655_0137651 | 3300053083 | Bacteria | 757 |
| 788 | Ga0495619_0651134 | 3300053085 | Bacteria | 718 |
| 789 | Ga0500644_0035803 | 3300053088 | Bacteria | 1611 |
| 790 | Ga0500644_0056149 | 3300053088 | Bacteria | 1370 |
| 791 | Ga0500583_0089994 | 3300053092 | Bacteria | 1493 |
| 792 | Ga0500560_003768 | 3300053107 | Bacteria | 3118 |
| 793 | Ga0500572_018074 | 3300053111 | Bacteria | 1820 |
| 794 | Ga0500573_0018878 | 3300053140 | Bacteria | 3939 |
| 795 | Ga0501084_0016029 | 3300054114 | Bacteria | 6219 |
| 796 | Ga0501084_0025730 | 3300054114 | Bacteria | 4907 |
| 797 | Ga0501084_0277760 | 3300054114 | Bacteria | 1414 |
| 798 | Ga0590075_033303 | 3300059424 | Bacteria | 1308 |
| 799 | Ga0501082_0163367 | 3300060353 | Bacteria | 1935 |
| 800 | Ga0501082_0851232 | 3300060353 | Bacteria | 798 |
| 801 | Ga0466962_0010345 | 3300061719 | Bacteria | 4482 |
| 802 | Ga0466962_0035839 | 3300061719 | Bacteria | 2374 |
| 803 | Ga0466962_0131269 | 3300061719 | Unclassified | 1211 |
| 804 | Ga0530510_0085728 | 3300061734 | Bacteria | 2295 |
| 805 | Ga0530510_0094201 | 3300061734 | Bacteria | 2187 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044684 | Ga0466966_0118121 | Ga0466966_0118121_1058_1612 | 184 |
| 2 | 3300005436 | Ga0070713_100291471 | Ga0070713_1002914711 | 189 |
| 3 | 3300053083 | Ga0495655_0137651 | Ga0495655_0137651_52_633 | 191 |
| 4 | 3300006871 | Ga0075434_100080611 | Ga0075434_1000806111 | 196 |
| 5 | 3300007076 | Ga0075435_100026088 | Ga0075435_1000260885 | 196 |
| 6 | 3300009147 | Ga0114129_10020245 | Ga0114129_100202454 | 196 |
| 7 | 3300050507 | nmdc:mga05p37_193583_c1 | nmdc:mga05p37_193583_c1_672_1364 | 196 |
| 8 | 3300050512 | nmdc:mga0n895_166739_c1 | nmdc:mga0n895_166739_c1_25_717 | 196 |
| 9 | 3300050513 | nmdc:mga0rr50_162160_c1 | nmdc:mga0rr50_162160_c1_636_1328 | 196 |
| 10 | 3300005548 | Ga0070665_100001537 | Ga0070665_10000153717 | 206 |
| 11 | 3300028379 | Ga0268266_10003180 | Ga0268266_100031805 | 206 |
| 12 | 3300045976 | Ga0466967_0233958 | Ga0466967_0233958_808_1443 | 207 |
| 13 | 3300005445 | Ga0070708_100022119 | Ga0070708_1000221193 | 208 |
| 14 | 3300005468 | Ga0070707_100007169 | Ga0070707_1000071696 | 208 |
| 15 | 3300005518 | Ga0070699_100402406 | Ga0070699_1004024061 | 208 |
| 16 | 3300025922 | Ga0207646_10002366 | Ga0207646_1000236610 | 208 |
| 17 | 3300005434 | Ga0070709_10020372 | Ga0070709_100203724 | 209 |
| 18 | 3300005435 | Ga0070714_100003898 | Ga0070714_1000038983 | 209 |
| 19 | 3300005436 | Ga0070713_100017234 | Ga0070713_1000172342 | 209 |
| 20 | 3300005437 | Ga0070710_10000818 | Ga0070710_100008182 | 209 |
| 21 | 3300005439 | Ga0070711_100007336 | Ga0070711_1000073363 | 209 |
| 22 | 3300006028 | Ga0070717_10191264 | Ga0070717_101912641 | 209 |
| 23 | 3300006163 | Ga0070715_10067979 | Ga0070715_100679793 | 209 |
| 24 | 3300006173 | Ga0070716_100014234 | Ga0070716_1000142343 | 209 |
| 25 | 3300006175 | Ga0070712_100001324 | Ga0070712_1000013243 | 209 |
| 26 | 3300025898 | Ga0207692_10000357 | Ga0207692_1000035719 | 209 |
| 27 | 3300025898 | Ga0207692_10001795 | Ga0207692_100017958 | 209 |
| 28 | 3300025905 | Ga0207685_10000722 | Ga0207685_100007223 | 209 |
| 29 | 3300025906 | Ga0207699_10001097 | Ga0207699_1000109711 | 209 |
| 30 | 3300025915 | Ga0207693_10001115 | Ga0207693_1000111513 | 209 |
| 31 | 3300025916 | Ga0207663_10005008 | Ga0207663_100050087 | 209 |
| 32 | 3300025928 | Ga0207700_10000376 | Ga0207700_1000037611 | 209 |
| 33 | 3300025929 | Ga0207664_10000616 | Ga0207664_1000061617 | 209 |
| 34 | 3300025939 | Ga0207665_10001058 | Ga0207665_100010588 | 209 |
| 35 | 3300030733 | Ga0314311_1039871 | Ga0314311_10398718 | 209 |
| 36 | 3300030736 | Ga0316180_1027963 | Ga0316180_10279632 | 209 |
| 37 | 3300031456 | Ga0307513_10222279 | Ga0307513_102222792 | 209 |
| 38 | 3300044683 | Ga0466965_0027756 | Ga0466965_0027756_1966_2595 | 209 |
| 39 | 3300044683 | Ga0466965_0081301 | Ga0466965_0081301_32_664 | 209 |
| 40 | 3300046471 | Ga0495650_0023768 | Ga0495650_0023768_351_986 | 209 |
| 41 | 3300005530 | Ga0070679_100060535 | Ga0070679_1000605354 | 210 |
| 42 | 3300045976 | Ga0466967_0272735 | Ga0466967_0272735_232_912 | 210 |
| 43 | 3300046476 | Ga0495662_0101616 | Ga0495662_0101616_444_1079 | 211 |
| 44 | 3300046526 | Ga0495666_0073113 | Ga0495666_0073113_129_794 | 211 |
| 45 | 3300046683 | Ga0495658_0193310 | Ga0495658_0193310_139_804 | 211 |
| 46 | 3300048917 | Ga0496114_0293925 | Ga0496114_0293925_59_724 | 211 |
| 47 | 3300005327 | Ga0070658_10127072 | Ga0070658_101270722 | 212 |
| 48 | 3300005329 | Ga0070683_100078557 | Ga0070683_1000785574 | 212 |
| 49 | 3300005329 | Ga0070683_100098482 | Ga0070683_1000984823 | 212 |
| 50 | 3300005339 | Ga0070660_100085794 | Ga0070660_1000857943 | 212 |
| 51 | 3300005344 | Ga0070661_100156503 | Ga0070661_1001565032 | 212 |
| 52 | 3300005344 | Ga0070661_100231090 | Ga0070661_1002310903 | 212 |
| 53 | 3300005344 | Ga0070661_100252855 | Ga0070661_1002528552 | 212 |
| 54 | 3300005344 | Ga0070661_100350152 | Ga0070661_1003501522 | 212 |
| 55 | 3300005458 | Ga0070681_10012815 | Ga0070681_100128154 | 212 |
| 56 | 3300005458 | Ga0070681_10075300 | Ga0070681_100753003 | 212 |
| 57 | 3300005458 | Ga0070681_10235076 | Ga0070681_102350763 | 212 |
| 58 | 3300005530 | Ga0070679_100029541 | Ga0070679_1000295414 | 212 |
| 59 | 3300005530 | Ga0070679_100173536 | Ga0070679_1001735363 | 212 |
| 60 | 3300005539 | Ga0068853_100149931 | Ga0068853_1001499314 | 212 |
| 61 | 3300005548 | Ga0070665_100058138 | Ga0070665_1000581383 | 212 |
| 62 | 3300005577 | Ga0068857_100073213 | Ga0068857_1000732132 | 212 |
| 63 | 3300005578 | Ga0068854_100101835 | Ga0068854_1001018353 | 212 |
| 64 | 3300005578 | Ga0068854_100114116 | Ga0068854_1001141163 | 212 |
| 65 | 3300005578 | Ga0068854_100143513 | Ga0068854_1001435133 | 212 |
| 66 | 3300005614 | Ga0068856_100024430 | Ga0068856_1000244304 | 212 |
| 67 | 3300005614 | Ga0068856_100145850 | Ga0068856_1001458502 | 212 |
| 68 | 3300005614 | Ga0068856_100529393 | Ga0068856_1005293932 | 212 |
| 69 | 3300009093 | Ga0105240_10296540 | Ga0105240_102965403 | 212 |
| 70 | 3300009093 | Ga0105240_10430336 | Ga0105240_104303363 | 212 |
| 71 | 3300009545 | Ga0105237_10138217 | Ga0105237_101382173 | 212 |
| 72 | 3300009545 | Ga0105237_10378399 | Ga0105237_103783992 | 212 |
| 73 | 3300009551 | Ga0105238_10047445 | Ga0105238_100474454 | 212 |
| 74 | 3300009551 | Ga0105238_10201226 | Ga0105238_102012262 | 212 |
| 75 | 3300010375 | Ga0105239_10767357 | Ga0105239_107673572 | 212 |
| 76 | 3300013102 | Ga0157371_10328289 | Ga0157371_103282891 | 212 |
| 77 | 3300013104 | Ga0157370_10025062 | Ga0157370_100250624 | 212 |
| 78 | 3300013104 | Ga0157370_10155952 | Ga0157370_101559523 | 212 |
| 79 | 3300013105 | Ga0157369_10065615 | Ga0157369_100656154 | 212 |
| 80 | 3300013105 | Ga0157369_10232162 | Ga0157369_102321621 | 212 |
| 81 | 3300013105 | Ga0157369_10404040 | Ga0157369_104040402 | 212 |
| 82 | 3300013296 | Ga0157374_10054840 | Ga0157374_100548403 | 212 |
| 83 | 3300013296 | Ga0157374_10482444 | Ga0157374_104824442 | 212 |
| 84 | 3300013307 | Ga0157372_10153346 | Ga0157372_101533463 | 212 |
| 85 | 3300013307 | Ga0157372_10160400 | Ga0157372_101604003 | 212 |
| 86 | 3300020070 | Ga0206356_11179862 | Ga0206356_111798623 | 212 |
| 87 | 3300025909 | Ga0207705_10081584 | Ga0207705_100815842 | 212 |
| 88 | 3300025912 | Ga0207707_10046648 | Ga0207707_100466484 | 212 |
| 89 | 3300025912 | Ga0207707_10191122 | Ga0207707_101911222 | 212 |
| 90 | 3300025912 | Ga0207707_10362648 | Ga0207707_103626482 | 212 |
| 91 | 3300025913 | Ga0207695_10150512 | Ga0207695_101505122 | 212 |
| 92 | 3300025913 | Ga0207695_10425500 | Ga0207695_104255002 | 212 |
| 93 | 3300025914 | Ga0207671_10081911 | Ga0207671_100819112 | 212 |
| 94 | 3300025917 | Ga0207660_10015308 | Ga0207660_100153084 | 212 |
| 95 | 3300025917 | Ga0207660_10203761 | Ga0207660_102037612 | 212 |
| 96 | 3300025919 | Ga0207657_10011831 | Ga0207657_100118318 | 212 |
| 97 | 3300025920 | Ga0207649_10195361 | Ga0207649_101953612 | 212 |
| 98 | 3300025921 | Ga0207652_10011230 | Ga0207652_100112304 | 212 |
| 99 | 3300025921 | Ga0207652_10265087 | Ga0207652_102650873 | 212 |
| 100 | 3300025924 | Ga0207694_10105778 | Ga0207694_101057782 | 212 |
| 101 | 3300025924 | Ga0207694_10274510 | Ga0207694_102745102 | 212 |
| 102 | 3300025929 | Ga0207664_10534646 | Ga0207664_105346462 | 212 |
| 103 | 3300025932 | Ga0207690_10013385 | Ga0207690_100133853 | 212 |
| 104 | 3300025944 | Ga0207661_10024764 | Ga0207661_100247644 | 212 |
| 105 | 3300025944 | Ga0207661_10066131 | Ga0207661_100661313 | 212 |
| 106 | 3300025944 | Ga0207661_10119079 | Ga0207661_101190791 | 212 |
| 107 | 3300025981 | Ga0207640_10177664 | Ga0207640_101776642 | 212 |
| 108 | 3300025981 | Ga0207640_10208579 | Ga0207640_102085792 | 212 |
| 109 | 3300025981 | Ga0207640_10667565 | Ga0207640_106675652 | 212 |
| 110 | 3300026041 | Ga0207639_10581040 | Ga0207639_105810402 | 212 |
| 111 | 3300026041 | Ga0207639_10622121 | Ga0207639_106221212 | 212 |
| 112 | 3300026067 | Ga0207678_10062607 | Ga0207678_100626073 | 212 |
| 113 | 3300026078 | Ga0207702_10123146 | Ga0207702_101231462 | 212 |
| 114 | 3300026078 | Ga0207702_10432098 | Ga0207702_104320982 | 212 |
| 115 | 3300026078 | Ga0207702_10904689 | Ga0207702_109046892 | 212 |
| 116 | 3300026116 | Ga0207674_10032175 | Ga0207674_100321753 | 212 |
| 117 | 3300026116 | Ga0207674_10060394 | Ga0207674_100603944 | 212 |
| 118 | 3300026142 | Ga0207698_10431311 | Ga0207698_104313112 | 212 |
| 119 | 3300028379 | Ga0268266_10071603 | Ga0268266_100716033 | 212 |
| 120 | 3300032126 | Ga0307415_100154126 | Ga0307415_1001541262 | 212 |
| 121 | 3300037466 | Ga0395898_0194689 | Ga0395898_0194689_797_1435 | 212 |
| 122 | 3300045976 | Ga0466967_0231742 | Ga0466967_0231742_57_695 | 212 |
| 123 | 3300049571 | Ga0501034_0031993 | Ga0501034_0031993_1588_2262 | 212 |
| 124 | 3300049581 | Ga0501047_0364334 | Ga0501047_0364334_386_1060 | 212 |
| 125 | 3300049583 | Ga0501067_0005406 | Ga0501067_0005406_5762_6436 | 212 |
| 126 | 3300049583 | Ga0501067_0009506 | Ga0501067_0009506_3769_4407 | 212 |
| 127 | 3300049584 | Ga0501068_0142532 | Ga0501068_0142532_487_1161 | 212 |
| 128 | 3300049585 | Ga0501069_0002785 | Ga0501069_0002785_4498_5136 | 212 |
| 129 | 3300049586 | Ga0501070_0007465 | Ga0501070_0007465_6167_6841 | 212 |
| 130 | 3300049586 | Ga0501070_0593863 | Ga0501070_0593863_57_695 | 212 |
| 131 | 3300049587 | Ga0501071_0020808 | Ga0501071_0020808_986_1660 | 212 |
| 132 | 3300049589 | Ga0501073_0027549 | Ga0501073_0027549_2733_3407 | 212 |
| 133 | 3300049590 | Ga0501074_0007423 | Ga0501074_0007423_22_696 | 212 |
| 134 | 3300049742 | Ga0501080_0000361 | Ga0501080_0000361_6041_6715 | 212 |
| 135 | 3300049744 | Ga0501083_0176851 | Ga0501083_0176851_389_1063 | 212 |
| 136 | 3300054114 | Ga0501084_0025730 | Ga0501084_0025730_3549_4223 | 212 |
| 137 | 3300005440 | Ga0070705_100517345 | Ga0070705_1005173451 | 213 |
| 138 | 3300049568 | Ga0501031_0550610 | Ga0501031_0550610_48_692 | 213 |
| 139 | 3300049572 | Ga0501036_0089159 | Ga0501036_0089159_491_1135 | 213 |
| 140 | 3300049575 | Ga0501039_0049390 | Ga0501039_0049390_1346_1990 | 213 |
| 141 | 3300049577 | Ga0501041_0039450 | Ga0501041_0039450_1045_1689 | 213 |
| 142 | 3300049582 | Ga0501048_0073926 | Ga0501048_0073926_1480_2124 | 213 |
| 143 | 3300049592 | Ga0501076_0385777 | Ga0501076_0385777_297_941 | 213 |
| 144 | 3300049593 | Ga0501077_0159263 | Ga0501077_0159263_285_929 | 213 |
| 145 | 3300049742 | Ga0501080_0345719 | Ga0501080_0345719_178_831 | 213 |
| 146 | 3300049743 | Ga0501081_0155505 | Ga0501081_0155505_495_1139 | 213 |
| 147 | 3300049824 | Ga0501045_0179760 | Ga0501045_0179760_741_1385 | 213 |
| 148 | 3300061734 | Ga0530510_0085728 | Ga0530510_0085728_1206_1850 | 213 |
| 149 | 3300007076 | Ga0075435_100277727 | Ga0075435_1002777271 | 214 |
| 150 | 3300009098 | Ga0105245_10066020 | Ga0105245_100660202 | 214 |
| 151 | 3300009553 | Ga0105249_10252720 | Ga0105249_102527202 | 214 |
| 152 | 3300010375 | Ga0105239_10048937 | Ga0105239_100489373 | 214 |
| 153 | 3300011119 | Ga0105246_10457669 | Ga0105246_104576691 | 214 |
| 154 | 3300013104 | Ga0157370_10325871 | Ga0157370_103258712 | 214 |
| 155 | 3300013105 | Ga0157369_10482019 | Ga0157369_104820192 | 214 |
| 156 | 3300013296 | Ga0157374_10017252 | Ga0157374_100172524 | 214 |
| 157 | 3300013306 | Ga0163162_10144977 | Ga0163162_101449772 | 214 |
| 158 | 3300013307 | Ga0157372_10760570 | Ga0157372_107605701 | 214 |
| 159 | 3300014968 | Ga0157379_10008723 | Ga0157379_100087234 | 214 |
| 160 | 3300014969 | Ga0157376_10138658 | Ga0157376_101386583 | 214 |
| 161 | 3300025906 | Ga0207699_10443580 | Ga0207699_104435802 | 214 |
| 162 | 3300035086 | Ga0373934_0137327 | Ga0373934_0137327_226_900 | 214 |
| 163 | 3300035089 | Ga0373944_0006890 | Ga0373944_0006890_2160_2834 | 214 |
| 164 | 3300035113 | Ga0373936_0212412 | Ga0373936_0212412_13_687 | 214 |
| 165 | 3300035172 | Ga0373955_0359489 | Ga0373955_0359489_136_810 | 214 |
| 166 | 3300044693 | Ga0466961_0388562 | Ga0466961_0388562_37_723 | 214 |
| 167 | 3300046454 | Ga0495592_0168274 | Ga0495592_0168274_656_1330 | 214 |
| 168 | 3300046455 | Ga0495603_0033390 | Ga0495603_0033390_2053_2703 | 214 |
| 169 | 3300046459 | Ga0495629_0005692 | Ga0495629_0005692_106_813 | 214 |
| 170 | 3300046459 | Ga0495629_0174973 | Ga0495629_0174973_635_1309 | 214 |
| 171 | 3300046462 | Ga0495651_0007293 | Ga0495651_0007293_1031_1705 | 214 |
| 172 | 3300046473 | Ga0495582_0039185 | Ga0495582_0039185_609_1283 | 214 |
| 173 | 3300046474 | Ga0495605_0107843 | Ga0495605_0107843_230_880 | 214 |
| 174 | 3300046476 | Ga0495662_0095002 | Ga0495662_0095002_509_1183 | 214 |
| 175 | 3300046499 | Ga0495594_0310521 | Ga0495594_0310521_210_860 | 214 |
| 176 | 3300046499 | Ga0495594_0439404 | Ga0495594_0439404_62_712 | 214 |
| 177 | 3300046511 | Ga0495608_0299594 | Ga0495608_0299594_309_983 | 214 |
| 178 | 3300046514 | Ga0495618_0006775 | Ga0495618_0006775_5308_6015 | 214 |
| 179 | 3300046514 | Ga0495618_0172146 | Ga0495618_0172146_82_756 | 214 |
| 180 | 3300046515 | Ga0495620_0007810 | Ga0495620_0007810_23_673 | 214 |
| 181 | 3300046516 | Ga0495628_0022627 | Ga0495628_0022627_375_1049 | 214 |
| 182 | 3300046516 | Ga0495628_0148447 | Ga0495628_0148447_39_689 | 214 |
| 183 | 3300046516 | Ga0495628_0470603 | Ga0495628_0470603_124_831 | 214 |
| 184 | 3300046516 | Ga0495628_0537511 | Ga0495628_0537511_40_684 | 214 |
| 185 | 3300046517 | Ga0495630_0081592 | Ga0495630_0081592_712_1386 | 214 |
| 186 | 3300046518 | Ga0495631_0007379 | Ga0495631_0007379_22_672 | 214 |
| 187 | 3300046526 | Ga0495666_0088084 | Ga0495666_0088084_773_1423 | 214 |
| 188 | 3300046529 | Ga0495652_0056716 | Ga0495652_0056716_1402_2076 | 214 |
| 189 | 3300046529 | Ga0495652_0219301 | Ga0495652_0219301_630_1337 | 214 |
| 190 | 3300046529 | Ga0495652_0415896 | Ga0495652_0415896_135_809 | 214 |
| 191 | 3300046531 | Ga0495665_0126182 | Ga0495665_0126182_174_848 | 214 |
| 192 | 3300046533 | Ga0495640_0072507 | Ga0495640_0072507_1393_2100 | 214 |
| 193 | 3300046535 | Ga0495586_0059691 | Ga0495586_0059691_214_888 | 214 |
| 194 | 3300046536 | Ga0495587_0020823 | Ga0495587_0020823_1315_1989 | 214 |
| 195 | 3300046543 | Ga0495645_0014612 | Ga0495645_0014612_375_1049 | 214 |
| 196 | 3300046559 | Ga0495667_0119439 | Ga0495667_0119439_775_1449 | 214 |
| 197 | 3300046559 | Ga0495667_0163470 | Ga0495667_0163470_651_1358 | 214 |
| 198 | 3300046616 | Ga0495668_0269848 | Ga0495668_0269848_132_782 | 214 |
| 199 | 3300046642 | Ga0495634_0017179 | Ga0495634_0017179_3077_3784 | 214 |
| 200 | 3300046642 | Ga0495634_0022096 | Ga0495634_0022096_3662_4336 | 214 |
| 201 | 3300046663 | Ga0495635_0034588 | Ga0495635_0034588_562_1236 | 214 |
| 202 | 3300046664 | Ga0495659_0144150 | Ga0495659_0144150_219_869 | 214 |
| 203 | 3300046675 | Ga0495657_0018127 | Ga0495657_0018127_229_936 | 214 |
| 204 | 3300046675 | Ga0495657_0118079 | Ga0495657_0118079_275_949 | 214 |
| 205 | 3300046678 | Ga0495599_0004232 | Ga0495599_0004232_307_981 | 214 |
| 206 | 3300046678 | Ga0495599_0394306 | Ga0495599_0394306_39_812 | 214 |
| 207 | 3300046679 | Ga0495623_0112950 | Ga0495623_0112950_711_1385 | 214 |
| 208 | 3300046680 | Ga0495646_0104388 | Ga0495646_0104388_259_933 | 214 |
| 209 | 3300046680 | Ga0495646_0213872 | Ga0495646_0213872_41_685 | 214 |
| 210 | 3300046690 | Ga0495624_0075002 | Ga0495624_0075002_938_1645 | 214 |
| 211 | 3300046794 | Ga0495589_0052307 | Ga0495589_0052307_946_1596 | 214 |
| 212 | 3300046809 | Ga0495600_0054859 | Ga0495600_0054859_509_1216 | 214 |
| 213 | 3300047317 | Ga0495604_0008372 | Ga0495604_0008372_5688_6395 | 214 |
| 214 | 3300047317 | Ga0495604_0082937 | Ga0495604_0082937_247_921 | 214 |
| 215 | 3300047319 | Ga0495674_0619876 | Ga0495674_0619876_165_839 | 214 |
| 216 | 3300047321 | Ga0495676_0063378 | Ga0495676_0063378_799_1506 | 214 |
| 217 | 3300047322 | Ga0495680_0300721 | Ga0495680_0300721_78_752 | 214 |
| 218 | 3300047323 | Ga0495683_0057405 | Ga0495683_0057405_304_954 | 214 |
| 219 | 3300047323 | Ga0495683_0081415 | Ga0495683_0081415_905_1555 | 214 |
| 220 | 3300047444 | Ga0495675_0011001 | Ga0495675_0011001_21_728 | 214 |
| 221 | 3300047471 | Ga0495684_0002552 | Ga0495684_0002552_3722_4396 | 214 |
| 222 | 3300047673 | Ga0495593_0061116 | Ga0495593_0061116_100_774 | 214 |
| 223 | 3300048088 | Ga0495602_0297058 | Ga0495602_0297058_22_696 | 214 |
| 224 | 3300048089 | Ga0495614_0076287 | Ga0495614_0076287_649_1356 | 214 |
| 225 | 3300048907 | Ga0496104_0026135 | Ga0496104_0026135_3954_4628 | 214 |
| 226 | 3300048908 | Ga0496105_0017025 | Ga0496105_0017025_441_1115 | 214 |
| 227 | 3300048910 | Ga0496107_0301326 | Ga0496107_0301326_215_889 | 214 |
| 228 | 3300048910 | Ga0496107_0484911 | Ga0496107_0484911_173_844 | 214 |
| 229 | 3300048911 | Ga0496108_0026052 | Ga0496108_0026052_2988_3662 | 214 |
| 230 | 3300048912 | Ga0496109_0065271 | Ga0496109_0065271_278_952 | 214 |
| 231 | 3300048913 | Ga0496110_0035945 | Ga0496110_0035945_2367_3041 | 214 |
| 232 | 3300048914 | Ga0496111_0405477 | Ga0496111_0405477_298_972 | 214 |
| 233 | 3300049573 | Ga0501037_0226531 | Ga0501037_0226531_371_1015 | 214 |
| 234 | 3300049578 | Ga0501042_0074520 | Ga0501042_0074520_1111_1755 | 214 |
| 235 | 3300049581 | Ga0501047_0000118 | Ga0501047_0000118_91222_91866 | 214 |
| 236 | 3300050512 | nmdc:mga0n895_199314_c1 | nmdc:mga0n895_199314_c1_587_1261 | 214 |
| 237 | 3300053077 | Ga0495601_0023504 | Ga0495601_0023504_530_1204 | 214 |
| 238 | 3300053078 | Ga0495612_0164914 | Ga0495612_0164914_275_949 | 214 |
| 239 | 3300053085 | Ga0495619_0651134 | Ga0495619_0651134_30_704 | 214 |
| 240 | 3300053088 | Ga0500644_0035803 | Ga0500644_0035803_934_1584 | 214 |
| 241 | 3300053092 | Ga0500583_0089994 | Ga0500583_0089994_441_1091 | 214 |
| 242 | 3300041512 | Ga0451853_2550968 | Ga0451853_2550968_355_1047 | 215 |
| 243 | 3300005445 | Ga0070708_100203359 | Ga0070708_1002033592 | 216 |
| 244 | 3300005468 | Ga0070707_100124832 | Ga0070707_1001248323 | 216 |
| 245 | 3300005471 | Ga0070698_100003266 | Ga0070698_10000326612 | 216 |
| 246 | 3300005518 | Ga0070699_100374721 | Ga0070699_1003747212 | 216 |
| 247 | 3300005536 | Ga0070697_100017778 | Ga0070697_1000177785 | 216 |
| 248 | 3300025922 | Ga0207646_10003767 | Ga0207646_1000376710 | 216 |
| 249 | 3300025922 | Ga0207646_10249254 | Ga0207646_102492542 | 216 |
| 250 | 3300005435 | Ga0070714_101164355 | Ga0070714_1011643551 | 217 |
| 251 | 3300006358 | Ga0068871_100549039 | Ga0068871_1005490392 | 217 |
| 252 | 3300025905 | Ga0207685_10026039 | Ga0207685_100260392 | 217 |
| 253 | 3300048903 | Ga0496100_0119412 | Ga0496100_0119412_377_1057 | 217 |
| 254 | 3300048907 | Ga0496104_0056091 | Ga0496104_0056091_2857_3537 | 217 |
| 255 | 3300048908 | Ga0496105_0019234 | Ga0496105_0019234_1079_1759 | 217 |
| 256 | 3300048909 | Ga0496106_0172434 | Ga0496106_0172434_344_1024 | 217 |
| 257 | 3300048910 | Ga0496107_0025625 | Ga0496107_0025625_1723_2403 | 217 |
| 258 | 3300048913 | Ga0496110_0075328 | Ga0496110_0075328_430_1110 | 217 |
| 259 | 3300048914 | Ga0496111_0100586 | Ga0496111_0100586_516_1196 | 217 |
| 260 | 3300048917 | Ga0496114_0055660 | Ga0496114_0055660_57_737 | 217 |
| 261 | 3300048918 | Ga0496115_0172067 | Ga0496115_0172067_622_1302 | 217 |
| 262 | iso_pu_bacteria | 2738543034 | 2739367211 | 217 |
| 263 | iso_pu_bacteria | 2818991472 | 2819743381 | 217 |
| 264 | 3300005434 | Ga0070709_10570442 | Ga0070709_105704422 | 218 |
| 265 | 3300031456 | Ga0307513_10004055 | Ga0307513_1000405519 | 218 |
| 266 | iso_pu_bacteria | 2791354901 | 2791913488 | 218 |
| 267 | 3300005437 | Ga0070710_10000044 | Ga0070710_1000004449 | 219 |
| 268 | 3300025928 | Ga0207700_10013007 | Ga0207700_100130075 | 219 |
| 269 | 3300044658 | Ga0466972_0014301 | Ga0466972_0014301_1918_2580 | 219 |
| 270 | 3300044683 | Ga0466965_0000544 | Ga0466965_0000544_2984_3646 | 219 |
| 271 | 3300044694 | Ga0466963_0057304 | Ga0466963_0057304_1023_1730 | 219 |
| 272 | 3300044706 | Ga0466964_0052239 | Ga0466964_0052239_900_1607 | 219 |
| 273 | 3300044735 | Ga0466968_0083235 | Ga0466968_0083235_645_1352 | 219 |
| 274 | 3300044901 | Ga0466960_0003032 | Ga0466960_0003032_3655_4317 | 219 |
| 275 | 3300045836 | Ga0466958_0049358 | Ga0466958_0049358_378_1085 | 219 |
| 276 | 3300049741 | Ga0501079_0291744 | Ga0501079_0291744_379_1041 | 219 |
| 277 | 3300005338 | Ga0068868_100220600 | Ga0068868_1002206003 | 220 |
| 278 | 3300005339 | Ga0070660_100277059 | Ga0070660_1002770591 | 220 |
| 279 | 3300005345 | Ga0070692_10151247 | Ga0070692_101512472 | 220 |
| 280 | 3300005356 | Ga0070674_100287931 | Ga0070674_1002879312 | 220 |
| 281 | 3300005366 | Ga0070659_100575541 | Ga0070659_1005755411 | 220 |
| 282 | 3300005435 | Ga0070714_100097787 | Ga0070714_1000977872 | 220 |
| 283 | 3300005456 | Ga0070678_100499511 | Ga0070678_1004995112 | 220 |
| 284 | 3300005535 | Ga0070684_100179038 | Ga0070684_1001790383 | 220 |
| 285 | 3300005544 | Ga0070686_100255985 | Ga0070686_1002559851 | 220 |
| 286 | 3300005615 | Ga0070702_100125197 | Ga0070702_1001251973 | 220 |
| 287 | 3300005937 | Ga0081455_10181745 | Ga0081455_101817452 | 220 |
| 288 | 3300006871 | Ga0075434_100587729 | Ga0075434_1005877292 | 220 |
| 289 | 3300007076 | Ga0075435_100037406 | Ga0075435_1000374063 | 220 |
| 290 | 3300009098 | Ga0105245_10329610 | Ga0105245_103296102 | 220 |
| 291 | 3300009148 | Ga0105243_10076132 | Ga0105243_100761322 | 220 |
| 292 | 3300025901 | Ga0207688_10017141 | Ga0207688_100171411 | 220 |
| 293 | 3300025927 | Ga0207687_10192374 | Ga0207687_101923742 | 220 |
| 294 | 3300025929 | Ga0207664_10009185 | Ga0207664_100091855 | 220 |
| 295 | 3300025935 | Ga0207709_10278680 | Ga0207709_102786802 | 220 |
| 296 | 3300025939 | Ga0207665_10075499 | Ga0207665_100754993 | 220 |
| 297 | 3300026023 | Ga0207677_10495280 | Ga0207677_104952802 | 220 |
| 298 | 3300026089 | Ga0207648_11080995 | Ga0207648_110809951 | 220 |
| 299 | 3300038443 | Ga0395901_0235728 | Ga0395901_0235728_1124_1789 | 220 |
| 300 | 3300041405 | Ga0439438_042727 | Ga0439438_042727_115_780 | 220 |
| 301 | 3300048904 | Ga0496101_0030634 | Ga0496101_0030634_1467_2132 | 220 |
| 302 | 3300048905 | Ga0496102_0031505 | Ga0496102_0031505_2871_3542 | 220 |
| 303 | 3300048909 | Ga0496106_0009222 | Ga0496106_0009222_4623_5288 | 220 |
| 304 | 3300048910 | Ga0496107_0077109 | Ga0496107_0077109_758_1423 | 220 |
| 305 | 3300050491 | nmdc:mga00v17_80174_c1 | nmdc:mga00v17_80174_c1_198_872 | 220 |
| 306 | iso_pu_bacteria | 2891326441 | 2891330896 | 220 |
| 307 | iso_pu_bacteria | 2904765812 | 2904768701 | 220 |
| 308 | iso_pu_bacteria | 2904770941 | 2904772027 | 220 |
| 309 | iso_pu_bacteria | 2908811453 | 2908812679 | 220 |
| 310 | iso_pu_bacteria | 8003314358 | 8003323040 | 220 |
| 311 | 3300026118 | Ga0207675_100608683 | Ga0207675_1006086831 | 221 |
| 312 | 3300041404 | Ga0439436_0032644 | Ga0439436_0032644_13_693 | 221 |
| 313 | 3300042002 | Ga0439442_009247 | Ga0439442_009247_361_1041 | 221 |
| 314 | 3300042015 | Ga0439462_0095769 | Ga0439462_0095769_32_712 | 221 |
| 315 | 3300042156 | Ga0439446_0023092 | Ga0439446_0023092_144_824 | 221 |
| 316 | 3300044658 | Ga0466972_0012228 | Ga0466972_0012228_673_1347 | 221 |
| 317 | 3300044765 | Ga0466970_0066150 | Ga0466970_0066150_550_1224 | 221 |
| 318 | 3300046674 | Ga0495588_0279310 | Ga0495588_0279310_118_789 | 221 |
| 319 | 3300049568 | Ga0501031_0000271 | Ga0501031_0000271_927_1604 | 221 |
| 320 | 3300049569 | Ga0501032_0000877 | Ga0501032_0000877_846_1523 | 221 |
| 321 | 3300049570 | Ga0501033_0001027 | Ga0501033_0001027_814_1491 | 221 |
| 322 | 3300049571 | Ga0501034_0005247 | Ga0501034_0005247_11019_11696 | 221 |
| 323 | 3300049572 | Ga0501036_0010404 | Ga0501036_0010404_4173_4850 | 221 |
| 324 | 3300049573 | Ga0501037_0002088 | Ga0501037_0002088_13064_13741 | 221 |
| 325 | 3300049574 | Ga0501038_0003094 | Ga0501038_0003094_13876_14553 | 221 |
| 326 | 3300049575 | Ga0501039_0118948 | Ga0501039_0118948_1118_1795 | 221 |
| 327 | 3300049579 | Ga0501043_0002492 | Ga0501043_0002492_955_1632 | 221 |
| 328 | 3300049582 | Ga0501048_0000654 | Ga0501048_0000654_11737_12414 | 221 |
| 329 | 3300049583 | Ga0501067_0011887 | Ga0501067_0011887_3054_3731 | 221 |
| 330 | 3300049584 | Ga0501068_0289115 | Ga0501068_0289115_66_743 | 221 |
| 331 | 3300049585 | Ga0501069_0001722 | Ga0501069_0001722_9381_10058 | 221 |
| 332 | 3300049586 | Ga0501070_0007168 | Ga0501070_0007168_918_1595 | 221 |
| 333 | 3300049587 | Ga0501071_0220168 | Ga0501071_0220168_609_1286 | 221 |
| 334 | 3300049590 | Ga0501074_0074161 | Ga0501074_0074161_812_1489 | 221 |
| 335 | 3300049591 | Ga0501075_0432365 | Ga0501075_0432365_64_765 | 221 |
| 336 | 3300049741 | Ga0501079_0490860 | Ga0501079_0490860_28_705 | 221 |
| 337 | 3300049742 | Ga0501080_0001246 | Ga0501080_0001246_19365_20042 | 221 |
| 338 | 3300049822 | Ga0501035_0003465 | Ga0501035_0003465_12600_13277 | 221 |
| 339 | 3300049823 | Ga0501044_0288623 | Ga0501044_0288623_644_1321 | 221 |
| 340 | 3300054114 | Ga0501084_0277760 | Ga0501084_0277760_510_1187 | 221 |
| 341 | iso_pu_bacteria | 8047710418 | 8047713570 | 221 |
| 342 | 3300005937 | Ga0081455_10108634 | Ga0081455_101086342 | 222 |
| 343 | 3300020080 | Ga0206350_11409316 | Ga0206350_114093162 | 222 |
| 344 | 3300028379 | Ga0268266_10700459 | Ga0268266_107004591 | 222 |
| 345 | 3300030522 | Ga0307512_10031261 | Ga0307512_100312612 | 222 |
| 346 | 3300031730 | Ga0307516_10044287 | Ga0307516_100442873 | 222 |
| 347 | 3300044694 | Ga0466963_0036762 | Ga0466963_0036762_1684_2403 | 222 |
| 348 | 3300044842 | Ga0466957_0006437 | Ga0466957_0006437_4244_4963 | 222 |
| 349 | 3300045836 | Ga0466958_0033825 | Ga0466958_0033825_2297_3016 | 222 |
| 350 | 3300005544 | Ga0070686_100193517 | Ga0070686_1001935172 | 223 |
| 351 | 3300044693 | Ga0466961_0370172 | Ga0466961_0370172_185_859 | 223 |
| 352 | 3300045976 | Ga0466967_0076001 | Ga0466967_0076001_2195_2866 | 223 |
| 353 | 3300046679 | Ga0495623_0013779 | Ga0495623_0013779_3965_4789 | 223 |
| 354 | 3300047317 | Ga0495604_0016764 | Ga0495604_0016764_1247_2071 | 223 |
| 355 | 3300047444 | Ga0495675_0027857 | Ga0495675_0027857_2309_3133 | 223 |
| 356 | 3300061719 | Ga0466962_0131269 | Ga0466962_0131269_425_1099 | 223 |
| 357 | iso_pu_bacteria | 2863404153 | 2863410267 | 223 |
| 358 | iso_pu_bacteria | 8056060235 | 8056062542 | 223 |
| 359 | 3300005530 | Ga0070679_100270356 | Ga0070679_1002703562 | 224 |
| 360 | 3300025921 | Ga0207652_10243452 | Ga0207652_102434522 | 224 |
| 361 | 3300044694 | Ga0466963_0117072 | Ga0466963_0117072_67_759 | 224 |
| 362 | 3300044706 | Ga0466964_0134798 | Ga0466964_0134798_260_979 | 224 |
| 363 | 3300044765 | Ga0466970_0143464 | Ga0466970_0143464_63_752 | 224 |
| 364 | 3300044765 | Ga0466970_0252014 | Ga0466970_0252014_131_823 | 224 |
| 365 | 3300045836 | Ga0466958_0109359 | Ga0466958_0109359_976_1668 | 224 |
| 366 | 3300045976 | Ga0466967_0899349 | Ga0466967_0899349_95_787 | 224 |
| 367 | 3300049583 | Ga0501067_0032541 | Ga0501067_0032541_730_1410 | 224 |
| 368 | 3300049586 | Ga0501070_0002795 | Ga0501070_0002795_7188_7874 | 224 |
| 369 | 3300060353 | Ga0501082_0851232 | Ga0501082_0851232_44_766 | 224 |
| 370 | iso_pu_bacteria | 2585427649 | 2586059570 | 224 |
| 371 | iso_pu_bacteria | 2784746763 | 2785339753 | 224 |
| 372 | iso_pu_bacteria | 2802429296 | 2804849158 | 224 |
| 373 | iso_pu_bacteria | 2808606522 | 2809591667 | 224 |
| 374 | iso_pu_bacteria | 2811994879 | 2812354380 | 224 |
| 375 | iso_pu_bacteria | 2852635781 | 2852636002 | 224 |
| 376 | iso_pu_bacteria | 2862382967 | 2862383911 | 224 |
| 377 | iso_pu_bacteria | 2899359706 | 2899364011 | 224 |
| 378 | iso_pu_bacteria | 2946064051 | 2946071323 | 224 |
| 379 | iso_pu_bacteria | 8003314358 | 8003322282 | 224 |
| 380 | iso_pu_bacteria | 8008558824 | 8008564263 | 224 |
| 381 | iso_pu_bacteria | 8048406513 | 8048411911 | 224 |
| 382 | iso_pu_bacteria | 8056207758 | 8056212381 | 224 |
| 383 | 3300005329 | Ga0070683_100415034 | Ga0070683_1004150341 | 225 |
| 384 | 3300005434 | Ga0070709_10443303 | Ga0070709_104433031 | 225 |
| 385 | 3300005435 | Ga0070714_100004647 | Ga0070714_1000046476 | 225 |
| 386 | 3300005436 | Ga0070713_100010129 | Ga0070713_1000101293 | 225 |
| 387 | 3300005455 | Ga0070663_100109548 | Ga0070663_1001095482 | 225 |
| 388 | 3300005466 | Ga0070685_10476091 | Ga0070685_104760911 | 225 |
| 389 | 3300005578 | Ga0068854_100436146 | Ga0068854_1004361462 | 225 |
| 390 | 3300006028 | Ga0070717_10405128 | Ga0070717_104051282 | 225 |
| 391 | 3300020082 | Ga0206353_11785731 | Ga0206353_117857311 | 225 |
| 392 | 3300025927 | Ga0207687_10171008 | Ga0207687_101710083 | 225 |
| 393 | 3300025928 | Ga0207700_10162732 | Ga0207700_101627321 | 225 |
| 394 | 3300026067 | Ga0207678_10064141 | Ga0207678_100641412 | 225 |
| 395 | 3300026078 | Ga0207702_10760291 | Ga0207702_107602911 | 225 |
| 396 | 3300031616 | Ga0307508_10036278 | Ga0307508_100362783 | 225 |
| 397 | 3300039437 | Ga0436365_0278358 | Ga0436365_0278358_1607_2305 | 225 |
| 398 | 3300044656 | Ga0466969_0017309 | Ga0466969_0017309_519_1259 | 225 |
| 399 | 3300044658 | Ga0466972_0007816 | Ga0466972_0007816_3563_4303 | 225 |
| 400 | 3300044684 | Ga0466966_0012306 | Ga0466966_0012306_1088_1828 | 225 |
| 401 | 3300044693 | Ga0466961_0016316 | Ga0466961_0016316_1132_1872 | 225 |
| 402 | 3300044719 | Ga0466971_0009135 | Ga0466971_0009135_3081_3821 | 225 |
| 403 | 3300044735 | Ga0466968_0005233 | Ga0466968_0005233_3494_4234 | 225 |
| 404 | 3300044735 | Ga0466968_0124218 | Ga0466968_0124218_12_698 | 225 |
| 405 | 3300044765 | Ga0466970_0221070 | Ga0466970_0221070_131_871 | 225 |
| 406 | 3300045049 | Ga0466959_0107109 | Ga0466959_0107109_427_1167 | 225 |
| 407 | 3300045976 | Ga0466967_0206357 | Ga0466967_0206357_133_828 | 225 |
| 408 | 3300048929 | Ga0496126_0072955 | Ga0496126_0072955_1639_2358 | 225 |
| 409 | 3300049588 | Ga0501072_0273549 | Ga0501072_0273549_433_1116 | 225 |
| 410 | 3300061719 | Ga0466962_0035839 | Ga0466962_0035839_1272_2012 | 225 |
| 411 | iso_pu_bacteria | 2616644814 | 2616698931 | 225 |
| 412 | iso_pu_bacteria | 2643221601 | 2644014129 | 225 |
| 413 | iso_pu_bacteria | 2643221631 | 2644175477 | 225 |
| 414 | iso_pu_bacteria | 2997600082 | 2997605220 | 225 |
| 415 | 3300005467 | Ga0070706_100007732 | Ga0070706_1000077325 | 226 |
| 416 | 3300005468 | Ga0070707_100042733 | Ga0070707_1000427332 | 226 |
| 417 | 3300025910 | Ga0207684_10009868 | Ga0207684_100098684 | 226 |
| 418 | 3300025922 | Ga0207646_10000787 | Ga0207646_100007876 | 226 |
| 419 | 3300025922 | Ga0207646_10021628 | Ga0207646_100216283 | 226 |
| 420 | 3300031995 | Ga0307409_100501832 | Ga0307409_1005018322 | 226 |
| 421 | 3300035086 | Ga0373934_0010252 | Ga0373934_0010252_1260_1952 | 226 |
| 422 | 3300035117 | Ga0373953_0019808 | Ga0373953_0019808_336_1028 | 226 |
| 423 | 3300035118 | Ga0373954_0054426 | Ga0373954_0054426_356_1048 | 226 |
| 424 | 3300035119 | Ga0373956_0011043 | Ga0373956_0011043_1447_2139 | 226 |
| 425 | 3300035120 | Ga0373957_0041995 | Ga0373957_0041995_176_868 | 226 |
| 426 | 3300035410 | Ga0373924_0024459 | Ga0373924_0024459_307_999 | 226 |
| 427 | 3300035724 | Ga0373933_0077075 | Ga0373933_0077075_52_744 | 226 |
| 428 | 3300036401 | Ga0373937_0009708 | Ga0373937_0009708_3195_3887 | 226 |
| 429 | 3300046454 | Ga0495592_0278936 | Ga0495592_0278936_296_988 | 226 |
| 430 | 3300046511 | Ga0495608_0076379 | Ga0495608_0076379_704_1396 | 226 |
| 431 | 3300046529 | Ga0495652_0181027 | Ga0495652_0181027_188_880 | 226 |
| 432 | 3300046536 | Ga0495587_0092203 | Ga0495587_0092203_888_1580 | 226 |
| 433 | 3300046559 | Ga0495667_0047219 | Ga0495667_0047219_324_1016 | 226 |
| 434 | 3300046679 | Ga0495623_0091737 | Ga0495623_0091737_333_1025 | 226 |
| 435 | 3300046679 | Ga0495623_0109229 | Ga0495623_0109229_329_1021 | 226 |
| 436 | 3300046809 | Ga0495600_0076318 | Ga0495600_0076318_704_1396 | 226 |
| 437 | 3300047317 | Ga0495604_0167809 | Ga0495604_0167809_259_951 | 226 |
| 438 | 3300047322 | Ga0495680_0027595 | Ga0495680_0027595_1374_2066 | 226 |
| 439 | 3300047444 | Ga0495675_0254291 | Ga0495675_0254291_305_997 | 226 |
| 440 | 3300047471 | Ga0495684_0067917 | Ga0495684_0067917_1681_2373 | 226 |
| 441 | 3300048088 | Ga0495602_0036878 | Ga0495602_0036878_799_1491 | 226 |
| 442 | 3300048088 | Ga0495602_0096673 | Ga0495602_0096673_1586_2278 | 226 |
| 443 | 3300049568 | Ga0501031_0271846 | Ga0501031_0271846_210_911 | 226 |
| 444 | 3300049572 | Ga0501036_0207761 | Ga0501036_0207761_59_760 | 226 |
| 445 | 3300049575 | Ga0501039_0103658 | Ga0501039_0103658_955_1656 | 226 |
| 446 | 3300049590 | Ga0501074_0439644 | Ga0501074_0439644_190_891 | 226 |
| 447 | 3300049824 | Ga0501045_0228208 | Ga0501045_0228208_33_734 | 226 |
| 448 | iso_pu_bacteria | 2582581312 | 2585300794 | 226 |
| 449 | iso_pu_bacteria | 2582581313 | 2585304110 | 226 |
| 450 | iso_pu_bacteria | 2582581314 | 2585312103 | 226 |
| 451 | iso_pu_bacteria | 2616644941 | 2616905667 | 226 |
| 452 | iso_pu_bacteria | 2643221548 | 2643761299 | 226 |
| 453 | iso_pu_bacteria | 2643221578 | 2643901655 | 226 |
| 454 | iso_pu_bacteria | 2643221673 | 2644407801 | 226 |
| 455 | iso_pu_bacteria | 2643221682 | 2644459299 | 226 |
| 456 | iso_pu_bacteria | 2784746768 | 2785373192 | 226 |
| 457 | iso_pu_bacteria | 2786546132 | 2786674811 | 226 |
| 458 | iso_pu_bacteria | 2811994917 | 2812482827 | 226 |
| 459 | iso_pu_bacteria | 2818991463 | 2819696155 | 226 |
| 460 | iso_pu_bacteria | 2862507626 | 2862507646 | 226 |
| 461 | iso_pu_bacteria | 2867428634 | 2867436385 | 226 |
| 462 | iso_pu_bacteria | 2912715099 | 2912716000 | 226 |
| 463 | iso_pu_bacteria | 2912723979 | 2912728958 | 226 |
| 464 | iso_pu_bacteria | 2946045630 | 2946046537 | 226 |
| 465 | iso_pu_bacteria | 2954673503 | 2954680591 | 226 |
| 466 | iso_pu_bacteria | 2954682443 | 2954683562 | 226 |
| 467 | iso_pu_bacteria | 3006493962 | 3006494607 | 226 |
| 468 | iso_pu_bacteria | 8008574985 | 8008575866 | 226 |
| 469 | 3300005435 | Ga0070714_100046062 | Ga0070714_1000460626 | 227 |
| 470 | 3300005435 | Ga0070714_100297154 | Ga0070714_1002971542 | 227 |
| 471 | 3300005444 | Ga0070694_100024596 | Ga0070694_1000245964 | 227 |
| 472 | 3300005937 | Ga0081455_10061058 | Ga0081455_100610585 | 227 |
| 473 | 3300013306 | Ga0163162_11237451 | Ga0163162_112374511 | 227 |
| 474 | 3300025929 | Ga0207664_10002754 | Ga0207664_100027548 | 227 |
| 475 | 3300025944 | Ga0207661_10661363 | Ga0207661_106613631 | 227 |
| 476 | 3300028379 | Ga0268266_10722210 | Ga0268266_107222101 | 227 |
| 477 | 3300028794 | Ga0307515_10285340 | Ga0307515_102853403 | 227 |
| 478 | 3300030522 | Ga0307512_10164737 | Ga0307512_101647372 | 227 |
| 479 | 3300041404 | Ga0439436_0004403 | Ga0439436_0004403_2585_3289 | 227 |
| 480 | 3300041406 | Ga0439439_0003198 | Ga0439439_0003198_452_1156 | 227 |
| 481 | 3300041999 | Ga0439433_0001272 | Ga0439433_0001272_1613_2317 | 227 |
| 482 | 3300042002 | Ga0439442_023112 | Ga0439442_023112_178_882 | 227 |
| 483 | 3300044765 | Ga0466970_0119208 | Ga0466970_0119208_88_816 | 227 |
| 484 | 3300044842 | Ga0466957_0110442 | Ga0466957_0110442_404_1132 | 227 |
| 485 | 3300045836 | Ga0466958_0104637 | Ga0466958_0104637_182_910 | 227 |
| 486 | 3300046511 | Ga0495608_0000081 | Ga0495608_0000081_36870_37583 | 227 |
| 487 | 3300046680 | Ga0495646_0001725 | Ga0495646_0001725_5134_5847 | 227 |
| 488 | iso_pu_bacteria | 2791355406 | 2793981130 | 227 |
| 489 | iso_pu_bacteria | 2935390628 | 2935392967 | 227 |
| 490 | iso_pu_bacteria | 2954002825 | 2954009638 | 227 |
| 491 | iso_pu_bacteria | 3006393351 | 3006397002 | 227 |
| 492 | iso_pu_bacteria | 3006486233 | 3006488811 | 227 |
| 493 | iso_pu_bacteria | 8025530807 | 8025535316 | 227 |
| 494 | iso_pu_bacteria | 8047893842 | 8047900180 | 227 |
| 495 | iso_pu_bacteria | 8048127548 | 8048133994 | 227 |
| 496 | iso_pu_bacteria | 8048356638 | 8048358747 | 227 |
| 497 | iso_pu_bacteria | 8048369669 | 8048377127 | 227 |
| 498 | iso_pu_bacteria | 8048379754 | 8048386182 | 227 |
| 499 | 3300003320 | rootH2_10014028 | rootH2_100140282 | 228 |
| 500 | 3300005345 | Ga0070692_10061483 | Ga0070692_100614832 | 228 |
| 501 | 3300005347 | Ga0070668_100000654 | Ga0070668_10000065412 | 228 |
| 502 | 3300005354 | Ga0070675_100510288 | Ga0070675_1005102881 | 228 |
| 503 | 3300005435 | Ga0070714_100004987 | Ga0070714_1000049874 | 228 |
| 504 | 3300005440 | Ga0070705_100273482 | Ga0070705_1002734822 | 228 |
| 505 | 3300005444 | Ga0070694_100146697 | Ga0070694_1001466972 | 228 |
| 506 | 3300005455 | Ga0070663_100000249 | Ga0070663_10000024913 | 228 |
| 507 | 3300005456 | Ga0070678_100221563 | Ga0070678_1002215632 | 228 |
| 508 | 3300005456 | Ga0070678_100386459 | Ga0070678_1003864591 | 228 |
| 509 | 3300005539 | Ga0068853_100271296 | Ga0068853_1002712962 | 228 |
| 510 | 3300005544 | Ga0070686_100150353 | Ga0070686_1001503532 | 228 |
| 511 | 3300005549 | Ga0070704_100007703 | Ga0070704_1000077035 | 228 |
| 512 | 3300005563 | Ga0068855_100039742 | Ga0068855_1000397426 | 228 |
| 513 | 3300005578 | Ga0068854_100216504 | Ga0068854_1002165042 | 228 |
| 514 | 3300005614 | Ga0068856_100163980 | Ga0068856_1001639802 | 228 |
| 515 | 3300005841 | Ga0068863_100253152 | Ga0068863_1002531522 | 228 |
| 516 | 3300005937 | Ga0081455_10000155 | Ga0081455_1000015563 | 228 |
| 517 | 3300005937 | Ga0081455_10012770 | Ga0081455_1001277010 | 228 |
| 518 | 3300006163 | Ga0070715_10250047 | Ga0070715_102500471 | 228 |
| 519 | 3300006237 | Ga0097621_100026603 | Ga0097621_1000266034 | 228 |
| 520 | 3300006844 | Ga0075428_100105427 | Ga0075428_1001054273 | 228 |
| 521 | 3300006846 | Ga0075430_100021727 | Ga0075430_1000217275 | 228 |
| 522 | 3300006847 | Ga0075431_100001884 | Ga0075431_1000018847 | 228 |
| 523 | 3300006847 | Ga0075431_100167210 | Ga0075431_1001672102 | 228 |
| 524 | 3300006871 | Ga0075434_100086392 | Ga0075434_1000863923 | 228 |
| 525 | 3300006880 | Ga0075429_100045340 | Ga0075429_1000453404 | 228 |
| 526 | 3300009092 | Ga0105250_10136370 | Ga0105250_101363702 | 228 |
| 527 | 3300009094 | Ga0111539_10041947 | Ga0111539_100419476 | 228 |
| 528 | 3300009147 | Ga0114129_10037757 | Ga0114129_1003775711 | 228 |
| 529 | 3300009553 | Ga0105249_10004292 | Ga0105249_100042923 | 228 |
| 530 | 3300010375 | Ga0105239_11177322 | Ga0105239_111773222 | 228 |
| 531 | 3300025898 | Ga0207692_10054028 | Ga0207692_100540283 | 228 |
| 532 | 3300025904 | Ga0207647_10157646 | Ga0207647_101576462 | 228 |
| 533 | 3300025906 | Ga0207699_10022227 | Ga0207699_100222274 | 228 |
| 534 | 3300025921 | Ga0207652_10072444 | Ga0207652_100724443 | 228 |
| 535 | 3300025922 | Ga0207646_10182500 | Ga0207646_101825003 | 228 |
| 536 | 3300025926 | Ga0207659_10238186 | Ga0207659_102381862 | 228 |
| 537 | 3300025927 | Ga0207687_10013714 | Ga0207687_100137145 | 228 |
| 538 | 3300025928 | Ga0207700_10140318 | Ga0207700_101403182 | 228 |
| 539 | 3300025929 | Ga0207664_10017979 | Ga0207664_100179794 | 228 |
| 540 | 3300025929 | Ga0207664_10078835 | Ga0207664_100788352 | 228 |
| 541 | 3300025931 | Ga0207644_10206426 | Ga0207644_102064261 | 228 |
| 542 | 3300025949 | Ga0207667_10048763 | Ga0207667_100487633 | 228 |
| 543 | 3300025961 | Ga0207712_10013163 | Ga0207712_100131635 | 228 |
| 544 | 3300025972 | Ga0207668_10047899 | Ga0207668_100478992 | 228 |
| 545 | 3300025981 | Ga0207640_10565608 | Ga0207640_105656081 | 228 |
| 546 | 3300026023 | Ga0207677_10466142 | Ga0207677_104661421 | 228 |
| 547 | 3300026041 | Ga0207639_10262899 | Ga0207639_102628992 | 228 |
| 548 | 3300026067 | Ga0207678_10000065 | Ga0207678_1000006536 | 228 |
| 549 | 3300026078 | Ga0207702_10179579 | Ga0207702_101795791 | 228 |
| 550 | 3300026088 | Ga0207641_10042899 | Ga0207641_100428993 | 228 |
| 551 | 3300026095 | Ga0207676_10102595 | Ga0207676_101025952 | 228 |
| 552 | 3300026121 | Ga0207683_10187873 | Ga0207683_101878732 | 228 |
| 553 | 3300026121 | Ga0207683_10290806 | Ga0207683_102908061 | 228 |
| 554 | 3300028379 | Ga0268266_10272672 | Ga0268266_102726722 | 228 |
| 555 | 3300028381 | Ga0268264_10485720 | Ga0268264_104857202 | 228 |
| 556 | 3300028794 | Ga0307515_10057382 | Ga0307515_100573824 | 228 |
| 557 | 3300031838 | Ga0307518_10000187 | Ga0307518_1000018744 | 228 |
| 558 | 3300033179 | Ga0307507_10031670 | Ga0307507_100316702 | 228 |
| 559 | 3300035725 | Ga0373947_0371043 | Ga0373947_0371043_218_946 | 228 |
| 560 | 3300041404 | Ga0439436_0016465 | Ga0439436_0016465_829_1548 | 228 |
| 561 | 3300041406 | Ga0439439_0010488 | Ga0439439_0010488_165_884 | 228 |
| 562 | 3300042007 | Ga0439449_0093824 | Ga0439449_0093824_286_1005 | 228 |
| 563 | 3300042014 | Ga0439457_001153 | Ga0439457_001153_4505_5224 | 228 |
| 564 | 3300044683 | Ga0466965_0071861 | Ga0466965_0071861_524_1216 | 228 |
| 565 | 3300044765 | Ga0466970_0017784 | Ga0466970_0017784_1182_1925 | 228 |
| 566 | 3300046472 | Ga0495580_0069800 | Ga0495580_0069800_144_872 | 228 |
| 567 | 3300046543 | Ga0495645_0043465 | Ga0495645_0043465_2131_2844 | 228 |
| 568 | 3300047444 | Ga0495675_0031352 | Ga0495675_0031352_540_1253 | 228 |
| 569 | 3300048906 | Ga0496103_0176207 | Ga0496103_0176207_412_1119 | 228 |
| 570 | 3300049568 | Ga0501031_0143497 | Ga0501031_0143497_469_1173 | 228 |
| 571 | 3300049571 | Ga0501034_0110403 | Ga0501034_0110403_1237_1941 | 228 |
| 572 | 3300049572 | Ga0501036_0172628 | Ga0501036_0172628_189_893 | 228 |
| 573 | 3300049573 | Ga0501037_0100295 | Ga0501037_0100295_780_1484 | 228 |
| 574 | 3300049574 | Ga0501038_0117244 | Ga0501038_0117244_798_1502 | 228 |
| 575 | 3300049575 | Ga0501039_0051266 | Ga0501039_0051266_681_1388 | 228 |
| 576 | 3300049575 | Ga0501039_0238244 | Ga0501039_0238244_67_771 | 228 |
| 577 | 3300049578 | Ga0501042_0008013 | Ga0501042_0008013_4562_5269 | 228 |
| 578 | 3300049579 | Ga0501043_0174209 | Ga0501043_0174209_260_967 | 228 |
| 579 | 3300049581 | Ga0501047_0188943 | Ga0501047_0188943_1124_1828 | 228 |
| 580 | 3300049585 | Ga0501069_0115925 | Ga0501069_0115925_210_917 | 228 |
| 581 | 3300049586 | Ga0501070_0433413 | Ga0501070_0433413_19_726 | 228 |
| 582 | 3300049587 | Ga0501071_0041076 | Ga0501071_0041076_2485_3192 | 228 |
| 583 | 3300049587 | Ga0501071_0058236 | Ga0501071_0058236_1400_2113 | 228 |
| 584 | 3300049588 | Ga0501072_0014056 | Ga0501072_0014056_4938_5645 | 228 |
| 585 | 3300049590 | Ga0501074_0089998 | Ga0501074_0089998_785_1492 | 228 |
| 586 | 3300049591 | Ga0501075_0027122 | Ga0501075_0027122_1993_2700 | 228 |
| 587 | 3300049592 | Ga0501076_0019494 | Ga0501076_0019494_2720_3427 | 228 |
| 588 | 3300049592 | Ga0501076_0189270 | Ga0501076_0189270_236_949 | 228 |
| 589 | 3300049741 | Ga0501079_0079936 | Ga0501079_0079936_1713_2420 | 228 |
| 590 | 3300049742 | Ga0501080_0121439 | Ga0501080_0121439_61_768 | 228 |
| 591 | 3300049743 | Ga0501081_0484341 | Ga0501081_0484341_28_732 | 228 |
| 592 | 3300049823 | Ga0501044_0078132 | Ga0501044_0078132_1508_2212 | 228 |
| 593 | 3300049824 | Ga0501045_0111206 | Ga0501045_0111206_123_830 | 228 |
| 594 | 3300049824 | Ga0501045_0221421 | Ga0501045_0221421_391_1095 | 228 |
| 595 | 3300050507 | nmdc:mga05p37_815_c1 | nmdc:mga05p37_815_c1_31881_32597 | 228 |
| 596 | 3300050508 | nmdc:mga09592_879_c1 | nmdc:mga09592_879_c1_3706_4422 | 228 |
| 597 | 3300050509 | nmdc:mga0qj67_20070_c1 | nmdc:mga0qj67_20070_c1_2024_2740 | 228 |
| 598 | 3300050510 | nmdc:mga06r32_106_c1 | nmdc:mga06r32_106_c1_56909_57625 | 228 |
| 599 | 3300050510 | nmdc:mga06r32_1482_c1 | nmdc:mga06r32_1482_c1_4279_4995 | 228 |
| 600 | 3300050511 | nmdc:mga08y16_2869_c1 | nmdc:mga08y16_2869_c1_12134_12850 | 228 |
| 601 | 3300054114 | Ga0501084_0016029 | Ga0501084_0016029_1129_1836 | 228 |
| 602 | 3300060353 | Ga0501082_0163367 | Ga0501082_0163367_503_1210 | 228 |
| 603 | 3300061734 | Ga0530510_0094201 | Ga0530510_0094201_1258_1965 | 228 |
| 604 | iso_pu_bacteria | 2827628540 | 2827634467 | 228 |
| 605 | iso_pu_bacteria | 2862574272 | 2862576168 | 228 |
| 606 | iso_pu_bacteria | 2875391855 | 2875397942 | 228 |
| 607 | iso_pu_bacteria | 2995463766 | 2995470480 | 228 |
| 608 | iso_pu_bacteria | 8056829672 | 8056836115 | 228 |
| 609 | 3300003323 | rootH1_10093147 | rootH1_100931472 | 229 |
| 610 | 3300003373 | JGI25407J50210_10007407 | JGI25407J50210_100074072 | 229 |
| 611 | 3300005434 | Ga0070709_10061975 | Ga0070709_100619752 | 229 |
| 612 | 3300005434 | Ga0070709_10088572 | Ga0070709_100885722 | 229 |
| 613 | 3300005435 | Ga0070714_100648059 | Ga0070714_1006480592 | 229 |
| 614 | 3300005437 | Ga0070710_10026061 | Ga0070710_100260612 | 229 |
| 615 | 3300005439 | Ga0070711_100471871 | Ga0070711_1004718711 | 229 |
| 616 | 3300005614 | Ga0068856_100201100 | Ga0068856_1002011002 | 229 |
| 617 | 3300005841 | Ga0068863_100358061 | Ga0068863_1003580612 | 229 |
| 618 | 3300005981 | Ga0081538_10000092 | Ga0081538_1000009272 | 229 |
| 619 | 3300005983 | Ga0081540_1011819 | Ga0081540_10118196 | 229 |
| 620 | 3300006028 | Ga0070717_10274218 | Ga0070717_102742182 | 229 |
| 621 | 3300006163 | Ga0070715_10000604 | Ga0070715_100006046 | 229 |
| 622 | 3300006173 | Ga0070716_100135036 | Ga0070716_1001350362 | 229 |
| 623 | 3300006175 | Ga0070712_100170326 | Ga0070712_1001703262 | 229 |
| 624 | 3300013105 | Ga0157369_10311976 | Ga0157369_103119762 | 229 |
| 625 | 3300013307 | Ga0157372_10733129 | Ga0157372_107331292 | 229 |
| 626 | 3300025898 | Ga0207692_10129548 | Ga0207692_101295482 | 229 |
| 627 | 3300025906 | Ga0207699_10044847 | Ga0207699_100448472 | 229 |
| 628 | 3300025906 | Ga0207699_10107805 | Ga0207699_101078053 | 229 |
| 629 | 3300025939 | Ga0207665_10006091 | Ga0207665_100060915 | 229 |
| 630 | 3300035119 | Ga0373956_0122307 | Ga0373956_0122307_373_1143 | 229 |
| 631 | 3300035170 | Ga0373943_0019277 | Ga0373943_0019277_781_1500 | 229 |
| 632 | 3300035692 | Ga0373935_0087985 | Ga0373935_0087985_503_1222 | 229 |
| 633 | 3300036401 | Ga0373937_0024043 | Ga0373937_0024043_1938_2708 | 229 |
| 634 | 3300036401 | Ga0373937_0135353 | Ga0373937_0135353_661_1500 | 229 |
| 635 | 3300037068 | Ga0373925_0004007 | Ga0373925_0004007_7863_8615 | 229 |
| 636 | 3300037068 | Ga0373925_0118650 | Ga0373925_0118650_322_1041 | 229 |
| 637 | 3300041494 | Ga0451837_1577462 | Ga0451837_1577462_1728_2426 | 229 |
| 638 | 3300044842 | Ga0466957_0065104 | Ga0466957_0065104_15_734 | 229 |
| 639 | 3300046452 | Ga0495617_049616 | Ga0495617_049616_585_1289 | 229 |
| 640 | 3300046454 | Ga0495592_0017645 | Ga0495592_0017645_4497_5201 | 229 |
| 641 | 3300046454 | Ga0495592_0032833 | Ga0495592_0032833_3106_3876 | 229 |
| 642 | 3300046455 | Ga0495603_0000038 | Ga0495603_0000038_3854_4555 | 229 |
| 643 | 3300046455 | Ga0495603_0055304 | Ga0495603_0055304_469_1173 | 229 |
| 644 | 3300046459 | Ga0495629_0006176 | Ga0495629_0006176_4333_5034 | 229 |
| 645 | 3300046459 | Ga0495629_0125586 | Ga0495629_0125586_174_878 | 229 |
| 646 | 3300046460 | Ga0495638_0073293 | Ga0495638_0073293_409_1119 | 229 |
| 647 | 3300046460 | Ga0495638_0197410 | Ga0495638_0197410_77_778 | 229 |
| 648 | 3300046462 | Ga0495651_0002692 | Ga0495651_0002692_7394_8164 | 229 |
| 649 | 3300046462 | Ga0495651_0248148 | Ga0495651_0248148_337_1041 | 229 |
| 650 | 3300046463 | Ga0495653_0077176 | Ga0495653_0077176_1664_2434 | 229 |
| 651 | 3300046472 | Ga0495580_0101543 | Ga0495580_0101543_155_859 | 229 |
| 652 | 3300046476 | Ga0495662_0022526 | Ga0495662_0022526_1804_2508 | 229 |
| 653 | 3300046491 | Ga0495584_0114125 | Ga0495584_0114125_28_732 | 229 |
| 654 | 3300046500 | Ga0495596_0102831 | Ga0495596_0102831_347_1051 | 229 |
| 655 | 3300046501 | Ga0495607_0037006 | Ga0495607_0037006_706_1410 | 229 |
| 656 | 3300046506 | Ga0495583_0056746 | Ga0495583_0056746_393_1097 | 229 |
| 657 | 3300046506 | Ga0495583_0100817 | Ga0495583_0100817_479_1183 | 229 |
| 658 | 3300046507 | Ga0495606_0004135 | Ga0495606_0004135_6151_6855 | 229 |
| 659 | 3300046511 | Ga0495608_0187339 | Ga0495608_0187339_146_850 | 229 |
| 660 | 3300046512 | Ga0495610_0034625 | Ga0495610_0034625_242_946 | 229 |
| 661 | 3300046513 | Ga0495616_0020462 | Ga0495616_0020462_257_961 | 229 |
| 662 | 3300046514 | Ga0495618_0048910 | Ga0495618_0048910_576_1280 | 229 |
| 663 | 3300046515 | Ga0495620_0007954 | Ga0495620_0007954_203_907 | 229 |
| 664 | 3300046516 | Ga0495628_0020871 | Ga0495628_0020871_3576_4346 | 229 |
| 665 | 3300046520 | Ga0495637_0061409 | Ga0495637_0061409_178_882 | 229 |
| 666 | 3300046522 | Ga0495643_0039751 | Ga0495643_0039751_1003_1707 | 229 |
| 667 | 3300046524 | Ga0495648_0078830 | Ga0495648_0078830_200_904 | 229 |
| 668 | 3300046526 | Ga0495666_0017841 | Ga0495666_0017841_2651_3355 | 229 |
| 669 | 3300046529 | Ga0495652_0006178 | Ga0495652_0006178_10110_10880 | 229 |
| 670 | 3300046533 | Ga0495640_0003158 | Ga0495640_0003158_3109_3813 | 229 |
| 671 | 3300046535 | Ga0495586_0200905 | Ga0495586_0200905_167_871 | 229 |
| 672 | 3300046536 | Ga0495587_0021932 | Ga0495587_0021932_618_1388 | 229 |
| 673 | 3300046538 | Ga0495609_0079300 | Ga0495609_0079300_146_850 | 229 |
| 674 | 3300046542 | Ga0495597_0048292 | Ga0495597_0048292_10_714 | 229 |
| 675 | 3300046543 | Ga0495645_0012603 | Ga0495645_0012603_4370_5140 | 229 |
| 676 | 3300046543 | Ga0495645_0014842 | Ga0495645_0014842_3686_4399 | 229 |
| 677 | 3300046558 | Ga0495633_0045184 | Ga0495633_0045184_406_1110 | 229 |
| 678 | 3300046559 | Ga0495667_0001808 | Ga0495667_0001808_11271_12041 | 229 |
| 679 | 3300046616 | Ga0495668_0062572 | Ga0495668_0062572_1171_1875 | 229 |
| 680 | 3300046642 | Ga0495634_0090584 | Ga0495634_0090584_270_974 | 229 |
| 681 | 3300046660 | Ga0495625_0139481 | Ga0495625_0139481_750_1454 | 229 |
| 682 | 3300046663 | Ga0495635_0031036 | Ga0495635_0031036_294_998 | 229 |
| 683 | 3300046665 | Ga0495661_0005397 | Ga0495661_0005397_976_1680 | 229 |
| 684 | 3300046679 | Ga0495623_0055675 | Ga0495623_0055675_859_1629 | 229 |
| 685 | 3300046680 | Ga0495646_0045970 | Ga0495646_0045970_1079_1849 | 229 |
| 686 | 3300046681 | Ga0495647_0127657 | Ga0495647_0127657_167_886 | 229 |
| 687 | 3300046689 | Ga0495613_0003220 | Ga0495613_0003220_5207_5908 | 229 |
| 688 | 3300046689 | Ga0495613_0006739 | Ga0495613_0006739_5771_6475 | 229 |
| 689 | 3300046690 | Ga0495624_0014308 | Ga0495624_0014308_1518_2222 | 229 |
| 690 | 3300046690 | Ga0495624_0362501 | Ga0495624_0362501_99_803 | 229 |
| 691 | 3300046691 | Ga0495670_0135427 | Ga0495670_0135427_432_1136 | 229 |
| 692 | 3300046694 | Ga0495649_0165816 | Ga0495649_0165816_287_991 | 229 |
| 693 | 3300046794 | Ga0495589_0227350 | Ga0495589_0227350_154_858 | 229 |
| 694 | 3300046809 | Ga0495600_0014821 | Ga0495600_0014821_2053_2823 | 229 |
| 695 | 3300046809 | Ga0495600_0110322 | Ga0495600_0110322_826_1530 | 229 |
| 696 | 3300046810 | Ga0495660_0132716 | Ga0495660_0132716_112_816 | 229 |
| 697 | 3300047317 | Ga0495604_0016027 | Ga0495604_0016027_2386_3156 | 229 |
| 698 | 3300047317 | Ga0495604_0020734 | Ga0495604_0020734_2015_2719 | 229 |
| 699 | 3300047319 | Ga0495674_0120604 | Ga0495674_0120604_682_1452 | 229 |
| 700 | 3300047320 | Ga0495672_0238441 | Ga0495672_0238441_90_794 | 229 |
| 701 | 3300047321 | Ga0495676_0001378 | Ga0495676_0001378_19990_20691 | 229 |
| 702 | 3300047321 | Ga0495676_0026048 | Ga0495676_0026048_1556_2275 | 229 |
| 703 | 3300047321 | Ga0495676_0055392 | Ga0495676_0055392_1676_2380 | 229 |
| 704 | 3300047322 | Ga0495680_0002145 | Ga0495680_0002145_2551_3321 | 229 |
| 705 | 3300047322 | Ga0495680_0010272 | Ga0495680_0010272_6830_7534 | 229 |
| 706 | 3300047443 | Ga0495687_023981 | Ga0495687_023981_1837_2541 | 229 |
| 707 | 3300047443 | Ga0495687_073012 | Ga0495687_073012_110_814 | 229 |
| 708 | 3300047444 | Ga0495675_0004402 | Ga0495675_0004402_1740_2510 | 229 |
| 709 | 3300047445 | Ga0495677_0094727 | Ga0495677_0094727_261_965 | 229 |
| 710 | 3300047447 | Ga0495685_092965 | Ga0495685_092965_168_872 | 229 |
| 711 | 3300047471 | Ga0495684_0030858 | Ga0495684_0030858_2312_3082 | 229 |
| 712 | 3300047673 | Ga0495593_0021941 | Ga0495593_0021941_1394_2098 | 229 |
| 713 | 3300047673 | Ga0495593_0026111 | Ga0495593_0026111_1793_2497 | 229 |
| 714 | 3300048088 | Ga0495602_0039724 | Ga0495602_0039724_1360_2130 | 229 |
| 715 | 3300048088 | Ga0495602_0248473 | Ga0495602_0248473_492_1304 | 229 |
| 716 | 3300048089 | Ga0495614_0021021 | Ga0495614_0021021_1700_2401 | 229 |
| 717 | 3300048089 | Ga0495614_0060964 | Ga0495614_0060964_295_999 | 229 |
| 718 | 3300048089 | Ga0495614_0172222 | Ga0495614_0172222_34_738 | 229 |
| 719 | 3300048905 | Ga0496102_0048348 | Ga0496102_0048348_986_1702 | 229 |
| 720 | 3300048907 | Ga0496104_0595854 | Ga0496104_0595854_153_869 | 229 |
| 721 | 3300048908 | Ga0496105_0004683 | Ga0496105_0004683_6437_7153 | 229 |
| 722 | 3300048911 | Ga0496108_0002269 | Ga0496108_0002269_14662_15378 | 229 |
| 723 | 3300048916 | Ga0496113_0002886 | Ga0496113_0002886_4774_5490 | 229 |
| 724 | 3300048917 | Ga0496114_0333909 | Ga0496114_0333909_601_1317 | 229 |
| 725 | 3300048918 | Ga0496115_0088219 | Ga0496115_0088219_794_1510 | 229 |
| 726 | 3300049459 | Ga0495678_026140 | Ga0495678_026140_102_806 | 229 |
| 727 | 3300049568 | Ga0501031_0220787 | Ga0501031_0220787_284_1018 | 229 |
| 728 | 3300049577 | Ga0501041_0225661 | Ga0501041_0225661_117_851 | 229 |
| 729 | 3300049578 | Ga0501042_0036140 | Ga0501042_0036140_610_1308 | 229 |
| 730 | 3300049822 | Ga0501035_0022357 | Ga0501035_0022357_2114_2974 | 229 |
| 731 | 3300049824 | Ga0501045_0294743 | Ga0501045_0294743_369_1103 | 229 |
| 732 | iso_pu_bacteria | 2966598605 | 2966599525 | 229 |
| 733 | iso_pu_bacteria | 2997451912 | 2997455265 | 229 |
| 734 | 3300005458 | Ga0070681_10398382 | Ga0070681_103983822 | 230 |
| 735 | 3300013307 | Ga0157372_10592947 | Ga0157372_105929472 | 230 |
| 736 | 3300013307 | Ga0157372_10695616 | Ga0157372_106956161 | 230 |
| 737 | 3300020070 | Ga0206356_10181501 | Ga0206356_101815011 | 230 |
| 738 | 3300021388 | Ga0213875_10028304 | Ga0213875_100283043 | 230 |
| 739 | 3300022467 | Ga0224712_10118669 | Ga0224712_101186692 | 230 |
| 740 | 3300025932 | Ga0207690_10046792 | Ga0207690_100467921 | 230 |
| 741 | 3300028666 | Ga0265336_10005555 | Ga0265336_100055554 | 230 |
| 742 | 3300028786 | Ga0307517_10012612 | Ga0307517_100126129 | 230 |
| 743 | 3300028794 | Ga0307515_10000287 | Ga0307515_1000028760 | 230 |
| 744 | 3300028800 | Ga0265338_10008871 | Ga0265338_100088712 | 230 |
| 745 | 3300030521 | Ga0307511_10001720 | Ga0307511_100017205 | 230 |
| 746 | 3300030521 | Ga0307511_10065316 | Ga0307511_100653163 | 230 |
| 747 | 3300030522 | Ga0307512_10073303 | Ga0307512_100733033 | 230 |
| 748 | 3300030522 | Ga0307512_10116505 | Ga0307512_101165052 | 230 |
| 749 | 3300031456 | Ga0307513_10279780 | Ga0307513_102797803 | 230 |
| 750 | 3300031507 | Ga0307509_10050413 | Ga0307509_100504132 | 230 |
| 751 | 3300031507 | Ga0307509_10373441 | Ga0307509_103734412 | 230 |
| 752 | 3300031649 | Ga0307514_10027128 | Ga0307514_100271283 | 230 |
| 753 | 3300031649 | Ga0307514_10130321 | Ga0307514_101303213 | 230 |
| 754 | 3300031730 | Ga0307516_10035339 | Ga0307516_100353397 | 230 |
| 755 | 3300031838 | Ga0307518_10016155 | Ga0307518_100161557 | 230 |
| 756 | 3300031903 | Ga0307407_10063280 | Ga0307407_100632802 | 230 |
| 757 | 3300031995 | Ga0307409_100025807 | Ga0307409_1000258074 | 230 |
| 758 | 3300032002 | Ga0307416_100215184 | Ga0307416_1002151843 | 230 |
| 759 | 3300032126 | Ga0307415_100158083 | Ga0307415_1001580832 | 230 |
| 760 | 3300033179 | Ga0307507_10010287 | Ga0307507_100102873 | 230 |
| 761 | 3300033179 | Ga0307507_10047750 | Ga0307507_100477504 | 230 |
| 762 | 3300033180 | Ga0307510_10000644 | Ga0307510_1000064419 | 230 |
| 763 | 3300033180 | Ga0307510_10112929 | Ga0307510_101129292 | 230 |
| 764 | 3300037312 | Ga0395899_0323570 | Ga0395899_0323570_78_785 | 230 |
| 765 | 3300037418 | Ga0395900_0528046 | Ga0395900_0528046_178_885 | 230 |
| 766 | 3300037466 | Ga0395898_0007795 | Ga0395898_0007795_4508_5215 | 230 |
| 767 | 3300037853 | Ga0436364_1360402 | Ga0436364_1360402_561_1277 | 230 |
| 768 | 3300038443 | Ga0395901_0186849 | Ga0395901_0186849_481_1188 | 230 |
| 769 | 3300042002 | Ga0439442_039778 | Ga0439442_039778_41_748 | 230 |
| 770 | 3300042005 | Ga0439448_0041472 | Ga0439448_0041472_185_892 | 230 |
| 771 | 3300042006 | Ga0439432_085318 | Ga0439432_085318_147_854 | 230 |
| 772 | 3300042136 | Ga0450900_023064 | Ga0450900_023064_150_857 | 230 |
| 773 | 3300042138 | Ga0450903_000178 | Ga0450903_000178_1079_1786 | 230 |
| 774 | 3300042157 | Ga0439458_0000694 | Ga0439458_0000694_7906_8613 | 230 |
| 775 | 3300044658 | Ga0466972_0023889 | Ga0466972_0023889_1408_2115 | 230 |
| 776 | 3300044684 | Ga0466966_0010560 | Ga0466966_0010560_5291_6007 | 230 |
| 777 | 3300044693 | Ga0466961_0107037 | Ga0466961_0107037_244_951 | 230 |
| 778 | 3300044694 | Ga0466963_0026338 | Ga0466963_0026338_63_779 | 230 |
| 779 | 3300044719 | Ga0466971_0002653 | Ga0466971_0002653_1146_1862 | 230 |
| 780 | 3300044735 | Ga0466968_0001070 | Ga0466968_0001070_3418_4131 | 230 |
| 781 | 3300044765 | Ga0466970_0001010 | Ga0466970_0001010_11580_12287 | 230 |
| 782 | 3300044765 | Ga0466970_0119308 | Ga0466970_0119308_175_882 | 230 |
| 783 | 3300044842 | Ga0466957_0042974 | Ga0466957_0042974_88_804 | 230 |
| 784 | 3300044842 | Ga0466957_0198397 | Ga0466957_0198397_337_1125 | 230 |
| 785 | 3300044901 | Ga0466960_0008740 | Ga0466960_0008740_2529_3236 | 230 |
| 786 | 3300045836 | Ga0466958_0000718 | Ga0466958_0000718_9428_10144 | 230 |
| 787 | 3300045836 | Ga0466958_0156201 | Ga0466958_0156201_677_1393 | 230 |
| 788 | 3300045836 | Ga0466958_0226848 | Ga0466958_0226848_422_1129 | 230 |
| 789 | 3300045976 | Ga0466967_0026337 | Ga0466967_0026337_3660_4367 | 230 |
| 790 | 3300045976 | Ga0466967_0345556 | Ga0466967_0345556_474_1181 | 230 |
| 791 | 3300046454 | Ga0495592_0013138 | Ga0495592_0013138_2072_2779 | 230 |
| 792 | 3300046455 | Ga0495603_0005963 | Ga0495603_0005963_4881_5582 | 230 |
| 793 | 3300046459 | Ga0495629_0020835 | Ga0495629_0020835_2085_2795 | 230 |
| 794 | 3300046459 | Ga0495629_0040143 | Ga0495629_0040143_1830_2537 | 230 |
| 795 | 3300046459 | Ga0495629_0335109 | Ga0495629_0335109_83_784 | 230 |
| 796 | 3300046475 | Ga0495639_0021326 | Ga0495639_0021326_1892_2593 | 230 |
| 797 | 3300046476 | Ga0495662_0000436 | Ga0495662_0000436_8783_9490 | 230 |
| 798 | 3300046476 | Ga0495662_0099497 | Ga0495662_0099497_255_956 | 230 |
| 799 | 3300046477 | Ga0495664_0013903 | Ga0495664_0013903_647_1354 | 230 |
| 800 | 3300046477 | Ga0495664_0378265 | Ga0495664_0378265_65_781 | 230 |
| 801 | 3300046514 | Ga0495618_0043697 | Ga0495618_0043697_223_930 | 230 |
| 802 | 3300046536 | Ga0495587_0051104 | Ga0495587_0051104_494_1201 | 230 |
| 803 | 3300046559 | Ga0495667_0094568 | Ga0495667_0094568_623_1330 | 230 |
| 804 | 3300046642 | Ga0495634_0369246 | Ga0495634_0369246_106_813 | 230 |
| 805 | 3300046660 | Ga0495625_0007591 | Ga0495625_0007591_7133_7843 | 230 |
| 806 | 3300046660 | Ga0495625_0069062 | Ga0495625_0069062_1121_1834 | 230 |
| 807 | 3300046663 | Ga0495635_0018440 | Ga0495635_0018440_3408_4115 | 230 |
| 808 | 3300046674 | Ga0495588_0030614 | Ga0495588_0030614_380_1090 | 230 |
| 809 | 3300046675 | Ga0495657_0020166 | Ga0495657_0020166_2845_3552 | 230 |
| 810 | 3300046683 | Ga0495658_0060078 | Ga0495658_0060078_828_1535 | 230 |
| 811 | 3300046689 | Ga0495613_0006178 | Ga0495613_0006178_4009_4716 | 230 |
| 812 | 3300046794 | Ga0495589_0058130 | Ga0495589_0058130_260_961 | 230 |
| 813 | 3300046809 | Ga0495600_0053305 | Ga0495600_0053305_105_812 | 230 |
| 814 | 3300047315 | Ga0495581_0025349 | Ga0495581_0025349_1918_2625 | 230 |
| 815 | 3300047317 | Ga0495604_0001681 | Ga0495604_0001681_154_861 | 230 |
| 816 | 3300047318 | Ga0495636_0000492 | Ga0495636_0000492_7423_8124 | 230 |
| 817 | 3300047319 | Ga0495674_0179803 | Ga0495674_0179803_455_1171 | 230 |
| 818 | 3300047321 | Ga0495676_0016397 | Ga0495676_0016397_3627_4334 | 230 |
| 819 | 3300047443 | Ga0495687_001283 | Ga0495687_001283_1486_2193 | 230 |
| 820 | 3300047443 | Ga0495687_016780 | Ga0495687_016780_2115_2816 | 230 |
| 821 | 3300047447 | Ga0495685_009381 | Ga0495685_009381_276_977 | 230 |
| 822 | 3300047447 | Ga0495685_038671 | Ga0495685_038671_276_977 | 230 |
| 823 | 3300047470 | Ga0495681_0016334 | Ga0495681_0016334_3442_4152 | 230 |
| 824 | 3300047673 | Ga0495593_0048634 | Ga0495593_0048634_1480_2187 | 230 |
| 825 | 3300048088 | Ga0495602_0091463 | Ga0495602_0091463_707_1414 | 230 |
| 826 | 3300048089 | Ga0495614_0003869 | Ga0495614_0003869_3657_4367 | 230 |
| 827 | 3300048089 | Ga0495614_0018379 | Ga0495614_0018379_1244_1951 | 230 |
| 828 | 3300049568 | Ga0501031_0148210 | Ga0501031_0148210_480_1214 | 230 |
| 829 | 3300049569 | Ga0501032_0211538 | Ga0501032_0211538_162_869 | 230 |
| 830 | 3300049570 | Ga0501033_0007592 | Ga0501033_0007592_4235_4942 | 230 |
| 831 | 3300049570 | Ga0501033_0007870 | Ga0501033_0007870_6509_7216 | 230 |
| 832 | 3300049571 | Ga0501034_0001799 | Ga0501034_0001799_4004_4711 | 230 |
| 833 | 3300049571 | Ga0501034_0179654 | Ga0501034_0179654_1031_1738 | 230 |
| 834 | 3300049572 | Ga0501036_0001507 | Ga0501036_0001507_15156_15863 | 230 |
| 835 | 3300049575 | Ga0501039_0287137 | Ga0501039_0287137_171_878 | 230 |
| 836 | 3300049579 | Ga0501043_0005810 | Ga0501043_0005810_239_946 | 230 |
| 837 | 3300049581 | Ga0501047_0011932 | Ga0501047_0011932_2157_2864 | 230 |
| 838 | 3300049583 | Ga0501067_0180442 | Ga0501067_0180442_99_803 | 230 |
| 839 | 3300049586 | Ga0501070_0004372 | Ga0501070_0004372_2697_3404 | 230 |
| 840 | 3300049590 | Ga0501074_0001645 | Ga0501074_0001645_6056_6763 | 230 |
| 841 | 3300049822 | Ga0501035_0046679 | Ga0501035_0046679_2914_3705 | 230 |
| 842 | 3300049822 | Ga0501035_0051954 | Ga0501035_0051954_2005_2712 | 230 |
| 843 | 3300049822 | Ga0501035_0239367 | Ga0501035_0239367_183_890 | 230 |
| 844 | 3300049823 | Ga0501044_0005136 | Ga0501044_0005136_8209_8916 | 230 |
| 845 | 3300053077 | Ga0495601_0105853 | Ga0495601_0105853_758_1474 | 230 |
| 846 | 3300053088 | Ga0500644_0056149 | Ga0500644_0056149_286_996 | 230 |
| 847 | 3300053107 | Ga0500560_003768 | Ga0500560_003768_1231_1941 | 230 |
| 848 | 3300053111 | Ga0500572_018074 | Ga0500572_018074_993_1700 | 230 |
| 849 | 3300053140 | Ga0500573_0018878 | Ga0500573_0018878_2148_2855 | 230 |
| 850 | 3300059424 | Ga0590075_033303 | Ga0590075_033303_159_866 | 230 |
| 851 | 3300061719 | Ga0466962_0010345 | Ga0466962_0010345_2842_3558 | 230 |
| 852 | 3300003316 | rootH1_10041079 | rootH1_100410791 | 231 |
| 853 | 3300003320 | rootH2_10125902 | rootH2_101259021 | 231 |
| 854 | 3300003323 | rootH1_10000628 | rootH1_100006287 | 231 |
| 855 | 3300003323 | rootH1_10039347 | rootH1_100393472 | 231 |
| 856 | 3300003354 | JGI25160J50197_1017047 | JGI25160J50197_10170473 | 231 |
| 857 | 3300005435 | Ga0070714_100411550 | Ga0070714_1004115502 | 231 |
| 858 | 3300005439 | Ga0070711_100198319 | Ga0070711_1001983192 | 231 |
| 859 | 3300020082 | Ga0206353_11671143 | Ga0206353_116711432 | 231 |
| 860 | 3300022467 | Ga0224712_10046583 | Ga0224712_100465831 | 231 |
| 861 | 3300025929 | Ga0207664_10123149 | Ga0207664_101231492 | 231 |
| 862 | 3300037466 | Ga0395898_0247181 | Ga0395898_0247181_211_945 | 231 |
| 863 | 3300041460 | Ga0451802_1162497 | Ga0451802_1162497_73_816 | 231 |
| 864 | 3300041512 | Ga0451853_1404968 | Ga0451853_1404968_223_948 | 231 |
| 865 | 3300046477 | Ga0495664_0193671 | Ga0495664_0193671_356_1150 | 231 |
| 866 | 3300046529 | Ga0495652_0282800 | Ga0495652_0282800_111_956 | 231 |
| 867 | 3300046690 | Ga0495624_0263790 | Ga0495624_0263790_205_999 | 231 |
| 868 | 3300047319 | Ga0495674_0037074 | Ga0495674_0037074_881_1675 | 231 |
| 869 | 3300048929 | Ga0496126_0039141 | Ga0496126_0039141_3088_3816 | 231 |
| 870 | 3300049568 | Ga0501031_0278914 | Ga0501031_0278914_56_787 | 231 |
| 871 | iso_pu_bacteria | 2867369537 | 2867374914 | 231 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5vrb-assembly1.cif.gz_A | crystal structure of a transketolase from neisseria gonorrhoeae | 0.8712 | 12 | 227 |
| 5vrb-assembly3.cif.gz_C | crystal structure of a transketolase from neisseria gonorrhoeae | 0.8689 | 13 | 229 |
| 3rim-assembly2.cif.gz_D | crystal structure of mycobacterium tuberculosis transketolase (rv1449c) | 0.8558 | 13 | 227 |
| 5i5g-assembly1.cif.gz_A-2 | crystal structure of transketolase mutant-r525l from pichia stipitis | 0.8498 | 30 | 227 |
| 5hgx-assembly1.cif.gz_A | crystal structure of transketolase mutant - h261f from pichia stipitis | 0.8476 | 26 | 227 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FYT8_1_292_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8977 | 39 | 228 | 3.40.50.970 |
| af_Q58094_1_274_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8561 | 6 | 227 | 3.40.50.970 |
| 3rimD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8558 | 13 | 227 | 3.40.50.970 |
| af_Q4CW17_1_198_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8454 | 139 | 227 | 3.40.50.970 |
| 5hjeA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8451 | 14 | 227 | 3.40.50.970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W9HBD8-F1-model_v4 | Transketolase (EC 2.2.1.1) | 0.9803 | 1 | 230 |
GO:0000287
GO:0004802 |
| AF-A0A1C5EZ75-F1-model_v4 | Transketolase | 0.9787 | 3 | 231 |
GO:0000287
|
| AF-A0A2P8B6X8-F1-model_v4 | deleted | 0.975 | 4 | 231 |
|
| AF-A0A754B5C4-F1-model_v4 | Transketolase | 0.9743 | 12 | 231 |
|
| AF-A0A4D4KVS4-F1-model_v4 | Transketolase N-terminal domain-containing protein | 0.9736 | 105 | 231 |
GO:0000287
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar