F484205

General Info

Members Datasets Scaffolds Average Seq Length
871 439 1742 324

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_192714_c1|nmdc:mga00v17_192714_c1_188_1150
Length 320
Sequence MPYRRLGRSGLQLSVLSFGSWVTFDTQIKDDLALDCMQAAHDAGCNFYDNAEAYAGGESEAIMGRVIEQLGWARQSYVLSTKVYWGIDGRMPNMQNTLNRKYLHHSIEGCLDRLKVDFVDLLFCHRADKNTPIEETVWAMSDLIDRGKVLYWGTSEWSADEIRAAWEVAERHHLHKPVMEQPQYNMVERGKVEDEFARLYDDIGLGLTTWSPLASGLLTGKYRDGIPDDSRGALPGYGWLAKRFTDPAQVQRVERIRPIADELGCTMAQLSIAWCAANPHVSTVITGASKVSQVVDNFGALDVLEALTPDIIERINAAVS

Samples

Sample ID Description Type Environment
1 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
109 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
177 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
178 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
179 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
180 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
181 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
182 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
185 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
186 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
191 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
192 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
193 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
196 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
207 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
208 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
209 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
212 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
213 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
214 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
215 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
216 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
217 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
218 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
219 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
220 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
221 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
222 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
223 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
226 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
231 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
232 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
233 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
234 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
235 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
242 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
243 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
244 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
245 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
246 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
247 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
248 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
249 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
250 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
251 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
254 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
255 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
256 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
257 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
258 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
259 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
260 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
261 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
262 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
263 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
264 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
265 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
266 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
267 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
268 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
269 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
270 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
271 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
272 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
273 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
274 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
275 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
276 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
277 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
278 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
279 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
280 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
281 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
282 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
283 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
284 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
285 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
286 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
287 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
288 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
289 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
290 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
291 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
292 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
293 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
294 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
295 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
296 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
297 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
298 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
299 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
300 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
301 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
302 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
303 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
304 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
307 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
308 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
309 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
310 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
311 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
312 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
313 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
314 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
315 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
316 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
317 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
318 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
319 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
320 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
321 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
329 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
330 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
331 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
332 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
333 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
334 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
335 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
336 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
337 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
338 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
339 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
340 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
341 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
342 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
343 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
344 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
345 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
346 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
347 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
348 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
349 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
350 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
351 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
352 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
353 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
354 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
355 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
356 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
357 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
358 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
359 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
360 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
361 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
362 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
363 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
364 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
365 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
366 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
367 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
368 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
369 2519103095 Burkholderia sp. KJ006 Isolate Nodule
370 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
371 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
372 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
373 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
374 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
375 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
376 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
377 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
378 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
379 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
380 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
381 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
382 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
383 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
384 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
385 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
386 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
387 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
388 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
389 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
390 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
391 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
392 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
393 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
394 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
395 2818991450 Burkholderia sp. 604 Isolate Unclassified
396 2818991452 Burkholderia cepacia 561 Isolate Unclassified
397 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
398 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
399 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
400 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
401 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
402 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
403 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
404 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
405 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
406 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
407 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
408 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
409 2904564687 Burkholderia sp. 571 Isolate Unclassified
410 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
411 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
412 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
413 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
414 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
415 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
416 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
417 2928163908 Burkholderia sp. 567 Isolate Unclassified
418 2928170801 Burkholderia sp. 572 Isolate Unclassified
419 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
420 2928536128 Burkholderia sola 565 Isolate Unclassified
421 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
422 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
423 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
424 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
425 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
426 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
427 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
428 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
429 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
430 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
431 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
432 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
433 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
434 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
435 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
436 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
437 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
438 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
439 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.9
Metatranscriptomes 0.23
Isolates 9.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.92
Nodule 2.18
Rhizoplane 4.36
Rhizosphere 76.81
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga00v17_192714_c1 3300050491 Bacteria 1317
2 JGI24739J22299_10023103 3300001989 Bacteria 2200
3 JGI24739J22299_10052858 3300001989 Bacteria 1305
4 JGI25156J39149_1000699 3300002705 Bacteria 17885
5 JGI25156J39149_1001586 3300002705 Bacteria 9345
6 JGI25165J46597_1001672 3300003214 Bacteria 10091
7 rootH2_10020431 3300003320 Bacteria 10578
8 rootL2_10120394 3300003322 Bacteria 3092
9 JGI25160J50197_1000176 3300003354 Bacteria 54145
10 Ga0055533_1000115 3300003756 Bacteria 91607
11 Ga0055533_1000295 3300003756 Bacteria 25347
12 Ga0055533_1001385 3300003756 Bacteria 6439
13 Ga0055532_1000055 3300003758 Bacteria 160192
14 Ga0055532_1002459 3300003758 Bacteria 3836
15 Ga0055532_1006639 3300003758 Bacteria 1535
16 Ga0055532_1007106 3300003758 Bacteria 1459
17 Ga0055527_1000030 3300003760 Bacteria 160175
18 Ga0055527_1001931 3300003760 Bacteria 3836
19 Ga0055535_1000038 3300003761 Bacteria 160192
20 Ga0055535_1003937 3300003761 Bacteria 3884
21 Ga0055535_1003988 3300003761 Bacteria 3836
22 Ga0055542_1000063 3300003762 Bacteria 160175
23 Ga0055542_1003837 3300003762 Bacteria 3884
24 Ga0055542_1007116 3300003762 Bacteria 2312
25 Ga0055529_1000071 3300003763 Bacteria 160192
26 Ga0055529_1002271 3300003763 Bacteria 3884
27 Ga0058692_1015022 3300003856 Bacteria 1756
28 Ga0065165_1001993 3300005262 Bacteria 19160
29 Ga0070658_10001803 3300005327 Bacteria 18000
30 Ga0070658_10005160 3300005327 Bacteria 10628
31 Ga0070658_10026579 3300005327 Bacteria 4643
32 Ga0070658_10040481 3300005327 Bacteria 3759
33 Ga0070676_10137038 3300005328 Bacteria 1554
34 Ga0070690_100085532 3300005330 Bacteria 2069
35 Ga0070670_100007152 3300005331 Bacteria 9453
36 Ga0070677_10128494 3300005333 Bacteria 1154
37 Ga0068869_100001855 3300005334 Bacteria 12701
38 Ga0068869_100041020 3300005334 Bacteria 3312
39 Ga0070666_10012676 3300005335 Bacteria 5327
40 Ga0070666_10026746 3300005335 Bacteria 3773
41 Ga0070666_10150718 3300005335 Bacteria 1622
42 Ga0068868_100035657 3300005338 Bacteria 3846
43 Ga0068868_100036971 3300005338 Bacteria 3783
44 Ga0068868_100157461 3300005338 Bacteria 1874
45 Ga0070660_100067315 3300005339 Bacteria 2790
46 Ga0070660_100083083 3300005339 Bacteria 2516
47 Ga0070689_100116466 3300005340 Bacteria 2131
48 Ga0070689_100166946 3300005340 Bacteria 1782
49 Ga0070661_100081011 3300005344 Bacteria 2396
50 Ga0070661_100213121 3300005344 Bacteria 1479
51 Ga0070668_100054030 3300005347 Bacteria 3098
52 Ga0070669_100131527 3300005353 Bacteria 1920
53 Ga0070675_100004408 3300005354 Bacteria 10731
54 Ga0070674_100079715 3300005356 Bacteria 2337
55 Ga0070674_100287934 3300005356 Bacteria 1305
56 Ga0070673_100015615 3300005364 Bacteria 5341
57 Ga0070673_100025146 3300005364 Bacteria 4378
58 Ga0070688_100014913 3300005365 Bacteria 4410
59 Ga0070688_100097084 3300005365 Bacteria 1936
60 Ga0070659_100005265 3300005366 Bacteria 9283
61 Ga0070659_100035384 3300005366 Bacteria 3889
62 Ga0070659_100079058 3300005366 Bacteria 2625
63 Ga0070659_100444014 3300005366 Bacteria 1100
64 Ga0070667_100026964 3300005367 Bacteria 4779
65 Ga0070667_100083974 3300005367 Bacteria 2729
66 Ga0070667_100085922 3300005367 Bacteria 2699
67 Ga0070667_100422876 3300005367 Bacteria 1215
68 Ga0070709_10043780 3300005434 Bacteria 2770
69 Ga0070709_10077889 3300005434 Bacteria 2156
70 Ga0070714_100009479 3300005435 Bacteria 7656
71 Ga0070714_100018047 3300005435 Bacteria 5723
72 Ga0070714_100027642 3300005435 Bacteria 4699
73 Ga0070713_100001234 3300005436 Bacteria 16347
74 Ga0070713_100003076 3300005436 Bacteria 10967
75 Ga0070713_100046858 3300005436 Bacteria 3549
76 Ga0070705_100072203 3300005440 Bacteria 2090
77 Ga0070700_100151046 3300005441 Bacteria 1588
78 Ga0070663_100047783 3300005455 Bacteria 3032
79 Ga0070663_100102242 3300005455 Bacteria 2140
80 Ga0070678_100026374 3300005456 Bacteria 3927
81 Ga0070662_100025893 3300005457 Bacteria 4055
82 Ga0070681_10003759 3300005458 Bacteria 14249
83 Ga0070681_10214990 3300005458 Bacteria 1839
84 Ga0068867_100005803 3300005459 Bacteria 8761
85 Ga0068867_100036328 3300005459 Bacteria 3576
86 Ga0068867_100181510 3300005459 Bacteria 1674
87 Ga0070685_10034429 3300005466 Bacteria 2853
88 Ga0070699_100045007 3300005518 Bacteria 3820
89 Ga0070679_100464760 3300005530 Bacteria 1210
90 Ga0070679_100543074 3300005530 Bacteria 1106
91 Ga0070684_100153996 3300005535 Bacteria 2084
92 Ga0068853_100240948 3300005539 Bacteria 1657
93 Ga0070672_100027074 3300005543 Bacteria 4274
94 Ga0070693_100000556 3300005547 Bacteria 16534
95 Ga0070693_100052133 3300005547 Bacteria 2344
96 Ga0070665_100072838 3300005548 Bacteria 3442
97 Ga0070665_100198103 3300005548 Bacteria 2009
98 Ga0070665_100199775 3300005548 Bacteria 2000
99 Ga0070704_100038661 3300005549 Bacteria 3271
100 Ga0068855_100007084 3300005563 Bacteria 13600
101 Ga0068855_100023145 3300005563 Bacteria 7444
102 Ga0068855_100037529 3300005563 Bacteria 5761
103 Ga0068855_100379276 3300005563 Bacteria 1553
104 Ga0068856_100052656 3300005614 Bacteria 4014
105 Ga0068856_100154492 3300005614 Bacteria 2305
106 Ga0068852_100019417 3300005616 Bacteria 5379
107 Ga0068852_100072662 3300005616 Bacteria 3024
108 Ga0068852_100153771 3300005616 Bacteria 2141
109 Ga0068852_100160200 3300005616 Bacteria 2101
110 Ga0068852_100514389 3300005616 Bacteria 1194
111 Ga0068859_100004344 3300005617 Bacteria 14458
112 Ga0068859_100028508 3300005617 Bacteria 5598
113 Ga0068859_100164596 3300005617 Bacteria 2297
114 Ga0068859_100526879 3300005617 Bacteria 1276
115 Ga0068864_100001630 3300005618 Bacteria 18503
116 Ga0068864_100308240 3300005618 Bacteria 1484
117 Ga0068866_10006390 3300005718 Bacteria 4908
118 Ga0068866_10015134 3300005718 Bacteria 3423
119 Ga0068866_10020974 3300005718 Bacteria 3002
120 Ga0068861_100000216 3300005719 Bacteria 30988
121 Ga0068851_10001738 3300005834 Bacteria 9517
122 Ga0068870_10032489 3300005840 Bacteria 2654
123 Ga0068863_100001897 3300005841 Bacteria 20747
124 Ga0068863_100010160 3300005841 Bacteria 9154
125 Ga0068858_100002185 3300005842 Bacteria 19807
126 Ga0068858_100019968 3300005842 Bacteria 6265
127 Ga0068858_100029613 3300005842 Bacteria 5085
128 Ga0068858_100043547 3300005842 Bacteria 4162
129 Ga0068858_100064967 3300005842 Bacteria 3377
130 Ga0068858_100528526 3300005842 Bacteria 1141
131 Ga0068860_100102175 3300005843 Bacteria 2735
132 Ga0068860_100173619 3300005843 Bacteria 2082
133 Ga0068860_100489442 3300005843 Bacteria 1227
134 Ga0068862_100005857 3300005844 Bacteria 10240
135 Ga0068862_100085538 3300005844 Bacteria 2740
136 Ga0070717_10134803 3300006028 Bacteria 2126
137 Ga0075365_10003445 3300006038 Bacteria 8153
138 Ga0075365_10010772 3300006038 Bacteria 5343
139 Ga0075365_10067400 3300006038 Bacteria 2403
140 Ga0075365_10144663 3300006038 Bacteria 1651
141 Ga0075368_10008078 3300006042 Bacteria 3736
142 Ga0075363_100012431 3300006048 Bacteria 4102
143 Ga0070716_100019576 3300006173 Bacteria 3539
144 Ga0070716_100050292 3300006173 Bacteria 2365
145 Ga0075367_10011941 3300006178 Bacteria 4614
146 Ga0075366_10000934 3300006195 Bacteria 14194
147 Ga0075366_10035448 3300006195 Bacteria 2941
148 Ga0097621_100024432 3300006237 Bacteria 4719
149 Ga0075370_10223179 3300006353 Bacteria 1114
150 Ga0068871_100062659 3300006358 Bacteria 3040
151 Ga0075433_10145605 3300006852 Bacteria 2106
152 Ga0075434_100344013 3300006871 Bacteria 1512
153 Ga0075434_100380283 3300006871 Bacteria 1433
154 Ga0068865_100020352 3300006881 Bacteria 4302
155 Ga0068865_100308002 3300006881 Bacteria 1270
156 Ga0068865_100489548 3300006881 Bacteria 1023
157 Ga0097620_100004344 3300006931 Bacteria 14458
158 Ga0097620_100028509 3300006931 Bacteria 5598
159 Ga0097620_100164596 3300006931 Bacteria 2297
160 Ga0097620_100526887 3300006931 Bacteria 1276
161 Ga0105251_10000164 3300009011 Bacteria 68693
162 Ga0105250_10008849 3300009092 Bacteria 4261
163 Ga0105240_10000595 3300009093 Bacteria 67094
164 Ga0105240_10081508 3300009093 Bacteria 3976
165 Ga0105240_10143605 3300009093 Bacteria 2851
166 Ga0105240_10146839 3300009093 Bacteria 2813
167 Ga0105245_10079831 3300009098 Bacteria 2988
168 Ga0105245_10100350 3300009098 Bacteria 2677
169 Ga0105243_10032053 3300009148 Bacteria 4056
170 Ga0105243_10043792 3300009148 Bacteria 3509
171 Ga0105242_10008414 3300009176 Bacteria 7930
172 Ga0105242_10148766 3300009176 Bacteria 2040
173 Ga0105248_10057731 3300009177 Bacteria 4356
174 Ga0105248_10111694 3300009177 Bacteria 3082
175 Ga0105248_10124291 3300009177 Bacteria 2910
176 Ga0105248_10132322 3300009177 Bacteria 2814
177 Ga0105248_10346014 3300009177 Bacteria 1674
178 Ga0105237_10070814 3300009545 Bacteria 3482
179 Ga0105238_10002675 3300009551 Bacteria 17721
180 Ga0105238_10063799 3300009551 Bacteria 3685
181 Ga0105238_10616955 3300009551 Bacteria 1093
182 Ga0105239_10055981 3300010375 Bacteria 4326
183 Ga0157373_10046497 3300013100 Bacteria 3097
184 Ga0157370_10005459 3300013104 Bacteria 14256
185 Ga0157370_10006907 3300013104 Bacteria 12413
186 Ga0157369_10000059 3300013105 Bacteria 154283
187 Ga0157369_10000067 3300013105 Bacteria 144506
188 Ga0157369_10003432 3300013105 Bacteria 18795
189 Ga0157369_10045065 3300013105 Bacteria 4798
190 Ga0157369_10052130 3300013105 Bacteria 4428
191 Ga0157374_10254866 3300013296 Bacteria 1727
192 Ga0157378_10036796 3300013297 Bacteria 4332
193 Ga0157378_10200363 3300013297 Bacteria 1888
194 Ga0163162_10000707 3300013306 Bacteria 30906
195 Ga0163162_10097971 3300013306 Bacteria 3021
196 Ga0163162_10114385 3300013306 Bacteria 2797
197 Ga0157372_10010273 3300013307 Bacteria 9943
198 Ga0157372_10114930 3300013307 Bacteria 3085
199 Ga0157372_10145524 3300013307 Bacteria 2733
200 Ga0163163_10504430 3300014325 Bacteria 1272
201 Ga0157380_10047818 3300014326 Bacteria 3366
202 Ga0157380_10111436 3300014326 Bacteria 2300
203 Ga0182008_10035336 3300014497 Bacteria 2504
204 Ga0157377_10119048 3300014745 Bacteria 1598
205 Ga0157379_10000044 3300014968 Bacteria 75399
206 Ga0157379_10056174 3300014968 Bacteria 3518
207 Ga0157379_10121898 3300014968 Bacteria 2346
208 Ga0157379_10122191 3300014968 Bacteria 2343
209 Ga0157379_10125497 3300014968 Bacteria 2309
210 Ga0157379_10147547 3300014968 Bacteria 2121
211 Ga0157376_10036466 3300014969 Bacteria 3984
212 Ga0157376_10086274 3300014969 Bacteria 2706
213 Ga0157376_10307845 3300014969 Bacteria 1502
214 Ga0182007_10001108 3300015262 Bacteria 14590
215 Ga0182007_10010175 3300015262 Bacteria 3734
216 Ga0183361_10011 3300016635 Bacteria 203855
217 Ga0163161_10040984 3300017792 Bacteria 3327
218 Ga0206356_10949391 3300020070 Bacteria 8897
219 Ga0213872_10011643 3300021361 Bacteria 4159
220 Ga0224712_10000014 3300022467 Bacteria 26099
221 Ga0209566_102280 3300025225 Bacteria 3731
222 Ga0209674_100022 3300025226 Bacteria 563656
223 Ga0209674_100112 3300025226 Bacteria 142700
224 Ga0209672_100001 3300025228 Bacteria 2828210
225 Ga0209672_100373 3300025228 Bacteria 27548
226 Ga0209672_100454 3300025228 Bacteria 23194
227 Ga0209147_100001 3300025229 Bacteria 2384371
228 Ga0209147_100424 3300025229 Bacteria 27807
229 Ga0209147_100564 3300025229 Bacteria 20849
230 Ga0209147_100565 3300025229 Bacteria 20776
231 Ga0209563_100853 3300025230 Bacteria 9081
232 Ga0207427_103272 3300025231 Bacteria 3520
233 Ga0209258_100001 3300025242 Bacteria 2384269
234 Ga0209258_100633 3300025242 Bacteria 27801
235 Ga0209258_100695 3300025242 Bacteria 23194
236 Ga0209148_1000003 3300025254 Bacteria 2384288
237 Ga0209148_1000754 3300025254 Bacteria 24738
238 Ga0209148_1003947 3300025254 Bacteria 3818
239 Ga0209759_1000099 3300025256 Bacteria 156332
240 Ga0209759_1000125 3300025256 Bacteria 135516
241 Ga0209759_1000157 3300025256 Bacteria 116657
242 Ga0209759_1011456 3300025256 Bacteria 2520
243 Ga0209233_1000180 3300025261 Bacteria 140304
244 Ga0209455_1000001 3300025272 Bacteria 2384278
245 Ga0209455_1000509 3300025272 Bacteria 27807
246 Ga0209455_1005335 3300025272 Bacteria 3997
247 Ga0209673_1008403 3300025273 Bacteria 4598
248 Ga0209130_1019356 3300025284 Bacteria 1580
249 Ga0209564_1004199 3300025295 Bacteria 8981
250 Ga0209564_1005992 3300025295 Bacteria 6720
251 Ga0207426_1000252 3300025302 Bacteria 117376
252 Ga0207713_1000526 3300025735 Bacteria 38454
253 Ga0207642_10019624 3300025899 Bacteria 2621
254 Ga0207647_10005852 3300025904 Bacteria 8964
255 Ga0207647_10024827 3300025904 Bacteria 3948
256 Ga0207645_10049017 3300025907 Bacteria 2697
257 Ga0207643_10053053 3300025908 Bacteria 2303
258 Ga0207705_10000771 3300025909 Bacteria 26342
259 Ga0207705_10005777 3300025909 Bacteria 9222
260 Ga0207705_10018066 3300025909 Bacteria 5043
261 Ga0207705_10331217 3300025909 Bacteria 1171
262 Ga0207654_10035572 3300025911 Bacteria 2776
263 Ga0207654_10220589 3300025911 Bacteria 1258
264 Ga0207707_10111785 3300025912 Bacteria 2388
265 Ga0207695_10002553 3300025913 Bacteria 26751
266 Ga0207695_10059296 3300025913 Bacteria 3969
267 Ga0207695_10139653 3300025913 Bacteria 2373
268 Ga0207695_10242581 3300025913 Bacteria 1703
269 Ga0207671_10032438 3300025914 Bacteria 3888
270 Ga0207671_10081863 3300025914 Bacteria 2421
271 Ga0207663_10134907 3300025916 Bacteria 1711
272 Ga0207657_10047904 3300025919 Bacteria 3733
273 Ga0207657_10206246 3300025919 Bacteria 1579
274 Ga0207657_10289226 3300025919 Bacteria 1300
275 Ga0207652_10257581 3300025921 Bacteria 1574
276 Ga0207681_10071735 3300025923 Bacteria 2416
277 Ga0207694_10036796 3300025924 Bacteria 3756
278 Ga0207694_10046338 3300025924 Bacteria 3360
279 Ga0207694_10303644 3300025924 Bacteria 1314
280 Ga0207650_10043615 3300025925 Bacteria 3293
281 Ga0207659_10014354 3300025926 Bacteria 5105
282 Ga0207687_10172790 3300025927 Bacteria 1668
283 Ga0207700_10000934 3300025928 Bacteria 16798
284 Ga0207700_10001721 3300025928 Bacteria 12423
285 Ga0207700_10075528 3300025928 Bacteria 2612
286 Ga0207664_10005619 3300025929 Bacteria 8580
287 Ga0207664_10020960 3300025929 Bacteria 4851
288 Ga0207690_10019878 3300025932 Bacteria 4140
289 Ga0207690_10022747 3300025932 Bacteria 3903
290 Ga0207690_10243308 3300025932 Bacteria 1387
291 Ga0207686_10010703 3300025934 Bacteria 4997
292 Ga0207686_10022272 3300025934 Bacteria 3648
293 Ga0207686_10072842 3300025934 Bacteria 2215
294 Ga0207709_10044027 3300025935 Bacteria 2695
295 Ga0207670_10048959 3300025936 Bacteria 2824
296 Ga0207670_10114900 3300025936 Bacteria 1946
297 Ga0207669_10146517 3300025937 Bacteria 1647
298 Ga0207665_10009637 3300025939 Bacteria 6344
299 Ga0207665_10036883 3300025939 Bacteria 3252
300 Ga0207691_10031621 3300025940 Bacteria 4938
301 Ga0207711_10007434 3300025941 Bacteria 9169
302 Ga0207711_10014343 3300025941 Bacteria 6582
303 Ga0207711_10054670 3300025941 Bacteria 3427
304 Ga0207711_10147800 3300025941 Bacteria 2118
305 Ga0207711_10172205 3300025941 Bacteria 1965
306 Ga0207689_10002193 3300025942 Bacteria 18314
307 Ga0207689_10014153 3300025942 Bacteria 6788
308 Ga0207689_10027428 3300025942 Bacteria 4767
309 Ga0207667_10000347 3300025949 Bacteria 63149
310 Ga0207667_10037059 3300025949 Bacteria 5216
311 Ga0207667_10088270 3300025949 Bacteria 3207
312 Ga0207667_10114477 3300025949 Bacteria 2780
313 Ga0207667_10219678 3300025949 Bacteria 1947
314 Ga0207667_10239669 3300025949 Bacteria 1856
315 Ga0207651_10008860 3300025960 Bacteria 5463
316 Ga0207651_10045804 3300025960 Bacteria 2936
317 Ga0207651_10045894 3300025960 Bacteria 2934
318 Ga0207712_10093236 3300025961 Bacteria 2222
319 Ga0207668_10073639 3300025972 Bacteria 2448
320 Ga0207640_10240884 3300025981 Bacteria 1397
321 Ga0207658_10031309 3300025986 Bacteria 3776
322 Ga0207658_10198378 3300025986 Bacteria 1674
323 Ga0207703_10001245 3300026035 Bacteria 23856
324 Ga0207703_10024604 3300026035 Bacteria 4736
325 Ga0207703_10041596 3300026035 Bacteria 3683
326 Ga0207703_10051592 3300026035 Bacteria 3334
327 Ga0207703_10268607 3300026035 Bacteria 1544
328 Ga0207639_10094905 3300026041 Bacteria 2396
329 Ga0207678_10044867 3300026067 Bacteria 3823
330 Ga0207678_10060999 3300026067 Bacteria 3243
331 Ga0207678_10067517 3300026067 Bacteria 3069
332 Ga0207678_10092259 3300026067 Bacteria 2589
333 Ga0207678_10105427 3300026067 Bacteria 2405
334 Ga0207708_10194582 3300026075 Bacteria 1615
335 Ga0207702_10301107 3300026078 Bacteria 1522
336 Ga0207641_10005674 3300026088 Bacteria 10621
337 Ga0207641_10043813 3300026088 Bacteria 3760
338 Ga0207641_10063138 3300026088 Bacteria 3163
339 Ga0207648_10005826 3300026089 Bacteria 12341
340 Ga0207648_10111319 3300026089 Bacteria 2404
341 Ga0207676_10005716 3300026095 Bacteria 8801
342 Ga0207674_10023627 3300026116 Bacteria 6581
343 Ga0207675_100000672 3300026118 Bacteria 33681
344 Ga0207675_100187777 3300026118 Bacteria 1981
345 Ga0207675_100484399 3300026118 Bacteria 1230
346 Ga0207683_10123613 3300026121 Bacteria 2324
347 Ga0207683_10141151 3300026121 Bacteria 2171
348 Ga0207683_10215619 3300026121 Bacteria 1748
349 Ga0207698_10051168 3300026142 Bacteria 3156
350 Ga0207698_10083165 3300026142 Bacteria 2590
351 Ga0207698_10193814 3300026142 Bacteria 1813
352 Ga0207698_10373212 3300026142 Bacteria 1355
353 Ga0207698_10425785 3300026142 Bacteria 1275
354 Ga0209371_1001698 3300027312 Bacteria 13970
355 Ga0268266_10163836 3300028379 Bacteria 2013
356 Ga0268265_10026894 3300028380 Bacteria 4098
357 Ga0268265_10152601 3300028380 Bacteria 1950
358 Ga0268264_10001103 3300028381 Bacteria 26672
359 Ga0265318_10002884 3300028577 Bacteria 8957
360 Ga0265338_10000104 3300028800 Bacteria 156596
361 Ga0265338_10076974 3300028800 Bacteria 2822
362 Ga0268256_1007215 3300030500 Bacteria 3998
363 Ga0265330_10001319 3300031235 Bacteria 14499
364 Ga0265325_10000403 3300031241 Bacteria 30655
365 Ga0265339_10013001 3300031249 Bacteria 5060
366 Ga0265339_10060246 3300031249 Bacteria 2046
367 Ga0265316_10002283 3300031344 Bacteria 20065
368 Ga0265316_10056370 3300031344 Bacteria 3070
369 Ga0307408_100154902 3300031548 Bacteria 1813
370 Ga0307408_100185513 3300031548 Bacteria 1672
371 Ga0265313_10003435 3300031595 Bacteria 12820
372 Ga0265342_10024858 3300031712 Bacteria 3774
373 Ga0316578_10064750 3300031728 Bacteria 2158
374 Ga0307405_10051272 3300031731 Bacteria 2560
375 Ga0307405_10128969 3300031731 Bacteria 1744
376 Ga0307412_10000054 3300031911 Bacteria 147105
377 Ga0307416_100246617 3300032002 Bacteria 1735
378 Ga0307416_100279912 3300032002 Bacteria 1644
379 Ga0373930_0004268 3300034816 Bacteria 2314
380 Ga0373930_0016747 3300034816 Bacteria 1390
381 Ga0373928_0000567 3300035084 Bacteria 7229
382 Ga0373929_0019040 3300035085 Bacteria 1370
383 Ga0373932_0000132 3300035112 Bacteria 21153
384 Ga0373955_0007760 3300035172 Bacteria 4945
385 Ga0316574_0014777 3300035398 Bacteria 4519
386 Ga0316574_0072172 3300035398 Bacteria 2181
387 Ga0316574_0213038 3300035398 Bacteria 1239
388 Ga0373924_0065430 3300035410 Bacteria 1526
389 Ga0373931_0000001 3300035691 Bacteria 634029
390 Ga0373931_0092653 3300035691 Bacteria 1686
391 Ga0373927_0010962 3300035695 Bacteria 6036
392 Ga0373937_0323312 3300036401 Bacteria 1460
393 Ga0316584_0185255 3300036712 Bacteria 1540
394 Ga0395899_0000029 3300037312 Bacteria 329371
395 Ga0395899_0078087 3300037312 Bacteria 2414
396 Ga0395899_0166640 3300037312 Bacteria 1554
397 Ga0395900_0000098 3300037418 Bacteria 158030
398 Ga0395900_0000196 3300037418 Bacteria 96480
399 Ga0395900_0140713 3300037418 Bacteria 2471
400 Ga0395900_0154138 3300037418 Bacteria 2347
401 Ga0395898_0000086 3300037466 Bacteria 239895
402 Ga0395898_0002206 3300037466 Bacteria 23779
403 Ga0395905_0000107 3300037471 Bacteria 138710
404 Ga0395905_0002228 3300037471 Bacteria 21868
405 Ga0395905_0030315 3300037471 Bacteria 5098
406 Ga0395905_0336558 3300037471 Bacteria 1400
407 Ga0395901_0000104 3300038443 Bacteria 114939
408 Ga0395901_0000137 3300038443 Bacteria 95185
409 Ga0395901_0181778 3300038443 Bacteria 2205
410 Ga0400483_124349 3300039062 Bacteria 5128
411 Ga0400483_281211 3300039062 Bacteria 2578
412 Ga0436361_0218373 3300039447 Bacteria 11684
413 Ga0436361_0667566 3300039447 Bacteria 3634
414 Ga0436361_0859276 3300039447 Bacteria 1096
415 Ga0439433_0033354 3300041999 Unclassified 1183
416 Ga0439460_0022663 3300042461 Bacteria 1725
417 Ga0451577_0001796 3300042876 Bacteria 27445
418 Ga0451577_0011238 3300042876 Bacteria 8485
419 Ga0451577_0011721 3300042876 Bacteria 8276
420 Ga0451577_0153558 3300042876 Bacteria 2071
421 Ga0451577_0168179 3300042876 Unclassified 1975
422 Ga0451577_0230519 3300042876 Bacteria 1675
423 Ga0466969_0000707 3300044656 Bacteria 18081
424 Ga0466972_0009212 3300044658 Bacteria 4958
425 Ga0466973_0038994 3300044659 Bacteria 4494
426 Ga0453683_0039993 3300044673 Bacteria 2946
427 Ga0453683_0070147 3300044673 Bacteria 2192
428 Ga0453683_0101012 3300044673 Unclassified 1811
429 Ga0453683_0159296 3300044673 Bacteria 1428
430 Ga0453683_0208645 3300044673 Bacteria 1241
431 Ga0466965_0003560 3300044683 Bacteria 6844
432 Ga0466965_0040842 3300044683 Bacteria 2284
433 Ga0466965_0110897 3300044683 Bacteria 1410
434 Ga0466966_0000005 3300044684 Bacteria 193939
435 Ga0466966_0022936 3300044684 Bacteria 4090
436 Ga0466966_0038146 3300044684 Bacteria 3096
437 Ga0466966_0054667 3300044684 Bacteria 2529
438 Ga0466966_0145425 3300044684 Bacteria 1447
439 Ga0466966_0160371 3300044684 Bacteria 1369
440 Ga0466961_0001666 3300044693 Bacteria 13819
441 Ga0466961_0006747 3300044693 Bacteria 7304
442 Ga0466961_0060153 3300044693 Bacteria 2415
443 Ga0466961_0084792 3300044693 Bacteria 2003
444 Ga0466961_0099566 3300044693 Bacteria 1832
445 Ga0466963_0005666 3300044694 Bacteria 7336
446 Ga0466963_0011265 3300044694 Bacteria 5442
447 Ga0466963_0020762 3300044694 Bacteria 4134
448 Ga0466964_0001910 3300044706 Bacteria 7287
449 Ga0453684_0000007 3300044712 Bacteria 1301482
450 Ga0453684_0000056 3300044712 Bacteria 513389
451 Ga0453684_0003522 3300044712 Bacteria 35045
452 Ga0453684_0007475 3300044712 Bacteria 20062
453 Ga0453684_0011550 3300044712 Bacteria 14775
454 Ga0453684_0012139 3300044712 Bacteria 14294
455 Ga0453684_0059665 3300044712 Bacteria 4916
456 Ga0453684_0129316 3300044712 Bacteria 3032
457 Ga0453684_0446996 3300044712 Bacteria 1439
458 Ga0466971_0006197 3300044719 Bacteria 5198
459 Ga0466971_0047654 3300044719 Bacteria 1926
460 Ga0466968_0048030 3300044735 Bacteria 1816
461 Ga0466970_0123469 3300044765 Bacteria 1419
462 Ga0466957_0001296 3300044842 Bacteria 13054
463 Ga0466957_0002597 3300044842 Bacteria 9736
464 Ga0466957_0007806 3300044842 Bacteria 6061
465 Ga0466957_0025440 3300044842 Bacteria 3508
466 Ga0466957_0043283 3300044842 Bacteria 2726
467 Ga0466957_0158137 3300044842 Bacteria 1470
468 Ga0466960_0012676 3300044901 Bacteria 3564
469 Ga0466959_0012397 3300045049 Bacteria 6158
470 Ga0466959_0015649 3300045049 Bacteria 5530
471 Ga0451576_0000192 3300045051 Bacteria 154140
472 Ga0451576_0000829 3300045051 Bacteria 60290
473 Ga0451576_0001119 3300045051 Bacteria 48710
474 Ga0451576_0011393 3300045051 Bacteria 10105
475 Ga0451576_0123113 3300045051 Bacteria 2701
476 Ga0451576_0149959 3300045051 Bacteria 2432
477 Ga0451576_0348181 3300045051 Bacteria 1551
478 Ga0466958_0002607 3300045836 Bacteria 9108
479 Ga0466958_0013951 3300045836 Bacteria 4581
480 Ga0466958_0021290 3300045836 Bacteria 3787
481 Ga0466958_0094609 3300045836 Bacteria 1851
482 Ga0466958_0121786 3300045836 Bacteria 1633
483 Ga0495592_0018445 3300046454 Bacteria 5307
484 Ga0495592_0019113 3300046454 Bacteria 5213
485 Ga0495592_0047416 3300046454 Bacteria 3200
486 Ga0495603_0001492 3300046455 Bacteria 13623
487 Ga0495590_0021858 3300046457 Bacteria 2265
488 Ga0495591_001173 3300046458 Bacteria 17117
489 Ga0495629_0002860 3300046459 Bacteria 13186
490 Ga0495629_0006339 3300046459 Bacteria 8775
491 Ga0495629_0007060 3300046459 Bacteria 8274
492 Ga0495638_0003196 3300046460 Bacteria 12954
493 Ga0495638_0006860 3300046460 Bacteria 8220
494 Ga0495641_0079357 3300046461 Bacteria 1471
495 Ga0495651_0008582 3300046462 Bacteria 7832
496 Ga0495653_0002493 3300046463 Bacteria 14654
497 Ga0495653_0003241 3300046463 Bacteria 13048
498 Ga0495653_0010264 3300046463 Bacteria 7663
499 Ga0495653_0079027 3300046463 Bacteria 2438
500 Ga0495653_0081128 3300046463 Bacteria 2397
501 Ga0495653_0150723 3300046463 Bacteria 1625
502 Ga0495650_0012432 3300046471 Bacteria 4581
503 Ga0495580_0005037 3300046472 Bacteria 11014
504 Ga0495580_0005977 3300046472 Bacteria 9974
505 Ga0495580_0008862 3300046472 Bacteria 7959
506 Ga0495580_0013075 3300046472 Bacteria 6354
507 Ga0495580_0031201 3300046472 Bacteria 3853
508 Ga0495582_0006253 3300046473 Bacteria 6637
509 Ga0495582_0016675 3300046473 Bacteria 4022
510 Ga0495582_0060829 3300046473 Bacteria 2084
511 Ga0495605_0003102 3300046474 Bacteria 10022
512 Ga0495605_0008110 3300046474 Bacteria 5941
513 Ga0495605_0010240 3300046474 Bacteria 5251
514 Ga0495662_0012041 3300046476 Bacteria 4227
515 Ga0495662_0023367 3300046476 Bacteria 2985
516 Ga0495664_0000998 3300046477 Bacteria 14594
517 Ga0495664_0002627 3300046477 Bacteria 9666
518 Ga0495596_0006417 3300046500 Bacteria 5411
519 Ga0495596_0007366 3300046500 Bacteria 4968
520 Ga0495596_0013157 3300046500 Bacteria 3519
521 Ga0495583_0005795 3300046506 Bacteria 8251
522 Ga0495583_0039286 3300046506 Bacteria 2230
523 Ga0495606_0017601 3300046507 Bacteria 5394
524 Ga0495608_0001733 3300046511 Bacteria 15643
525 Ga0495608_0005902 3300046511 Bacteria 8709
526 Ga0495608_0073808 3300046511 Bacteria 2224
527 Ga0495610_0002328 3300046512 Bacteria 16057
528 Ga0495616_0062177 3300046513 Bacteria 1829
529 Ga0495618_0005279 3300046514 Bacteria 7896
530 Ga0495618_0017149 3300046514 Bacteria 4438
531 Ga0495618_0021892 3300046514 Bacteria 3944
532 Ga0495618_0091188 3300046514 Bacteria 1948
533 Ga0495620_0038514 3300046515 Bacteria 2121
534 Ga0495620_0076897 3300046515 Bacteria 1356
535 Ga0495628_0003132 3300046516 Bacteria 14849
536 Ga0495628_0016423 3300046516 Bacteria 6176
537 Ga0495628_0051819 3300046516 Bacteria 3243
538 Ga0495628_0060380 3300046516 Bacteria 2975
539 Ga0495628_0061020 3300046516 Bacteria 2958
540 Ga0495628_0117665 3300046516 Bacteria 2040
541 Ga0495628_0131392 3300046516 Bacteria 1914
542 Ga0495630_0011646 3300046517 Bacteria 6373
543 Ga0495630_0020586 3300046517 Bacteria 4865
544 Ga0495630_0074633 3300046517 Bacteria 2555
545 Ga0495648_0015959 3300046524 Bacteria 5426
546 Ga0495648_0023219 3300046524 Bacteria 4253
547 Ga0495648_0027977 3300046524 Bacteria 3764
548 Ga0495666_0001172 3300046526 Bacteria 12597
549 Ga0495666_0001884 3300046526 Bacteria 10354
550 Ga0495666_0001892 3300046526 Bacteria 10332
551 Ga0495642_0086541 3300046528 Bacteria 1324
552 Ga0495652_0006806 3300046529 Bacteria 10596
553 Ga0495652_0012881 3300046529 Bacteria 7534
554 Ga0495652_0022650 3300046529 Bacteria 5573
555 Ga0495665_0002407 3300046531 Bacteria 10111
556 Ga0495665_0002948 3300046531 Bacteria 9190
557 Ga0495665_0011102 3300046531 Bacteria 4875
558 Ga0495640_0012698 3300046533 Bacteria 6430
559 Ga0495640_0017072 3300046533 Bacteria 5416
560 Ga0495586_0011268 3300046535 Bacteria 4754
561 Ga0495586_0023915 3300046535 Bacteria 3262
562 Ga0495586_0031698 3300046535 Bacteria 2833
563 Ga0495587_0003605 3300046536 Bacteria 10302
564 Ga0495645_0002890 3300046543 Bacteria 11656
565 Ga0495622_0002306 3300046557 Bacteria 9288
566 Ga0495622_0049758 3300046557 Bacteria 1946
567 Ga0495667_0072591 3300046559 Bacteria 2243
568 Ga0495634_0002770 3300046642 Bacteria 14393
569 Ga0495634_0012419 3300046642 Bacteria 6165
570 Ga0495634_0080951 3300046642 Bacteria 2124
571 Ga0495611_0012801 3300046648 Bacteria 3564
572 Ga0495635_0002838 3300046663 Bacteria 11900
573 Ga0495635_0012550 3300046663 Bacteria 5936
574 Ga0495635_0201222 3300046663 Bacteria 1351
575 Ga0495661_0002331 3300046665 Bacteria 14643
576 Ga0495661_0009682 3300046665 Bacteria 6601
577 Ga0495661_0041284 3300046665 Bacteria 2855
578 Ga0495657_0013783 3300046675 Bacteria 5951
579 Ga0495657_0066709 3300046675 Bacteria 2364
580 Ga0495657_0169029 3300046675 Bacteria 1348
581 Ga0495657_0270112 3300046675 Bacteria 1020
582 Ga0495599_0022153 3300046678 Bacteria 3965
583 Ga0495623_0015547 3300046679 Bacteria 4921
584 Ga0495646_0001230 3300046680 Bacteria 15030
585 Ga0495646_0004523 3300046680 Bacteria 8754
586 Ga0495646_0025145 3300046680 Bacteria 3746
587 Ga0495669_0015313 3300046684 Bacteria 3284
588 Ga0495669_0026475 3300046684 Bacteria 2535
589 Ga0495613_0002243 3300046689 Bacteria 14613
590 Ga0495613_0015727 3300046689 Bacteria 5631
591 Ga0495613_0049041 3300046689 Bacteria 3117
592 Ga0495624_0002882 3300046690 Bacteria 12871
593 Ga0495624_0011558 3300046690 Bacteria 6065
594 Ga0495624_0095898 3300046690 Bacteria 1827
595 Ga0495670_0012440 3300046691 Bacteria 4185
596 Ga0495649_0017196 3300046694 Bacteria 4084
597 Ga0495589_0017215 3300046794 Bacteria 3711
598 Ga0495589_0113375 3300046794 Bacteria 1308
599 Ga0495600_0001140 3300046809 Bacteria 14518
600 Ga0495600_0041387 3300046809 Bacteria 3002
601 Ga0495600_0204231 3300046809 Bacteria 1268
602 Ga0495660_0067323 3300046810 Bacteria 1908
603 Ga0495581_0001962 3300047315 Bacteria 11527
604 Ga0495581_0006868 3300047315 Bacteria 6600
605 Ga0495604_0002319 3300047317 Bacteria 15243
606 Ga0495604_0012572 3300047317 Bacteria 6732
607 Ga0495604_0013874 3300047317 Bacteria 6427
608 Ga0495604_0075157 3300047317 Bacteria 2544
609 Ga0495674_0005769 3300047319 Bacteria 11870
610 Ga0495674_0013154 3300047319 Bacteria 7782
611 Ga0495674_0033647 3300047319 Bacteria 4641
612 Ga0495674_0270421 3300047319 Bacteria 1394
613 Ga0495672_0011901 3300047320 Bacteria 6104
614 Ga0495672_0017178 3300047320 Bacteria 4844
615 Ga0495672_0050341 3300047320 Bacteria 2459
616 Ga0495676_0002156 3300047321 Bacteria 17418
617 Ga0495676_0019012 3300047321 Bacteria 6051
618 Ga0495676_0042612 3300047321 Bacteria 3723
619 Ga0495676_0123569 3300047321 Bacteria 1879
620 Ga0495680_0003344 3300047322 Bacteria 15854
621 Ga0495680_0003961 3300047322 Bacteria 14320
622 Ga0495680_0023699 3300047322 Bacteria 5099
623 Ga0495680_0051553 3300047322 Bacteria 3212
624 Ga0495683_0004640 3300047323 Bacteria 7742
625 Ga0495683_0009341 3300047323 Bacteria 5222
626 Ga0495683_0009690 3300047323 Bacteria 5123
627 Ga0495683_0065755 3300047323 Bacteria 1788
628 Ga0495687_007357 3300047443 Bacteria 6500
629 Ga0495687_011859 3300047443 Bacteria 4653
630 Ga0495687_012450 3300047443 Bacteria 4497
631 Ga0495687_017589 3300047443 Bacteria 3560
632 Ga0495675_0001442 3300047444 Bacteria 14384
633 Ga0495675_0004332 3300047444 Bacteria 8583
634 Ga0495675_0004681 3300047444 Bacteria 8312
635 Ga0495677_0040387 3300047445 Bacteria 1706
636 Ga0495679_000399 3300047446 Bacteria 32765
637 Ga0495679_000514 3300047446 Bacteria 27522
638 Ga0495679_000737 3300047446 Bacteria 20997
639 Ga0495673_0005498 3300047469 Bacteria 7653
640 Ga0495673_0006064 3300047469 Bacteria 7178
641 Ga0495684_0115330 3300047471 Bacteria 2025
642 Ga0495684_0194463 3300047471 Bacteria 1498
643 Ga0495686_0000076 3300047472 Bacteria 206039
644 Ga0495593_0003425 3300047673 Bacteria 9492
645 Ga0495593_0003829 3300047673 Bacteria 8983
646 Ga0495593_0008127 3300047673 Bacteria 6105
647 Ga0495593_0057294 3300047673 Bacteria 2046
648 Ga0495602_0004536 3300048088 Bacteria 14489
649 Ga0495602_0011568 3300048088 Bacteria 9118
650 Ga0495602_0027460 3300048088 Bacteria 5468
651 Ga0495602_0072371 3300048088 Bacteria 2939
652 Ga0495602_0107796 3300048088 Bacteria 2269
653 Ga0495614_0001762 3300048089 Bacteria 9458
654 Ga0495626_0010364 3300048091 Bacteria 4976
655 Ga0496100_0071924 3300048903 Bacteria 2310
656 Ga0496101_0001769 3300048904 Bacteria 12973
657 Ga0496101_0024446 3300048904 Bacteria 4181
658 Ga0496101_0064829 3300048904 Bacteria 2662
659 Ga0496101_0320787 3300048904 Bacteria 1215
660 Ga0496102_0003988 3300048905 Bacteria 12499
661 Ga0496102_0015741 3300048905 Bacteria 6590
662 Ga0496102_0050204 3300048905 Bacteria 3798
663 Ga0496103_0002668 3300048906 Bacteria 11164
664 Ga0496103_0029652 3300048906 Bacteria 3325
665 Ga0496104_0009080 3300048907 Bacteria 8839
666 Ga0496104_0042296 3300048907 Bacteria 4275
667 Ga0496104_0188710 3300048907 Bacteria 1972
668 Ga0496105_0073706 3300048908 Bacteria 2820
669 Ga0496105_0133127 3300048908 Bacteria 2048
670 Ga0496106_0000301 3300048909 Bacteria 34836
671 Ga0496106_0056502 3300048909 Bacteria 2967
672 Ga0496106_0228121 3300048909 Bacteria 1486
673 Ga0496107_0044666 3300048910 Bacteria 3186
674 Ga0496107_0053687 3300048910 Bacteria 2907
675 Ga0496108_0073486 3300048911 Bacteria 2887
676 Ga0496108_0237794 3300048911 Bacteria 1584
677 Ga0496109_0213459 3300048912 Bacteria 1815
678 Ga0496110_0064675 3300048913 Bacteria 3233
679 Ga0496110_0231393 3300048913 Bacteria 1681
680 Ga0496112_0005293 3300048915 Bacteria 11129
681 Ga0496112_0134950 3300048915 Bacteria 2438
682 Ga0496113_0064725 3300048916 Bacteria 2765
683 Ga0496113_0105470 3300048916 Bacteria 2188
684 Ga0496114_0064580 3300048917 Bacteria 3066
685 Ga0496114_0101879 3300048917 Bacteria 2452
686 Ga0496114_0295716 3300048917 Bacteria 1429
687 Ga0496115_0100087 3300048918 Bacteria 2376
688 Ga0496116_0020190 3300048919 Bacteria 5068
689 Ga0496116_0025219 3300048919 Bacteria 4375
690 Ga0496116_0080793 3300048919 Bacteria 2018
691 Ga0496117_0003049 3300048920 Bacteria 20080
692 Ga0496117_0004615 3300048920 Bacteria 15013
693 Ga0496117_0012097 3300048920 Bacteria 7657
694 Ga0496117_0016129 3300048920 Bacteria 6319
695 Ga0496117_0022931 3300048920 Bacteria 4996
696 Ga0496117_0074363 3300048920 Bacteria 2262
697 Ga0496118_0001753 3300048921 Bacteria 31462
698 Ga0496118_0003700 3300048921 Bacteria 18957
699 Ga0496118_0006470 3300048921 Bacteria 12861
700 Ga0496118_0006753 3300048921 Bacteria 12484
701 Ga0496118_0031206 3300048921 Bacteria 4424
702 Ga0496118_0033101 3300048921 Bacteria 4248
703 Ga0496121_0004965 3300048924 Bacteria 17438
704 Ga0496121_0006290 3300048924 Bacteria 14846
705 Ga0496121_0006544 3300048924 Bacteria 14397
706 Ga0496121_0039725 3300048924 Bacteria 4139
707 Ga0496121_0075755 3300048924 Bacteria 2686
708 Ga0496124_0099954 3300048927 Bacteria 2352
709 Ga0496126_0000263 3300048929 Bacteria 111847
710 Ga0496126_0003028 3300048929 Bacteria 21785
711 Ga0496126_0007901 3300048929 Bacteria 11580
712 Ga0496126_0031426 3300048929 Bacteria 5017
713 Ga0496126_0045435 3300048929 Bacteria 4036
714 Ga0496126_0066680 3300048929 Bacteria 3218
715 Ga0496126_0126367 3300048929 Bacteria 2213
716 Ga0495682_0007462 3300049460 Bacteria 4345
717 Ga0495682_0016020 3300049460 Bacteria 2836
718 Ga0501031_0192723 3300049568 Bacteria 1331
719 Ga0501034_0000559 3300049571 Bacteria 58910
720 Ga0501037_0063610 3300049573 Bacteria 2689
721 Ga0501040_0012787 3300049576 Bacteria 5510
722 Ga0501042_0081171 3300049578 Bacteria 2324
723 Ga0501042_0316125 3300049578 Bacteria 1128
724 Ga0501047_0062150 3300049581 Bacteria 3603
725 Ga0501047_0069118 3300049581 Bacteria 3402
726 Ga0501047_0332370 3300049581 Bacteria 1358
727 Ga0501048_0035506 3300049582 Bacteria 3589
728 Ga0501068_0000033 3300049584 Bacteria 51001
729 Ga0501068_0011853 3300049584 Bacteria 4928
730 Ga0501069_0000010 3300049585 Bacteria 154317
731 Ga0501069_0002518 3300049585 Bacteria 9356
732 Ga0501069_0005019 3300049585 Bacteria 6866
733 Ga0501070_0000005 3300049586 Bacteria 250033
734 Ga0501070_0001192 3300049586 Bacteria 23236
735 Ga0501070_0021433 3300049586 Bacteria 5420
736 Ga0501071_0071724 3300049587 Bacteria 2525
737 Ga0501071_0122860 3300049587 Bacteria 1925
738 Ga0501071_0153533 3300049587 Bacteria 1718
739 Ga0501071_0156396 3300049587 Bacteria 1702
740 Ga0501072_0003879 3300049588 Bacteria 11308
741 Ga0501072_0027469 3300049588 Bacteria 4439
742 Ga0501073_0002509 3300049589 Bacteria 13717
743 Ga0501073_0009076 3300049589 Bacteria 7340
744 Ga0501073_0017057 3300049589 Bacteria 5259
745 Ga0501074_0005030 3300049590 Bacteria 9486
746 Ga0501074_0027676 3300049590 Bacteria 4110
747 Ga0501074_0111950 3300049590 Bacteria 1953
748 Ga0501074_0270954 3300049590 Bacteria 1207
749 Ga0501075_0003860 3300049591 Bacteria 10095
750 Ga0501075_0012640 3300049591 Bacteria 6005
751 Ga0501076_0088389 3300049592 Bacteria 2490
752 Ga0501079_0003247 3300049741 Bacteria 11912
753 Ga0501079_0040844 3300049741 Unclassified 3580
754 Ga0501080_0018433 3300049742 Bacteria 6460
755 Ga0501080_0083331 3300049742 Bacteria 2970
756 Ga0501080_0146638 3300049742 Bacteria 2182
757 Ga0501083_0004878 3300049744 Bacteria 9491
758 Ga0501083_0006807 3300049744 Bacteria 8113
759 nmdc:mga03n38_124845_c1 3300050490 Bacteria 1269
760 nmdc:mga00v17_250077_c1 3300050491 Bacteria 1149
761 nmdc:mga00v17_34262_c1 3300050491 Bacteria 3014
762 nmdc:mga0yw44_1281_c1 3300050492 Bacteria 9912
763 nmdc:mga0yw44_57274_c1 3300050492 Bacteria 2377
764 nmdc:mga0k408_11551_c1 3300050493 Bacteria 4813
765 nmdc:mga0k408_4514_c1 3300050493 Bacteria 7389
766 nmdc:mga0k408_467_c1 3300050493 Bacteria 22231
767 nmdc:mga05p37_70516_c1 3300050507 Bacteria 4298
768 nmdc:mga0n895_256104_c1 3300050512 Bacteria 1776
769 nmdc:mga0n895_63959_c1 3300050512 Bacteria 3638
770 nmdc:mga0a205_8637_c1 3300050515 Bacteria 9269
771 nmdc:mga0sz30_39823_c1 3300050516 Bacteria 1973
772 Ga0495619_0085412 3300053085 Bacteria 2131
773 Ga0500566_0007609 3300053094 Bacteria 6421
774 Ga0500593_059822 3300053117 Bacteria 1676
775 Ga0501084_0000517 3300054114 Bacteria 29536
776 Ga0501084_0020197 3300054114 Bacteria 5552
777 Ga0501084_0100307 3300054114 Bacteria 2431
778 Ga0501084_0461511 3300054114 Bacteria 1074
779 Ga0501082_0018429 3300060353 Bacteria 6013
780 Ga0501082_0062527 3300060353 Bacteria 3205
781 Ga0501082_0135658 3300060353 Bacteria 2135
782 Ga0466962_0003300 3300061719 Bacteria 7667
783 Ga0466962_0005580 3300061719 Bacteria 6039
784 Ga0530510_0049273 3300061734 Bacteria 3044
785 Ga0530510_0057750 3300061734 Bacteria 2805
786 2501076681 2501025501 Bacteria 7768574
787 2501082552 2501025502 Bacteria 9641094
788 2501408499 2501025504 Bacteria 8008976
789 2509131548 2508501125 Bacteria 7208311
790 2510250543 2510065045 Bacteria 7761063
791 2511086114 2510917013 Bacteria 9951648
792 2511096233 2510917014 Bacteria 8296963
793 2511103044 2510917015 Bacteria 7950052
794 2512346749 2512047030 Bacteria 9031815
795 2513556424 2513237082 Bacteria 8640282
796 2513564444 2513237083 Bacteria 8410967
797 2513963639 2513237151 Bacteria 6309801
798 2514053276 2513237166 Bacteria 10373764
799 2515680056 2515154122 Bacteria 8609520
800 2516024461 2515154189 Bacteria 9629850
801 2519459275 2519103095 Bacteria 6629912
802 2527079889 2526164713 Bacteria 6780608
803 2563063334 2562617112 Bacteria 10918404
804 2585295843 2582581311 Bacteria 6763856
805 2599742207 2599185239 Bacteria 8686614
806 2599749409 2599185240 Bacteria 7968121
807 2600211536 2599185355 Bacteria 7968906
808 2600810714 2600255067 Bacteria 6795583
809 2676747663 2675903129 Bacteria 7964495
810 2713477550 2711768613 Bacteria 11048459
811 2719639695 2718217991 Bacteria 7829542
812 2738824486 2738541296 Bacteria 7285013
813 2738836895 2738541298 Bacteria 7286732
814 2738878426 2738541306 Bacteria 7284992
815 2739190118 2738543002 Bacteria 7284546
816 2739225019 2738543008 Bacteria 7282815
817 2746086156 2744054900 Bacteria 8399525
818 2746094818 2744054901 Bacteria 8397047
819 2753570849 2751185846 Bacteria 7242164
820 2792840806 2791355137 Bacteria 9654227
821 2808974526 2808606384 Bacteria 8474373
822 2809009387 2808606390 Bacteria 8476311
823 2809016464 2808606391 Bacteria 8308166
824 2817261563 2816332253 Bacteria 6764532
825 2817279245 2816332256 Bacteria 6891714
826 2817452476 2816332286 Bacteria 6853759
827 2819624601 2818991450 Bacteria 6962147
828 2819631418 2818991452 Bacteria 8442785
829 2842332339 2842324504 Bacteria 9364110
830 2842356627 2842348783 Bacteria 9002918
831 2842461881 2842454564 Bacteria 8730687
832 2856292674 2856287931 Bacteria 7223934
833 2857360877 2857357740 Bacteria 9937880
834 2863428115 2863421361 Bacteria 7300805
835 2870070736 2870068957 Bacteria 8925310
836 2883087931 2883087390 Bacteria 9532701
837 2885278384 2885270888 Bacteria 9831543
838 2900635572 2900634093 Bacteria 10263517
839 2902688763 2902682994 Bacteria 8951596
840 2904485670 2904483920 Bacteria 7545285
841 2904571635 2904564687 Bacteria 7609577
842 2904578673 2904571731 Bacteria 7608790
843 2904618373 2904615490 Bacteria 10047340
844 2919533828 2919527303 Bacteria 7718827
845 2921650723 2921643360 Bacteria 11448031
846 2928110686 2928108538 Bacteria 7360024
847 2928140202 2928135762 Bacteria 7259641
848 2928162775 2928157003 Bacteria 7522202
849 2928169436 2928163908 Bacteria 7561269
850 2928178953 2928170801 Bacteria 8785406
851 2928505696 2928503688 Bacteria 7268108
852 2928543154 2928536128 Bacteria 7657547
853 2945936189 2945934425 Bacteria 7444609
854 2981997222 2981990288 Bacteria 7590678
855 2990709908 2990703756 Bacteria 7715990
856 642427435 641736151 Bacteria 7477263
857 642420527 641736154 Bacteria 7689995
858 642593750 642555112 Bacteria 8676562
859 642620957 642555113 Bacteria 8214658
860 8003960875 8003955200 Bacteria 8601927
861 8018852836 8018845410 Bacteria 8933938
862 8020813817 8020807995 Bacteria 6801506
863 8020942481 8020938398 Bacteria 7472757
864 8020952599 8020945358 Bacteria 8467355
865 8020958925 8020953355 Bacteria 7439080
866 8021121981 8021120328 Bacteria 8782274
867 8039104327 8039098773 Bacteria 6602928
868 8040173187 8040167225 Bacteria 6542727
869 8040178633 8040173305 Bacteria 6827067
870 8055271320 8055266321 Bacteria 7999742
871 8055303230 8055301274 Bacteria 8587385
872 nmdc:mga00v17_192714_c1
873 JGI24739J22299_10023103
874 JGI24739J22299_10052858
875 JGI25156J39149_1000699
876 JGI25156J39149_1001586
877 JGI25165J46597_1001672
878 rootH2_10020431
879 rootL2_10120394
880 JGI25160J50197_1000176
881 Ga0055533_1000115
882 Ga0055533_1000295
883 Ga0055533_1001385
884 Ga0055532_1000055
885 Ga0055532_1002459
886 Ga0055532_1006639
887 Ga0055532_1007106
888 Ga0055527_1000030
889 Ga0055527_1001931
890 Ga0055535_1000038
891 Ga0055535_1003937
892 Ga0055535_1003988
893 Ga0055542_1000063
894 Ga0055542_1003837
895 Ga0055542_1007116
896 Ga0055529_1000071
897 Ga0055529_1002271
898 Ga0058692_1015022
899 Ga0065165_1001993
900 Ga0070658_10001803
901 Ga0070658_10005160
902 Ga0070658_10026579
903 Ga0070658_10040481
904 Ga0070676_10137038
905 Ga0070690_100085532
906 Ga0070670_100007152
907 Ga0070677_10128494
908 Ga0068869_100001855
909 Ga0068869_100041020
910 Ga0070666_10012676
911 Ga0070666_10026746
912 Ga0070666_10150718
913 Ga0068868_100035657
914 Ga0068868_100036971
915 Ga0068868_100157461
916 Ga0070660_100067315
917 Ga0070660_100083083
918 Ga0070689_100116466
919 Ga0070689_100166946
920 Ga0070661_100081011
921 Ga0070661_100213121
922 Ga0070668_100054030
923 Ga0070669_100131527
924 Ga0070675_100004408
925 Ga0070674_100079715
926 Ga0070674_100287934
927 Ga0070673_100015615
928 Ga0070673_100025146
929 Ga0070688_100014913
930 Ga0070688_100097084
931 Ga0070659_100005265
932 Ga0070659_100035384
933 Ga0070659_100079058
934 Ga0070659_100444014
935 Ga0070667_100026964
936 Ga0070667_100083974
937 Ga0070667_100085922
938 Ga0070667_100422876
939 Ga0070709_10043780
940 Ga0070709_10077889
941 Ga0070714_100009479
942 Ga0070714_100018047
943 Ga0070714_100027642
944 Ga0070713_100001234
945 Ga0070713_100003076
946 Ga0070713_100046858
947 Ga0070705_100072203
948 Ga0070700_100151046
949 Ga0070663_100047783
950 Ga0070663_100102242
951 Ga0070678_100026374
952 Ga0070662_100025893
953 Ga0070681_10003759
954 Ga0070681_10214990
955 Ga0068867_100005803
956 Ga0068867_100036328
957 Ga0068867_100181510
958 Ga0070685_10034429
959 Ga0070699_100045007
960 Ga0070679_100464760
961 Ga0070679_100543074
962 Ga0070684_100153996
963 Ga0068853_100240948
964 Ga0070672_100027074
965 Ga0070693_100000556
966 Ga0070693_100052133
967 Ga0070665_100072838
968 Ga0070665_100198103
969 Ga0070665_100199775
970 Ga0070704_100038661
971 Ga0068855_100007084
972 Ga0068855_100023145
973 Ga0068855_100037529
974 Ga0068855_100379276
975 Ga0068856_100052656
976 Ga0068856_100154492
977 Ga0068852_100019417
978 Ga0068852_100072662
979 Ga0068852_100153771
980 Ga0068852_100160200
981 Ga0068852_100514389
982 Ga0068859_100004344
983 Ga0068859_100028508
984 Ga0068859_100164596
985 Ga0068859_100526879
986 Ga0068864_100001630
987 Ga0068864_100308240
988 Ga0068866_10006390
989 Ga0068866_10015134
990 Ga0068866_10020974
991 Ga0068861_100000216
992 Ga0068851_10001738
993 Ga0068870_10032489
994 Ga0068863_100001897
995 Ga0068863_100010160
996 Ga0068858_100002185
997 Ga0068858_100019968
998 Ga0068858_100029613
999 Ga0068858_100043547
1000 Ga0068858_100064967
1001 Ga0068858_100528526
1002 Ga0068860_100102175
1003 Ga0068860_100173619
1004 Ga0068860_100489442
1005 Ga0068862_100005857
1006 Ga0068862_100085538
1007 Ga0070717_10134803
1008 Ga0075365_10003445
1009 Ga0075365_10010772
1010 Ga0075365_10067400
1011 Ga0075365_10144663
1012 Ga0075368_10008078
1013 Ga0075363_100012431
1014 Ga0070716_100019576
1015 Ga0070716_100050292
1016 Ga0075367_10011941
1017 Ga0075366_10000934
1018 Ga0075366_10035448
1019 Ga0097621_100024432
1020 Ga0075370_10223179
1021 Ga0068871_100062659
1022 Ga0075433_10145605
1023 Ga0075434_100344013
1024 Ga0075434_100380283
1025 Ga0068865_100020352
1026 Ga0068865_100308002
1027 Ga0068865_100489548
1028 Ga0097620_100004344
1029 Ga0097620_100028509
1030 Ga0097620_100164596
1031 Ga0097620_100526887
1032 Ga0105251_10000164
1033 Ga0105250_10008849
1034 Ga0105240_10000595
1035 Ga0105240_10081508
1036 Ga0105240_10143605
1037 Ga0105240_10146839
1038 Ga0105245_10079831
1039 Ga0105245_10100350
1040 Ga0105243_10032053
1041 Ga0105243_10043792
1042 Ga0105242_10008414
1043 Ga0105242_10148766
1044 Ga0105248_10057731
1045 Ga0105248_10111694
1046 Ga0105248_10124291
1047 Ga0105248_10132322
1048 Ga0105248_10346014
1049 Ga0105237_10070814
1050 Ga0105238_10002675
1051 Ga0105238_10063799
1052 Ga0105238_10616955
1053 Ga0105239_10055981
1054 Ga0157373_10046497
1055 Ga0157370_10005459
1056 Ga0157370_10006907
1057 Ga0157369_10000059
1058 Ga0157369_10000067
1059 Ga0157369_10003432
1060 Ga0157369_10045065
1061 Ga0157369_10052130
1062 Ga0157374_10254866
1063 Ga0157378_10036796
1064 Ga0157378_10200363
1065 Ga0163162_10000707
1066 Ga0163162_10097971
1067 Ga0163162_10114385
1068 Ga0157372_10010273
1069 Ga0157372_10114930
1070 Ga0157372_10145524
1071 Ga0163163_10504430
1072 Ga0157380_10047818
1073 Ga0157380_10111436
1074 Ga0182008_10035336
1075 Ga0157377_10119048
1076 Ga0157379_10000044
1077 Ga0157379_10056174
1078 Ga0157379_10121898
1079 Ga0157379_10122191
1080 Ga0157379_10125497
1081 Ga0157379_10147547
1082 Ga0157376_10036466
1083 Ga0157376_10086274
1084 Ga0157376_10307845
1085 Ga0182007_10001108
1086 Ga0182007_10010175
1087 Ga0183361_10011
1088 Ga0163161_10040984
1089 Ga0206356_10949391
1090 Ga0213872_10011643
1091 Ga0224712_10000014
1092 Ga0209566_102280
1093 Ga0209674_100022
1094 Ga0209674_100112
1095 Ga0209672_100001
1096 Ga0209672_100373
1097 Ga0209672_100454
1098 Ga0209147_100001
1099 Ga0209147_100424
1100 Ga0209147_100564
1101 Ga0209147_100565
1102 Ga0209563_100853
1103 Ga0207427_103272
1104 Ga0209258_100001
1105 Ga0209258_100633
1106 Ga0209258_100695
1107 Ga0209148_1000003
1108 Ga0209148_1000754
1109 Ga0209148_1003947
1110 Ga0209759_1000099
1111 Ga0209759_1000125
1112 Ga0209759_1000157
1113 Ga0209759_1011456
1114 Ga0209233_1000180
1115 Ga0209455_1000001
1116 Ga0209455_1000509
1117 Ga0209455_1005335
1118 Ga0209673_1008403
1119 Ga0209130_1019356
1120 Ga0209564_1004199
1121 Ga0209564_1005992
1122 Ga0207426_1000252
1123 Ga0207713_1000526
1124 Ga0207642_10019624
1125 Ga0207647_10005852
1126 Ga0207647_10024827
1127 Ga0207645_10049017
1128 Ga0207643_10053053
1129 Ga0207705_10000771
1130 Ga0207705_10005777
1131 Ga0207705_10018066
1132 Ga0207705_10331217
1133 Ga0207654_10035572
1134 Ga0207654_10220589
1135 Ga0207707_10111785
1136 Ga0207695_10002553
1137 Ga0207695_10059296
1138 Ga0207695_10139653
1139 Ga0207695_10242581
1140 Ga0207671_10032438
1141 Ga0207671_10081863
1142 Ga0207663_10134907
1143 Ga0207657_10047904
1144 Ga0207657_10206246
1145 Ga0207657_10289226
1146 Ga0207652_10257581
1147 Ga0207681_10071735
1148 Ga0207694_10036796
1149 Ga0207694_10046338
1150 Ga0207694_10303644
1151 Ga0207650_10043615
1152 Ga0207659_10014354
1153 Ga0207687_10172790
1154 Ga0207700_10000934
1155 Ga0207700_10001721
1156 Ga0207700_10075528
1157 Ga0207664_10005619
1158 Ga0207664_10020960
1159 Ga0207690_10019878
1160 Ga0207690_10022747
1161 Ga0207690_10243308
1162 Ga0207686_10010703
1163 Ga0207686_10022272
1164 Ga0207686_10072842
1165 Ga0207709_10044027
1166 Ga0207670_10048959
1167 Ga0207670_10114900
1168 Ga0207669_10146517
1169 Ga0207665_10009637
1170 Ga0207665_10036883
1171 Ga0207691_10031621
1172 Ga0207711_10007434
1173 Ga0207711_10014343
1174 Ga0207711_10054670
1175 Ga0207711_10147800
1176 Ga0207711_10172205
1177 Ga0207689_10002193
1178 Ga0207689_10014153
1179 Ga0207689_10027428
1180 Ga0207667_10000347
1181 Ga0207667_10037059
1182 Ga0207667_10088270
1183 Ga0207667_10114477
1184 Ga0207667_10219678
1185 Ga0207667_10239669
1186 Ga0207651_10008860
1187 Ga0207651_10045804
1188 Ga0207651_10045894
1189 Ga0207712_10093236
1190 Ga0207668_10073639
1191 Ga0207640_10240884
1192 Ga0207658_10031309
1193 Ga0207658_10198378
1194 Ga0207703_10001245
1195 Ga0207703_10024604
1196 Ga0207703_10041596
1197 Ga0207703_10051592
1198 Ga0207703_10268607
1199 Ga0207639_10094905
1200 Ga0207678_10044867
1201 Ga0207678_10060999
1202 Ga0207678_10067517
1203 Ga0207678_10092259
1204 Ga0207678_10105427
1205 Ga0207708_10194582
1206 Ga0207702_10301107
1207 Ga0207641_10005674
1208 Ga0207641_10043813
1209 Ga0207641_10063138
1210 Ga0207648_10005826
1211 Ga0207648_10111319
1212 Ga0207676_10005716
1213 Ga0207674_10023627
1214 Ga0207675_100000672
1215 Ga0207675_100187777
1216 Ga0207675_100484399
1217 Ga0207683_10123613
1218 Ga0207683_10141151
1219 Ga0207683_10215619
1220 Ga0207698_10051168
1221 Ga0207698_10083165
1222 Ga0207698_10193814
1223 Ga0207698_10373212
1224 Ga0207698_10425785
1225 Ga0209371_1001698
1226 Ga0268266_10163836
1227 Ga0268265_10026894
1228 Ga0268265_10152601
1229 Ga0268264_10001103
1230 Ga0265318_10002884
1231 Ga0265338_10000104
1232 Ga0265338_10076974
1233 Ga0268256_1007215
1234 Ga0265330_10001319
1235 Ga0265325_10000403
1236 Ga0265339_10013001
1237 Ga0265339_10060246
1238 Ga0265316_10002283
1239 Ga0265316_10056370
1240 Ga0307408_100154902
1241 Ga0307408_100185513
1242 Ga0265313_10003435
1243 Ga0265342_10024858
1244 Ga0316578_10064750
1245 Ga0307405_10051272
1246 Ga0307405_10128969
1247 Ga0307412_10000054
1248 Ga0307416_100246617
1249 Ga0307416_100279912
1250 Ga0373930_0004268
1251 Ga0373930_0016747
1252 Ga0373928_0000567
1253 Ga0373929_0019040
1254 Ga0373932_0000132
1255 Ga0373955_0007760
1256 Ga0316574_0014777
1257 Ga0316574_0072172
1258 Ga0316574_0213038
1259 Ga0373924_0065430
1260 Ga0373931_0000001
1261 Ga0373931_0092653
1262 Ga0373927_0010962
1263 Ga0373937_0323312
1264 Ga0316584_0185255
1265 Ga0395899_0000029
1266 Ga0395899_0078087
1267 Ga0395899_0166640
1268 Ga0395900_0000098
1269 Ga0395900_0000196
1270 Ga0395900_0140713
1271 Ga0395900_0154138
1272 Ga0395898_0000086
1273 Ga0395898_0002206
1274 Ga0395905_0000107
1275 Ga0395905_0002228
1276 Ga0395905_0030315
1277 Ga0395905_0336558
1278 Ga0395901_0000104
1279 Ga0395901_0000137
1280 Ga0395901_0181778
1281 Ga0400483_124349
1282 Ga0400483_281211
1283 Ga0436361_0218373
1284 Ga0436361_0667566
1285 Ga0436361_0859276
1286 Ga0439433_0033354
1287 Ga0439460_0022663
1288 Ga0451577_0001796
1289 Ga0451577_0011238
1290 Ga0451577_0011721
1291 Ga0451577_0153558
1292 Ga0451577_0168179
1293 Ga0451577_0230519
1294 Ga0466969_0000707
1295 Ga0466972_0009212
1296 Ga0466973_0038994
1297 Ga0453683_0039993
1298 Ga0453683_0070147
1299 Ga0453683_0101012
1300 Ga0453683_0159296
1301 Ga0453683_0208645
1302 Ga0466965_0003560
1303 Ga0466965_0040842
1304 Ga0466965_0110897
1305 Ga0466966_0000005
1306 Ga0466966_0022936
1307 Ga0466966_0038146
1308 Ga0466966_0054667
1309 Ga0466966_0145425
1310 Ga0466966_0160371
1311 Ga0466961_0001666
1312 Ga0466961_0006747
1313 Ga0466961_0060153
1314 Ga0466961_0084792
1315 Ga0466961_0099566
1316 Ga0466963_0005666
1317 Ga0466963_0011265
1318 Ga0466963_0020762
1319 Ga0466964_0001910
1320 Ga0453684_0000007
1321 Ga0453684_0000056
1322 Ga0453684_0003522
1323 Ga0453684_0007475
1324 Ga0453684_0011550
1325 Ga0453684_0012139
1326 Ga0453684_0059665
1327 Ga0453684_0129316
1328 Ga0453684_0446996
1329 Ga0466971_0006197
1330 Ga0466971_0047654
1331 Ga0466968_0048030
1332 Ga0466970_0123469
1333 Ga0466957_0001296
1334 Ga0466957_0002597
1335 Ga0466957_0007806
1336 Ga0466957_0025440
1337 Ga0466957_0043283
1338 Ga0466957_0158137
1339 Ga0466960_0012676
1340 Ga0466959_0012397
1341 Ga0466959_0015649
1342 Ga0451576_0000192
1343 Ga0451576_0000829
1344 Ga0451576_0001119
1345 Ga0451576_0011393
1346 Ga0451576_0123113
1347 Ga0451576_0149959
1348 Ga0451576_0348181
1349 Ga0466958_0002607
1350 Ga0466958_0013951
1351 Ga0466958_0021290
1352 Ga0466958_0094609
1353 Ga0466958_0121786
1354 Ga0495592_0018445
1355 Ga0495592_0019113
1356 Ga0495592_0047416
1357 Ga0495603_0001492
1358 Ga0495590_0021858
1359 Ga0495591_001173
1360 Ga0495629_0002860
1361 Ga0495629_0006339
1362 Ga0495629_0007060
1363 Ga0495638_0003196
1364 Ga0495638_0006860
1365 Ga0495641_0079357
1366 Ga0495651_0008582
1367 Ga0495653_0002493
1368 Ga0495653_0003241
1369 Ga0495653_0010264
1370 Ga0495653_0079027
1371 Ga0495653_0081128
1372 Ga0495653_0150723
1373 Ga0495650_0012432
1374 Ga0495580_0005037
1375 Ga0495580_0005977
1376 Ga0495580_0008862
1377 Ga0495580_0013075
1378 Ga0495580_0031201
1379 Ga0495582_0006253
1380 Ga0495582_0016675
1381 Ga0495582_0060829
1382 Ga0495605_0003102
1383 Ga0495605_0008110
1384 Ga0495605_0010240
1385 Ga0495662_0012041
1386 Ga0495662_0023367
1387 Ga0495664_0000998
1388 Ga0495664_0002627
1389 Ga0495596_0006417
1390 Ga0495596_0007366
1391 Ga0495596_0013157
1392 Ga0495583_0005795
1393 Ga0495583_0039286
1394 Ga0495606_0017601
1395 Ga0495608_0001733
1396 Ga0495608_0005902
1397 Ga0495608_0073808
1398 Ga0495610_0002328
1399 Ga0495616_0062177
1400 Ga0495618_0005279
1401 Ga0495618_0017149
1402 Ga0495618_0021892
1403 Ga0495618_0091188
1404 Ga0495620_0038514
1405 Ga0495620_0076897
1406 Ga0495628_0003132
1407 Ga0495628_0016423
1408 Ga0495628_0051819
1409 Ga0495628_0060380
1410 Ga0495628_0061020
1411 Ga0495628_0117665
1412 Ga0495628_0131392
1413 Ga0495630_0011646
1414 Ga0495630_0020586
1415 Ga0495630_0074633
1416 Ga0495648_0015959
1417 Ga0495648_0023219
1418 Ga0495648_0027977
1419 Ga0495666_0001172
1420 Ga0495666_0001884
1421 Ga0495666_0001892
1422 Ga0495642_0086541
1423 Ga0495652_0006806
1424 Ga0495652_0012881
1425 Ga0495652_0022650
1426 Ga0495665_0002407
1427 Ga0495665_0002948
1428 Ga0495665_0011102
1429 Ga0495640_0012698
1430 Ga0495640_0017072
1431 Ga0495586_0011268
1432 Ga0495586_0023915
1433 Ga0495586_0031698
1434 Ga0495587_0003605
1435 Ga0495645_0002890
1436 Ga0495622_0002306
1437 Ga0495622_0049758
1438 Ga0495667_0072591
1439 Ga0495634_0002770
1440 Ga0495634_0012419
1441 Ga0495634_0080951
1442 Ga0495611_0012801
1443 Ga0495635_0002838
1444 Ga0495635_0012550
1445 Ga0495635_0201222
1446 Ga0495661_0002331
1447 Ga0495661_0009682
1448 Ga0495661_0041284
1449 Ga0495657_0013783
1450 Ga0495657_0066709
1451 Ga0495657_0169029
1452 Ga0495657_0270112
1453 Ga0495599_0022153
1454 Ga0495623_0015547
1455 Ga0495646_0001230
1456 Ga0495646_0004523
1457 Ga0495646_0025145
1458 Ga0495669_0015313
1459 Ga0495669_0026475
1460 Ga0495613_0002243
1461 Ga0495613_0015727
1462 Ga0495613_0049041
1463 Ga0495624_0002882
1464 Ga0495624_0011558
1465 Ga0495624_0095898
1466 Ga0495670_0012440
1467 Ga0495649_0017196
1468 Ga0495589_0017215
1469 Ga0495589_0113375
1470 Ga0495600_0001140
1471 Ga0495600_0041387
1472 Ga0495600_0204231
1473 Ga0495660_0067323
1474 Ga0495581_0001962
1475 Ga0495581_0006868
1476 Ga0495604_0002319
1477 Ga0495604_0012572
1478 Ga0495604_0013874
1479 Ga0495604_0075157
1480 Ga0495674_0005769
1481 Ga0495674_0013154
1482 Ga0495674_0033647
1483 Ga0495674_0270421
1484 Ga0495672_0011901
1485 Ga0495672_0017178
1486 Ga0495672_0050341
1487 Ga0495676_0002156
1488 Ga0495676_0019012
1489 Ga0495676_0042612
1490 Ga0495676_0123569
1491 Ga0495680_0003344
1492 Ga0495680_0003961
1493 Ga0495680_0023699
1494 Ga0495680_0051553
1495 Ga0495683_0004640
1496 Ga0495683_0009341
1497 Ga0495683_0009690
1498 Ga0495683_0065755
1499 Ga0495687_007357
1500 Ga0495687_011859
1501 Ga0495687_012450
1502 Ga0495687_017589
1503 Ga0495675_0001442
1504 Ga0495675_0004332
1505 Ga0495675_0004681
1506 Ga0495677_0040387
1507 Ga0495679_000399
1508 Ga0495679_000514
1509 Ga0495679_000737
1510 Ga0495673_0005498
1511 Ga0495673_0006064
1512 Ga0495684_0115330
1513 Ga0495684_0194463
1514 Ga0495686_0000076
1515 Ga0495593_0003425
1516 Ga0495593_0003829
1517 Ga0495593_0008127
1518 Ga0495593_0057294
1519 Ga0495602_0004536
1520 Ga0495602_0011568
1521 Ga0495602_0027460
1522 Ga0495602_0072371
1523 Ga0495602_0107796
1524 Ga0495614_0001762
1525 Ga0495626_0010364
1526 Ga0496100_0071924
1527 Ga0496101_0001769
1528 Ga0496101_0024446
1529 Ga0496101_0064829
1530 Ga0496101_0320787
1531 Ga0496102_0003988
1532 Ga0496102_0015741
1533 Ga0496102_0050204
1534 Ga0496103_0002668
1535 Ga0496103_0029652
1536 Ga0496104_0009080
1537 Ga0496104_0042296
1538 Ga0496104_0188710
1539 Ga0496105_0073706
1540 Ga0496105_0133127
1541 Ga0496106_0000301
1542 Ga0496106_0056502
1543 Ga0496106_0228121
1544 Ga0496107_0044666
1545 Ga0496107_0053687
1546 Ga0496108_0073486
1547 Ga0496108_0237794
1548 Ga0496109_0213459
1549 Ga0496110_0064675
1550 Ga0496110_0231393
1551 Ga0496112_0005293
1552 Ga0496112_0134950
1553 Ga0496113_0064725
1554 Ga0496113_0105470
1555 Ga0496114_0064580
1556 Ga0496114_0101879
1557 Ga0496114_0295716
1558 Ga0496115_0100087
1559 Ga0496116_0020190
1560 Ga0496116_0025219
1561 Ga0496116_0080793
1562 Ga0496117_0003049
1563 Ga0496117_0004615
1564 Ga0496117_0012097
1565 Ga0496117_0016129
1566 Ga0496117_0022931
1567 Ga0496117_0074363
1568 Ga0496118_0001753
1569 Ga0496118_0003700
1570 Ga0496118_0006470
1571 Ga0496118_0006753
1572 Ga0496118_0031206
1573 Ga0496118_0033101
1574 Ga0496121_0004965
1575 Ga0496121_0006290
1576 Ga0496121_0006544
1577 Ga0496121_0039725
1578 Ga0496121_0075755
1579 Ga0496124_0099954
1580 Ga0496126_0000263
1581 Ga0496126_0003028
1582 Ga0496126_0007901
1583 Ga0496126_0031426
1584 Ga0496126_0045435
1585 Ga0496126_0066680
1586 Ga0496126_0126367
1587 Ga0495682_0007462
1588 Ga0495682_0016020
1589 Ga0501031_0192723
1590 Ga0501034_0000559
1591 Ga0501037_0063610
1592 Ga0501040_0012787
1593 Ga0501042_0081171
1594 Ga0501042_0316125
1595 Ga0501047_0062150
1596 Ga0501047_0069118
1597 Ga0501047_0332370
1598 Ga0501048_0035506
1599 Ga0501068_0000033
1600 Ga0501068_0011853
1601 Ga0501069_0000010
1602 Ga0501069_0002518
1603 Ga0501069_0005019
1604 Ga0501070_0000005
1605 Ga0501070_0001192
1606 Ga0501070_0021433
1607 Ga0501071_0071724
1608 Ga0501071_0122860
1609 Ga0501071_0153533
1610 Ga0501071_0156396
1611 Ga0501072_0003879
1612 Ga0501072_0027469
1613 Ga0501073_0002509
1614 Ga0501073_0009076
1615 Ga0501073_0017057
1616 Ga0501074_0005030
1617 Ga0501074_0027676
1618 Ga0501074_0111950
1619 Ga0501074_0270954
1620 Ga0501075_0003860
1621 Ga0501075_0012640
1622 Ga0501076_0088389
1623 Ga0501079_0003247
1624 Ga0501079_0040844
1625 Ga0501080_0018433
1626 Ga0501080_0083331
1627 Ga0501080_0146638
1628 Ga0501083_0004878
1629 Ga0501083_0006807
1630 nmdc:mga03n38_124845_c1
1631 nmdc:mga00v17_250077_c1
1632 nmdc:mga00v17_34262_c1
1633 nmdc:mga0yw44_1281_c1
1634 nmdc:mga0yw44_57274_c1
1635 nmdc:mga0k408_11551_c1
1636 nmdc:mga0k408_4514_c1
1637 nmdc:mga0k408_467_c1
1638 nmdc:mga05p37_70516_c1
1639 nmdc:mga0n895_256104_c1
1640 nmdc:mga0n895_63959_c1
1641 nmdc:mga0a205_8637_c1
1642 nmdc:mga0sz30_39823_c1
1643 Ga0495619_0085412
1644 Ga0500566_0007609
1645 Ga0500593_059822
1646 Ga0501084_0000517
1647 Ga0501084_0020197
1648 Ga0501084_0100307
1649 Ga0501084_0461511
1650 Ga0501082_0018429
1651 Ga0501082_0062527
1652 Ga0501082_0135658
1653 Ga0466962_0003300
1654 Ga0466962_0005580
1655 Ga0530510_0049273
1656 Ga0530510_0057750
1657 2501076681
1658 2501082552
1659 2501408499
1660 2509131548
1661 2510250543
1662 2511086114
1663 2511096233
1664 2511103044
1665 2512346749
1666 2513556424
1667 2513564444
1668 2513963639
1669 2514053276
1670 2515680056
1671 2516024461
1672 2519459275
1673 2527079889
1674 2563063334
1675 2585295843
1676 2599742207
1677 2599749409
1678 2600211536
1679 2600810714
1680 2676747663
1681 2713477550
1682 2719639695
1683 2738824486
1684 2738836895
1685 2738878426
1686 2739190118
1687 2739225019
1688 2746086156
1689 2746094818
1690 2753570849
1691 2792840806
1692 2808974526
1693 2809009387
1694 2809016464
1695 2817261563
1696 2817279245
1697 2817452476
1698 2819624601
1699 2819631418
1700 2842332339
1701 2842356627
1702 2842461881
1703 2856292674
1704 2857360877
1705 2863428115
1706 2870070736
1707 2883087931
1708 2885278384
1709 2900635572
1710 2902688763
1711 2904485670
1712 2904571635
1713 2904578673
1714 2904618373
1715 2919533828
1716 2921650723
1717 2928110686
1718 2928140202
1719 2928162775
1720 2928169436
1721 2928178953
1722 2928505696
1723 2928543154
1724 2945936189
1725 2981997222
1726 2990709908
1727 642427435
1728 642420527
1729 642593750
1730 642620957
1731 8003960875
1732 8018852836
1733 8020813817
1734 8020942481
1735 8020952599
1736 8020958925
1737 8021121981
1738 8039104327
1739 8040173187
1740 8040178633
1741 8055271320
1742 8055303230

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

15

320

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3eb3-assembly1.cif.gz_A voltage-dependent k+ channel beta subunit (w121a) in complex with cortisone 0.971 1 320
3eb4-assembly1.cif.gz_A voltage-dependent k+ channel beta subunit (i211r) in complex with cortisone 0.97 1 320
7wf3-assembly1.cif.gz_C composite map of human kv1.3 channel in apo state with beta subunits 0.9633 3 320
3eb3-assembly1.cif.gz_A voltage-dependent k+ channel beta subunit (w121a) in complex with cortisone 0.9592 1 320
3eb4-assembly1.cif.gz_A voltage-dependent k+ channel beta subunit (i211r) in complex with cortisone 0.9582 1 320
ID Description Score Start End Superfamily
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9765 1 320 3.20.20.100
af_E9QGU5_66_406_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9709 1 320 3.20.20.100
af_P97382_23_247_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9661 106 320 3.20.20.100
af_E9QGU5_66_406_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9591 1 320 3.20.20.100
af_O59826_13_339_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9583 1 318 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A382BNH0-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9873 1 170 GO:0016491
AF-A0A7C7GQV1-F1-model_v4 deleted 0.9871 1 176
AF-A0A7J6WMD8-F1-model_v4 Voltage-gated potassium channel subunit beta-1 0.9865 1 194 GO:0016491
GO:0034220
AF-A0A2U2SJ32-F1-model_v4 Aldo/keto reductase 0.9857 1 320 GO:0016491
AF-A0A821WSN5-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9802 1 193 GO:0008076
GO:0015459
GO:0016491
GO:0044325
GO:1901379

Map