F484205
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 871 | 439 | 1742 | 324 |
Family's Representative Sequence
| Representative Sequence | 3300050491|nmdc:mga00v17_192714_c1|nmdc:mga00v17_192714_c1_188_1150 |
| Length | 320 |
| Sequence | MPYRRLGRSGLQLSVLSFGSWVTFDTQIKDDLALDCMQAAHDAGCNFYDNAEAYAGGESEAIMGRVIEQLGWARQSYVLSTKVYWGIDGRMPNMQNTLNRKYLHHSIEGCLDRLKVDFVDLLFCHRADKNTPIEETVWAMSDLIDRGKVLYWGTSEWSADEIRAAWEVAERHHLHKPVMEQPQYNMVERGKVEDEFARLYDDIGLGLTTWSPLASGLLTGKYRDGIPDDSRGALPGYGWLAKRFTDPAQVQRVERIRPIADELGCTMAQLSIAWCAANPHVSTVITGASKVSQVVDNFGALDVLEALTPDIIERINAAVS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 109 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 181 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 183 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 184 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 185 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 187 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 189 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 190 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 191 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 193 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 196 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 201 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 204 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 205 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 206 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 207 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 208 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 209 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 210 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 211 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 212 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 213 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 214 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 215 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 216 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 217 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 218 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 219 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 220 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 221 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 222 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 223 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 224 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 225 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 226 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 227 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 228 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 229 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 302 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 303 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 304 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 305 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 306 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 307 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 310 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 311 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 312 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 313 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 314 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 315 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 316 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 317 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 318 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 319 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 320 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 341 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 342 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 343 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 347 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 349 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 350 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 353 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 354 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 355 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 356 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 357 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 358 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 359 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 360 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 361 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 362 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 363 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 364 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 365 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 366 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 367 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 368 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 369 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 370 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 371 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 372 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 373 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 374 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 375 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 376 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 377 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 378 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 379 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 380 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 381 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 382 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 383 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 384 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 385 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 386 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 387 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 388 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 389 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 390 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 391 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 392 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 393 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 394 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 395 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 396 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 397 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 398 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 399 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 400 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 401 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 402 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 403 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 404 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 405 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 406 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 407 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 408 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 409 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 410 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 411 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 412 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 413 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 414 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 415 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 416 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 417 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 418 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 419 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 420 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 421 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 422 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 423 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 424 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 425 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 426 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 427 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 428 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 429 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 430 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 431 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 432 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 433 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 434 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 435 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 436 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 437 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 438 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 439 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.9 |
| Metatranscriptomes | 0.23 |
| Isolates | 9.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.92 |
| Nodule | 2.18 |
| Rhizoplane | 4.36 |
| Rhizosphere | 76.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga00v17_192714_c1 | 3300050491 | Bacteria | 1317 |
| 2 | JGI24739J22299_10023103 | 3300001989 | Bacteria | 2200 |
| 3 | JGI24739J22299_10052858 | 3300001989 | Bacteria | 1305 |
| 4 | JGI25156J39149_1000699 | 3300002705 | Bacteria | 17885 |
| 5 | JGI25156J39149_1001586 | 3300002705 | Bacteria | 9345 |
| 6 | JGI25165J46597_1001672 | 3300003214 | Bacteria | 10091 |
| 7 | rootH2_10020431 | 3300003320 | Bacteria | 10578 |
| 8 | rootL2_10120394 | 3300003322 | Bacteria | 3092 |
| 9 | JGI25160J50197_1000176 | 3300003354 | Bacteria | 54145 |
| 10 | Ga0055533_1000115 | 3300003756 | Bacteria | 91607 |
| 11 | Ga0055533_1000295 | 3300003756 | Bacteria | 25347 |
| 12 | Ga0055533_1001385 | 3300003756 | Bacteria | 6439 |
| 13 | Ga0055532_1000055 | 3300003758 | Bacteria | 160192 |
| 14 | Ga0055532_1002459 | 3300003758 | Bacteria | 3836 |
| 15 | Ga0055532_1006639 | 3300003758 | Bacteria | 1535 |
| 16 | Ga0055532_1007106 | 3300003758 | Bacteria | 1459 |
| 17 | Ga0055527_1000030 | 3300003760 | Bacteria | 160175 |
| 18 | Ga0055527_1001931 | 3300003760 | Bacteria | 3836 |
| 19 | Ga0055535_1000038 | 3300003761 | Bacteria | 160192 |
| 20 | Ga0055535_1003937 | 3300003761 | Bacteria | 3884 |
| 21 | Ga0055535_1003988 | 3300003761 | Bacteria | 3836 |
| 22 | Ga0055542_1000063 | 3300003762 | Bacteria | 160175 |
| 23 | Ga0055542_1003837 | 3300003762 | Bacteria | 3884 |
| 24 | Ga0055542_1007116 | 3300003762 | Bacteria | 2312 |
| 25 | Ga0055529_1000071 | 3300003763 | Bacteria | 160192 |
| 26 | Ga0055529_1002271 | 3300003763 | Bacteria | 3884 |
| 27 | Ga0058692_1015022 | 3300003856 | Bacteria | 1756 |
| 28 | Ga0065165_1001993 | 3300005262 | Bacteria | 19160 |
| 29 | Ga0070658_10001803 | 3300005327 | Bacteria | 18000 |
| 30 | Ga0070658_10005160 | 3300005327 | Bacteria | 10628 |
| 31 | Ga0070658_10026579 | 3300005327 | Bacteria | 4643 |
| 32 | Ga0070658_10040481 | 3300005327 | Bacteria | 3759 |
| 33 | Ga0070676_10137038 | 3300005328 | Bacteria | 1554 |
| 34 | Ga0070690_100085532 | 3300005330 | Bacteria | 2069 |
| 35 | Ga0070670_100007152 | 3300005331 | Bacteria | 9453 |
| 36 | Ga0070677_10128494 | 3300005333 | Bacteria | 1154 |
| 37 | Ga0068869_100001855 | 3300005334 | Bacteria | 12701 |
| 38 | Ga0068869_100041020 | 3300005334 | Bacteria | 3312 |
| 39 | Ga0070666_10012676 | 3300005335 | Bacteria | 5327 |
| 40 | Ga0070666_10026746 | 3300005335 | Bacteria | 3773 |
| 41 | Ga0070666_10150718 | 3300005335 | Bacteria | 1622 |
| 42 | Ga0068868_100035657 | 3300005338 | Bacteria | 3846 |
| 43 | Ga0068868_100036971 | 3300005338 | Bacteria | 3783 |
| 44 | Ga0068868_100157461 | 3300005338 | Bacteria | 1874 |
| 45 | Ga0070660_100067315 | 3300005339 | Bacteria | 2790 |
| 46 | Ga0070660_100083083 | 3300005339 | Bacteria | 2516 |
| 47 | Ga0070689_100116466 | 3300005340 | Bacteria | 2131 |
| 48 | Ga0070689_100166946 | 3300005340 | Bacteria | 1782 |
| 49 | Ga0070661_100081011 | 3300005344 | Bacteria | 2396 |
| 50 | Ga0070661_100213121 | 3300005344 | Bacteria | 1479 |
| 51 | Ga0070668_100054030 | 3300005347 | Bacteria | 3098 |
| 52 | Ga0070669_100131527 | 3300005353 | Bacteria | 1920 |
| 53 | Ga0070675_100004408 | 3300005354 | Bacteria | 10731 |
| 54 | Ga0070674_100079715 | 3300005356 | Bacteria | 2337 |
| 55 | Ga0070674_100287934 | 3300005356 | Bacteria | 1305 |
| 56 | Ga0070673_100015615 | 3300005364 | Bacteria | 5341 |
| 57 | Ga0070673_100025146 | 3300005364 | Bacteria | 4378 |
| 58 | Ga0070688_100014913 | 3300005365 | Bacteria | 4410 |
| 59 | Ga0070688_100097084 | 3300005365 | Bacteria | 1936 |
| 60 | Ga0070659_100005265 | 3300005366 | Bacteria | 9283 |
| 61 | Ga0070659_100035384 | 3300005366 | Bacteria | 3889 |
| 62 | Ga0070659_100079058 | 3300005366 | Bacteria | 2625 |
| 63 | Ga0070659_100444014 | 3300005366 | Bacteria | 1100 |
| 64 | Ga0070667_100026964 | 3300005367 | Bacteria | 4779 |
| 65 | Ga0070667_100083974 | 3300005367 | Bacteria | 2729 |
| 66 | Ga0070667_100085922 | 3300005367 | Bacteria | 2699 |
| 67 | Ga0070667_100422876 | 3300005367 | Bacteria | 1215 |
| 68 | Ga0070709_10043780 | 3300005434 | Bacteria | 2770 |
| 69 | Ga0070709_10077889 | 3300005434 | Bacteria | 2156 |
| 70 | Ga0070714_100009479 | 3300005435 | Bacteria | 7656 |
| 71 | Ga0070714_100018047 | 3300005435 | Bacteria | 5723 |
| 72 | Ga0070714_100027642 | 3300005435 | Bacteria | 4699 |
| 73 | Ga0070713_100001234 | 3300005436 | Bacteria | 16347 |
| 74 | Ga0070713_100003076 | 3300005436 | Bacteria | 10967 |
| 75 | Ga0070713_100046858 | 3300005436 | Bacteria | 3549 |
| 76 | Ga0070705_100072203 | 3300005440 | Bacteria | 2090 |
| 77 | Ga0070700_100151046 | 3300005441 | Bacteria | 1588 |
| 78 | Ga0070663_100047783 | 3300005455 | Bacteria | 3032 |
| 79 | Ga0070663_100102242 | 3300005455 | Bacteria | 2140 |
| 80 | Ga0070678_100026374 | 3300005456 | Bacteria | 3927 |
| 81 | Ga0070662_100025893 | 3300005457 | Bacteria | 4055 |
| 82 | Ga0070681_10003759 | 3300005458 | Bacteria | 14249 |
| 83 | Ga0070681_10214990 | 3300005458 | Bacteria | 1839 |
| 84 | Ga0068867_100005803 | 3300005459 | Bacteria | 8761 |
| 85 | Ga0068867_100036328 | 3300005459 | Bacteria | 3576 |
| 86 | Ga0068867_100181510 | 3300005459 | Bacteria | 1674 |
| 87 | Ga0070685_10034429 | 3300005466 | Bacteria | 2853 |
| 88 | Ga0070699_100045007 | 3300005518 | Bacteria | 3820 |
| 89 | Ga0070679_100464760 | 3300005530 | Bacteria | 1210 |
| 90 | Ga0070679_100543074 | 3300005530 | Bacteria | 1106 |
| 91 | Ga0070684_100153996 | 3300005535 | Bacteria | 2084 |
| 92 | Ga0068853_100240948 | 3300005539 | Bacteria | 1657 |
| 93 | Ga0070672_100027074 | 3300005543 | Bacteria | 4274 |
| 94 | Ga0070693_100000556 | 3300005547 | Bacteria | 16534 |
| 95 | Ga0070693_100052133 | 3300005547 | Bacteria | 2344 |
| 96 | Ga0070665_100072838 | 3300005548 | Bacteria | 3442 |
| 97 | Ga0070665_100198103 | 3300005548 | Bacteria | 2009 |
| 98 | Ga0070665_100199775 | 3300005548 | Bacteria | 2000 |
| 99 | Ga0070704_100038661 | 3300005549 | Bacteria | 3271 |
| 100 | Ga0068855_100007084 | 3300005563 | Bacteria | 13600 |
| 101 | Ga0068855_100023145 | 3300005563 | Bacteria | 7444 |
| 102 | Ga0068855_100037529 | 3300005563 | Bacteria | 5761 |
| 103 | Ga0068855_100379276 | 3300005563 | Bacteria | 1553 |
| 104 | Ga0068856_100052656 | 3300005614 | Bacteria | 4014 |
| 105 | Ga0068856_100154492 | 3300005614 | Bacteria | 2305 |
| 106 | Ga0068852_100019417 | 3300005616 | Bacteria | 5379 |
| 107 | Ga0068852_100072662 | 3300005616 | Bacteria | 3024 |
| 108 | Ga0068852_100153771 | 3300005616 | Bacteria | 2141 |
| 109 | Ga0068852_100160200 | 3300005616 | Bacteria | 2101 |
| 110 | Ga0068852_100514389 | 3300005616 | Bacteria | 1194 |
| 111 | Ga0068859_100004344 | 3300005617 | Bacteria | 14458 |
| 112 | Ga0068859_100028508 | 3300005617 | Bacteria | 5598 |
| 113 | Ga0068859_100164596 | 3300005617 | Bacteria | 2297 |
| 114 | Ga0068859_100526879 | 3300005617 | Bacteria | 1276 |
| 115 | Ga0068864_100001630 | 3300005618 | Bacteria | 18503 |
| 116 | Ga0068864_100308240 | 3300005618 | Bacteria | 1484 |
| 117 | Ga0068866_10006390 | 3300005718 | Bacteria | 4908 |
| 118 | Ga0068866_10015134 | 3300005718 | Bacteria | 3423 |
| 119 | Ga0068866_10020974 | 3300005718 | Bacteria | 3002 |
| 120 | Ga0068861_100000216 | 3300005719 | Bacteria | 30988 |
| 121 | Ga0068851_10001738 | 3300005834 | Bacteria | 9517 |
| 122 | Ga0068870_10032489 | 3300005840 | Bacteria | 2654 |
| 123 | Ga0068863_100001897 | 3300005841 | Bacteria | 20747 |
| 124 | Ga0068863_100010160 | 3300005841 | Bacteria | 9154 |
| 125 | Ga0068858_100002185 | 3300005842 | Bacteria | 19807 |
| 126 | Ga0068858_100019968 | 3300005842 | Bacteria | 6265 |
| 127 | Ga0068858_100029613 | 3300005842 | Bacteria | 5085 |
| 128 | Ga0068858_100043547 | 3300005842 | Bacteria | 4162 |
| 129 | Ga0068858_100064967 | 3300005842 | Bacteria | 3377 |
| 130 | Ga0068858_100528526 | 3300005842 | Bacteria | 1141 |
| 131 | Ga0068860_100102175 | 3300005843 | Bacteria | 2735 |
| 132 | Ga0068860_100173619 | 3300005843 | Bacteria | 2082 |
| 133 | Ga0068860_100489442 | 3300005843 | Bacteria | 1227 |
| 134 | Ga0068862_100005857 | 3300005844 | Bacteria | 10240 |
| 135 | Ga0068862_100085538 | 3300005844 | Bacteria | 2740 |
| 136 | Ga0070717_10134803 | 3300006028 | Bacteria | 2126 |
| 137 | Ga0075365_10003445 | 3300006038 | Bacteria | 8153 |
| 138 | Ga0075365_10010772 | 3300006038 | Bacteria | 5343 |
| 139 | Ga0075365_10067400 | 3300006038 | Bacteria | 2403 |
| 140 | Ga0075365_10144663 | 3300006038 | Bacteria | 1651 |
| 141 | Ga0075368_10008078 | 3300006042 | Bacteria | 3736 |
| 142 | Ga0075363_100012431 | 3300006048 | Bacteria | 4102 |
| 143 | Ga0070716_100019576 | 3300006173 | Bacteria | 3539 |
| 144 | Ga0070716_100050292 | 3300006173 | Bacteria | 2365 |
| 145 | Ga0075367_10011941 | 3300006178 | Bacteria | 4614 |
| 146 | Ga0075366_10000934 | 3300006195 | Bacteria | 14194 |
| 147 | Ga0075366_10035448 | 3300006195 | Bacteria | 2941 |
| 148 | Ga0097621_100024432 | 3300006237 | Bacteria | 4719 |
| 149 | Ga0075370_10223179 | 3300006353 | Bacteria | 1114 |
| 150 | Ga0068871_100062659 | 3300006358 | Bacteria | 3040 |
| 151 | Ga0075433_10145605 | 3300006852 | Bacteria | 2106 |
| 152 | Ga0075434_100344013 | 3300006871 | Bacteria | 1512 |
| 153 | Ga0075434_100380283 | 3300006871 | Bacteria | 1433 |
| 154 | Ga0068865_100020352 | 3300006881 | Bacteria | 4302 |
| 155 | Ga0068865_100308002 | 3300006881 | Bacteria | 1270 |
| 156 | Ga0068865_100489548 | 3300006881 | Bacteria | 1023 |
| 157 | Ga0097620_100004344 | 3300006931 | Bacteria | 14458 |
| 158 | Ga0097620_100028509 | 3300006931 | Bacteria | 5598 |
| 159 | Ga0097620_100164596 | 3300006931 | Bacteria | 2297 |
| 160 | Ga0097620_100526887 | 3300006931 | Bacteria | 1276 |
| 161 | Ga0105251_10000164 | 3300009011 | Bacteria | 68693 |
| 162 | Ga0105250_10008849 | 3300009092 | Bacteria | 4261 |
| 163 | Ga0105240_10000595 | 3300009093 | Bacteria | 67094 |
| 164 | Ga0105240_10081508 | 3300009093 | Bacteria | 3976 |
| 165 | Ga0105240_10143605 | 3300009093 | Bacteria | 2851 |
| 166 | Ga0105240_10146839 | 3300009093 | Bacteria | 2813 |
| 167 | Ga0105245_10079831 | 3300009098 | Bacteria | 2988 |
| 168 | Ga0105245_10100350 | 3300009098 | Bacteria | 2677 |
| 169 | Ga0105243_10032053 | 3300009148 | Bacteria | 4056 |
| 170 | Ga0105243_10043792 | 3300009148 | Bacteria | 3509 |
| 171 | Ga0105242_10008414 | 3300009176 | Bacteria | 7930 |
| 172 | Ga0105242_10148766 | 3300009176 | Bacteria | 2040 |
| 173 | Ga0105248_10057731 | 3300009177 | Bacteria | 4356 |
| 174 | Ga0105248_10111694 | 3300009177 | Bacteria | 3082 |
| 175 | Ga0105248_10124291 | 3300009177 | Bacteria | 2910 |
| 176 | Ga0105248_10132322 | 3300009177 | Bacteria | 2814 |
| 177 | Ga0105248_10346014 | 3300009177 | Bacteria | 1674 |
| 178 | Ga0105237_10070814 | 3300009545 | Bacteria | 3482 |
| 179 | Ga0105238_10002675 | 3300009551 | Bacteria | 17721 |
| 180 | Ga0105238_10063799 | 3300009551 | Bacteria | 3685 |
| 181 | Ga0105238_10616955 | 3300009551 | Bacteria | 1093 |
| 182 | Ga0105239_10055981 | 3300010375 | Bacteria | 4326 |
| 183 | Ga0157373_10046497 | 3300013100 | Bacteria | 3097 |
| 184 | Ga0157370_10005459 | 3300013104 | Bacteria | 14256 |
| 185 | Ga0157370_10006907 | 3300013104 | Bacteria | 12413 |
| 186 | Ga0157369_10000059 | 3300013105 | Bacteria | 154283 |
| 187 | Ga0157369_10000067 | 3300013105 | Bacteria | 144506 |
| 188 | Ga0157369_10003432 | 3300013105 | Bacteria | 18795 |
| 189 | Ga0157369_10045065 | 3300013105 | Bacteria | 4798 |
| 190 | Ga0157369_10052130 | 3300013105 | Bacteria | 4428 |
| 191 | Ga0157374_10254866 | 3300013296 | Bacteria | 1727 |
| 192 | Ga0157378_10036796 | 3300013297 | Bacteria | 4332 |
| 193 | Ga0157378_10200363 | 3300013297 | Bacteria | 1888 |
| 194 | Ga0163162_10000707 | 3300013306 | Bacteria | 30906 |
| 195 | Ga0163162_10097971 | 3300013306 | Bacteria | 3021 |
| 196 | Ga0163162_10114385 | 3300013306 | Bacteria | 2797 |
| 197 | Ga0157372_10010273 | 3300013307 | Bacteria | 9943 |
| 198 | Ga0157372_10114930 | 3300013307 | Bacteria | 3085 |
| 199 | Ga0157372_10145524 | 3300013307 | Bacteria | 2733 |
| 200 | Ga0163163_10504430 | 3300014325 | Bacteria | 1272 |
| 201 | Ga0157380_10047818 | 3300014326 | Bacteria | 3366 |
| 202 | Ga0157380_10111436 | 3300014326 | Bacteria | 2300 |
| 203 | Ga0182008_10035336 | 3300014497 | Bacteria | 2504 |
| 204 | Ga0157377_10119048 | 3300014745 | Bacteria | 1598 |
| 205 | Ga0157379_10000044 | 3300014968 | Bacteria | 75399 |
| 206 | Ga0157379_10056174 | 3300014968 | Bacteria | 3518 |
| 207 | Ga0157379_10121898 | 3300014968 | Bacteria | 2346 |
| 208 | Ga0157379_10122191 | 3300014968 | Bacteria | 2343 |
| 209 | Ga0157379_10125497 | 3300014968 | Bacteria | 2309 |
| 210 | Ga0157379_10147547 | 3300014968 | Bacteria | 2121 |
| 211 | Ga0157376_10036466 | 3300014969 | Bacteria | 3984 |
| 212 | Ga0157376_10086274 | 3300014969 | Bacteria | 2706 |
| 213 | Ga0157376_10307845 | 3300014969 | Bacteria | 1502 |
| 214 | Ga0182007_10001108 | 3300015262 | Bacteria | 14590 |
| 215 | Ga0182007_10010175 | 3300015262 | Bacteria | 3734 |
| 216 | Ga0183361_10011 | 3300016635 | Bacteria | 203855 |
| 217 | Ga0163161_10040984 | 3300017792 | Bacteria | 3327 |
| 218 | Ga0206356_10949391 | 3300020070 | Bacteria | 8897 |
| 219 | Ga0213872_10011643 | 3300021361 | Bacteria | 4159 |
| 220 | Ga0224712_10000014 | 3300022467 | Bacteria | 26099 |
| 221 | Ga0209566_102280 | 3300025225 | Bacteria | 3731 |
| 222 | Ga0209674_100022 | 3300025226 | Bacteria | 563656 |
| 223 | Ga0209674_100112 | 3300025226 | Bacteria | 142700 |
| 224 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 225 | Ga0209672_100373 | 3300025228 | Bacteria | 27548 |
| 226 | Ga0209672_100454 | 3300025228 | Bacteria | 23194 |
| 227 | Ga0209147_100001 | 3300025229 | Bacteria | 2384371 |
| 228 | Ga0209147_100424 | 3300025229 | Bacteria | 27807 |
| 229 | Ga0209147_100564 | 3300025229 | Bacteria | 20849 |
| 230 | Ga0209147_100565 | 3300025229 | Bacteria | 20776 |
| 231 | Ga0209563_100853 | 3300025230 | Bacteria | 9081 |
| 232 | Ga0207427_103272 | 3300025231 | Bacteria | 3520 |
| 233 | Ga0209258_100001 | 3300025242 | Bacteria | 2384269 |
| 234 | Ga0209258_100633 | 3300025242 | Bacteria | 27801 |
| 235 | Ga0209258_100695 | 3300025242 | Bacteria | 23194 |
| 236 | Ga0209148_1000003 | 3300025254 | Bacteria | 2384288 |
| 237 | Ga0209148_1000754 | 3300025254 | Bacteria | 24738 |
| 238 | Ga0209148_1003947 | 3300025254 | Bacteria | 3818 |
| 239 | Ga0209759_1000099 | 3300025256 | Bacteria | 156332 |
| 240 | Ga0209759_1000125 | 3300025256 | Bacteria | 135516 |
| 241 | Ga0209759_1000157 | 3300025256 | Bacteria | 116657 |
| 242 | Ga0209759_1011456 | 3300025256 | Bacteria | 2520 |
| 243 | Ga0209233_1000180 | 3300025261 | Bacteria | 140304 |
| 244 | Ga0209455_1000001 | 3300025272 | Bacteria | 2384278 |
| 245 | Ga0209455_1000509 | 3300025272 | Bacteria | 27807 |
| 246 | Ga0209455_1005335 | 3300025272 | Bacteria | 3997 |
| 247 | Ga0209673_1008403 | 3300025273 | Bacteria | 4598 |
| 248 | Ga0209130_1019356 | 3300025284 | Bacteria | 1580 |
| 249 | Ga0209564_1004199 | 3300025295 | Bacteria | 8981 |
| 250 | Ga0209564_1005992 | 3300025295 | Bacteria | 6720 |
| 251 | Ga0207426_1000252 | 3300025302 | Bacteria | 117376 |
| 252 | Ga0207713_1000526 | 3300025735 | Bacteria | 38454 |
| 253 | Ga0207642_10019624 | 3300025899 | Bacteria | 2621 |
| 254 | Ga0207647_10005852 | 3300025904 | Bacteria | 8964 |
| 255 | Ga0207647_10024827 | 3300025904 | Bacteria | 3948 |
| 256 | Ga0207645_10049017 | 3300025907 | Bacteria | 2697 |
| 257 | Ga0207643_10053053 | 3300025908 | Bacteria | 2303 |
| 258 | Ga0207705_10000771 | 3300025909 | Bacteria | 26342 |
| 259 | Ga0207705_10005777 | 3300025909 | Bacteria | 9222 |
| 260 | Ga0207705_10018066 | 3300025909 | Bacteria | 5043 |
| 261 | Ga0207705_10331217 | 3300025909 | Bacteria | 1171 |
| 262 | Ga0207654_10035572 | 3300025911 | Bacteria | 2776 |
| 263 | Ga0207654_10220589 | 3300025911 | Bacteria | 1258 |
| 264 | Ga0207707_10111785 | 3300025912 | Bacteria | 2388 |
| 265 | Ga0207695_10002553 | 3300025913 | Bacteria | 26751 |
| 266 | Ga0207695_10059296 | 3300025913 | Bacteria | 3969 |
| 267 | Ga0207695_10139653 | 3300025913 | Bacteria | 2373 |
| 268 | Ga0207695_10242581 | 3300025913 | Bacteria | 1703 |
| 269 | Ga0207671_10032438 | 3300025914 | Bacteria | 3888 |
| 270 | Ga0207671_10081863 | 3300025914 | Bacteria | 2421 |
| 271 | Ga0207663_10134907 | 3300025916 | Bacteria | 1711 |
| 272 | Ga0207657_10047904 | 3300025919 | Bacteria | 3733 |
| 273 | Ga0207657_10206246 | 3300025919 | Bacteria | 1579 |
| 274 | Ga0207657_10289226 | 3300025919 | Bacteria | 1300 |
| 275 | Ga0207652_10257581 | 3300025921 | Bacteria | 1574 |
| 276 | Ga0207681_10071735 | 3300025923 | Bacteria | 2416 |
| 277 | Ga0207694_10036796 | 3300025924 | Bacteria | 3756 |
| 278 | Ga0207694_10046338 | 3300025924 | Bacteria | 3360 |
| 279 | Ga0207694_10303644 | 3300025924 | Bacteria | 1314 |
| 280 | Ga0207650_10043615 | 3300025925 | Bacteria | 3293 |
| 281 | Ga0207659_10014354 | 3300025926 | Bacteria | 5105 |
| 282 | Ga0207687_10172790 | 3300025927 | Bacteria | 1668 |
| 283 | Ga0207700_10000934 | 3300025928 | Bacteria | 16798 |
| 284 | Ga0207700_10001721 | 3300025928 | Bacteria | 12423 |
| 285 | Ga0207700_10075528 | 3300025928 | Bacteria | 2612 |
| 286 | Ga0207664_10005619 | 3300025929 | Bacteria | 8580 |
| 287 | Ga0207664_10020960 | 3300025929 | Bacteria | 4851 |
| 288 | Ga0207690_10019878 | 3300025932 | Bacteria | 4140 |
| 289 | Ga0207690_10022747 | 3300025932 | Bacteria | 3903 |
| 290 | Ga0207690_10243308 | 3300025932 | Bacteria | 1387 |
| 291 | Ga0207686_10010703 | 3300025934 | Bacteria | 4997 |
| 292 | Ga0207686_10022272 | 3300025934 | Bacteria | 3648 |
| 293 | Ga0207686_10072842 | 3300025934 | Bacteria | 2215 |
| 294 | Ga0207709_10044027 | 3300025935 | Bacteria | 2695 |
| 295 | Ga0207670_10048959 | 3300025936 | Bacteria | 2824 |
| 296 | Ga0207670_10114900 | 3300025936 | Bacteria | 1946 |
| 297 | Ga0207669_10146517 | 3300025937 | Bacteria | 1647 |
| 298 | Ga0207665_10009637 | 3300025939 | Bacteria | 6344 |
| 299 | Ga0207665_10036883 | 3300025939 | Bacteria | 3252 |
| 300 | Ga0207691_10031621 | 3300025940 | Bacteria | 4938 |
| 301 | Ga0207711_10007434 | 3300025941 | Bacteria | 9169 |
| 302 | Ga0207711_10014343 | 3300025941 | Bacteria | 6582 |
| 303 | Ga0207711_10054670 | 3300025941 | Bacteria | 3427 |
| 304 | Ga0207711_10147800 | 3300025941 | Bacteria | 2118 |
| 305 | Ga0207711_10172205 | 3300025941 | Bacteria | 1965 |
| 306 | Ga0207689_10002193 | 3300025942 | Bacteria | 18314 |
| 307 | Ga0207689_10014153 | 3300025942 | Bacteria | 6788 |
| 308 | Ga0207689_10027428 | 3300025942 | Bacteria | 4767 |
| 309 | Ga0207667_10000347 | 3300025949 | Bacteria | 63149 |
| 310 | Ga0207667_10037059 | 3300025949 | Bacteria | 5216 |
| 311 | Ga0207667_10088270 | 3300025949 | Bacteria | 3207 |
| 312 | Ga0207667_10114477 | 3300025949 | Bacteria | 2780 |
| 313 | Ga0207667_10219678 | 3300025949 | Bacteria | 1947 |
| 314 | Ga0207667_10239669 | 3300025949 | Bacteria | 1856 |
| 315 | Ga0207651_10008860 | 3300025960 | Bacteria | 5463 |
| 316 | Ga0207651_10045804 | 3300025960 | Bacteria | 2936 |
| 317 | Ga0207651_10045894 | 3300025960 | Bacteria | 2934 |
| 318 | Ga0207712_10093236 | 3300025961 | Bacteria | 2222 |
| 319 | Ga0207668_10073639 | 3300025972 | Bacteria | 2448 |
| 320 | Ga0207640_10240884 | 3300025981 | Bacteria | 1397 |
| 321 | Ga0207658_10031309 | 3300025986 | Bacteria | 3776 |
| 322 | Ga0207658_10198378 | 3300025986 | Bacteria | 1674 |
| 323 | Ga0207703_10001245 | 3300026035 | Bacteria | 23856 |
| 324 | Ga0207703_10024604 | 3300026035 | Bacteria | 4736 |
| 325 | Ga0207703_10041596 | 3300026035 | Bacteria | 3683 |
| 326 | Ga0207703_10051592 | 3300026035 | Bacteria | 3334 |
| 327 | Ga0207703_10268607 | 3300026035 | Bacteria | 1544 |
| 328 | Ga0207639_10094905 | 3300026041 | Bacteria | 2396 |
| 329 | Ga0207678_10044867 | 3300026067 | Bacteria | 3823 |
| 330 | Ga0207678_10060999 | 3300026067 | Bacteria | 3243 |
| 331 | Ga0207678_10067517 | 3300026067 | Bacteria | 3069 |
| 332 | Ga0207678_10092259 | 3300026067 | Bacteria | 2589 |
| 333 | Ga0207678_10105427 | 3300026067 | Bacteria | 2405 |
| 334 | Ga0207708_10194582 | 3300026075 | Bacteria | 1615 |
| 335 | Ga0207702_10301107 | 3300026078 | Bacteria | 1522 |
| 336 | Ga0207641_10005674 | 3300026088 | Bacteria | 10621 |
| 337 | Ga0207641_10043813 | 3300026088 | Bacteria | 3760 |
| 338 | Ga0207641_10063138 | 3300026088 | Bacteria | 3163 |
| 339 | Ga0207648_10005826 | 3300026089 | Bacteria | 12341 |
| 340 | Ga0207648_10111319 | 3300026089 | Bacteria | 2404 |
| 341 | Ga0207676_10005716 | 3300026095 | Bacteria | 8801 |
| 342 | Ga0207674_10023627 | 3300026116 | Bacteria | 6581 |
| 343 | Ga0207675_100000672 | 3300026118 | Bacteria | 33681 |
| 344 | Ga0207675_100187777 | 3300026118 | Bacteria | 1981 |
| 345 | Ga0207675_100484399 | 3300026118 | Bacteria | 1230 |
| 346 | Ga0207683_10123613 | 3300026121 | Bacteria | 2324 |
| 347 | Ga0207683_10141151 | 3300026121 | Bacteria | 2171 |
| 348 | Ga0207683_10215619 | 3300026121 | Bacteria | 1748 |
| 349 | Ga0207698_10051168 | 3300026142 | Bacteria | 3156 |
| 350 | Ga0207698_10083165 | 3300026142 | Bacteria | 2590 |
| 351 | Ga0207698_10193814 | 3300026142 | Bacteria | 1813 |
| 352 | Ga0207698_10373212 | 3300026142 | Bacteria | 1355 |
| 353 | Ga0207698_10425785 | 3300026142 | Bacteria | 1275 |
| 354 | Ga0209371_1001698 | 3300027312 | Bacteria | 13970 |
| 355 | Ga0268266_10163836 | 3300028379 | Bacteria | 2013 |
| 356 | Ga0268265_10026894 | 3300028380 | Bacteria | 4098 |
| 357 | Ga0268265_10152601 | 3300028380 | Bacteria | 1950 |
| 358 | Ga0268264_10001103 | 3300028381 | Bacteria | 26672 |
| 359 | Ga0265318_10002884 | 3300028577 | Bacteria | 8957 |
| 360 | Ga0265338_10000104 | 3300028800 | Bacteria | 156596 |
| 361 | Ga0265338_10076974 | 3300028800 | Bacteria | 2822 |
| 362 | Ga0268256_1007215 | 3300030500 | Bacteria | 3998 |
| 363 | Ga0265330_10001319 | 3300031235 | Bacteria | 14499 |
| 364 | Ga0265325_10000403 | 3300031241 | Bacteria | 30655 |
| 365 | Ga0265339_10013001 | 3300031249 | Bacteria | 5060 |
| 366 | Ga0265339_10060246 | 3300031249 | Bacteria | 2046 |
| 367 | Ga0265316_10002283 | 3300031344 | Bacteria | 20065 |
| 368 | Ga0265316_10056370 | 3300031344 | Bacteria | 3070 |
| 369 | Ga0307408_100154902 | 3300031548 | Bacteria | 1813 |
| 370 | Ga0307408_100185513 | 3300031548 | Bacteria | 1672 |
| 371 | Ga0265313_10003435 | 3300031595 | Bacteria | 12820 |
| 372 | Ga0265342_10024858 | 3300031712 | Bacteria | 3774 |
| 373 | Ga0316578_10064750 | 3300031728 | Bacteria | 2158 |
| 374 | Ga0307405_10051272 | 3300031731 | Bacteria | 2560 |
| 375 | Ga0307405_10128969 | 3300031731 | Bacteria | 1744 |
| 376 | Ga0307412_10000054 | 3300031911 | Bacteria | 147105 |
| 377 | Ga0307416_100246617 | 3300032002 | Bacteria | 1735 |
| 378 | Ga0307416_100279912 | 3300032002 | Bacteria | 1644 |
| 379 | Ga0373930_0004268 | 3300034816 | Bacteria | 2314 |
| 380 | Ga0373930_0016747 | 3300034816 | Bacteria | 1390 |
| 381 | Ga0373928_0000567 | 3300035084 | Bacteria | 7229 |
| 382 | Ga0373929_0019040 | 3300035085 | Bacteria | 1370 |
| 383 | Ga0373932_0000132 | 3300035112 | Bacteria | 21153 |
| 384 | Ga0373955_0007760 | 3300035172 | Bacteria | 4945 |
| 385 | Ga0316574_0014777 | 3300035398 | Bacteria | 4519 |
| 386 | Ga0316574_0072172 | 3300035398 | Bacteria | 2181 |
| 387 | Ga0316574_0213038 | 3300035398 | Bacteria | 1239 |
| 388 | Ga0373924_0065430 | 3300035410 | Bacteria | 1526 |
| 389 | Ga0373931_0000001 | 3300035691 | Bacteria | 634029 |
| 390 | Ga0373931_0092653 | 3300035691 | Bacteria | 1686 |
| 391 | Ga0373927_0010962 | 3300035695 | Bacteria | 6036 |
| 392 | Ga0373937_0323312 | 3300036401 | Bacteria | 1460 |
| 393 | Ga0316584_0185255 | 3300036712 | Bacteria | 1540 |
| 394 | Ga0395899_0000029 | 3300037312 | Bacteria | 329371 |
| 395 | Ga0395899_0078087 | 3300037312 | Bacteria | 2414 |
| 396 | Ga0395899_0166640 | 3300037312 | Bacteria | 1554 |
| 397 | Ga0395900_0000098 | 3300037418 | Bacteria | 158030 |
| 398 | Ga0395900_0000196 | 3300037418 | Bacteria | 96480 |
| 399 | Ga0395900_0140713 | 3300037418 | Bacteria | 2471 |
| 400 | Ga0395900_0154138 | 3300037418 | Bacteria | 2347 |
| 401 | Ga0395898_0000086 | 3300037466 | Bacteria | 239895 |
| 402 | Ga0395898_0002206 | 3300037466 | Bacteria | 23779 |
| 403 | Ga0395905_0000107 | 3300037471 | Bacteria | 138710 |
| 404 | Ga0395905_0002228 | 3300037471 | Bacteria | 21868 |
| 405 | Ga0395905_0030315 | 3300037471 | Bacteria | 5098 |
| 406 | Ga0395905_0336558 | 3300037471 | Bacteria | 1400 |
| 407 | Ga0395901_0000104 | 3300038443 | Bacteria | 114939 |
| 408 | Ga0395901_0000137 | 3300038443 | Bacteria | 95185 |
| 409 | Ga0395901_0181778 | 3300038443 | Bacteria | 2205 |
| 410 | Ga0400483_124349 | 3300039062 | Bacteria | 5128 |
| 411 | Ga0400483_281211 | 3300039062 | Bacteria | 2578 |
| 412 | Ga0436361_0218373 | 3300039447 | Bacteria | 11684 |
| 413 | Ga0436361_0667566 | 3300039447 | Bacteria | 3634 |
| 414 | Ga0436361_0859276 | 3300039447 | Bacteria | 1096 |
| 415 | Ga0439433_0033354 | 3300041999 | Unclassified | 1183 |
| 416 | Ga0439460_0022663 | 3300042461 | Bacteria | 1725 |
| 417 | Ga0451577_0001796 | 3300042876 | Bacteria | 27445 |
| 418 | Ga0451577_0011238 | 3300042876 | Bacteria | 8485 |
| 419 | Ga0451577_0011721 | 3300042876 | Bacteria | 8276 |
| 420 | Ga0451577_0153558 | 3300042876 | Bacteria | 2071 |
| 421 | Ga0451577_0168179 | 3300042876 | Unclassified | 1975 |
| 422 | Ga0451577_0230519 | 3300042876 | Bacteria | 1675 |
| 423 | Ga0466969_0000707 | 3300044656 | Bacteria | 18081 |
| 424 | Ga0466972_0009212 | 3300044658 | Bacteria | 4958 |
| 425 | Ga0466973_0038994 | 3300044659 | Bacteria | 4494 |
| 426 | Ga0453683_0039993 | 3300044673 | Bacteria | 2946 |
| 427 | Ga0453683_0070147 | 3300044673 | Bacteria | 2192 |
| 428 | Ga0453683_0101012 | 3300044673 | Unclassified | 1811 |
| 429 | Ga0453683_0159296 | 3300044673 | Bacteria | 1428 |
| 430 | Ga0453683_0208645 | 3300044673 | Bacteria | 1241 |
| 431 | Ga0466965_0003560 | 3300044683 | Bacteria | 6844 |
| 432 | Ga0466965_0040842 | 3300044683 | Bacteria | 2284 |
| 433 | Ga0466965_0110897 | 3300044683 | Bacteria | 1410 |
| 434 | Ga0466966_0000005 | 3300044684 | Bacteria | 193939 |
| 435 | Ga0466966_0022936 | 3300044684 | Bacteria | 4090 |
| 436 | Ga0466966_0038146 | 3300044684 | Bacteria | 3096 |
| 437 | Ga0466966_0054667 | 3300044684 | Bacteria | 2529 |
| 438 | Ga0466966_0145425 | 3300044684 | Bacteria | 1447 |
| 439 | Ga0466966_0160371 | 3300044684 | Bacteria | 1369 |
| 440 | Ga0466961_0001666 | 3300044693 | Bacteria | 13819 |
| 441 | Ga0466961_0006747 | 3300044693 | Bacteria | 7304 |
| 442 | Ga0466961_0060153 | 3300044693 | Bacteria | 2415 |
| 443 | Ga0466961_0084792 | 3300044693 | Bacteria | 2003 |
| 444 | Ga0466961_0099566 | 3300044693 | Bacteria | 1832 |
| 445 | Ga0466963_0005666 | 3300044694 | Bacteria | 7336 |
| 446 | Ga0466963_0011265 | 3300044694 | Bacteria | 5442 |
| 447 | Ga0466963_0020762 | 3300044694 | Bacteria | 4134 |
| 448 | Ga0466964_0001910 | 3300044706 | Bacteria | 7287 |
| 449 | Ga0453684_0000007 | 3300044712 | Bacteria | 1301482 |
| 450 | Ga0453684_0000056 | 3300044712 | Bacteria | 513389 |
| 451 | Ga0453684_0003522 | 3300044712 | Bacteria | 35045 |
| 452 | Ga0453684_0007475 | 3300044712 | Bacteria | 20062 |
| 453 | Ga0453684_0011550 | 3300044712 | Bacteria | 14775 |
| 454 | Ga0453684_0012139 | 3300044712 | Bacteria | 14294 |
| 455 | Ga0453684_0059665 | 3300044712 | Bacteria | 4916 |
| 456 | Ga0453684_0129316 | 3300044712 | Bacteria | 3032 |
| 457 | Ga0453684_0446996 | 3300044712 | Bacteria | 1439 |
| 458 | Ga0466971_0006197 | 3300044719 | Bacteria | 5198 |
| 459 | Ga0466971_0047654 | 3300044719 | Bacteria | 1926 |
| 460 | Ga0466968_0048030 | 3300044735 | Bacteria | 1816 |
| 461 | Ga0466970_0123469 | 3300044765 | Bacteria | 1419 |
| 462 | Ga0466957_0001296 | 3300044842 | Bacteria | 13054 |
| 463 | Ga0466957_0002597 | 3300044842 | Bacteria | 9736 |
| 464 | Ga0466957_0007806 | 3300044842 | Bacteria | 6061 |
| 465 | Ga0466957_0025440 | 3300044842 | Bacteria | 3508 |
| 466 | Ga0466957_0043283 | 3300044842 | Bacteria | 2726 |
| 467 | Ga0466957_0158137 | 3300044842 | Bacteria | 1470 |
| 468 | Ga0466960_0012676 | 3300044901 | Bacteria | 3564 |
| 469 | Ga0466959_0012397 | 3300045049 | Bacteria | 6158 |
| 470 | Ga0466959_0015649 | 3300045049 | Bacteria | 5530 |
| 471 | Ga0451576_0000192 | 3300045051 | Bacteria | 154140 |
| 472 | Ga0451576_0000829 | 3300045051 | Bacteria | 60290 |
| 473 | Ga0451576_0001119 | 3300045051 | Bacteria | 48710 |
| 474 | Ga0451576_0011393 | 3300045051 | Bacteria | 10105 |
| 475 | Ga0451576_0123113 | 3300045051 | Bacteria | 2701 |
| 476 | Ga0451576_0149959 | 3300045051 | Bacteria | 2432 |
| 477 | Ga0451576_0348181 | 3300045051 | Bacteria | 1551 |
| 478 | Ga0466958_0002607 | 3300045836 | Bacteria | 9108 |
| 479 | Ga0466958_0013951 | 3300045836 | Bacteria | 4581 |
| 480 | Ga0466958_0021290 | 3300045836 | Bacteria | 3787 |
| 481 | Ga0466958_0094609 | 3300045836 | Bacteria | 1851 |
| 482 | Ga0466958_0121786 | 3300045836 | Bacteria | 1633 |
| 483 | Ga0495592_0018445 | 3300046454 | Bacteria | 5307 |
| 484 | Ga0495592_0019113 | 3300046454 | Bacteria | 5213 |
| 485 | Ga0495592_0047416 | 3300046454 | Bacteria | 3200 |
| 486 | Ga0495603_0001492 | 3300046455 | Bacteria | 13623 |
| 487 | Ga0495590_0021858 | 3300046457 | Bacteria | 2265 |
| 488 | Ga0495591_001173 | 3300046458 | Bacteria | 17117 |
| 489 | Ga0495629_0002860 | 3300046459 | Bacteria | 13186 |
| 490 | Ga0495629_0006339 | 3300046459 | Bacteria | 8775 |
| 491 | Ga0495629_0007060 | 3300046459 | Bacteria | 8274 |
| 492 | Ga0495638_0003196 | 3300046460 | Bacteria | 12954 |
| 493 | Ga0495638_0006860 | 3300046460 | Bacteria | 8220 |
| 494 | Ga0495641_0079357 | 3300046461 | Bacteria | 1471 |
| 495 | Ga0495651_0008582 | 3300046462 | Bacteria | 7832 |
| 496 | Ga0495653_0002493 | 3300046463 | Bacteria | 14654 |
| 497 | Ga0495653_0003241 | 3300046463 | Bacteria | 13048 |
| 498 | Ga0495653_0010264 | 3300046463 | Bacteria | 7663 |
| 499 | Ga0495653_0079027 | 3300046463 | Bacteria | 2438 |
| 500 | Ga0495653_0081128 | 3300046463 | Bacteria | 2397 |
| 501 | Ga0495653_0150723 | 3300046463 | Bacteria | 1625 |
| 502 | Ga0495650_0012432 | 3300046471 | Bacteria | 4581 |
| 503 | Ga0495580_0005037 | 3300046472 | Bacteria | 11014 |
| 504 | Ga0495580_0005977 | 3300046472 | Bacteria | 9974 |
| 505 | Ga0495580_0008862 | 3300046472 | Bacteria | 7959 |
| 506 | Ga0495580_0013075 | 3300046472 | Bacteria | 6354 |
| 507 | Ga0495580_0031201 | 3300046472 | Bacteria | 3853 |
| 508 | Ga0495582_0006253 | 3300046473 | Bacteria | 6637 |
| 509 | Ga0495582_0016675 | 3300046473 | Bacteria | 4022 |
| 510 | Ga0495582_0060829 | 3300046473 | Bacteria | 2084 |
| 511 | Ga0495605_0003102 | 3300046474 | Bacteria | 10022 |
| 512 | Ga0495605_0008110 | 3300046474 | Bacteria | 5941 |
| 513 | Ga0495605_0010240 | 3300046474 | Bacteria | 5251 |
| 514 | Ga0495662_0012041 | 3300046476 | Bacteria | 4227 |
| 515 | Ga0495662_0023367 | 3300046476 | Bacteria | 2985 |
| 516 | Ga0495664_0000998 | 3300046477 | Bacteria | 14594 |
| 517 | Ga0495664_0002627 | 3300046477 | Bacteria | 9666 |
| 518 | Ga0495596_0006417 | 3300046500 | Bacteria | 5411 |
| 519 | Ga0495596_0007366 | 3300046500 | Bacteria | 4968 |
| 520 | Ga0495596_0013157 | 3300046500 | Bacteria | 3519 |
| 521 | Ga0495583_0005795 | 3300046506 | Bacteria | 8251 |
| 522 | Ga0495583_0039286 | 3300046506 | Bacteria | 2230 |
| 523 | Ga0495606_0017601 | 3300046507 | Bacteria | 5394 |
| 524 | Ga0495608_0001733 | 3300046511 | Bacteria | 15643 |
| 525 | Ga0495608_0005902 | 3300046511 | Bacteria | 8709 |
| 526 | Ga0495608_0073808 | 3300046511 | Bacteria | 2224 |
| 527 | Ga0495610_0002328 | 3300046512 | Bacteria | 16057 |
| 528 | Ga0495616_0062177 | 3300046513 | Bacteria | 1829 |
| 529 | Ga0495618_0005279 | 3300046514 | Bacteria | 7896 |
| 530 | Ga0495618_0017149 | 3300046514 | Bacteria | 4438 |
| 531 | Ga0495618_0021892 | 3300046514 | Bacteria | 3944 |
| 532 | Ga0495618_0091188 | 3300046514 | Bacteria | 1948 |
| 533 | Ga0495620_0038514 | 3300046515 | Bacteria | 2121 |
| 534 | Ga0495620_0076897 | 3300046515 | Bacteria | 1356 |
| 535 | Ga0495628_0003132 | 3300046516 | Bacteria | 14849 |
| 536 | Ga0495628_0016423 | 3300046516 | Bacteria | 6176 |
| 537 | Ga0495628_0051819 | 3300046516 | Bacteria | 3243 |
| 538 | Ga0495628_0060380 | 3300046516 | Bacteria | 2975 |
| 539 | Ga0495628_0061020 | 3300046516 | Bacteria | 2958 |
| 540 | Ga0495628_0117665 | 3300046516 | Bacteria | 2040 |
| 541 | Ga0495628_0131392 | 3300046516 | Bacteria | 1914 |
| 542 | Ga0495630_0011646 | 3300046517 | Bacteria | 6373 |
| 543 | Ga0495630_0020586 | 3300046517 | Bacteria | 4865 |
| 544 | Ga0495630_0074633 | 3300046517 | Bacteria | 2555 |
| 545 | Ga0495648_0015959 | 3300046524 | Bacteria | 5426 |
| 546 | Ga0495648_0023219 | 3300046524 | Bacteria | 4253 |
| 547 | Ga0495648_0027977 | 3300046524 | Bacteria | 3764 |
| 548 | Ga0495666_0001172 | 3300046526 | Bacteria | 12597 |
| 549 | Ga0495666_0001884 | 3300046526 | Bacteria | 10354 |
| 550 | Ga0495666_0001892 | 3300046526 | Bacteria | 10332 |
| 551 | Ga0495642_0086541 | 3300046528 | Bacteria | 1324 |
| 552 | Ga0495652_0006806 | 3300046529 | Bacteria | 10596 |
| 553 | Ga0495652_0012881 | 3300046529 | Bacteria | 7534 |
| 554 | Ga0495652_0022650 | 3300046529 | Bacteria | 5573 |
| 555 | Ga0495665_0002407 | 3300046531 | Bacteria | 10111 |
| 556 | Ga0495665_0002948 | 3300046531 | Bacteria | 9190 |
| 557 | Ga0495665_0011102 | 3300046531 | Bacteria | 4875 |
| 558 | Ga0495640_0012698 | 3300046533 | Bacteria | 6430 |
| 559 | Ga0495640_0017072 | 3300046533 | Bacteria | 5416 |
| 560 | Ga0495586_0011268 | 3300046535 | Bacteria | 4754 |
| 561 | Ga0495586_0023915 | 3300046535 | Bacteria | 3262 |
| 562 | Ga0495586_0031698 | 3300046535 | Bacteria | 2833 |
| 563 | Ga0495587_0003605 | 3300046536 | Bacteria | 10302 |
| 564 | Ga0495645_0002890 | 3300046543 | Bacteria | 11656 |
| 565 | Ga0495622_0002306 | 3300046557 | Bacteria | 9288 |
| 566 | Ga0495622_0049758 | 3300046557 | Bacteria | 1946 |
| 567 | Ga0495667_0072591 | 3300046559 | Bacteria | 2243 |
| 568 | Ga0495634_0002770 | 3300046642 | Bacteria | 14393 |
| 569 | Ga0495634_0012419 | 3300046642 | Bacteria | 6165 |
| 570 | Ga0495634_0080951 | 3300046642 | Bacteria | 2124 |
| 571 | Ga0495611_0012801 | 3300046648 | Bacteria | 3564 |
| 572 | Ga0495635_0002838 | 3300046663 | Bacteria | 11900 |
| 573 | Ga0495635_0012550 | 3300046663 | Bacteria | 5936 |
| 574 | Ga0495635_0201222 | 3300046663 | Bacteria | 1351 |
| 575 | Ga0495661_0002331 | 3300046665 | Bacteria | 14643 |
| 576 | Ga0495661_0009682 | 3300046665 | Bacteria | 6601 |
| 577 | Ga0495661_0041284 | 3300046665 | Bacteria | 2855 |
| 578 | Ga0495657_0013783 | 3300046675 | Bacteria | 5951 |
| 579 | Ga0495657_0066709 | 3300046675 | Bacteria | 2364 |
| 580 | Ga0495657_0169029 | 3300046675 | Bacteria | 1348 |
| 581 | Ga0495657_0270112 | 3300046675 | Bacteria | 1020 |
| 582 | Ga0495599_0022153 | 3300046678 | Bacteria | 3965 |
| 583 | Ga0495623_0015547 | 3300046679 | Bacteria | 4921 |
| 584 | Ga0495646_0001230 | 3300046680 | Bacteria | 15030 |
| 585 | Ga0495646_0004523 | 3300046680 | Bacteria | 8754 |
| 586 | Ga0495646_0025145 | 3300046680 | Bacteria | 3746 |
| 587 | Ga0495669_0015313 | 3300046684 | Bacteria | 3284 |
| 588 | Ga0495669_0026475 | 3300046684 | Bacteria | 2535 |
| 589 | Ga0495613_0002243 | 3300046689 | Bacteria | 14613 |
| 590 | Ga0495613_0015727 | 3300046689 | Bacteria | 5631 |
| 591 | Ga0495613_0049041 | 3300046689 | Bacteria | 3117 |
| 592 | Ga0495624_0002882 | 3300046690 | Bacteria | 12871 |
| 593 | Ga0495624_0011558 | 3300046690 | Bacteria | 6065 |
| 594 | Ga0495624_0095898 | 3300046690 | Bacteria | 1827 |
| 595 | Ga0495670_0012440 | 3300046691 | Bacteria | 4185 |
| 596 | Ga0495649_0017196 | 3300046694 | Bacteria | 4084 |
| 597 | Ga0495589_0017215 | 3300046794 | Bacteria | 3711 |
| 598 | Ga0495589_0113375 | 3300046794 | Bacteria | 1308 |
| 599 | Ga0495600_0001140 | 3300046809 | Bacteria | 14518 |
| 600 | Ga0495600_0041387 | 3300046809 | Bacteria | 3002 |
| 601 | Ga0495600_0204231 | 3300046809 | Bacteria | 1268 |
| 602 | Ga0495660_0067323 | 3300046810 | Bacteria | 1908 |
| 603 | Ga0495581_0001962 | 3300047315 | Bacteria | 11527 |
| 604 | Ga0495581_0006868 | 3300047315 | Bacteria | 6600 |
| 605 | Ga0495604_0002319 | 3300047317 | Bacteria | 15243 |
| 606 | Ga0495604_0012572 | 3300047317 | Bacteria | 6732 |
| 607 | Ga0495604_0013874 | 3300047317 | Bacteria | 6427 |
| 608 | Ga0495604_0075157 | 3300047317 | Bacteria | 2544 |
| 609 | Ga0495674_0005769 | 3300047319 | Bacteria | 11870 |
| 610 | Ga0495674_0013154 | 3300047319 | Bacteria | 7782 |
| 611 | Ga0495674_0033647 | 3300047319 | Bacteria | 4641 |
| 612 | Ga0495674_0270421 | 3300047319 | Bacteria | 1394 |
| 613 | Ga0495672_0011901 | 3300047320 | Bacteria | 6104 |
| 614 | Ga0495672_0017178 | 3300047320 | Bacteria | 4844 |
| 615 | Ga0495672_0050341 | 3300047320 | Bacteria | 2459 |
| 616 | Ga0495676_0002156 | 3300047321 | Bacteria | 17418 |
| 617 | Ga0495676_0019012 | 3300047321 | Bacteria | 6051 |
| 618 | Ga0495676_0042612 | 3300047321 | Bacteria | 3723 |
| 619 | Ga0495676_0123569 | 3300047321 | Bacteria | 1879 |
| 620 | Ga0495680_0003344 | 3300047322 | Bacteria | 15854 |
| 621 | Ga0495680_0003961 | 3300047322 | Bacteria | 14320 |
| 622 | Ga0495680_0023699 | 3300047322 | Bacteria | 5099 |
| 623 | Ga0495680_0051553 | 3300047322 | Bacteria | 3212 |
| 624 | Ga0495683_0004640 | 3300047323 | Bacteria | 7742 |
| 625 | Ga0495683_0009341 | 3300047323 | Bacteria | 5222 |
| 626 | Ga0495683_0009690 | 3300047323 | Bacteria | 5123 |
| 627 | Ga0495683_0065755 | 3300047323 | Bacteria | 1788 |
| 628 | Ga0495687_007357 | 3300047443 | Bacteria | 6500 |
| 629 | Ga0495687_011859 | 3300047443 | Bacteria | 4653 |
| 630 | Ga0495687_012450 | 3300047443 | Bacteria | 4497 |
| 631 | Ga0495687_017589 | 3300047443 | Bacteria | 3560 |
| 632 | Ga0495675_0001442 | 3300047444 | Bacteria | 14384 |
| 633 | Ga0495675_0004332 | 3300047444 | Bacteria | 8583 |
| 634 | Ga0495675_0004681 | 3300047444 | Bacteria | 8312 |
| 635 | Ga0495677_0040387 | 3300047445 | Bacteria | 1706 |
| 636 | Ga0495679_000399 | 3300047446 | Bacteria | 32765 |
| 637 | Ga0495679_000514 | 3300047446 | Bacteria | 27522 |
| 638 | Ga0495679_000737 | 3300047446 | Bacteria | 20997 |
| 639 | Ga0495673_0005498 | 3300047469 | Bacteria | 7653 |
| 640 | Ga0495673_0006064 | 3300047469 | Bacteria | 7178 |
| 641 | Ga0495684_0115330 | 3300047471 | Bacteria | 2025 |
| 642 | Ga0495684_0194463 | 3300047471 | Bacteria | 1498 |
| 643 | Ga0495686_0000076 | 3300047472 | Bacteria | 206039 |
| 644 | Ga0495593_0003425 | 3300047673 | Bacteria | 9492 |
| 645 | Ga0495593_0003829 | 3300047673 | Bacteria | 8983 |
| 646 | Ga0495593_0008127 | 3300047673 | Bacteria | 6105 |
| 647 | Ga0495593_0057294 | 3300047673 | Bacteria | 2046 |
| 648 | Ga0495602_0004536 | 3300048088 | Bacteria | 14489 |
| 649 | Ga0495602_0011568 | 3300048088 | Bacteria | 9118 |
| 650 | Ga0495602_0027460 | 3300048088 | Bacteria | 5468 |
| 651 | Ga0495602_0072371 | 3300048088 | Bacteria | 2939 |
| 652 | Ga0495602_0107796 | 3300048088 | Bacteria | 2269 |
| 653 | Ga0495614_0001762 | 3300048089 | Bacteria | 9458 |
| 654 | Ga0495626_0010364 | 3300048091 | Bacteria | 4976 |
| 655 | Ga0496100_0071924 | 3300048903 | Bacteria | 2310 |
| 656 | Ga0496101_0001769 | 3300048904 | Bacteria | 12973 |
| 657 | Ga0496101_0024446 | 3300048904 | Bacteria | 4181 |
| 658 | Ga0496101_0064829 | 3300048904 | Bacteria | 2662 |
| 659 | Ga0496101_0320787 | 3300048904 | Bacteria | 1215 |
| 660 | Ga0496102_0003988 | 3300048905 | Bacteria | 12499 |
| 661 | Ga0496102_0015741 | 3300048905 | Bacteria | 6590 |
| 662 | Ga0496102_0050204 | 3300048905 | Bacteria | 3798 |
| 663 | Ga0496103_0002668 | 3300048906 | Bacteria | 11164 |
| 664 | Ga0496103_0029652 | 3300048906 | Bacteria | 3325 |
| 665 | Ga0496104_0009080 | 3300048907 | Bacteria | 8839 |
| 666 | Ga0496104_0042296 | 3300048907 | Bacteria | 4275 |
| 667 | Ga0496104_0188710 | 3300048907 | Bacteria | 1972 |
| 668 | Ga0496105_0073706 | 3300048908 | Bacteria | 2820 |
| 669 | Ga0496105_0133127 | 3300048908 | Bacteria | 2048 |
| 670 | Ga0496106_0000301 | 3300048909 | Bacteria | 34836 |
| 671 | Ga0496106_0056502 | 3300048909 | Bacteria | 2967 |
| 672 | Ga0496106_0228121 | 3300048909 | Bacteria | 1486 |
| 673 | Ga0496107_0044666 | 3300048910 | Bacteria | 3186 |
| 674 | Ga0496107_0053687 | 3300048910 | Bacteria | 2907 |
| 675 | Ga0496108_0073486 | 3300048911 | Bacteria | 2887 |
| 676 | Ga0496108_0237794 | 3300048911 | Bacteria | 1584 |
| 677 | Ga0496109_0213459 | 3300048912 | Bacteria | 1815 |
| 678 | Ga0496110_0064675 | 3300048913 | Bacteria | 3233 |
| 679 | Ga0496110_0231393 | 3300048913 | Bacteria | 1681 |
| 680 | Ga0496112_0005293 | 3300048915 | Bacteria | 11129 |
| 681 | Ga0496112_0134950 | 3300048915 | Bacteria | 2438 |
| 682 | Ga0496113_0064725 | 3300048916 | Bacteria | 2765 |
| 683 | Ga0496113_0105470 | 3300048916 | Bacteria | 2188 |
| 684 | Ga0496114_0064580 | 3300048917 | Bacteria | 3066 |
| 685 | Ga0496114_0101879 | 3300048917 | Bacteria | 2452 |
| 686 | Ga0496114_0295716 | 3300048917 | Bacteria | 1429 |
| 687 | Ga0496115_0100087 | 3300048918 | Bacteria | 2376 |
| 688 | Ga0496116_0020190 | 3300048919 | Bacteria | 5068 |
| 689 | Ga0496116_0025219 | 3300048919 | Bacteria | 4375 |
| 690 | Ga0496116_0080793 | 3300048919 | Bacteria | 2018 |
| 691 | Ga0496117_0003049 | 3300048920 | Bacteria | 20080 |
| 692 | Ga0496117_0004615 | 3300048920 | Bacteria | 15013 |
| 693 | Ga0496117_0012097 | 3300048920 | Bacteria | 7657 |
| 694 | Ga0496117_0016129 | 3300048920 | Bacteria | 6319 |
| 695 | Ga0496117_0022931 | 3300048920 | Bacteria | 4996 |
| 696 | Ga0496117_0074363 | 3300048920 | Bacteria | 2262 |
| 697 | Ga0496118_0001753 | 3300048921 | Bacteria | 31462 |
| 698 | Ga0496118_0003700 | 3300048921 | Bacteria | 18957 |
| 699 | Ga0496118_0006470 | 3300048921 | Bacteria | 12861 |
| 700 | Ga0496118_0006753 | 3300048921 | Bacteria | 12484 |
| 701 | Ga0496118_0031206 | 3300048921 | Bacteria | 4424 |
| 702 | Ga0496118_0033101 | 3300048921 | Bacteria | 4248 |
| 703 | Ga0496121_0004965 | 3300048924 | Bacteria | 17438 |
| 704 | Ga0496121_0006290 | 3300048924 | Bacteria | 14846 |
| 705 | Ga0496121_0006544 | 3300048924 | Bacteria | 14397 |
| 706 | Ga0496121_0039725 | 3300048924 | Bacteria | 4139 |
| 707 | Ga0496121_0075755 | 3300048924 | Bacteria | 2686 |
| 708 | Ga0496124_0099954 | 3300048927 | Bacteria | 2352 |
| 709 | Ga0496126_0000263 | 3300048929 | Bacteria | 111847 |
| 710 | Ga0496126_0003028 | 3300048929 | Bacteria | 21785 |
| 711 | Ga0496126_0007901 | 3300048929 | Bacteria | 11580 |
| 712 | Ga0496126_0031426 | 3300048929 | Bacteria | 5017 |
| 713 | Ga0496126_0045435 | 3300048929 | Bacteria | 4036 |
| 714 | Ga0496126_0066680 | 3300048929 | Bacteria | 3218 |
| 715 | Ga0496126_0126367 | 3300048929 | Bacteria | 2213 |
| 716 | Ga0495682_0007462 | 3300049460 | Bacteria | 4345 |
| 717 | Ga0495682_0016020 | 3300049460 | Bacteria | 2836 |
| 718 | Ga0501031_0192723 | 3300049568 | Bacteria | 1331 |
| 719 | Ga0501034_0000559 | 3300049571 | Bacteria | 58910 |
| 720 | Ga0501037_0063610 | 3300049573 | Bacteria | 2689 |
| 721 | Ga0501040_0012787 | 3300049576 | Bacteria | 5510 |
| 722 | Ga0501042_0081171 | 3300049578 | Bacteria | 2324 |
| 723 | Ga0501042_0316125 | 3300049578 | Bacteria | 1128 |
| 724 | Ga0501047_0062150 | 3300049581 | Bacteria | 3603 |
| 725 | Ga0501047_0069118 | 3300049581 | Bacteria | 3402 |
| 726 | Ga0501047_0332370 | 3300049581 | Bacteria | 1358 |
| 727 | Ga0501048_0035506 | 3300049582 | Bacteria | 3589 |
| 728 | Ga0501068_0000033 | 3300049584 | Bacteria | 51001 |
| 729 | Ga0501068_0011853 | 3300049584 | Bacteria | 4928 |
| 730 | Ga0501069_0000010 | 3300049585 | Bacteria | 154317 |
| 731 | Ga0501069_0002518 | 3300049585 | Bacteria | 9356 |
| 732 | Ga0501069_0005019 | 3300049585 | Bacteria | 6866 |
| 733 | Ga0501070_0000005 | 3300049586 | Bacteria | 250033 |
| 734 | Ga0501070_0001192 | 3300049586 | Bacteria | 23236 |
| 735 | Ga0501070_0021433 | 3300049586 | Bacteria | 5420 |
| 736 | Ga0501071_0071724 | 3300049587 | Bacteria | 2525 |
| 737 | Ga0501071_0122860 | 3300049587 | Bacteria | 1925 |
| 738 | Ga0501071_0153533 | 3300049587 | Bacteria | 1718 |
| 739 | Ga0501071_0156396 | 3300049587 | Bacteria | 1702 |
| 740 | Ga0501072_0003879 | 3300049588 | Bacteria | 11308 |
| 741 | Ga0501072_0027469 | 3300049588 | Bacteria | 4439 |
| 742 | Ga0501073_0002509 | 3300049589 | Bacteria | 13717 |
| 743 | Ga0501073_0009076 | 3300049589 | Bacteria | 7340 |
| 744 | Ga0501073_0017057 | 3300049589 | Bacteria | 5259 |
| 745 | Ga0501074_0005030 | 3300049590 | Bacteria | 9486 |
| 746 | Ga0501074_0027676 | 3300049590 | Bacteria | 4110 |
| 747 | Ga0501074_0111950 | 3300049590 | Bacteria | 1953 |
| 748 | Ga0501074_0270954 | 3300049590 | Bacteria | 1207 |
| 749 | Ga0501075_0003860 | 3300049591 | Bacteria | 10095 |
| 750 | Ga0501075_0012640 | 3300049591 | Bacteria | 6005 |
| 751 | Ga0501076_0088389 | 3300049592 | Bacteria | 2490 |
| 752 | Ga0501079_0003247 | 3300049741 | Bacteria | 11912 |
| 753 | Ga0501079_0040844 | 3300049741 | Unclassified | 3580 |
| 754 | Ga0501080_0018433 | 3300049742 | Bacteria | 6460 |
| 755 | Ga0501080_0083331 | 3300049742 | Bacteria | 2970 |
| 756 | Ga0501080_0146638 | 3300049742 | Bacteria | 2182 |
| 757 | Ga0501083_0004878 | 3300049744 | Bacteria | 9491 |
| 758 | Ga0501083_0006807 | 3300049744 | Bacteria | 8113 |
| 759 | nmdc:mga03n38_124845_c1 | 3300050490 | Bacteria | 1269 |
| 760 | nmdc:mga00v17_250077_c1 | 3300050491 | Bacteria | 1149 |
| 761 | nmdc:mga00v17_34262_c1 | 3300050491 | Bacteria | 3014 |
| 762 | nmdc:mga0yw44_1281_c1 | 3300050492 | Bacteria | 9912 |
| 763 | nmdc:mga0yw44_57274_c1 | 3300050492 | Bacteria | 2377 |
| 764 | nmdc:mga0k408_11551_c1 | 3300050493 | Bacteria | 4813 |
| 765 | nmdc:mga0k408_4514_c1 | 3300050493 | Bacteria | 7389 |
| 766 | nmdc:mga0k408_467_c1 | 3300050493 | Bacteria | 22231 |
| 767 | nmdc:mga05p37_70516_c1 | 3300050507 | Bacteria | 4298 |
| 768 | nmdc:mga0n895_256104_c1 | 3300050512 | Bacteria | 1776 |
| 769 | nmdc:mga0n895_63959_c1 | 3300050512 | Bacteria | 3638 |
| 770 | nmdc:mga0a205_8637_c1 | 3300050515 | Bacteria | 9269 |
| 771 | nmdc:mga0sz30_39823_c1 | 3300050516 | Bacteria | 1973 |
| 772 | Ga0495619_0085412 | 3300053085 | Bacteria | 2131 |
| 773 | Ga0500566_0007609 | 3300053094 | Bacteria | 6421 |
| 774 | Ga0500593_059822 | 3300053117 | Bacteria | 1676 |
| 775 | Ga0501084_0000517 | 3300054114 | Bacteria | 29536 |
| 776 | Ga0501084_0020197 | 3300054114 | Bacteria | 5552 |
| 777 | Ga0501084_0100307 | 3300054114 | Bacteria | 2431 |
| 778 | Ga0501084_0461511 | 3300054114 | Bacteria | 1074 |
| 779 | Ga0501082_0018429 | 3300060353 | Bacteria | 6013 |
| 780 | Ga0501082_0062527 | 3300060353 | Bacteria | 3205 |
| 781 | Ga0501082_0135658 | 3300060353 | Bacteria | 2135 |
| 782 | Ga0466962_0003300 | 3300061719 | Bacteria | 7667 |
| 783 | Ga0466962_0005580 | 3300061719 | Bacteria | 6039 |
| 784 | Ga0530510_0049273 | 3300061734 | Bacteria | 3044 |
| 785 | Ga0530510_0057750 | 3300061734 | Bacteria | 2805 |
| 786 | 2501076681 | 2501025501 | Bacteria | 7768574 |
| 787 | 2501082552 | 2501025502 | Bacteria | 9641094 |
| 788 | 2501408499 | 2501025504 | Bacteria | 8008976 |
| 789 | 2509131548 | 2508501125 | Bacteria | 7208311 |
| 790 | 2510250543 | 2510065045 | Bacteria | 7761063 |
| 791 | 2511086114 | 2510917013 | Bacteria | 9951648 |
| 792 | 2511096233 | 2510917014 | Bacteria | 8296963 |
| 793 | 2511103044 | 2510917015 | Bacteria | 7950052 |
| 794 | 2512346749 | 2512047030 | Bacteria | 9031815 |
| 795 | 2513556424 | 2513237082 | Bacteria | 8640282 |
| 796 | 2513564444 | 2513237083 | Bacteria | 8410967 |
| 797 | 2513963639 | 2513237151 | Bacteria | 6309801 |
| 798 | 2514053276 | 2513237166 | Bacteria | 10373764 |
| 799 | 2515680056 | 2515154122 | Bacteria | 8609520 |
| 800 | 2516024461 | 2515154189 | Bacteria | 9629850 |
| 801 | 2519459275 | 2519103095 | Bacteria | 6629912 |
| 802 | 2527079889 | 2526164713 | Bacteria | 6780608 |
| 803 | 2563063334 | 2562617112 | Bacteria | 10918404 |
| 804 | 2585295843 | 2582581311 | Bacteria | 6763856 |
| 805 | 2599742207 | 2599185239 | Bacteria | 8686614 |
| 806 | 2599749409 | 2599185240 | Bacteria | 7968121 |
| 807 | 2600211536 | 2599185355 | Bacteria | 7968906 |
| 808 | 2600810714 | 2600255067 | Bacteria | 6795583 |
| 809 | 2676747663 | 2675903129 | Bacteria | 7964495 |
| 810 | 2713477550 | 2711768613 | Bacteria | 11048459 |
| 811 | 2719639695 | 2718217991 | Bacteria | 7829542 |
| 812 | 2738824486 | 2738541296 | Bacteria | 7285013 |
| 813 | 2738836895 | 2738541298 | Bacteria | 7286732 |
| 814 | 2738878426 | 2738541306 | Bacteria | 7284992 |
| 815 | 2739190118 | 2738543002 | Bacteria | 7284546 |
| 816 | 2739225019 | 2738543008 | Bacteria | 7282815 |
| 817 | 2746086156 | 2744054900 | Bacteria | 8399525 |
| 818 | 2746094818 | 2744054901 | Bacteria | 8397047 |
| 819 | 2753570849 | 2751185846 | Bacteria | 7242164 |
| 820 | 2792840806 | 2791355137 | Bacteria | 9654227 |
| 821 | 2808974526 | 2808606384 | Bacteria | 8474373 |
| 822 | 2809009387 | 2808606390 | Bacteria | 8476311 |
| 823 | 2809016464 | 2808606391 | Bacteria | 8308166 |
| 824 | 2817261563 | 2816332253 | Bacteria | 6764532 |
| 825 | 2817279245 | 2816332256 | Bacteria | 6891714 |
| 826 | 2817452476 | 2816332286 | Bacteria | 6853759 |
| 827 | 2819624601 | 2818991450 | Bacteria | 6962147 |
| 828 | 2819631418 | 2818991452 | Bacteria | 8442785 |
| 829 | 2842332339 | 2842324504 | Bacteria | 9364110 |
| 830 | 2842356627 | 2842348783 | Bacteria | 9002918 |
| 831 | 2842461881 | 2842454564 | Bacteria | 8730687 |
| 832 | 2856292674 | 2856287931 | Bacteria | 7223934 |
| 833 | 2857360877 | 2857357740 | Bacteria | 9937880 |
| 834 | 2863428115 | 2863421361 | Bacteria | 7300805 |
| 835 | 2870070736 | 2870068957 | Bacteria | 8925310 |
| 836 | 2883087931 | 2883087390 | Bacteria | 9532701 |
| 837 | 2885278384 | 2885270888 | Bacteria | 9831543 |
| 838 | 2900635572 | 2900634093 | Bacteria | 10263517 |
| 839 | 2902688763 | 2902682994 | Bacteria | 8951596 |
| 840 | 2904485670 | 2904483920 | Bacteria | 7545285 |
| 841 | 2904571635 | 2904564687 | Bacteria | 7609577 |
| 842 | 2904578673 | 2904571731 | Bacteria | 7608790 |
| 843 | 2904618373 | 2904615490 | Bacteria | 10047340 |
| 844 | 2919533828 | 2919527303 | Bacteria | 7718827 |
| 845 | 2921650723 | 2921643360 | Bacteria | 11448031 |
| 846 | 2928110686 | 2928108538 | Bacteria | 7360024 |
| 847 | 2928140202 | 2928135762 | Bacteria | 7259641 |
| 848 | 2928162775 | 2928157003 | Bacteria | 7522202 |
| 849 | 2928169436 | 2928163908 | Bacteria | 7561269 |
| 850 | 2928178953 | 2928170801 | Bacteria | 8785406 |
| 851 | 2928505696 | 2928503688 | Bacteria | 7268108 |
| 852 | 2928543154 | 2928536128 | Bacteria | 7657547 |
| 853 | 2945936189 | 2945934425 | Bacteria | 7444609 |
| 854 | 2981997222 | 2981990288 | Bacteria | 7590678 |
| 855 | 2990709908 | 2990703756 | Bacteria | 7715990 |
| 856 | 642427435 | 641736151 | Bacteria | 7477263 |
| 857 | 642420527 | 641736154 | Bacteria | 7689995 |
| 858 | 642593750 | 642555112 | Bacteria | 8676562 |
| 859 | 642620957 | 642555113 | Bacteria | 8214658 |
| 860 | 8003960875 | 8003955200 | Bacteria | 8601927 |
| 861 | 8018852836 | 8018845410 | Bacteria | 8933938 |
| 862 | 8020813817 | 8020807995 | Bacteria | 6801506 |
| 863 | 8020942481 | 8020938398 | Bacteria | 7472757 |
| 864 | 8020952599 | 8020945358 | Bacteria | 8467355 |
| 865 | 8020958925 | 8020953355 | Bacteria | 7439080 |
| 866 | 8021121981 | 8021120328 | Bacteria | 8782274 |
| 867 | 8039104327 | 8039098773 | Bacteria | 6602928 |
| 868 | 8040173187 | 8040167225 | Bacteria | 6542727 |
| 869 | 8040178633 | 8040173305 | Bacteria | 6827067 |
| 870 | 8055271320 | 8055266321 | Bacteria | 7999742 |
| 871 | 8055303230 | 8055301274 | Bacteria | 8587385 |
| 872 | nmdc:mga00v17_192714_c1 | |||
| 873 | JGI24739J22299_10023103 | |||
| 874 | JGI24739J22299_10052858 | |||
| 875 | JGI25156J39149_1000699 | |||
| 876 | JGI25156J39149_1001586 | |||
| 877 | JGI25165J46597_1001672 | |||
| 878 | rootH2_10020431 | |||
| 879 | rootL2_10120394 | |||
| 880 | JGI25160J50197_1000176 | |||
| 881 | Ga0055533_1000115 | |||
| 882 | Ga0055533_1000295 | |||
| 883 | Ga0055533_1001385 | |||
| 884 | Ga0055532_1000055 | |||
| 885 | Ga0055532_1002459 | |||
| 886 | Ga0055532_1006639 | |||
| 887 | Ga0055532_1007106 | |||
| 888 | Ga0055527_1000030 | |||
| 889 | Ga0055527_1001931 | |||
| 890 | Ga0055535_1000038 | |||
| 891 | Ga0055535_1003937 | |||
| 892 | Ga0055535_1003988 | |||
| 893 | Ga0055542_1000063 | |||
| 894 | Ga0055542_1003837 | |||
| 895 | Ga0055542_1007116 | |||
| 896 | Ga0055529_1000071 | |||
| 897 | Ga0055529_1002271 | |||
| 898 | Ga0058692_1015022 | |||
| 899 | Ga0065165_1001993 | |||
| 900 | Ga0070658_10001803 | |||
| 901 | Ga0070658_10005160 | |||
| 902 | Ga0070658_10026579 | |||
| 903 | Ga0070658_10040481 | |||
| 904 | Ga0070676_10137038 | |||
| 905 | Ga0070690_100085532 | |||
| 906 | Ga0070670_100007152 | |||
| 907 | Ga0070677_10128494 | |||
| 908 | Ga0068869_100001855 | |||
| 909 | Ga0068869_100041020 | |||
| 910 | Ga0070666_10012676 | |||
| 911 | Ga0070666_10026746 | |||
| 912 | Ga0070666_10150718 | |||
| 913 | Ga0068868_100035657 | |||
| 914 | Ga0068868_100036971 | |||
| 915 | Ga0068868_100157461 | |||
| 916 | Ga0070660_100067315 | |||
| 917 | Ga0070660_100083083 | |||
| 918 | Ga0070689_100116466 | |||
| 919 | Ga0070689_100166946 | |||
| 920 | Ga0070661_100081011 | |||
| 921 | Ga0070661_100213121 | |||
| 922 | Ga0070668_100054030 | |||
| 923 | Ga0070669_100131527 | |||
| 924 | Ga0070675_100004408 | |||
| 925 | Ga0070674_100079715 | |||
| 926 | Ga0070674_100287934 | |||
| 927 | Ga0070673_100015615 | |||
| 928 | Ga0070673_100025146 | |||
| 929 | Ga0070688_100014913 | |||
| 930 | Ga0070688_100097084 | |||
| 931 | Ga0070659_100005265 | |||
| 932 | Ga0070659_100035384 | |||
| 933 | Ga0070659_100079058 | |||
| 934 | Ga0070659_100444014 | |||
| 935 | Ga0070667_100026964 | |||
| 936 | Ga0070667_100083974 | |||
| 937 | Ga0070667_100085922 | |||
| 938 | Ga0070667_100422876 | |||
| 939 | Ga0070709_10043780 | |||
| 940 | Ga0070709_10077889 | |||
| 941 | Ga0070714_100009479 | |||
| 942 | Ga0070714_100018047 | |||
| 943 | Ga0070714_100027642 | |||
| 944 | Ga0070713_100001234 | |||
| 945 | Ga0070713_100003076 | |||
| 946 | Ga0070713_100046858 | |||
| 947 | Ga0070705_100072203 | |||
| 948 | Ga0070700_100151046 | |||
| 949 | Ga0070663_100047783 | |||
| 950 | Ga0070663_100102242 | |||
| 951 | Ga0070678_100026374 | |||
| 952 | Ga0070662_100025893 | |||
| 953 | Ga0070681_10003759 | |||
| 954 | Ga0070681_10214990 | |||
| 955 | Ga0068867_100005803 | |||
| 956 | Ga0068867_100036328 | |||
| 957 | Ga0068867_100181510 | |||
| 958 | Ga0070685_10034429 | |||
| 959 | Ga0070699_100045007 | |||
| 960 | Ga0070679_100464760 | |||
| 961 | Ga0070679_100543074 | |||
| 962 | Ga0070684_100153996 | |||
| 963 | Ga0068853_100240948 | |||
| 964 | Ga0070672_100027074 | |||
| 965 | Ga0070693_100000556 | |||
| 966 | Ga0070693_100052133 | |||
| 967 | Ga0070665_100072838 | |||
| 968 | Ga0070665_100198103 | |||
| 969 | Ga0070665_100199775 | |||
| 970 | Ga0070704_100038661 | |||
| 971 | Ga0068855_100007084 | |||
| 972 | Ga0068855_100023145 | |||
| 973 | Ga0068855_100037529 | |||
| 974 | Ga0068855_100379276 | |||
| 975 | Ga0068856_100052656 | |||
| 976 | Ga0068856_100154492 | |||
| 977 | Ga0068852_100019417 | |||
| 978 | Ga0068852_100072662 | |||
| 979 | Ga0068852_100153771 | |||
| 980 | Ga0068852_100160200 | |||
| 981 | Ga0068852_100514389 | |||
| 982 | Ga0068859_100004344 | |||
| 983 | Ga0068859_100028508 | |||
| 984 | Ga0068859_100164596 | |||
| 985 | Ga0068859_100526879 | |||
| 986 | Ga0068864_100001630 | |||
| 987 | Ga0068864_100308240 | |||
| 988 | Ga0068866_10006390 | |||
| 989 | Ga0068866_10015134 | |||
| 990 | Ga0068866_10020974 | |||
| 991 | Ga0068861_100000216 | |||
| 992 | Ga0068851_10001738 | |||
| 993 | Ga0068870_10032489 | |||
| 994 | Ga0068863_100001897 | |||
| 995 | Ga0068863_100010160 | |||
| 996 | Ga0068858_100002185 | |||
| 997 | Ga0068858_100019968 | |||
| 998 | Ga0068858_100029613 | |||
| 999 | Ga0068858_100043547 | |||
| 1000 | Ga0068858_100064967 | |||
| 1001 | Ga0068858_100528526 | |||
| 1002 | Ga0068860_100102175 | |||
| 1003 | Ga0068860_100173619 | |||
| 1004 | Ga0068860_100489442 | |||
| 1005 | Ga0068862_100005857 | |||
| 1006 | Ga0068862_100085538 | |||
| 1007 | Ga0070717_10134803 | |||
| 1008 | Ga0075365_10003445 | |||
| 1009 | Ga0075365_10010772 | |||
| 1010 | Ga0075365_10067400 | |||
| 1011 | Ga0075365_10144663 | |||
| 1012 | Ga0075368_10008078 | |||
| 1013 | Ga0075363_100012431 | |||
| 1014 | Ga0070716_100019576 | |||
| 1015 | Ga0070716_100050292 | |||
| 1016 | Ga0075367_10011941 | |||
| 1017 | Ga0075366_10000934 | |||
| 1018 | Ga0075366_10035448 | |||
| 1019 | Ga0097621_100024432 | |||
| 1020 | Ga0075370_10223179 | |||
| 1021 | Ga0068871_100062659 | |||
| 1022 | Ga0075433_10145605 | |||
| 1023 | Ga0075434_100344013 | |||
| 1024 | Ga0075434_100380283 | |||
| 1025 | Ga0068865_100020352 | |||
| 1026 | Ga0068865_100308002 | |||
| 1027 | Ga0068865_100489548 | |||
| 1028 | Ga0097620_100004344 | |||
| 1029 | Ga0097620_100028509 | |||
| 1030 | Ga0097620_100164596 | |||
| 1031 | Ga0097620_100526887 | |||
| 1032 | Ga0105251_10000164 | |||
| 1033 | Ga0105250_10008849 | |||
| 1034 | Ga0105240_10000595 | |||
| 1035 | Ga0105240_10081508 | |||
| 1036 | Ga0105240_10143605 | |||
| 1037 | Ga0105240_10146839 | |||
| 1038 | Ga0105245_10079831 | |||
| 1039 | Ga0105245_10100350 | |||
| 1040 | Ga0105243_10032053 | |||
| 1041 | Ga0105243_10043792 | |||
| 1042 | Ga0105242_10008414 | |||
| 1043 | Ga0105242_10148766 | |||
| 1044 | Ga0105248_10057731 | |||
| 1045 | Ga0105248_10111694 | |||
| 1046 | Ga0105248_10124291 | |||
| 1047 | Ga0105248_10132322 | |||
| 1048 | Ga0105248_10346014 | |||
| 1049 | Ga0105237_10070814 | |||
| 1050 | Ga0105238_10002675 | |||
| 1051 | Ga0105238_10063799 | |||
| 1052 | Ga0105238_10616955 | |||
| 1053 | Ga0105239_10055981 | |||
| 1054 | Ga0157373_10046497 | |||
| 1055 | Ga0157370_10005459 | |||
| 1056 | Ga0157370_10006907 | |||
| 1057 | Ga0157369_10000059 | |||
| 1058 | Ga0157369_10000067 | |||
| 1059 | Ga0157369_10003432 | |||
| 1060 | Ga0157369_10045065 | |||
| 1061 | Ga0157369_10052130 | |||
| 1062 | Ga0157374_10254866 | |||
| 1063 | Ga0157378_10036796 | |||
| 1064 | Ga0157378_10200363 | |||
| 1065 | Ga0163162_10000707 | |||
| 1066 | Ga0163162_10097971 | |||
| 1067 | Ga0163162_10114385 | |||
| 1068 | Ga0157372_10010273 | |||
| 1069 | Ga0157372_10114930 | |||
| 1070 | Ga0157372_10145524 | |||
| 1071 | Ga0163163_10504430 | |||
| 1072 | Ga0157380_10047818 | |||
| 1073 | Ga0157380_10111436 | |||
| 1074 | Ga0182008_10035336 | |||
| 1075 | Ga0157377_10119048 | |||
| 1076 | Ga0157379_10000044 | |||
| 1077 | Ga0157379_10056174 | |||
| 1078 | Ga0157379_10121898 | |||
| 1079 | Ga0157379_10122191 | |||
| 1080 | Ga0157379_10125497 | |||
| 1081 | Ga0157379_10147547 | |||
| 1082 | Ga0157376_10036466 | |||
| 1083 | Ga0157376_10086274 | |||
| 1084 | Ga0157376_10307845 | |||
| 1085 | Ga0182007_10001108 | |||
| 1086 | Ga0182007_10010175 | |||
| 1087 | Ga0183361_10011 | |||
| 1088 | Ga0163161_10040984 | |||
| 1089 | Ga0206356_10949391 | |||
| 1090 | Ga0213872_10011643 | |||
| 1091 | Ga0224712_10000014 | |||
| 1092 | Ga0209566_102280 | |||
| 1093 | Ga0209674_100022 | |||
| 1094 | Ga0209674_100112 | |||
| 1095 | Ga0209672_100001 | |||
| 1096 | Ga0209672_100373 | |||
| 1097 | Ga0209672_100454 | |||
| 1098 | Ga0209147_100001 | |||
| 1099 | Ga0209147_100424 | |||
| 1100 | Ga0209147_100564 | |||
| 1101 | Ga0209147_100565 | |||
| 1102 | Ga0209563_100853 | |||
| 1103 | Ga0207427_103272 | |||
| 1104 | Ga0209258_100001 | |||
| 1105 | Ga0209258_100633 | |||
| 1106 | Ga0209258_100695 | |||
| 1107 | Ga0209148_1000003 | |||
| 1108 | Ga0209148_1000754 | |||
| 1109 | Ga0209148_1003947 | |||
| 1110 | Ga0209759_1000099 | |||
| 1111 | Ga0209759_1000125 | |||
| 1112 | Ga0209759_1000157 | |||
| 1113 | Ga0209759_1011456 | |||
| 1114 | Ga0209233_1000180 | |||
| 1115 | Ga0209455_1000001 | |||
| 1116 | Ga0209455_1000509 | |||
| 1117 | Ga0209455_1005335 | |||
| 1118 | Ga0209673_1008403 | |||
| 1119 | Ga0209130_1019356 | |||
| 1120 | Ga0209564_1004199 | |||
| 1121 | Ga0209564_1005992 | |||
| 1122 | Ga0207426_1000252 | |||
| 1123 | Ga0207713_1000526 | |||
| 1124 | Ga0207642_10019624 | |||
| 1125 | Ga0207647_10005852 | |||
| 1126 | Ga0207647_10024827 | |||
| 1127 | Ga0207645_10049017 | |||
| 1128 | Ga0207643_10053053 | |||
| 1129 | Ga0207705_10000771 | |||
| 1130 | Ga0207705_10005777 | |||
| 1131 | Ga0207705_10018066 | |||
| 1132 | Ga0207705_10331217 | |||
| 1133 | Ga0207654_10035572 | |||
| 1134 | Ga0207654_10220589 | |||
| 1135 | Ga0207707_10111785 | |||
| 1136 | Ga0207695_10002553 | |||
| 1137 | Ga0207695_10059296 | |||
| 1138 | Ga0207695_10139653 | |||
| 1139 | Ga0207695_10242581 | |||
| 1140 | Ga0207671_10032438 | |||
| 1141 | Ga0207671_10081863 | |||
| 1142 | Ga0207663_10134907 | |||
| 1143 | Ga0207657_10047904 | |||
| 1144 | Ga0207657_10206246 | |||
| 1145 | Ga0207657_10289226 | |||
| 1146 | Ga0207652_10257581 | |||
| 1147 | Ga0207681_10071735 | |||
| 1148 | Ga0207694_10036796 | |||
| 1149 | Ga0207694_10046338 | |||
| 1150 | Ga0207694_10303644 | |||
| 1151 | Ga0207650_10043615 | |||
| 1152 | Ga0207659_10014354 | |||
| 1153 | Ga0207687_10172790 | |||
| 1154 | Ga0207700_10000934 | |||
| 1155 | Ga0207700_10001721 | |||
| 1156 | Ga0207700_10075528 | |||
| 1157 | Ga0207664_10005619 | |||
| 1158 | Ga0207664_10020960 | |||
| 1159 | Ga0207690_10019878 | |||
| 1160 | Ga0207690_10022747 | |||
| 1161 | Ga0207690_10243308 | |||
| 1162 | Ga0207686_10010703 | |||
| 1163 | Ga0207686_10022272 | |||
| 1164 | Ga0207686_10072842 | |||
| 1165 | Ga0207709_10044027 | |||
| 1166 | Ga0207670_10048959 | |||
| 1167 | Ga0207670_10114900 | |||
| 1168 | Ga0207669_10146517 | |||
| 1169 | Ga0207665_10009637 | |||
| 1170 | Ga0207665_10036883 | |||
| 1171 | Ga0207691_10031621 | |||
| 1172 | Ga0207711_10007434 | |||
| 1173 | Ga0207711_10014343 | |||
| 1174 | Ga0207711_10054670 | |||
| 1175 | Ga0207711_10147800 | |||
| 1176 | Ga0207711_10172205 | |||
| 1177 | Ga0207689_10002193 | |||
| 1178 | Ga0207689_10014153 | |||
| 1179 | Ga0207689_10027428 | |||
| 1180 | Ga0207667_10000347 | |||
| 1181 | Ga0207667_10037059 | |||
| 1182 | Ga0207667_10088270 | |||
| 1183 | Ga0207667_10114477 | |||
| 1184 | Ga0207667_10219678 | |||
| 1185 | Ga0207667_10239669 | |||
| 1186 | Ga0207651_10008860 | |||
| 1187 | Ga0207651_10045804 | |||
| 1188 | Ga0207651_10045894 | |||
| 1189 | Ga0207712_10093236 | |||
| 1190 | Ga0207668_10073639 | |||
| 1191 | Ga0207640_10240884 | |||
| 1192 | Ga0207658_10031309 | |||
| 1193 | Ga0207658_10198378 | |||
| 1194 | Ga0207703_10001245 | |||
| 1195 | Ga0207703_10024604 | |||
| 1196 | Ga0207703_10041596 | |||
| 1197 | Ga0207703_10051592 | |||
| 1198 | Ga0207703_10268607 | |||
| 1199 | Ga0207639_10094905 | |||
| 1200 | Ga0207678_10044867 | |||
| 1201 | Ga0207678_10060999 | |||
| 1202 | Ga0207678_10067517 | |||
| 1203 | Ga0207678_10092259 | |||
| 1204 | Ga0207678_10105427 | |||
| 1205 | Ga0207708_10194582 | |||
| 1206 | Ga0207702_10301107 | |||
| 1207 | Ga0207641_10005674 | |||
| 1208 | Ga0207641_10043813 | |||
| 1209 | Ga0207641_10063138 | |||
| 1210 | Ga0207648_10005826 | |||
| 1211 | Ga0207648_10111319 | |||
| 1212 | Ga0207676_10005716 | |||
| 1213 | Ga0207674_10023627 | |||
| 1214 | Ga0207675_100000672 | |||
| 1215 | Ga0207675_100187777 | |||
| 1216 | Ga0207675_100484399 | |||
| 1217 | Ga0207683_10123613 | |||
| 1218 | Ga0207683_10141151 | |||
| 1219 | Ga0207683_10215619 | |||
| 1220 | Ga0207698_10051168 | |||
| 1221 | Ga0207698_10083165 | |||
| 1222 | Ga0207698_10193814 | |||
| 1223 | Ga0207698_10373212 | |||
| 1224 | Ga0207698_10425785 | |||
| 1225 | Ga0209371_1001698 | |||
| 1226 | Ga0268266_10163836 | |||
| 1227 | Ga0268265_10026894 | |||
| 1228 | Ga0268265_10152601 | |||
| 1229 | Ga0268264_10001103 | |||
| 1230 | Ga0265318_10002884 | |||
| 1231 | Ga0265338_10000104 | |||
| 1232 | Ga0265338_10076974 | |||
| 1233 | Ga0268256_1007215 | |||
| 1234 | Ga0265330_10001319 | |||
| 1235 | Ga0265325_10000403 | |||
| 1236 | Ga0265339_10013001 | |||
| 1237 | Ga0265339_10060246 | |||
| 1238 | Ga0265316_10002283 | |||
| 1239 | Ga0265316_10056370 | |||
| 1240 | Ga0307408_100154902 | |||
| 1241 | Ga0307408_100185513 | |||
| 1242 | Ga0265313_10003435 | |||
| 1243 | Ga0265342_10024858 | |||
| 1244 | Ga0316578_10064750 | |||
| 1245 | Ga0307405_10051272 | |||
| 1246 | Ga0307405_10128969 | |||
| 1247 | Ga0307412_10000054 | |||
| 1248 | Ga0307416_100246617 | |||
| 1249 | Ga0307416_100279912 | |||
| 1250 | Ga0373930_0004268 | |||
| 1251 | Ga0373930_0016747 | |||
| 1252 | Ga0373928_0000567 | |||
| 1253 | Ga0373929_0019040 | |||
| 1254 | Ga0373932_0000132 | |||
| 1255 | Ga0373955_0007760 | |||
| 1256 | Ga0316574_0014777 | |||
| 1257 | Ga0316574_0072172 | |||
| 1258 | Ga0316574_0213038 | |||
| 1259 | Ga0373924_0065430 | |||
| 1260 | Ga0373931_0000001 | |||
| 1261 | Ga0373931_0092653 | |||
| 1262 | Ga0373927_0010962 | |||
| 1263 | Ga0373937_0323312 | |||
| 1264 | Ga0316584_0185255 | |||
| 1265 | Ga0395899_0000029 | |||
| 1266 | Ga0395899_0078087 | |||
| 1267 | Ga0395899_0166640 | |||
| 1268 | Ga0395900_0000098 | |||
| 1269 | Ga0395900_0000196 | |||
| 1270 | Ga0395900_0140713 | |||
| 1271 | Ga0395900_0154138 | |||
| 1272 | Ga0395898_0000086 | |||
| 1273 | Ga0395898_0002206 | |||
| 1274 | Ga0395905_0000107 | |||
| 1275 | Ga0395905_0002228 | |||
| 1276 | Ga0395905_0030315 | |||
| 1277 | Ga0395905_0336558 | |||
| 1278 | Ga0395901_0000104 | |||
| 1279 | Ga0395901_0000137 | |||
| 1280 | Ga0395901_0181778 | |||
| 1281 | Ga0400483_124349 | |||
| 1282 | Ga0400483_281211 | |||
| 1283 | Ga0436361_0218373 | |||
| 1284 | Ga0436361_0667566 | |||
| 1285 | Ga0436361_0859276 | |||
| 1286 | Ga0439433_0033354 | |||
| 1287 | Ga0439460_0022663 | |||
| 1288 | Ga0451577_0001796 | |||
| 1289 | Ga0451577_0011238 | |||
| 1290 | Ga0451577_0011721 | |||
| 1291 | Ga0451577_0153558 | |||
| 1292 | Ga0451577_0168179 | |||
| 1293 | Ga0451577_0230519 | |||
| 1294 | Ga0466969_0000707 | |||
| 1295 | Ga0466972_0009212 | |||
| 1296 | Ga0466973_0038994 | |||
| 1297 | Ga0453683_0039993 | |||
| 1298 | Ga0453683_0070147 | |||
| 1299 | Ga0453683_0101012 | |||
| 1300 | Ga0453683_0159296 | |||
| 1301 | Ga0453683_0208645 | |||
| 1302 | Ga0466965_0003560 | |||
| 1303 | Ga0466965_0040842 | |||
| 1304 | Ga0466965_0110897 | |||
| 1305 | Ga0466966_0000005 | |||
| 1306 | Ga0466966_0022936 | |||
| 1307 | Ga0466966_0038146 | |||
| 1308 | Ga0466966_0054667 | |||
| 1309 | Ga0466966_0145425 | |||
| 1310 | Ga0466966_0160371 | |||
| 1311 | Ga0466961_0001666 | |||
| 1312 | Ga0466961_0006747 | |||
| 1313 | Ga0466961_0060153 | |||
| 1314 | Ga0466961_0084792 | |||
| 1315 | Ga0466961_0099566 | |||
| 1316 | Ga0466963_0005666 | |||
| 1317 | Ga0466963_0011265 | |||
| 1318 | Ga0466963_0020762 | |||
| 1319 | Ga0466964_0001910 | |||
| 1320 | Ga0453684_0000007 | |||
| 1321 | Ga0453684_0000056 | |||
| 1322 | Ga0453684_0003522 | |||
| 1323 | Ga0453684_0007475 | |||
| 1324 | Ga0453684_0011550 | |||
| 1325 | Ga0453684_0012139 | |||
| 1326 | Ga0453684_0059665 | |||
| 1327 | Ga0453684_0129316 | |||
| 1328 | Ga0453684_0446996 | |||
| 1329 | Ga0466971_0006197 | |||
| 1330 | Ga0466971_0047654 | |||
| 1331 | Ga0466968_0048030 | |||
| 1332 | Ga0466970_0123469 | |||
| 1333 | Ga0466957_0001296 | |||
| 1334 | Ga0466957_0002597 | |||
| 1335 | Ga0466957_0007806 | |||
| 1336 | Ga0466957_0025440 | |||
| 1337 | Ga0466957_0043283 | |||
| 1338 | Ga0466957_0158137 | |||
| 1339 | Ga0466960_0012676 | |||
| 1340 | Ga0466959_0012397 | |||
| 1341 | Ga0466959_0015649 | |||
| 1342 | Ga0451576_0000192 | |||
| 1343 | Ga0451576_0000829 | |||
| 1344 | Ga0451576_0001119 | |||
| 1345 | Ga0451576_0011393 | |||
| 1346 | Ga0451576_0123113 | |||
| 1347 | Ga0451576_0149959 | |||
| 1348 | Ga0451576_0348181 | |||
| 1349 | Ga0466958_0002607 | |||
| 1350 | Ga0466958_0013951 | |||
| 1351 | Ga0466958_0021290 | |||
| 1352 | Ga0466958_0094609 | |||
| 1353 | Ga0466958_0121786 | |||
| 1354 | Ga0495592_0018445 | |||
| 1355 | Ga0495592_0019113 | |||
| 1356 | Ga0495592_0047416 | |||
| 1357 | Ga0495603_0001492 | |||
| 1358 | Ga0495590_0021858 | |||
| 1359 | Ga0495591_001173 | |||
| 1360 | Ga0495629_0002860 | |||
| 1361 | Ga0495629_0006339 | |||
| 1362 | Ga0495629_0007060 | |||
| 1363 | Ga0495638_0003196 | |||
| 1364 | Ga0495638_0006860 | |||
| 1365 | Ga0495641_0079357 | |||
| 1366 | Ga0495651_0008582 | |||
| 1367 | Ga0495653_0002493 | |||
| 1368 | Ga0495653_0003241 | |||
| 1369 | Ga0495653_0010264 | |||
| 1370 | Ga0495653_0079027 | |||
| 1371 | Ga0495653_0081128 | |||
| 1372 | Ga0495653_0150723 | |||
| 1373 | Ga0495650_0012432 | |||
| 1374 | Ga0495580_0005037 | |||
| 1375 | Ga0495580_0005977 | |||
| 1376 | Ga0495580_0008862 | |||
| 1377 | Ga0495580_0013075 | |||
| 1378 | Ga0495580_0031201 | |||
| 1379 | Ga0495582_0006253 | |||
| 1380 | Ga0495582_0016675 | |||
| 1381 | Ga0495582_0060829 | |||
| 1382 | Ga0495605_0003102 | |||
| 1383 | Ga0495605_0008110 | |||
| 1384 | Ga0495605_0010240 | |||
| 1385 | Ga0495662_0012041 | |||
| 1386 | Ga0495662_0023367 | |||
| 1387 | Ga0495664_0000998 | |||
| 1388 | Ga0495664_0002627 | |||
| 1389 | Ga0495596_0006417 | |||
| 1390 | Ga0495596_0007366 | |||
| 1391 | Ga0495596_0013157 | |||
| 1392 | Ga0495583_0005795 | |||
| 1393 | Ga0495583_0039286 | |||
| 1394 | Ga0495606_0017601 | |||
| 1395 | Ga0495608_0001733 | |||
| 1396 | Ga0495608_0005902 | |||
| 1397 | Ga0495608_0073808 | |||
| 1398 | Ga0495610_0002328 | |||
| 1399 | Ga0495616_0062177 | |||
| 1400 | Ga0495618_0005279 | |||
| 1401 | Ga0495618_0017149 | |||
| 1402 | Ga0495618_0021892 | |||
| 1403 | Ga0495618_0091188 | |||
| 1404 | Ga0495620_0038514 | |||
| 1405 | Ga0495620_0076897 | |||
| 1406 | Ga0495628_0003132 | |||
| 1407 | Ga0495628_0016423 | |||
| 1408 | Ga0495628_0051819 | |||
| 1409 | Ga0495628_0060380 | |||
| 1410 | Ga0495628_0061020 | |||
| 1411 | Ga0495628_0117665 | |||
| 1412 | Ga0495628_0131392 | |||
| 1413 | Ga0495630_0011646 | |||
| 1414 | Ga0495630_0020586 | |||
| 1415 | Ga0495630_0074633 | |||
| 1416 | Ga0495648_0015959 | |||
| 1417 | Ga0495648_0023219 | |||
| 1418 | Ga0495648_0027977 | |||
| 1419 | Ga0495666_0001172 | |||
| 1420 | Ga0495666_0001884 | |||
| 1421 | Ga0495666_0001892 | |||
| 1422 | Ga0495642_0086541 | |||
| 1423 | Ga0495652_0006806 | |||
| 1424 | Ga0495652_0012881 | |||
| 1425 | Ga0495652_0022650 | |||
| 1426 | Ga0495665_0002407 | |||
| 1427 | Ga0495665_0002948 | |||
| 1428 | Ga0495665_0011102 | |||
| 1429 | Ga0495640_0012698 | |||
| 1430 | Ga0495640_0017072 | |||
| 1431 | Ga0495586_0011268 | |||
| 1432 | Ga0495586_0023915 | |||
| 1433 | Ga0495586_0031698 | |||
| 1434 | Ga0495587_0003605 | |||
| 1435 | Ga0495645_0002890 | |||
| 1436 | Ga0495622_0002306 | |||
| 1437 | Ga0495622_0049758 | |||
| 1438 | Ga0495667_0072591 | |||
| 1439 | Ga0495634_0002770 | |||
| 1440 | Ga0495634_0012419 | |||
| 1441 | Ga0495634_0080951 | |||
| 1442 | Ga0495611_0012801 | |||
| 1443 | Ga0495635_0002838 | |||
| 1444 | Ga0495635_0012550 | |||
| 1445 | Ga0495635_0201222 | |||
| 1446 | Ga0495661_0002331 | |||
| 1447 | Ga0495661_0009682 | |||
| 1448 | Ga0495661_0041284 | |||
| 1449 | Ga0495657_0013783 | |||
| 1450 | Ga0495657_0066709 | |||
| 1451 | Ga0495657_0169029 | |||
| 1452 | Ga0495657_0270112 | |||
| 1453 | Ga0495599_0022153 | |||
| 1454 | Ga0495623_0015547 | |||
| 1455 | Ga0495646_0001230 | |||
| 1456 | Ga0495646_0004523 | |||
| 1457 | Ga0495646_0025145 | |||
| 1458 | Ga0495669_0015313 | |||
| 1459 | Ga0495669_0026475 | |||
| 1460 | Ga0495613_0002243 | |||
| 1461 | Ga0495613_0015727 | |||
| 1462 | Ga0495613_0049041 | |||
| 1463 | Ga0495624_0002882 | |||
| 1464 | Ga0495624_0011558 | |||
| 1465 | Ga0495624_0095898 | |||
| 1466 | Ga0495670_0012440 | |||
| 1467 | Ga0495649_0017196 | |||
| 1468 | Ga0495589_0017215 | |||
| 1469 | Ga0495589_0113375 | |||
| 1470 | Ga0495600_0001140 | |||
| 1471 | Ga0495600_0041387 | |||
| 1472 | Ga0495600_0204231 | |||
| 1473 | Ga0495660_0067323 | |||
| 1474 | Ga0495581_0001962 | |||
| 1475 | Ga0495581_0006868 | |||
| 1476 | Ga0495604_0002319 | |||
| 1477 | Ga0495604_0012572 | |||
| 1478 | Ga0495604_0013874 | |||
| 1479 | Ga0495604_0075157 | |||
| 1480 | Ga0495674_0005769 | |||
| 1481 | Ga0495674_0013154 | |||
| 1482 | Ga0495674_0033647 | |||
| 1483 | Ga0495674_0270421 | |||
| 1484 | Ga0495672_0011901 | |||
| 1485 | Ga0495672_0017178 | |||
| 1486 | Ga0495672_0050341 | |||
| 1487 | Ga0495676_0002156 | |||
| 1488 | Ga0495676_0019012 | |||
| 1489 | Ga0495676_0042612 | |||
| 1490 | Ga0495676_0123569 | |||
| 1491 | Ga0495680_0003344 | |||
| 1492 | Ga0495680_0003961 | |||
| 1493 | Ga0495680_0023699 | |||
| 1494 | Ga0495680_0051553 | |||
| 1495 | Ga0495683_0004640 | |||
| 1496 | Ga0495683_0009341 | |||
| 1497 | Ga0495683_0009690 | |||
| 1498 | Ga0495683_0065755 | |||
| 1499 | Ga0495687_007357 | |||
| 1500 | Ga0495687_011859 | |||
| 1501 | Ga0495687_012450 | |||
| 1502 | Ga0495687_017589 | |||
| 1503 | Ga0495675_0001442 | |||
| 1504 | Ga0495675_0004332 | |||
| 1505 | Ga0495675_0004681 | |||
| 1506 | Ga0495677_0040387 | |||
| 1507 | Ga0495679_000399 | |||
| 1508 | Ga0495679_000514 | |||
| 1509 | Ga0495679_000737 | |||
| 1510 | Ga0495673_0005498 | |||
| 1511 | Ga0495673_0006064 | |||
| 1512 | Ga0495684_0115330 | |||
| 1513 | Ga0495684_0194463 | |||
| 1514 | Ga0495686_0000076 | |||
| 1515 | Ga0495593_0003425 | |||
| 1516 | Ga0495593_0003829 | |||
| 1517 | Ga0495593_0008127 | |||
| 1518 | Ga0495593_0057294 | |||
| 1519 | Ga0495602_0004536 | |||
| 1520 | Ga0495602_0011568 | |||
| 1521 | Ga0495602_0027460 | |||
| 1522 | Ga0495602_0072371 | |||
| 1523 | Ga0495602_0107796 | |||
| 1524 | Ga0495614_0001762 | |||
| 1525 | Ga0495626_0010364 | |||
| 1526 | Ga0496100_0071924 | |||
| 1527 | Ga0496101_0001769 | |||
| 1528 | Ga0496101_0024446 | |||
| 1529 | Ga0496101_0064829 | |||
| 1530 | Ga0496101_0320787 | |||
| 1531 | Ga0496102_0003988 | |||
| 1532 | Ga0496102_0015741 | |||
| 1533 | Ga0496102_0050204 | |||
| 1534 | Ga0496103_0002668 | |||
| 1535 | Ga0496103_0029652 | |||
| 1536 | Ga0496104_0009080 | |||
| 1537 | Ga0496104_0042296 | |||
| 1538 | Ga0496104_0188710 | |||
| 1539 | Ga0496105_0073706 | |||
| 1540 | Ga0496105_0133127 | |||
| 1541 | Ga0496106_0000301 | |||
| 1542 | Ga0496106_0056502 | |||
| 1543 | Ga0496106_0228121 | |||
| 1544 | Ga0496107_0044666 | |||
| 1545 | Ga0496107_0053687 | |||
| 1546 | Ga0496108_0073486 | |||
| 1547 | Ga0496108_0237794 | |||
| 1548 | Ga0496109_0213459 | |||
| 1549 | Ga0496110_0064675 | |||
| 1550 | Ga0496110_0231393 | |||
| 1551 | Ga0496112_0005293 | |||
| 1552 | Ga0496112_0134950 | |||
| 1553 | Ga0496113_0064725 | |||
| 1554 | Ga0496113_0105470 | |||
| 1555 | Ga0496114_0064580 | |||
| 1556 | Ga0496114_0101879 | |||
| 1557 | Ga0496114_0295716 | |||
| 1558 | Ga0496115_0100087 | |||
| 1559 | Ga0496116_0020190 | |||
| 1560 | Ga0496116_0025219 | |||
| 1561 | Ga0496116_0080793 | |||
| 1562 | Ga0496117_0003049 | |||
| 1563 | Ga0496117_0004615 | |||
| 1564 | Ga0496117_0012097 | |||
| 1565 | Ga0496117_0016129 | |||
| 1566 | Ga0496117_0022931 | |||
| 1567 | Ga0496117_0074363 | |||
| 1568 | Ga0496118_0001753 | |||
| 1569 | Ga0496118_0003700 | |||
| 1570 | Ga0496118_0006470 | |||
| 1571 | Ga0496118_0006753 | |||
| 1572 | Ga0496118_0031206 | |||
| 1573 | Ga0496118_0033101 | |||
| 1574 | Ga0496121_0004965 | |||
| 1575 | Ga0496121_0006290 | |||
| 1576 | Ga0496121_0006544 | |||
| 1577 | Ga0496121_0039725 | |||
| 1578 | Ga0496121_0075755 | |||
| 1579 | Ga0496124_0099954 | |||
| 1580 | Ga0496126_0000263 | |||
| 1581 | Ga0496126_0003028 | |||
| 1582 | Ga0496126_0007901 | |||
| 1583 | Ga0496126_0031426 | |||
| 1584 | Ga0496126_0045435 | |||
| 1585 | Ga0496126_0066680 | |||
| 1586 | Ga0496126_0126367 | |||
| 1587 | Ga0495682_0007462 | |||
| 1588 | Ga0495682_0016020 | |||
| 1589 | Ga0501031_0192723 | |||
| 1590 | Ga0501034_0000559 | |||
| 1591 | Ga0501037_0063610 | |||
| 1592 | Ga0501040_0012787 | |||
| 1593 | Ga0501042_0081171 | |||
| 1594 | Ga0501042_0316125 | |||
| 1595 | Ga0501047_0062150 | |||
| 1596 | Ga0501047_0069118 | |||
| 1597 | Ga0501047_0332370 | |||
| 1598 | Ga0501048_0035506 | |||
| 1599 | Ga0501068_0000033 | |||
| 1600 | Ga0501068_0011853 | |||
| 1601 | Ga0501069_0000010 | |||
| 1602 | Ga0501069_0002518 | |||
| 1603 | Ga0501069_0005019 | |||
| 1604 | Ga0501070_0000005 | |||
| 1605 | Ga0501070_0001192 | |||
| 1606 | Ga0501070_0021433 | |||
| 1607 | Ga0501071_0071724 | |||
| 1608 | Ga0501071_0122860 | |||
| 1609 | Ga0501071_0153533 | |||
| 1610 | Ga0501071_0156396 | |||
| 1611 | Ga0501072_0003879 | |||
| 1612 | Ga0501072_0027469 | |||
| 1613 | Ga0501073_0002509 | |||
| 1614 | Ga0501073_0009076 | |||
| 1615 | Ga0501073_0017057 | |||
| 1616 | Ga0501074_0005030 | |||
| 1617 | Ga0501074_0027676 | |||
| 1618 | Ga0501074_0111950 | |||
| 1619 | Ga0501074_0270954 | |||
| 1620 | Ga0501075_0003860 | |||
| 1621 | Ga0501075_0012640 | |||
| 1622 | Ga0501076_0088389 | |||
| 1623 | Ga0501079_0003247 | |||
| 1624 | Ga0501079_0040844 | |||
| 1625 | Ga0501080_0018433 | |||
| 1626 | Ga0501080_0083331 | |||
| 1627 | Ga0501080_0146638 | |||
| 1628 | Ga0501083_0004878 | |||
| 1629 | Ga0501083_0006807 | |||
| 1630 | nmdc:mga03n38_124845_c1 | |||
| 1631 | nmdc:mga00v17_250077_c1 | |||
| 1632 | nmdc:mga00v17_34262_c1 | |||
| 1633 | nmdc:mga0yw44_1281_c1 | |||
| 1634 | nmdc:mga0yw44_57274_c1 | |||
| 1635 | nmdc:mga0k408_11551_c1 | |||
| 1636 | nmdc:mga0k408_4514_c1 | |||
| 1637 | nmdc:mga0k408_467_c1 | |||
| 1638 | nmdc:mga05p37_70516_c1 | |||
| 1639 | nmdc:mga0n895_256104_c1 | |||
| 1640 | nmdc:mga0n895_63959_c1 | |||
| 1641 | nmdc:mga0a205_8637_c1 | |||
| 1642 | nmdc:mga0sz30_39823_c1 | |||
| 1643 | Ga0495619_0085412 | |||
| 1644 | Ga0500566_0007609 | |||
| 1645 | Ga0500593_059822 | |||
| 1646 | Ga0501084_0000517 | |||
| 1647 | Ga0501084_0020197 | |||
| 1648 | Ga0501084_0100307 | |||
| 1649 | Ga0501084_0461511 | |||
| 1650 | Ga0501082_0018429 | |||
| 1651 | Ga0501082_0062527 | |||
| 1652 | Ga0501082_0135658 | |||
| 1653 | Ga0466962_0003300 | |||
| 1654 | Ga0466962_0005580 | |||
| 1655 | Ga0530510_0049273 | |||
| 1656 | Ga0530510_0057750 | |||
| 1657 | 2501076681 | |||
| 1658 | 2501082552 | |||
| 1659 | 2501408499 | |||
| 1660 | 2509131548 | |||
| 1661 | 2510250543 | |||
| 1662 | 2511086114 | |||
| 1663 | 2511096233 | |||
| 1664 | 2511103044 | |||
| 1665 | 2512346749 | |||
| 1666 | 2513556424 | |||
| 1667 | 2513564444 | |||
| 1668 | 2513963639 | |||
| 1669 | 2514053276 | |||
| 1670 | 2515680056 | |||
| 1671 | 2516024461 | |||
| 1672 | 2519459275 | |||
| 1673 | 2527079889 | |||
| 1674 | 2563063334 | |||
| 1675 | 2585295843 | |||
| 1676 | 2599742207 | |||
| 1677 | 2599749409 | |||
| 1678 | 2600211536 | |||
| 1679 | 2600810714 | |||
| 1680 | 2676747663 | |||
| 1681 | 2713477550 | |||
| 1682 | 2719639695 | |||
| 1683 | 2738824486 | |||
| 1684 | 2738836895 | |||
| 1685 | 2738878426 | |||
| 1686 | 2739190118 | |||
| 1687 | 2739225019 | |||
| 1688 | 2746086156 | |||
| 1689 | 2746094818 | |||
| 1690 | 2753570849 | |||
| 1691 | 2792840806 | |||
| 1692 | 2808974526 | |||
| 1693 | 2809009387 | |||
| 1694 | 2809016464 | |||
| 1695 | 2817261563 | |||
| 1696 | 2817279245 | |||
| 1697 | 2817452476 | |||
| 1698 | 2819624601 | |||
| 1699 | 2819631418 | |||
| 1700 | 2842332339 | |||
| 1701 | 2842356627 | |||
| 1702 | 2842461881 | |||
| 1703 | 2856292674 | |||
| 1704 | 2857360877 | |||
| 1705 | 2863428115 | |||
| 1706 | 2870070736 | |||
| 1707 | 2883087931 | |||
| 1708 | 2885278384 | |||
| 1709 | 2900635572 | |||
| 1710 | 2902688763 | |||
| 1711 | 2904485670 | |||
| 1712 | 2904571635 | |||
| 1713 | 2904578673 | |||
| 1714 | 2904618373 | |||
| 1715 | 2919533828 | |||
| 1716 | 2921650723 | |||
| 1717 | 2928110686 | |||
| 1718 | 2928140202 | |||
| 1719 | 2928162775 | |||
| 1720 | 2928169436 | |||
| 1721 | 2928178953 | |||
| 1722 | 2928505696 | |||
| 1723 | 2928543154 | |||
| 1724 | 2945936189 | |||
| 1725 | 2981997222 | |||
| 1726 | 2990709908 | |||
| 1727 | 642427435 | |||
| 1728 | 642420527 | |||
| 1729 | 642593750 | |||
| 1730 | 642620957 | |||
| 1731 | 8003960875 | |||
| 1732 | 8018852836 | |||
| 1733 | 8020813817 | |||
| 1734 | 8020942481 | |||
| 1735 | 8020952599 | |||
| 1736 | 8020958925 | |||
| 1737 | 8021121981 | |||
| 1738 | 8039104327 | |||
| 1739 | 8040173187 | |||
| 1740 | 8040178633 | |||
| 1741 | 8055271320 | |||
| 1742 | 8055303230 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3eb3-assembly1.cif.gz_A | voltage-dependent k+ channel beta subunit (w121a) in complex with cortisone | 0.971 | 1 | 320 |
| 3eb4-assembly1.cif.gz_A | voltage-dependent k+ channel beta subunit (i211r) in complex with cortisone | 0.97 | 1 | 320 |
| 7wf3-assembly1.cif.gz_C | composite map of human kv1.3 channel in apo state with beta subunits | 0.9633 | 3 | 320 |
| 3eb3-assembly1.cif.gz_A | voltage-dependent k+ channel beta subunit (w121a) in complex with cortisone | 0.9592 | 1 | 320 |
| 3eb4-assembly1.cif.gz_A | voltage-dependent k+ channel beta subunit (i211r) in complex with cortisone | 0.9582 | 1 | 320 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C4J2K0_1_323_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9765 | 1 | 320 | 3.20.20.100 |
| af_E9QGU5_66_406_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9709 | 1 | 320 | 3.20.20.100 |
| af_P97382_23_247_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9661 | 106 | 320 | 3.20.20.100 |
| af_E9QGU5_66_406_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9591 | 1 | 320 | 3.20.20.100 |
| af_O59826_13_339_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9583 | 1 | 318 | 3.20.20.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382BNH0-F1-model_v4 | NADP-dependent oxidoreductase domain-containing protein | 0.9873 | 1 | 170 |
GO:0016491
|
| AF-A0A7C7GQV1-F1-model_v4 | deleted | 0.9871 | 1 | 176 |
|
| AF-A0A7J6WMD8-F1-model_v4 | Voltage-gated potassium channel subunit beta-1 | 0.9865 | 1 | 194 |
GO:0016491
GO:0034220 |
| AF-A0A2U2SJ32-F1-model_v4 | Aldo/keto reductase | 0.9857 | 1 | 320 |
GO:0016491
|
| AF-A0A821WSN5-F1-model_v4 | NADP-dependent oxidoreductase domain-containing protein | 0.9802 | 1 | 193 |
GO:0008076
GO:0015459 GO:0016491 GO:0044325 GO:1901379 |