F484206

General Info

Members Datasets Scaffolds Average Seq Length
871 414 1742 287

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_312467_c1|nmdc:mga05p37_312467_c1_841_1719
Length 279
Sequence MGALANHAFVKMNGLGNEIVVVDMRRQPAAISAAEARAAAQPDGAPYDQLMALYPPRTAGTDSYVRIYNSDGSESGACGNGMRCIASLITKETGKDTATFEVDGRVLNCWKHANTGLFTVDMGAPRFAWNEIPLAEKFNDTRKIELQIGPIDKPILHSPSAVNMGNPHAIFWVADVNAYDLGKVGPLLEHHPMFPQRANITLCAVKSPEHIEIRTWERGAGLTKACGSATGRKLKVTLPGGDLAVEWRERDSHVLMTGPVEYEYEGTFDPALFAKMGAA

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
94 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
95 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
110 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
124 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
141 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
142 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
214 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
215 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
216 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
217 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
218 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
219 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
220 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
221 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
222 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
223 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
224 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
225 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
226 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
227 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
228 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
229 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
230 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
231 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
232 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
233 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
234 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
235 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
236 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
238 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
239 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
240 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
241 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
242 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
243 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
244 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
245 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
246 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
247 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
248 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
249 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
250 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
251 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
252 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
253 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
254 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
255 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
256 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
257 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
258 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
259 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
260 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
261 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
262 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
263 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
264 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
265 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
266 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
267 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
268 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
269 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
270 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
271 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
272 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
273 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
274 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
275 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
276 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
277 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
278 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
279 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
280 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
281 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
282 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
283 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
284 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
285 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
286 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
287 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
288 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
289 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
290 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
291 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
292 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
293 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
294 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
295 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
296 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
297 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
298 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
299 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
300 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
301 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
302 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
303 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
304 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
305 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
306 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
307 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
308 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
309 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
310 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
311 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
312 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
313 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
314 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
315 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
316 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
317 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
318 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
319 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
320 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
321 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
322 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
323 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
324 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
325 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
326 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
327 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
328 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
329 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
330 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
331 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
332 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
333 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
334 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
335 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
336 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
337 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
338 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
339 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
340 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
341 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
342 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
343 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
344 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
345 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
346 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
347 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
348 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
349 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
350 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
351 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
352 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
353 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
354 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
367 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
368 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
369 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
370 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
371 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
372 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
373 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
374 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
375 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
376 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
377 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
378 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
379 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
380 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
383 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
384 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
385 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
386 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
387 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
388 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
389 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
390 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
391 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
392 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
393 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
394 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
395 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
396 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
397 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
398 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
399 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
400 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
401 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
402 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
403 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
404 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
405 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
406 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
407 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
408 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
409 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
410 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
411 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
412 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
413 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
414 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.11
Isolates 0.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.36
Nodule 0
Rhizoplane 6.43
Rhizosphere 88.17
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_312467_c1 3300050507 Bacteria 1862
2 2214750793 2209111006 Bacteria 3272
3 ARcpr5oldR_c000008 3300000041 Bacteria 40651
4 ARSoilYngRDRAFT_c00021 3300000042 Bacteria 23635
5 ARcpr5yngRDRAFT_c000269 3300000043 Bacteria 7452
6 ARSoilOldRDRAFT_c000004 3300000044 Bacteria 62556
7 ARCol0oldRDRAFT_c00519 3300000045 Bacteria 3501
8 ARCol0yngRDRAFT_1000405 3300000652 Bacteria 5751
9 JGI24739J22299_10000119 3300001989 Bacteria 24437
10 JGI24737J22298_10016402 3300001990 Bacteria 2391
11 JGI24738J21930_10000653 3300002075 Bacteria 10027
12 JGI24749J21850_1000821 3300002076 Bacteria 4457
13 JGI24744J21845_10000855 3300002077 Bacteria 5755
14 JGI24034J26672_10002428 3300002239 Bacteria 2561
15 JGI25153J46596_10001550 3300003215 Bacteria 13655
16 JGI25405J52794_10003987 3300003911 Bacteria 2615
17 Ga0065716_1001943 3300005277 Bacteria 2685
18 Ga0065704_10082626 3300005289 Bacteria 3574
19 Ga0065712_10002667 3300005290 Bacteria 6357
20 Ga0065712_10071402 3300005290 Bacteria 5290
21 Ga0065715_10002782 3300005293 Bacteria 7282
22 Ga0070658_10014072 3300005327 Bacteria 6424
23 Ga0070683_100015125 3300005329 Bacteria 6772
24 Ga0070683_100230825 3300005329 Bacteria 1759
25 Ga0070690_100016228 3300005330 Bacteria 4457
26 Ga0070690_100091164 3300005330 Bacteria 2008
27 Ga0070670_100002160 3300005331 Bacteria 16146
28 Ga0068869_100004994 3300005334 Bacteria 8305
29 Ga0070666_10039476 3300005335 Bacteria 3147
30 Ga0070680_100003115 3300005336 Bacteria 12309
31 Ga0070680_100006411 3300005336 Bacteria 8939
32 Ga0070680_100017168 3300005336 Bacteria 5703
33 Ga0070682_100008882 3300005337 Bacteria 5675
34 Ga0068868_100123546 3300005338 Bacteria 2112
35 Ga0070660_100002712 3300005339 Bacteria 12162
36 Ga0070660_100008655 3300005339 Bacteria 7128
37 Ga0070660_100070972 3300005339 Bacteria 2719
38 Ga0070689_100007061 3300005340 Bacteria 7818
39 Ga0070689_100016827 3300005340 Bacteria 5359
40 Ga0070689_100037360 3300005340 Bacteria 3713
41 Ga0070691_10000519 3300005341 Bacteria 14524
42 Ga0070687_100000762 3300005343 Bacteria 10689
43 Ga0070661_100004148 3300005344 Bacteria 9994
44 Ga0070661_100445464 3300005344 Bacteria 1030
45 Ga0070692_10006740 3300005345 Bacteria 5006
46 Ga0070668_100097991 3300005347 Bacteria 2319
47 Ga0070669_100009605 3300005353 Bacteria 6888
48 Ga0070675_100004458 3300005354 Bacteria 10679
49 Ga0070671_100002139 3300005355 Bacteria 15248
50 Ga0070671_100014975 3300005355 Bacteria 6263
51 Ga0070671_100323004 3300005355 Bacteria 1315
52 Ga0070674_100003695 3300005356 Bacteria 8622
53 Ga0070674_100011100 3300005356 Bacteria 5470
54 Ga0070674_100054945 3300005356 Bacteria 2756
55 Ga0070673_100000278 3300005364 Bacteria 26473
56 Ga0070673_100129073 3300005364 Bacteria 2118
57 Ga0070688_100002472 3300005365 Bacteria 9344
58 Ga0070688_100022886 3300005365 Bacteria 3669
59 Ga0070659_100016217 3300005366 Bacteria 5591
60 Ga0070667_100037839 3300005367 Bacteria 4045
61 Ga0070667_100309820 3300005367 Bacteria 1423
62 Ga0070703_10006001 3300005406 Bacteria 3400
63 Ga0070709_10007640 3300005434 Bacteria 5933
64 Ga0070709_10061034 3300005434 Bacteria 2399
65 Ga0070714_100065202 3300005435 Bacteria 3137
66 Ga0070714_100102072 3300005435 Bacteria 2528
67 Ga0070713_100002202 3300005436 Bacteria 12626
68 Ga0070713_100052565 3300005436 Bacteria 3373
69 Ga0070710_10033061 3300005437 Bacteria 2806
70 Ga0070710_10116315 3300005437 Bacteria 1612
71 Ga0070701_10022153 3300005438 Bacteria 3043
72 Ga0070711_100007031 3300005439 Bacteria 6827
73 Ga0070711_100057039 3300005439 Bacteria 2702
74 Ga0070705_100003982 3300005440 Bacteria 7219
75 Ga0070700_100065143 3300005441 Bacteria 2309
76 Ga0070694_100047324 3300005444 Bacteria 2890
77 Ga0070694_100155820 3300005444 Bacteria 1672
78 Ga0070694_100398195 3300005444 Bacteria 1077
79 Ga0070663_100049191 3300005455 Bacteria 2992
80 Ga0070663_100120175 3300005455 Bacteria 1984
81 Ga0070678_100042719 3300005456 Bacteria 3224
82 Ga0070662_100023146 3300005457 Bacteria 4264
83 Ga0070681_10124512 3300005458 Bacteria 2510
84 Ga0070681_10206665 3300005458 Bacteria 1880
85 Ga0070681_10606952 3300005458 Bacteria 1009
86 Ga0068867_100003764 3300005459 Bacteria 10677
87 Ga0068867_100028355 3300005459 Bacteria 4031
88 Ga0068867_100126057 3300005459 Bacteria 1984
89 Ga0070685_10045920 3300005466 Bacteria 2507
90 Ga0070679_100013963 3300005530 Bacteria 7697
91 Ga0070679_100056479 3300005530 Bacteria 3912
92 Ga0070679_100146290 3300005530 Bacteria 2341
93 Ga0070679_100247411 3300005530 Bacteria 1740
94 Ga0070679_100351995 3300005530 Bacteria 1420
95 Ga0070679_100356422 3300005530 Bacteria 1410
96 Ga0070684_100002161 3300005535 Bacteria 14516
97 Ga0070684_100032052 3300005535 Bacteria 4477
98 Ga0068853_100065701 3300005539 Bacteria 3148
99 Ga0068853_100136870 3300005539 Bacteria 2196
100 Ga0070672_100008897 3300005543 Bacteria 6897
101 Ga0070686_100002376 3300005544 Bacteria 10368
102 Ga0070686_100051856 3300005544 Bacteria 2613
103 Ga0070686_100074409 3300005544 Bacteria 2232
104 Ga0070695_100028064 3300005545 Bacteria 3491
105 Ga0070695_100030233 3300005545 Bacteria 3371
106 Ga0070693_100002348 3300005547 Bacteria 8698
107 Ga0070693_100047618 3300005547 Bacteria 2440
108 Ga0070693_100049315 3300005547 Bacteria 2401
109 Ga0070665_100040827 3300005548 Bacteria 4663
110 Ga0070704_100009589 3300005549 Bacteria 5860
111 Ga0070704_100020522 3300005549 Bacteria 4262
112 Ga0068855_100120810 3300005563 Bacteria 2998
113 Ga0068855_100122447 3300005563 Bacteria 2976
114 Ga0068855_100265043 3300005563 Bacteria 1912
115 Ga0070664_100006568 3300005564 Bacteria 9381
116 Ga0068857_100009381 3300005577 Bacteria 8494
117 Ga0068857_100404457 3300005577 Bacteria 1271
118 Ga0068854_100004762 3300005578 Bacteria 8555
119 Ga0068856_100011377 3300005614 Bacteria 8632
120 Ga0068852_100013724 3300005616 Bacteria 6209
121 Ga0068859_100005699 3300005617 Bacteria 12674
122 Ga0068859_100033770 3300005617 Bacteria 5136
123 Ga0068859_100082374 3300005617 Bacteria 3260
124 Ga0068859_100190634 3300005617 Bacteria 2134
125 Ga0068864_100000715 3300005618 Bacteria 27854
126 Ga0068864_100220189 3300005618 Bacteria 1751
127 Ga0068866_10000992 3300005718 Bacteria 12484
128 Ga0068866_10096179 3300005718 Bacteria 1624
129 Ga0068861_100038639 3300005719 Bacteria 3557
130 Ga0068870_10001034 3300005840 Bacteria 11000
131 Ga0068863_100010345 3300005841 Bacteria 9061
132 Ga0068863_100509401 3300005841 Bacteria 1186
133 Ga0068858_100012900 3300005842 Bacteria 7881
134 Ga0068858_100256457 3300005842 Bacteria 1662
135 Ga0068858_100296281 3300005842 Bacteria 1542
136 Ga0068862_100011703 3300005844 Bacteria 7240
137 Ga0081455_10000002 3300005937 Bacteria 460472
138 Ga0081455_10014993 3300005937 Bacteria 7549
139 Ga0081455_10024073 3300005937 Bacteria 5648
140 Ga0070717_10166008 3300006028 Bacteria 1918
141 Ga0070717_10218361 3300006028 Bacteria 1675
142 Ga0070717_10274337 3300006028 Bacteria 1494
143 Ga0075368_10055549 3300006042 Bacteria 1578
144 Ga0075363_100069748 3300006048 Bacteria 1907
145 Ga0075363_100075300 3300006048 Bacteria 1839
146 Ga0075363_100084473 3300006048 Bacteria 1741
147 Ga0075432_10002282 3300006058 Bacteria 6384
148 Ga0075432_10018616 3300006058 Bacteria 2369
149 Ga0070715_10009757 3300006163 Bacteria 3396
150 Ga0070715_10036612 3300006163 Bacteria 2025
151 Ga0070715_10114076 3300006163 Bacteria 1279
152 Ga0070712_100162115 3300006175 Bacteria 1727
153 Ga0070712_100193545 3300006175 Bacteria 1593
154 Ga0075362_10043769 3300006177 Bacteria 1983
155 Ga0075367_10083936 3300006178 Bacteria 1930
156 Ga0075369_10025847 3300006186 Bacteria 2444
157 Ga0075427_10001160 3300006194 Bacteria 3337
158 Ga0075366_10012706 3300006195 Bacteria 4783
159 Ga0075366_10014070 3300006195 Bacteria 4565
160 Ga0075366_10014999 3300006195 Bacteria 4431
161 Ga0075366_10093437 3300006195 Bacteria 1802
162 Ga0097621_100002611 3300006237 Bacteria 12347
163 Ga0097621_100372225 3300006237 Bacteria 1274
164 Ga0075370_10025998 3300006353 Bacteria 3240
165 Ga0068871_100000012 3300006358 Bacteria 105267
166 Ga0068871_100110227 3300006358 Bacteria 2314
167 Ga0075428_100002408 3300006844 Bacteria 20309
168 Ga0075430_100000032 3300006846 Bacteria 72679
169 Ga0075431_100000903 3300006847 Bacteria 26158
170 Ga0075433_10000976 3300006852 Bacteria 20309
171 Ga0075433_10150031 3300006852 Bacteria 2073
172 Ga0075433_10253362 3300006852 Bacteria 1561
173 Ga0075433_10403970 3300006852 Bacteria 1205
174 Ga0075434_100000341 3300006871 Bacteria 33666
175 Ga0075434_100008227 3300006871 Bacteria 9681
176 Ga0075434_100089709 3300006871 Bacteria 3075
177 Ga0075434_100250439 3300006871 Bacteria 1791
178 Ga0075429_100000561 3300006880 Bacteria 28469
179 Ga0068865_100002705 3300006881 Bacteria 10514
180 Ga0075436_100007663 3300006914 Bacteria 7377
181 Ga0075436_100145082 3300006914 Bacteria 1669
182 Ga0097620_100005699 3300006931 Bacteria 12674
183 Ga0097620_100033767 3300006931 Bacteria 5136
184 Ga0097620_100082374 3300006931 Bacteria 3260
185 Ga0097620_100190625 3300006931 Bacteria 2134
186 Ga0075435_100020155 3300007076 Bacteria 5103
187 Ga0075435_100038297 3300007076 Bacteria 3823
188 Ga0105251_10028097 3300009011 Bacteria 2845
189 Ga0105250_10025741 3300009092 Bacteria 2371
190 Ga0111539_10001270 3300009094 Bacteria 33682
191 Ga0111539_10044176 3300009094 Bacteria 5339
192 Ga0111539_10120803 3300009094 Bacteria 3070
193 Ga0111539_10152872 3300009094 Bacteria 2701
194 Ga0111539_10489501 3300009094 Bacteria 1432
195 Ga0105245_10000460 3300009098 Bacteria 37264
196 Ga0105245_10038487 3300009098 Bacteria 4255
197 Ga0105247_10000881 3300009101 Bacteria 22689
198 Ga0105247_10062048 3300009101 Bacteria 2318
199 Ga0114129_10001035 3300009147 Bacteria 36374
200 Ga0114129_10049815 3300009147 Bacteria 5885
201 Ga0105243_10004739 3300009148 Bacteria 10698
202 Ga0105243_10128115 3300009148 Bacteria 2150
203 Ga0105243_10301587 3300009148 Bacteria 1452
204 Ga0105243_10450285 3300009148 Bacteria 1208
205 Ga0105241_10004650 3300009174 Bacteria 10147
206 Ga0105241_10008370 3300009174 Bacteria 7618
207 Ga0105242_10200826 3300009176 Bacteria 1771
208 Ga0105248_10033712 3300009177 Bacteria 5722
209 Ga0105248_10083081 3300009177 Bacteria 3603
210 Ga0105248_10110218 3300009177 Bacteria 3103
211 Ga0105248_10156104 3300009177 Bacteria 2575
212 Ga0105237_10160826 3300009545 Bacteria 2244
213 Ga0105237_10164073 3300009545 Bacteria 2220
214 Ga0105249_10099335 3300009553 Bacteria 2735
215 Ga0105239_10033955 3300010375 Bacteria 5601
216 Ga0105239_10063805 3300010375 Bacteria 4044
217 Ga0105239_10116695 3300010375 Bacteria 2962
218 Ga0105239_10473927 3300010375 Bacteria 1422
219 Ga0105246_10003054 3300011119 Bacteria 10161
220 Ga0105246_10504659 3300011119 Bacteria 1028
221 Ga0157341_1000565 3300012494 Bacteria 1923
222 Ga0157342_1001832 3300012507 Bacteria 1643
223 Ga0157373_10024356 3300013100 Bacteria 4385
224 Ga0157373_10040293 3300013100 Bacteria 3343
225 Ga0157373_10235188 3300013100 Bacteria 1294
226 Ga0157371_10012799 3300013102 Bacteria 6395
227 Ga0157369_10149116 3300013105 Bacteria 2472
228 Ga0157374_10005485 3300013296 Bacteria 10651
229 Ga0157378_10030471 3300013297 Bacteria 4767
230 Ga0157378_10658225 3300013297 Bacteria 1064
231 Ga0163162_10043904 3300013306 Bacteria 4475
232 Ga0157372_10061874 3300013307 Bacteria 4192
233 Ga0157372_10273924 3300013307 Bacteria 1961
234 Ga0157375_10006955 3300013308 Bacteria 9875
235 Ga0157375_10197306 3300013308 Bacteria 2168
236 Ga0163163_10000824 3300014325 Bacteria 26424
237 Ga0163163_10028743 3300014325 Bacteria 5343
238 Ga0163163_10045150 3300014325 Bacteria 4325
239 Ga0157380_10051367 3300014326 Bacteria 3261
240 Ga0157377_10000747 3300014745 Bacteria 13471
241 Ga0157377_10052187 3300014745 Bacteria 2308
242 Ga0157379_10007473 3300014968 Bacteria 9462
243 Ga0157379_10018294 3300014968 Bacteria 6176
244 Ga0157376_10057154 3300014969 Bacteria 3262
245 Ga0163161_10014113 3300017792 Bacteria 5564
246 Ga0206356_11408241 3300020070 Bacteria 2136
247 Ga0213876_10015539 3300021384 Bacteria 4028
248 Ga0213876_10063571 3300021384 Bacteria 1949
249 Ga0213875_10000033 3300021388 Bacteria 170944
250 Ga0207666_1000321 3300025271 Bacteria 6685
251 Ga0209758_1000469 3300025297 Bacteria 66568
252 Ga0207653_10007479 3300025885 Bacteria 3405
253 Ga0207682_10000011 3300025893 Bacteria 85533
254 Ga0207692_10003084 3300025898 Bacteria 6471
255 Ga0207642_10000524 3300025899 Bacteria 11752
256 Ga0207642_10036802 3300025899 Bacteria 2104
257 Ga0207710_10002624 3300025900 Bacteria 8291
258 Ga0207710_10023925 3300025900 Bacteria 2628
259 Ga0207710_10088397 3300025900 Unclassified 1447
260 Ga0207688_10013082 3300025901 Bacteria 4510
261 Ga0207680_10013942 3300025903 Bacteria 4144
262 Ga0207647_10016450 3300025904 Bacteria 5049
263 Ga0207685_10075112 3300025905 Bacteria 1382
264 Ga0207685_10083721 3300025905 Bacteria 1326
265 Ga0207685_10131663 3300025905 Bacteria 1111
266 Ga0207699_10009636 3300025906 Bacteria 4819
267 Ga0207699_10028372 3300025906 Bacteria 3110
268 Ga0207699_10037784 3300025906 Bacteria 2763
269 Ga0207645_10000788 3300025907 Bacteria 26477
270 Ga0207645_10025475 3300025907 Bacteria 3827
271 Ga0207643_10000284 3300025908 Bacteria 35172
272 Ga0207643_10250228 3300025908 Bacteria 1091
273 Ga0207705_10004585 3300025909 Bacteria 10439
274 Ga0207705_10082151 3300025909 Bacteria 2349
275 Ga0207654_10008933 3300025911 Bacteria 5082
276 Ga0207707_10016051 3300025912 Bacteria 6530
277 Ga0207707_10041522 3300025912 Bacteria 4017
278 Ga0207707_10152501 3300025912 Bacteria 2020
279 Ga0207695_10160029 3300025913 Bacteria 2184
280 Ga0207671_10260053 3300025914 Bacteria 1366
281 Ga0207693_10016842 3300025915 Bacteria 5835
282 Ga0207693_10020112 3300025915 Bacteria 5310
283 Ga0207693_10024473 3300025915 Bacteria 4791
284 Ga0207693_10051020 3300025915 Bacteria 3248
285 Ga0207663_10013091 3300025916 Bacteria 4501
286 Ga0207663_10027630 3300025916 Bacteria 3310
287 Ga0207660_10078958 3300025917 Bacteria 2413
288 Ga0207660_10214577 3300025917 Bacteria 1508
289 Ga0207662_10021432 3300025918 Bacteria 3693
290 Ga0207662_10229285 3300025918 Bacteria 1212
291 Ga0207657_10036437 3300025919 Bacteria 4403
292 Ga0207657_10052478 3300025919 Bacteria 3538
293 Ga0207649_10000057 3300025920 Bacteria 102314
294 Ga0207649_10113866 3300025920 Bacteria 1812
295 Ga0207652_10021510 3300025921 Bacteria 5323
296 Ga0207681_10000181 3300025923 Bacteria 51755
297 Ga0207694_10040270 3300025924 Bacteria 3596
298 Ga0207650_10124772 3300025925 Bacteria 2009
299 Ga0207659_10000028 3300025926 Bacteria 130804
300 Ga0207659_10061296 3300025926 Bacteria 2711
301 Ga0207687_10000061 3300025927 Bacteria 84113
302 Ga0207687_10199537 3300025927 Bacteria 1563
303 Ga0207700_10044738 3300025928 Bacteria 3261
304 Ga0207700_10214544 3300025928 Bacteria 1629
305 Ga0207664_10187902 3300025929 Bacteria 1777
306 Ga0207644_10000315 3300025931 Bacteria 31527
307 Ga0207690_10003360 3300025932 Bacteria 9568
308 Ga0207706_10038800 3300025933 Bacteria 4224
309 Ga0207686_10010685 3300025934 Bacteria 5000
310 Ga0207686_10025623 3300025934 Bacteria 3433
311 Ga0207686_10053137 3300025934 Bacteria 2531
312 Ga0207709_10000539 3300025935 Bacteria 32486
313 Ga0207709_10046250 3300025935 Bacteria 2640
314 Ga0207709_10085023 3300025935 Bacteria 2050
315 Ga0207670_10000217 3300025936 Bacteria 37598
316 Ga0207670_10060747 3300025936 Bacteria 2576
317 Ga0207670_10062944 3300025936 Bacteria 2537
318 Ga0207669_10000147 3300025937 Bacteria 34031
319 Ga0207669_10035654 3300025937 Bacteria 2833
320 Ga0207704_10000299 3300025938 Bacteria 23415
321 Ga0207665_10001292 3300025939 Bacteria 16913
322 Ga0207665_10024608 3300025939 Bacteria 3971
323 Ga0207691_10015666 3300025940 Bacteria 7206
324 Ga0207691_10285750 3300025940 Bacteria 1419
325 Ga0207711_10001580 3300025941 Bacteria 21028
326 Ga0207711_10028537 3300025941 Bacteria 4696
327 Ga0207711_10114282 3300025941 Bacteria 2404
328 Ga0207689_10103768 3300025942 Bacteria 2336
329 Ga0207661_10000215 3300025944 Bacteria 37435
330 Ga0207679_10000026 3300025945 Bacteria 200073
331 Ga0207667_10015965 3300025949 Bacteria 8504
332 Ga0207651_10000173 3300025960 Bacteria 27970
333 Ga0207712_10005574 3300025961 Bacteria 7941
334 Ga0207668_10000242 3300025972 Bacteria 36700
335 Ga0207668_10071828 3300025972 Bacteria 2474
336 Ga0207640_10003534 3300025981 Bacteria 8427
337 Ga0207677_10006056 3300026023 Bacteria 6597
338 Ga0207703_10022834 3300026035 Bacteria 4914
339 Ga0207703_10267695 3300026035 Bacteria 1547
340 Ga0207639_10042423 3300026041 Bacteria 3409
341 Ga0207678_10040853 3300026067 Bacteria 4021
342 Ga0207678_10050370 3300026067 Bacteria 3598
343 Ga0207708_10172949 3300026075 Bacteria 1712
344 Ga0207702_10012057 3300026078 Bacteria 7188
345 Ga0207702_10034120 3300026078 Bacteria 4253
346 Ga0207702_10214522 3300026078 Bacteria 1791
347 Ga0207641_10015438 3300026088 Bacteria 6257
348 Ga0207641_10122423 3300026088 Bacteria 2323
349 Ga0207641_10396813 3300026088 Unclassified 1324
350 Ga0207648_10019819 3300026089 Bacteria 6070
351 Ga0207648_10669775 3300026089 Bacteria 960
352 Ga0207676_10000361 3300026095 Bacteria 38795
353 Ga0207674_10026550 3300026116 Bacteria 6146
354 Ga0207674_10476045 3300026116 Bacteria 1207
355 Ga0207675_100128119 3300026118 Bacteria 2405
356 Ga0207675_100600621 3300026118 Bacteria 1103
357 Ga0207683_10000034 3300026121 Bacteria 101817
358 Ga0207683_10005439 3300026121 Bacteria 10906
359 Ga0207683_10162730 3300026121 Bacteria 2018
360 Ga0207683_10181584 3300026121 Bacteria 1908
361 Ga0207698_10017559 3300026142 Bacteria 4859
362 Ga0207698_10031807 3300026142 Bacteria 3814
363 Ga0207698_10087200 3300026142 Bacteria 2541
364 Ga0207698_10390606 3300026142 Bacteria 1327
365 Ga0209983_1004372 3300027665 Bacteria 2970
366 Ga0209971_1001670 3300027682 Bacteria 5485
367 Ga0209966_1000943 3300027695 Bacteria 5469
368 Ga0207428_10000082 3300027907 Bacteria 133684
369 Ga0207428_10000352 3300027907 Bacteria 59444
370 Ga0207428_10020766 3300027907 Bacteria 5571
371 Ga0268265_10008848 3300028380 Bacteria 6804
372 Ga0268265_10328819 3300028380 Bacteria 1387
373 Ga0268264_10007704 3300028381 Bacteria 8970
374 Ga0268264_10051446 3300028381 Bacteria 3433
375 Ga0265338_10039627 3300028800 Bacteria 4441
376 Ga0265338_10233865 3300028800 Bacteria 1365
377 Ga0265330_10037830 3300031235 Bacteria 2146
378 Ga0265332_10118736 3300031238 Bacteria 1111
379 Ga0265325_10000141 3300031241 Bacteria 50291
380 Ga0265325_10000843 3300031241 Bacteria 22219
381 Ga0265325_10026910 3300031241 Bacteria 3112
382 Ga0265340_10015105 3300031247 Bacteria 4017
383 Ga0265340_10067444 3300031247 Bacteria 1700
384 Ga0265331_10149821 3300031250 Bacteria 1060
385 Ga0265313_10000008 3300031595 Bacteria 173405
386 Ga0265313_10003676 3300031595 Bacteria 12252
387 Ga0265313_10013058 3300031595 Bacteria 5019
388 Ga0265314_10004544 3300031711 Bacteria 12816
389 Ga0265314_10015204 3300031711 Bacteria 6114
390 Ga0265342_10000841 3300031712 Bacteria 30728
391 Ga0265342_10080869 3300031712 Bacteria 1877
392 Ga0265342_10201713 3300031712 Bacteria 1080
393 Ga0316583_10032267 3300032133 Bacteria 1862
394 Ga0373930_0001225 3300034816 Bacteria 3786
395 Ga0373948_0000052 3300034817 Bacteria 12263
396 Ga0373958_0004612 3300034819 Bacteria 2048
397 Ga0373958_0005653 3300034819 Bacteria 1912
398 Ga0373959_0002099 3300034820 Bacteria 3182
399 Ga0373938_0000498 3300034957 Bacteria 6339
400 Ga0373938_0002088 3300034957 Bacteria 3213
401 Ga0373928_0051459 3300035084 Bacteria 974
402 Ga0373929_0000220 3300035085 Bacteria 10415
403 Ga0373934_0064869 3300035086 Bacteria 1458
404 Ga0373940_0000725 3300035088 Bacteria 5367
405 Ga0373940_0008718 3300035088 Bacteria 2339
406 Ga0373944_0006118 3300035089 Bacteria 3188
407 Ga0373949_0001073 3300035090 Bacteria 8354
408 Ga0373949_0001411 3300035090 Bacteria 6869
409 Ga0373949_0021002 3300035090 Bacteria 1498
410 Ga0373951_0000946 3300035091 Bacteria 7808
411 Ga0373951_0008358 3300035091 Bacteria 2340
412 Ga0373951_0041905 3300035091 Bacteria 1106
413 Ga0373952_0001673 3300035092 Bacteria 4033
414 Ga0373952_0059739 3300035092 Bacteria 929
415 Ga0373923_0000447 3300035111 Bacteria 9774
416 Ga0373923_0095622 3300035111 Bacteria 1304
417 Ga0373932_0008422 3300035112 Bacteria 2465
418 Ga0373932_0016104 3300035112 Bacteria 1904
419 Ga0373936_0003030 3300035113 Bacteria 6279
420 Ga0373939_0002953 3300035114 Bacteria 3995
421 Ga0373939_0008951 3300035114 Bacteria 2468
422 Ga0373939_0045159 3300035114 Bacteria 1343
423 Ga0373941_0000374 3300035115 Bacteria 8935
424 Ga0373941_0000572 3300035115 Bacteria 7395
425 Ga0373941_0001591 3300035115 Bacteria 4829
426 Ga0373941_0062799 3300035115 Bacteria 1213
427 Ga0373954_0008903 3300035118 Bacteria 4416
428 Ga0373954_0055607 3300035118 Bacteria 1862
429 Ga0373956_0019915 3300035119 Bacteria 2850
430 Ga0373956_0101575 3300035119 Bacteria 1334
431 Ga0373957_0000582 3300035120 Bacteria 9224
432 Ga0373960_0000735 3300035121 Bacteria 6847
433 Ga0373943_0021918 3300035170 Bacteria 2953
434 Ga0373946_0004134 3300035171 Bacteria 5169
435 Ga0373946_0048357 3300035171 Bacteria 1770
436 Ga0373955_0018189 3300035172 Bacteria 3491
437 Ga0373955_0027707 3300035172 Bacteria 2932
438 Ga0373942_0000845 3300035207 Bacteria 8411
439 Ga0373942_0010376 3300035207 Bacteria 2192
440 Ga0373942_0011864 3300035207 Bacteria 2072
441 Ga0373961_0000729 3300035241 Bacteria 11431
442 Ga0373961_0006236 3300035241 Bacteria 2866
443 Ga0373962_0002348 3300035242 Bacteria 4514
444 Ga0373962_0003814 3300035242 Bacteria 3622
445 Ga0373924_0001555 3300035410 Bacteria 7489
446 Ga0373924_0074916 3300035410 Bacteria 1432
447 Ga0373924_0090277 3300035410 Bacteria 1310
448 Ga0373931_0011579 3300035691 Bacteria 4260
449 Ga0373931_0026325 3300035691 Bacteria 2960
450 Ga0373931_0065181 3300035691 Bacteria 1973
451 Ga0373931_0113467 3300035691 Bacteria 1540
452 Ga0373935_0041438 3300035692 Bacteria 2892
453 Ga0373935_0084760 3300035692 Bacteria 2064
454 Ga0373935_0089813 3300035692 Bacteria 2010
455 Ga0373927_0043006 3300035695 Bacteria 2926
456 Ga0373927_0084349 3300035695 Bacteria 2060
457 Ga0373933_0001723 3300035724 Bacteria 12691
458 Ga0373933_0007095 3300035724 Bacteria 6102
459 Ga0373933_0018872 3300035724 Bacteria 3885
460 Ga0373947_0004938 3300035725 Bacteria 7800
461 Ga0373947_0015425 3300035725 Bacteria 4385
462 Ga0373947_0024258 3300035725 Bacteria 3534
463 Ga0373947_0273392 3300035725 Bacteria 1122
464 Ga0373937_0003184 3300036401 Bacteria 13739
465 Ga0373937_0005156 3300036401 Bacteria 11139
466 Ga0373937_0021697 3300036401 Bacteria 5764
467 Ga0316582_0307827 3300036647 Bacteria 1089
468 Ga0316584_0404667 3300036712 Bacteria 972
469 Ga0373925_0009568 3300037068 Bacteria 7060
470 Ga0373925_0025014 3300037068 Bacteria 4360
471 Ga0373925_0083791 3300037068 Bacteria 2429
472 Ga0373925_0136345 3300037068 Bacteria 1918
473 Ga0373925_0351432 3300037068 Bacteria 1197
474 Ga0395900_0003585 3300037418 Bacteria 16692
475 Ga0395898_0036583 3300037466 Bacteria 4874
476 Ga0395898_0129626 3300037466 Bacteria 2416
477 Ga0395898_0137333 3300037466 Bacteria 2341
478 Ga0436364_0509271 3300037853 Bacteria 1234
479 Ga0436364_0852054 3300037853 Bacteria 1182
480 Ga0436364_1338082 3300037853 Bacteria 27858
481 Ga0436364_1419137 3300037853 Bacteria 4857
482 Ga0395901_0443569 3300038443 Bacteria 1328
483 Ga0242420_001406 3300038996 Bacteria 3207
484 Ga0436365_0396058 3300039437 Bacteria 4165
485 Ga0439450_003470 3300042008 Bacteria 2609
486 Ga0439463_018014 3300042016 Bacteria 1756
487 Ga0439464_0007302 3300042439 Bacteria 2889
488 Ga0439460_0005008 3300042461 Bacteria 3239
489 Ga0451577_0189237 3300042876 Bacteria 1856
490 Ga0439440_0023424 3300042993 Bacteria 1408
491 Ga0466966_0034416 3300044684 Bacteria 3275
492 Ga0466963_0118655 3300044694 Bacteria 1819
493 Ga0466963_0357762 3300044694 Bacteria 1028
494 Ga0453684_0268649 3300044712 Bacteria 1950
495 Ga0466957_0009192 3300044842 Bacteria 5638
496 Ga0466957_0020655 3300044842 Bacteria 3876
497 Ga0466957_0199630 3300044842 Bacteria 1313
498 Ga0466959_0110327 3300045049 Bacteria 1964
499 Ga0451576_0004698 3300045051 Bacteria 17570
500 Ga0451576_0514279 3300045051 Bacteria 1258
501 Ga0466958_0267554 3300045836 Bacteria 1094
502 Ga0466967_0377646 3300045976 Bacteria 1376
503 Ga0495592_0001184 3300046454 Bacteria 18095
504 Ga0495592_0044323 3300046454 Bacteria 3324
505 Ga0495592_0055711 3300046454 Bacteria 2923
506 Ga0495603_0017601 3300046455 Bacteria 4327
507 Ga0495603_0046194 3300046455 Bacteria 2595
508 Ga0495603_0096922 3300046455 Bacteria 1723
509 Ga0495629_0000062 3300046459 Bacteria 97169
510 Ga0495641_0003407 3300046461 Bacteria 11913
511 Ga0495641_0061784 3300046461 Bacteria 1690
512 Ga0495651_0000895 3300046462 Bacteria 23161
513 Ga0495651_0005305 3300046462 Bacteria 9828
514 Ga0495651_0092901 3300046462 Bacteria 2260
515 Ga0495653_0000987 3300046463 Bacteria 21890
516 Ga0495653_0004420 3300046463 Bacteria 11365
517 Ga0495653_0012511 3300046463 Bacteria 6929
518 Ga0495580_0022207 3300046472 Bacteria 4672
519 Ga0495580_0279372 3300046472 Bacteria 1139
520 Ga0495582_0027873 3300046473 Bacteria 3098
521 Ga0495639_0007730 3300046475 Bacteria 4622
522 Ga0495662_0058637 3300046476 Bacteria 1859
523 Ga0495664_0007609 3300046477 Bacteria 6021
524 Ga0495664_0034445 3300046477 Bacteria 2979
525 Ga0495664_0069608 3300046477 Bacteria 2100
526 Ga0495584_0035400 3300046491 Bacteria 2524
527 Ga0495585_0000389 3300046492 Bacteria 42431
528 Ga0495594_0033468 3300046499 Bacteria 2794
529 Ga0495594_0098308 3300046499 Bacteria 1645
530 Ga0495607_0001903 3300046501 Bacteria 17695
531 Ga0495608_0000129 3300046511 Bacteria 53862
532 Ga0495608_0013594 3300046511 Bacteria 5646
533 Ga0495608_0038785 3300046511 Bacteria 3197
534 Ga0495618_0001726 3300046514 Bacteria 14506
535 Ga0495618_0052717 3300046514 Bacteria 2571
536 Ga0495618_0138521 3300046514 Bacteria 1556
537 Ga0495628_0001570 3300046516 Bacteria 20927
538 Ga0495628_0004609 3300046516 Bacteria 12184
539 Ga0495628_0008485 3300046516 Bacteria 8808
540 Ga0495630_0034904 3300046517 Bacteria 3757
541 Ga0495630_0081529 3300046517 Bacteria 2441
542 Ga0495630_0092520 3300046517 Bacteria 2285
543 Ga0495637_0051495 3300046520 Bacteria 1723
544 Ga0495666_0006354 3300046526 Bacteria 5949
545 Ga0495652_0004520 3300046529 Bacteria 13265
546 Ga0495652_0005753 3300046529 Bacteria 11605
547 Ga0495652_0055841 3300046529 Bacteria 3356
548 Ga0495640_0043252 3300046533 Bacteria 3138
549 Ga0495640_0077409 3300046533 Bacteria 2217
550 Ga0495586_0052098 3300046535 Bacteria 2215
551 Ga0495587_0000354 3300046536 Bacteria 32868
552 Ga0495587_0036168 3300046536 Bacteria 2971
553 Ga0495598_0040307 3300046537 Bacteria 1361
554 Ga0495621_0038339 3300046539 Bacteria 1671
555 Ga0495645_0000800 3300046543 Bacteria 21568
556 Ga0495645_0001074 3300046543 Bacteria 18551
557 Ga0495645_0128873 3300046543 Bacteria 1775
558 Ga0495622_0004193 3300046557 Bacteria 6720
559 Ga0495633_0011365 3300046558 Bacteria 4803
560 Ga0495667_0002315 3300046559 Bacteria 12757
561 Ga0495667_0054524 3300046559 Bacteria 2630
562 Ga0495667_0062177 3300046559 Bacteria 2447
563 Ga0495656_0001813 3300046615 Bacteria 7024
564 Ga0495634_0014173 3300046642 Bacteria 5752
565 Ga0495634_0035924 3300046642 Bacteria 3391
566 Ga0495634_0130384 3300046642 Bacteria 1603
567 Ga0495635_0001388 3300046663 Bacteria 16150
568 Ga0495635_0008767 3300046663 Bacteria 7061
569 Ga0495635_0129123 3300046663 Bacteria 1723
570 Ga0495659_0000966 3300046664 Bacteria 10132
571 Ga0495661_0012736 3300046665 Bacteria 5675
572 Ga0495588_0004563 3300046674 Bacteria 6122
573 Ga0495657_0001374 3300046675 Bacteria 21110
574 Ga0495657_0035497 3300046675 Bacteria 3454
575 Ga0495657_0072817 3300046675 Bacteria 2240
576 Ga0495599_0000294 3300046678 Bacteria 30376
577 Ga0495599_0011840 3300046678 Bacteria 5363
578 Ga0495599_0021018 3300046678 Bacteria 4069
579 Ga0495599_0234212 3300046678 Bacteria 1121
580 Ga0495623_0000055 3300046679 Bacteria 69548
581 Ga0495623_0026535 3300046679 Bacteria 3728
582 Ga0495646_0000749 3300046680 Bacteria 18095
583 Ga0495646_0003654 3300046680 Bacteria 9601
584 Ga0495647_0056855 3300046681 Bacteria 1534
585 Ga0495658_0000109 3300046683 Bacteria 43760
586 Ga0495613_0043839 3300046689 Bacteria 3310
587 Ga0495613_0126968 3300046689 Bacteria 1828
588 Ga0495624_0031740 3300046690 Bacteria 3430
589 Ga0495670_0000106 3300046691 Bacteria 37100
590 Ga0495600_0001208 3300046809 Bacteria 14164
591 Ga0495600_0013152 3300046809 Bacteria 5191
592 Ga0495600_0014646 3300046809 Bacteria 4943
593 Ga0495600_0020004 3300046809 Bacteria 4280
594 Ga0495581_0001433 3300047315 Bacteria 13240
595 Ga0495604_0004110 3300047317 Bacteria 11566
596 Ga0495604_0010002 3300047317 Bacteria 7509
597 Ga0495604_0015210 3300047317 Bacteria 6142
598 Ga0495674_0005151 3300047319 Bacteria 12554
599 Ga0495674_0033478 3300047319 Bacteria 4653
600 Ga0495674_0073366 3300047319 Bacteria 2950
601 Ga0495680_0003711 3300047322 Bacteria 14906
602 Ga0495680_0008181 3300047322 Bacteria 9536
603 Ga0495680_0019769 3300047322 Bacteria 5680
604 Ga0495680_0056282 3300047322 Bacteria 3045
605 Ga0495680_0076363 3300047322 Bacteria 2540
606 Ga0495680_0310550 3300047322 Bacteria 1105
607 Ga0495675_0000190 3300047444 Bacteria 44968
608 Ga0495675_0119547 3300047444 Bacteria 1641
609 Ga0495681_0028053 3300047470 Bacteria 2903
610 Ga0495684_0010816 3300047471 Bacteria 7054
611 Ga0495684_0044448 3300047471 Bacteria 3401
612 Ga0495684_0067663 3300047471 Bacteria 2716
613 Ga0495593_0001596 3300047673 Bacteria 13393
614 Ga0495593_0032614 3300047673 Bacteria 2838
615 Ga0495593_0039517 3300047673 Bacteria 2543
616 Ga0495602_0000445 3300048088 Bacteria 38896
617 Ga0495602_0026002 3300048088 Bacteria 5654
618 Ga0495602_0048824 3300048088 Bacteria 3798
619 Ga0495614_0013507 3300048089 Bacteria 3580
620 Ga0496100_0003227 3300048903 Bacteria 8468
621 Ga0496100_0010592 3300048903 Bacteria 5222
622 Ga0496100_0125860 3300048903 Bacteria 1798
623 Ga0496101_0000756 3300048904 Bacteria 19156
624 Ga0496101_0068893 3300048904 Bacteria 2587
625 Ga0496101_0070748 3300048904 Bacteria 2556
626 Ga0496102_0044759 3300048905 Bacteria 4018
627 Ga0496102_0118048 3300048905 Bacteria 2476
628 Ga0496102_0118862 3300048905 Bacteria 2467
629 Ga0496102_0136069 3300048905 Bacteria 2302
630 Ga0496103_0081375 3300048906 Bacteria 2037
631 Ga0496104_0000685 3300048907 Bacteria 29134
632 Ga0496104_0053372 3300048907 Bacteria 3818
633 Ga0496104_0074667 3300048907 Bacteria 3227
634 Ga0496104_0149771 3300048907 Bacteria 2240
635 Ga0496104_0166282 3300048907 Bacteria 2115
636 Ga0496104_0432011 3300048907 Bacteria 1229
637 Ga0496105_0001954 3300048908 Bacteria 14793
638 Ga0496105_0004757 3300048908 Bacteria 10249
639 Ga0496106_0004105 3300048909 Bacteria 10848
640 Ga0496106_0042773 3300048909 Bacteria 3397
641 Ga0496106_0097826 3300048909 Bacteria 2272
642 Ga0496106_0100970 3300048909 Bacteria 2237
643 Ga0496106_0121195 3300048909 Bacteria 2044
644 Ga0496106_0341667 3300048909 Bacteria 1202
645 Ga0496107_0013534 3300048910 Bacteria 5703
646 Ga0496107_0013652 3300048910 Bacteria 5678
647 Ga0496107_0022645 3300048910 Bacteria 4440
648 Ga0496107_0034982 3300048910 Bacteria 3600
649 Ga0496107_0050129 3300048910 Bacteria 3009
650 Ga0496107_0095041 3300048910 Bacteria 2180
651 Ga0496108_0014622 3300048911 Bacteria 6407
652 Ga0496109_0000736 3300048912 Bacteria 27218
653 Ga0496109_0002526 3300048912 Bacteria 15338
654 Ga0496109_0264798 3300048912 Bacteria 1619
655 Ga0496109_0475158 3300048912 Bacteria 1180
656 Ga0496110_0035374 3300048913 Bacteria 4333
657 Ga0496110_0055710 3300048913 Bacteria 3479
658 Ga0496110_0069720 3300048913 Bacteria 3114
659 Ga0496110_0091186 3300048913 Bacteria 2726
660 Ga0496111_0013697 3300048914 Bacteria 5524
661 Ga0496111_0051148 3300048914 Bacteria 2983
662 Ga0496111_0078320 3300048914 Bacteria 2410
663 Ga0496111_0088525 3300048914 Bacteria 2268
664 Ga0496112_0005715 3300048915 Bacteria 10806
665 Ga0496112_0035592 3300048915 Bacteria 4851
666 Ga0496112_0195239 3300048915 Bacteria 1985
667 Ga0496113_0000137 3300048916 Bacteria 31613
668 Ga0496113_0067149 3300048916 Bacteria 2718
669 Ga0496113_0067574 3300048916 Bacteria 2710
670 Ga0496114_0029796 3300048917 Bacteria 4486
671 Ga0496114_0039419 3300048917 Bacteria 3909
672 Ga0496114_0156096 3300048917 Bacteria 1981
673 Ga0496115_0001071 3300048918 Bacteria 19818
674 Ga0496115_0005562 3300048918 Bacteria 9168
675 Ga0496115_0036013 3300048918 Bacteria 3917
676 Ga0501031_0165746 3300049568 Bacteria 1444
677 Ga0501032_0017503 3300049569 Bacteria 5032
678 Ga0501032_0018276 3300049569 Bacteria 4913
679 Ga0501032_0029636 3300049569 Bacteria 3754
680 Ga0501032_0151188 3300049569 Bacteria 1526
681 Ga0501033_0042439 3300049570 Bacteria 3391
682 Ga0501033_0072248 3300049570 Bacteria 2533
683 Ga0501033_0247293 3300049570 Bacteria 1265
684 Ga0501034_0000166 3300049571 Bacteria 122782
685 Ga0501034_0002279 3300049571 Bacteria 23553
686 Ga0501034_0010525 3300049571 Bacteria 9631
687 Ga0501034_0039342 3300049571 Bacteria 4790
688 Ga0501034_0046873 3300049571 Bacteria 4367
689 Ga0501034_0047608 3300049571 Bacteria 4329
690 Ga0501034_0049363 3300049571 Bacteria 4245
691 Ga0501034_0056805 3300049571 Bacteria 3936
692 Ga0501034_0057543 3300049571 Bacteria 3908
693 Ga0501034_0290678 3300049571 Bacteria 1572
694 Ga0501034_0317593 3300049571 Bacteria 1491
695 Ga0501034_0561415 3300049571 Bacteria 1050
696 Ga0501036_0001268 3300049572 Bacteria 19351
697 Ga0501036_0001435 3300049572 Bacteria 18318
698 Ga0501036_0023356 3300049572 Bacteria 5208
699 Ga0501036_0037375 3300049572 Bacteria 4108
700 Ga0501036_0050505 3300049572 Bacteria 3521
701 Ga0501036_0051817 3300049572 Bacteria 3475
702 Ga0501036_0251601 3300049572 Bacteria 1481
703 Ga0501037_0003033 3300049573 Bacteria 12191
704 Ga0501037_0006762 3300049573 Bacteria 8386
705 Ga0501037_0011748 3300049573 Bacteria 6447
706 Ga0501037_0020805 3300049573 Bacteria 4844
707 Ga0501037_0055834 3300049573 Bacteria 2886
708 Ga0501037_0074456 3300049573 Bacteria 2467
709 Ga0501038_0011216 3300049574 Bacteria 8182
710 Ga0501038_0029585 3300049574 Bacteria 4851
711 Ga0501038_0105864 3300049574 Bacteria 2336
712 Ga0501038_0129001 3300049574 Bacteria 2078
713 Ga0501038_0148738 3300049574 Bacteria 1910
714 Ga0501038_0218712 3300049574 Bacteria 1520
715 Ga0501039_0000758 3300049575 Bacteria 23236
716 Ga0501039_0019466 3300049575 Bacteria 5204
717 Ga0501039_0151567 3300049575 Bacteria 1821
718 Ga0501039_0289235 3300049575 Bacteria 1288
719 Ga0501043_0029469 3300049579 Bacteria 4312
720 Ga0501043_0030069 3300049579 Bacteria 4266
721 Ga0501046_0003696 3300049580 Bacteria 14007
722 Ga0501046_0006647 3300049580 Bacteria 10216
723 Ga0501046_0023536 3300049580 Bacteria 5065
724 Ga0501047_0002756 3300049581 Bacteria 16693
725 Ga0501047_0003470 3300049581 Bacteria 14899
726 Ga0501047_0027786 3300049581 Bacteria 5451
727 Ga0501047_0101585 3300049581 Bacteria 2755
728 Ga0501047_0127248 3300049581 Bacteria 2428
729 Ga0501048_0000429 3300049582 Bacteria 29567
730 Ga0501048_0264425 3300049582 Bacteria 1222
731 Ga0501067_0000345 3300049583 Bacteria 25284
732 Ga0501067_0014070 3300049583 Bacteria 4432
733 Ga0501067_0037009 3300049583 Bacteria 2710
734 Ga0501067_0064908 3300049583 Bacteria 2021
735 Ga0501067_0111989 3300049583 Bacteria 1517
736 Ga0501068_0132271 3300049584 Bacteria 1560
737 Ga0501068_0137551 3300049584 Bacteria 1530
738 Ga0501069_0026587 3300049585 Bacteria 3169
739 Ga0501070_0001845 3300049586 Bacteria 18698
740 Ga0501070_0012498 3300049586 Bacteria 7160
741 Ga0501070_0013652 3300049586 Bacteria 6843
742 Ga0501070_0026768 3300049586 Bacteria 4837
743 Ga0501070_0103505 3300049586 Bacteria 2354
744 Ga0501071_0022461 3300049587 Bacteria 4397
745 Ga0501071_0026336 3300049587 Bacteria 4081
746 Ga0501073_0031245 3300049589 Bacteria 3799
747 Ga0501073_0036159 3300049589 Bacteria 3509
748 Ga0501073_0141260 3300049589 Bacteria 1668
749 Ga0501073_0354884 3300049589 Bacteria 1012
750 Ga0501074_0021064 3300049590 Bacteria 4735
751 Ga0501074_0036572 3300049590 Bacteria 3556
752 Ga0501074_0141093 3300049590 Bacteria 1723
753 Ga0501074_0313888 3300049590 Bacteria 1113
754 Ga0501074_0420357 3300049590 Bacteria 948
755 Ga0501075_0035258 3300049591 Bacteria 3730
756 Ga0501076_0002841 3300049592 Bacteria 11982
757 Ga0501077_0053100 3300049593 Bacteria 2573
758 Ga0501077_0184536 3300049593 Bacteria 1325
759 Ga0501079_0082308 3300049741 Bacteria 2489
760 Ga0501079_0132355 3300049741 Bacteria 1941
761 Ga0501080_0000383 3300049742 Bacteria 34102
762 Ga0501080_0001688 3300049742 Bacteria 18817
763 Ga0501080_0020427 3300049742 Bacteria 6129
764 Ga0501080_0020834 3300049742 Bacteria 6068
765 Ga0501080_0031459 3300049742 Bacteria 4944
766 Ga0501080_0049497 3300049742 Bacteria 3911
767 Ga0501080_0213614 3300049742 Bacteria 1767
768 Ga0501080_0303288 3300049742 Bacteria 1448
769 Ga0501081_0091558 3300049743 Bacteria 2139
770 Ga0501081_0157860 3300049743 Bacteria 1633
771 Ga0501083_0004489 3300049744 Bacteria 9855
772 Ga0501083_0044550 3300049744 Bacteria 3003
773 Ga0501083_0053402 3300049744 Bacteria 2713
774 Ga0501083_0061823 3300049744 Bacteria 2500
775 Ga0501083_0077003 3300049744 Bacteria 2213
776 Ga0501035_0000084 3300049822 Bacteria 116222
777 Ga0501035_0000197 3300049822 Bacteria 73618
778 Ga0501035_0032596 3300049822 Bacteria 4739
779 Ga0501035_0043306 3300049822 Bacteria 4057
780 Ga0501035_0130879 3300049822 Bacteria 2187
781 Ga0501035_0333819 3300049822 Bacteria 1271
782 Ga0501044_0000073 3300049823 Bacteria 122507
783 Ga0501044_0030649 3300049823 Bacteria 5666
784 Ga0501044_0032568 3300049823 Bacteria 5478
785 Ga0501044_0044299 3300049823 Bacteria 4617
786 Ga0501044_0057292 3300049823 Bacteria 3999
787 Ga0501044_0088937 3300049823 Bacteria 3118
788 Ga0501044_0257880 3300049823 Bacteria 1682
789 Ga0501044_0334805 3300049823 Bacteria 1435
790 Ga0501044_0409918 3300049823 Bacteria 1266
791 Ga0501044_0448892 3300049823 Bacteria 1196
792 Ga0501045_0034565 3300049824 Bacteria 3669
793 Ga0501045_0154513 3300049824 Bacteria 1707
794 nmdc:mga03683_111129_c1 3300050489 Bacteria 1212
795 nmdc:mga03n38_31116_c1 3300050490 Bacteria 2249
796 nmdc:mga00v17_74252_c1 3300050491 Bacteria 2113
797 nmdc:mga0yw44_85728_c1 3300050492 Bacteria 1982
798 nmdc:mga0k408_19959_c1 3300050493 Bacteria 3751
799 nmdc:mga0k408_61999_c1 3300050493 Bacteria 2174
800 nmdc:mga06z11_236772_c1 3300050494 Bacteria 1071
801 nmdc:mga07m45_13691_c2 3300050496 Bacteria 3062
802 nmdc:mga07m45_49001_c1 3300050496 Bacteria 2377
803 nmdc:mga05p37_12681_c1 3300050507 Bacteria 10070
804 nmdc:mga05p37_19_c2 3300050507 Bacteria 99994
805 nmdc:mga09592_1297_c1 3300050508 Bacteria 20091
806 nmdc:mga0qj67_259_c1 3300050509 Bacteria 36242
807 nmdc:mga06r32_1133_c1 3300050510 Bacteria 23910
808 nmdc:mga08y16_114800_c1 3300050511 Bacteria 2804
809 nmdc:mga08y16_21083_c1 3300050511 Bacteria 6881
810 nmdc:mga08y16_293458_c1 3300050511 Bacteria 1676
811 nmdc:mga08y16_653311_c1 3300050511 Bacteria 1056
812 nmdc:mga0n895_112359_c1 3300050512 Bacteria 2741
813 nmdc:mga0n895_41918_c1 3300050512 Bacteria 4452
814 nmdc:mga0n895_439753_c1 3300050512 Bacteria 1317
815 nmdc:mga0n895_68456_c1 3300050512 Bacteria 3517
816 nmdc:mga0n895_701_c1 3300050512 Bacteria 23539
817 nmdc:mga0rr50_217046_c1 3300050513 Bacteria 1578
818 nmdc:mga0rr50_63863_c1 3300050513 Bacteria 2782
819 nmdc:mga0rr50_785_c1 3300050513 Bacteria 17098
820 nmdc:mga0rr50_83435_c1 3300050513 Bacteria 2471
821 nmdc:mga08x19_104497_c1 3300050514 Bacteria 1882
822 nmdc:mga08x19_162458_c1 3300050514 Bacteria 1517
823 nmdc:mga08x19_182439_c1 3300050514 Bacteria 1433
824 nmdc:mga08x19_196928_c1 3300050514 Bacteria 1380
825 nmdc:mga08x19_93555_c1 3300050514 Bacteria 1986
826 nmdc:mga0a205_11208_c1 3300050515 Bacteria 7608
827 nmdc:mga0a205_249_c1 3300050515 Bacteria 38472
828 nmdc:mga0a205_284511_c1 3300050515 Bacteria 1528
829 nmdc:mga0a205_88929_c2 3300050515 Bacteria 2383
830 Ga0495601_0000186 3300053077 Bacteria 33078
831 Ga0495601_0000677 3300053077 Bacteria 18186
832 Ga0495601_0000798 3300053077 Bacteria 17006
833 Ga0495601_0050367 3300053077 Bacteria 2626
834 Ga0495601_0127885 3300053077 Bacteria 1653
835 Ga0495601_0283553 3300053077 Bacteria 1080
836 Ga0495612_0000089 3300053078 Bacteria 40250
837 Ga0495612_0001470 3300053078 Bacteria 9700
838 Ga0495612_0039065 3300053078 Bacteria 1929
839 Ga0495595_0000369 3300053084 Bacteria 17095
840 Ga0495595_0005480 3300053084 Bacteria 5140
841 Ga0495595_0008524 3300053084 Bacteria 4212
842 Ga0495619_0000052 3300053085 Bacteria 98882
843 Ga0495619_0000078 3300053085 Bacteria 72749
844 Ga0495619_0002831 3300053085 Bacteria 11298
845 Ga0495619_0003693 3300053085 Bacteria 9866
846 Ga0495619_0004203 3300053085 Bacteria 9187
847 Ga0495619_0004787 3300053085 Bacteria 8603
848 Ga0500644_0000406 3300053088 Bacteria 20485
849 Ga0500651_0019843 3300053093 Bacteria 4183
850 Ga0500651_0132785 3300053093 Bacteria 1505
851 Ga0500566_0118772 3300053094 Bacteria 1428
852 Ga0500641_0004364 3300053096 Bacteria 4995
853 Ga0500641_0089619 3300053096 Bacteria 1312
854 Ga0500562_034091 3300053108 Bacteria 1346
855 Ga0500595_000001 3300053119 Bacteria 1088438
856 Ga0500595_019094 3300053119 Bacteria 2494
857 Ga0500597_054645 3300053120 Bacteria 1707
858 Ga0500652_003619 3300053131 Bacteria 4695
859 Ga0500616_0000001 3300053153 Bacteria 1986011
860 Ga0500616_0014708 3300053153 Bacteria 4489
861 Ga0500645_002831 3300053730 Bacteria 7473
862 Ga0500645_054630 3300053730 Bacteria 1161
863 Ga0501084_0379974 3300054114 Bacteria 1194
864 Ga0501084_0477523 3300054114 Bacteria 1054
865 Ga0501082_0005704 3300060353 Bacteria 10803
866 Ga0501082_0061688 3300060353 Bacteria 3227
867 Ga0501082_0125079 3300060353 Bacteria 2230
868 Ga0501082_0131729 3300060353 Bacteria 2170
869 Ga0501082_0268014 3300060353 Bacteria 1486
870 Ga0501082_0694731 3300060353 Bacteria 890
871 2643758229 2643221547 Bacteria 4740017
872 nmdc:mga05p37_312467_c1
873 2214750793
874 ARcpr5oldR_c000008
875 ARSoilYngRDRAFT_c00021
876 ARcpr5yngRDRAFT_c000269
877 ARSoilOldRDRAFT_c000004
878 ARCol0oldRDRAFT_c00519
879 ARCol0yngRDRAFT_1000405
880 JGI24739J22299_10000119
881 JGI24737J22298_10016402
882 JGI24738J21930_10000653
883 JGI24749J21850_1000821
884 JGI24744J21845_10000855
885 JGI24034J26672_10002428
886 JGI25153J46596_10001550
887 JGI25405J52794_10003987
888 Ga0065716_1001943
889 Ga0065704_10082626
890 Ga0065712_10002667
891 Ga0065712_10071402
892 Ga0065715_10002782
893 Ga0070658_10014072
894 Ga0070683_100015125
895 Ga0070683_100230825
896 Ga0070690_100016228
897 Ga0070690_100091164
898 Ga0070670_100002160
899 Ga0068869_100004994
900 Ga0070666_10039476
901 Ga0070680_100003115
902 Ga0070680_100006411
903 Ga0070680_100017168
904 Ga0070682_100008882
905 Ga0068868_100123546
906 Ga0070660_100002712
907 Ga0070660_100008655
908 Ga0070660_100070972
909 Ga0070689_100007061
910 Ga0070689_100016827
911 Ga0070689_100037360
912 Ga0070691_10000519
913 Ga0070687_100000762
914 Ga0070661_100004148
915 Ga0070661_100445464
916 Ga0070692_10006740
917 Ga0070668_100097991
918 Ga0070669_100009605
919 Ga0070675_100004458
920 Ga0070671_100002139
921 Ga0070671_100014975
922 Ga0070671_100323004
923 Ga0070674_100003695
924 Ga0070674_100011100
925 Ga0070674_100054945
926 Ga0070673_100000278
927 Ga0070673_100129073
928 Ga0070688_100002472
929 Ga0070688_100022886
930 Ga0070659_100016217
931 Ga0070667_100037839
932 Ga0070667_100309820
933 Ga0070703_10006001
934 Ga0070709_10007640
935 Ga0070709_10061034
936 Ga0070714_100065202
937 Ga0070714_100102072
938 Ga0070713_100002202
939 Ga0070713_100052565
940 Ga0070710_10033061
941 Ga0070710_10116315
942 Ga0070701_10022153
943 Ga0070711_100007031
944 Ga0070711_100057039
945 Ga0070705_100003982
946 Ga0070700_100065143
947 Ga0070694_100047324
948 Ga0070694_100155820
949 Ga0070694_100398195
950 Ga0070663_100049191
951 Ga0070663_100120175
952 Ga0070678_100042719
953 Ga0070662_100023146
954 Ga0070681_10124512
955 Ga0070681_10206665
956 Ga0070681_10606952
957 Ga0068867_100003764
958 Ga0068867_100028355
959 Ga0068867_100126057
960 Ga0070685_10045920
961 Ga0070679_100013963
962 Ga0070679_100056479
963 Ga0070679_100146290
964 Ga0070679_100247411
965 Ga0070679_100351995
966 Ga0070679_100356422
967 Ga0070684_100002161
968 Ga0070684_100032052
969 Ga0068853_100065701
970 Ga0068853_100136870
971 Ga0070672_100008897
972 Ga0070686_100002376
973 Ga0070686_100051856
974 Ga0070686_100074409
975 Ga0070695_100028064
976 Ga0070695_100030233
977 Ga0070693_100002348
978 Ga0070693_100047618
979 Ga0070693_100049315
980 Ga0070665_100040827
981 Ga0070704_100009589
982 Ga0070704_100020522
983 Ga0068855_100120810
984 Ga0068855_100122447
985 Ga0068855_100265043
986 Ga0070664_100006568
987 Ga0068857_100009381
988 Ga0068857_100404457
989 Ga0068854_100004762
990 Ga0068856_100011377
991 Ga0068852_100013724
992 Ga0068859_100005699
993 Ga0068859_100033770
994 Ga0068859_100082374
995 Ga0068859_100190634
996 Ga0068864_100000715
997 Ga0068864_100220189
998 Ga0068866_10000992
999 Ga0068866_10096179
1000 Ga0068861_100038639
1001 Ga0068870_10001034
1002 Ga0068863_100010345
1003 Ga0068863_100509401
1004 Ga0068858_100012900
1005 Ga0068858_100256457
1006 Ga0068858_100296281
1007 Ga0068862_100011703
1008 Ga0081455_10000002
1009 Ga0081455_10014993
1010 Ga0081455_10024073
1011 Ga0070717_10166008
1012 Ga0070717_10218361
1013 Ga0070717_10274337
1014 Ga0075368_10055549
1015 Ga0075363_100069748
1016 Ga0075363_100075300
1017 Ga0075363_100084473
1018 Ga0075432_10002282
1019 Ga0075432_10018616
1020 Ga0070715_10009757
1021 Ga0070715_10036612
1022 Ga0070715_10114076
1023 Ga0070712_100162115
1024 Ga0070712_100193545
1025 Ga0075362_10043769
1026 Ga0075367_10083936
1027 Ga0075369_10025847
1028 Ga0075427_10001160
1029 Ga0075366_10012706
1030 Ga0075366_10014070
1031 Ga0075366_10014999
1032 Ga0075366_10093437
1033 Ga0097621_100002611
1034 Ga0097621_100372225
1035 Ga0075370_10025998
1036 Ga0068871_100000012
1037 Ga0068871_100110227
1038 Ga0075428_100002408
1039 Ga0075430_100000032
1040 Ga0075431_100000903
1041 Ga0075433_10000976
1042 Ga0075433_10150031
1043 Ga0075433_10253362
1044 Ga0075433_10403970
1045 Ga0075434_100000341
1046 Ga0075434_100008227
1047 Ga0075434_100089709
1048 Ga0075434_100250439
1049 Ga0075429_100000561
1050 Ga0068865_100002705
1051 Ga0075436_100007663
1052 Ga0075436_100145082
1053 Ga0097620_100005699
1054 Ga0097620_100033767
1055 Ga0097620_100082374
1056 Ga0097620_100190625
1057 Ga0075435_100020155
1058 Ga0075435_100038297
1059 Ga0105251_10028097
1060 Ga0105250_10025741
1061 Ga0111539_10001270
1062 Ga0111539_10044176
1063 Ga0111539_10120803
1064 Ga0111539_10152872
1065 Ga0111539_10489501
1066 Ga0105245_10000460
1067 Ga0105245_10038487
1068 Ga0105247_10000881
1069 Ga0105247_10062048
1070 Ga0114129_10001035
1071 Ga0114129_10049815
1072 Ga0105243_10004739
1073 Ga0105243_10128115
1074 Ga0105243_10301587
1075 Ga0105243_10450285
1076 Ga0105241_10004650
1077 Ga0105241_10008370
1078 Ga0105242_10200826
1079 Ga0105248_10033712
1080 Ga0105248_10083081
1081 Ga0105248_10110218
1082 Ga0105248_10156104
1083 Ga0105237_10160826
1084 Ga0105237_10164073
1085 Ga0105249_10099335
1086 Ga0105239_10033955
1087 Ga0105239_10063805
1088 Ga0105239_10116695
1089 Ga0105239_10473927
1090 Ga0105246_10003054
1091 Ga0105246_10504659
1092 Ga0157341_1000565
1093 Ga0157342_1001832
1094 Ga0157373_10024356
1095 Ga0157373_10040293
1096 Ga0157373_10235188
1097 Ga0157371_10012799
1098 Ga0157369_10149116
1099 Ga0157374_10005485
1100 Ga0157378_10030471
1101 Ga0157378_10658225
1102 Ga0163162_10043904
1103 Ga0157372_10061874
1104 Ga0157372_10273924
1105 Ga0157375_10006955
1106 Ga0157375_10197306
1107 Ga0163163_10000824
1108 Ga0163163_10028743
1109 Ga0163163_10045150
1110 Ga0157380_10051367
1111 Ga0157377_10000747
1112 Ga0157377_10052187
1113 Ga0157379_10007473
1114 Ga0157379_10018294
1115 Ga0157376_10057154
1116 Ga0163161_10014113
1117 Ga0206356_11408241
1118 Ga0213876_10015539
1119 Ga0213876_10063571
1120 Ga0213875_10000033
1121 Ga0207666_1000321
1122 Ga0209758_1000469
1123 Ga0207653_10007479
1124 Ga0207682_10000011
1125 Ga0207692_10003084
1126 Ga0207642_10000524
1127 Ga0207642_10036802
1128 Ga0207710_10002624
1129 Ga0207710_10023925
1130 Ga0207710_10088397
1131 Ga0207688_10013082
1132 Ga0207680_10013942
1133 Ga0207647_10016450
1134 Ga0207685_10075112
1135 Ga0207685_10083721
1136 Ga0207685_10131663
1137 Ga0207699_10009636
1138 Ga0207699_10028372
1139 Ga0207699_10037784
1140 Ga0207645_10000788
1141 Ga0207645_10025475
1142 Ga0207643_10000284
1143 Ga0207643_10250228
1144 Ga0207705_10004585
1145 Ga0207705_10082151
1146 Ga0207654_10008933
1147 Ga0207707_10016051
1148 Ga0207707_10041522
1149 Ga0207707_10152501
1150 Ga0207695_10160029
1151 Ga0207671_10260053
1152 Ga0207693_10016842
1153 Ga0207693_10020112
1154 Ga0207693_10024473
1155 Ga0207693_10051020
1156 Ga0207663_10013091
1157 Ga0207663_10027630
1158 Ga0207660_10078958
1159 Ga0207660_10214577
1160 Ga0207662_10021432
1161 Ga0207662_10229285
1162 Ga0207657_10036437
1163 Ga0207657_10052478
1164 Ga0207649_10000057
1165 Ga0207649_10113866
1166 Ga0207652_10021510
1167 Ga0207681_10000181
1168 Ga0207694_10040270
1169 Ga0207650_10124772
1170 Ga0207659_10000028
1171 Ga0207659_10061296
1172 Ga0207687_10000061
1173 Ga0207687_10199537
1174 Ga0207700_10044738
1175 Ga0207700_10214544
1176 Ga0207664_10187902
1177 Ga0207644_10000315
1178 Ga0207690_10003360
1179 Ga0207706_10038800
1180 Ga0207686_10010685
1181 Ga0207686_10025623
1182 Ga0207686_10053137
1183 Ga0207709_10000539
1184 Ga0207709_10046250
1185 Ga0207709_10085023
1186 Ga0207670_10000217
1187 Ga0207670_10060747
1188 Ga0207670_10062944
1189 Ga0207669_10000147
1190 Ga0207669_10035654
1191 Ga0207704_10000299
1192 Ga0207665_10001292
1193 Ga0207665_10024608
1194 Ga0207691_10015666
1195 Ga0207691_10285750
1196 Ga0207711_10001580
1197 Ga0207711_10028537
1198 Ga0207711_10114282
1199 Ga0207689_10103768
1200 Ga0207661_10000215
1201 Ga0207679_10000026
1202 Ga0207667_10015965
1203 Ga0207651_10000173
1204 Ga0207712_10005574
1205 Ga0207668_10000242
1206 Ga0207668_10071828
1207 Ga0207640_10003534
1208 Ga0207677_10006056
1209 Ga0207703_10022834
1210 Ga0207703_10267695
1211 Ga0207639_10042423
1212 Ga0207678_10040853
1213 Ga0207678_10050370
1214 Ga0207708_10172949
1215 Ga0207702_10012057
1216 Ga0207702_10034120
1217 Ga0207702_10214522
1218 Ga0207641_10015438
1219 Ga0207641_10122423
1220 Ga0207641_10396813
1221 Ga0207648_10019819
1222 Ga0207648_10669775
1223 Ga0207676_10000361
1224 Ga0207674_10026550
1225 Ga0207674_10476045
1226 Ga0207675_100128119
1227 Ga0207675_100600621
1228 Ga0207683_10000034
1229 Ga0207683_10005439
1230 Ga0207683_10162730
1231 Ga0207683_10181584
1232 Ga0207698_10017559
1233 Ga0207698_10031807
1234 Ga0207698_10087200
1235 Ga0207698_10390606
1236 Ga0209983_1004372
1237 Ga0209971_1001670
1238 Ga0209966_1000943
1239 Ga0207428_10000082
1240 Ga0207428_10000352
1241 Ga0207428_10020766
1242 Ga0268265_10008848
1243 Ga0268265_10328819
1244 Ga0268264_10007704
1245 Ga0268264_10051446
1246 Ga0265338_10039627
1247 Ga0265338_10233865
1248 Ga0265330_10037830
1249 Ga0265332_10118736
1250 Ga0265325_10000141
1251 Ga0265325_10000843
1252 Ga0265325_10026910
1253 Ga0265340_10015105
1254 Ga0265340_10067444
1255 Ga0265331_10149821
1256 Ga0265313_10000008
1257 Ga0265313_10003676
1258 Ga0265313_10013058
1259 Ga0265314_10004544
1260 Ga0265314_10015204
1261 Ga0265342_10000841
1262 Ga0265342_10080869
1263 Ga0265342_10201713
1264 Ga0316583_10032267
1265 Ga0373930_0001225
1266 Ga0373948_0000052
1267 Ga0373958_0004612
1268 Ga0373958_0005653
1269 Ga0373959_0002099
1270 Ga0373938_0000498
1271 Ga0373938_0002088
1272 Ga0373928_0051459
1273 Ga0373929_0000220
1274 Ga0373934_0064869
1275 Ga0373940_0000725
1276 Ga0373940_0008718
1277 Ga0373944_0006118
1278 Ga0373949_0001073
1279 Ga0373949_0001411
1280 Ga0373949_0021002
1281 Ga0373951_0000946
1282 Ga0373951_0008358
1283 Ga0373951_0041905
1284 Ga0373952_0001673
1285 Ga0373952_0059739
1286 Ga0373923_0000447
1287 Ga0373923_0095622
1288 Ga0373932_0008422
1289 Ga0373932_0016104
1290 Ga0373936_0003030
1291 Ga0373939_0002953
1292 Ga0373939_0008951
1293 Ga0373939_0045159
1294 Ga0373941_0000374
1295 Ga0373941_0000572
1296 Ga0373941_0001591
1297 Ga0373941_0062799
1298 Ga0373954_0008903
1299 Ga0373954_0055607
1300 Ga0373956_0019915
1301 Ga0373956_0101575
1302 Ga0373957_0000582
1303 Ga0373960_0000735
1304 Ga0373943_0021918
1305 Ga0373946_0004134
1306 Ga0373946_0048357
1307 Ga0373955_0018189
1308 Ga0373955_0027707
1309 Ga0373942_0000845
1310 Ga0373942_0010376
1311 Ga0373942_0011864
1312 Ga0373961_0000729
1313 Ga0373961_0006236
1314 Ga0373962_0002348
1315 Ga0373962_0003814
1316 Ga0373924_0001555
1317 Ga0373924_0074916
1318 Ga0373924_0090277
1319 Ga0373931_0011579
1320 Ga0373931_0026325
1321 Ga0373931_0065181
1322 Ga0373931_0113467
1323 Ga0373935_0041438
1324 Ga0373935_0084760
1325 Ga0373935_0089813
1326 Ga0373927_0043006
1327 Ga0373927_0084349
1328 Ga0373933_0001723
1329 Ga0373933_0007095
1330 Ga0373933_0018872
1331 Ga0373947_0004938
1332 Ga0373947_0015425
1333 Ga0373947_0024258
1334 Ga0373947_0273392
1335 Ga0373937_0003184
1336 Ga0373937_0005156
1337 Ga0373937_0021697
1338 Ga0316582_0307827
1339 Ga0316584_0404667
1340 Ga0373925_0009568
1341 Ga0373925_0025014
1342 Ga0373925_0083791
1343 Ga0373925_0136345
1344 Ga0373925_0351432
1345 Ga0395900_0003585
1346 Ga0395898_0036583
1347 Ga0395898_0129626
1348 Ga0395898_0137333
1349 Ga0436364_0509271
1350 Ga0436364_0852054
1351 Ga0436364_1338082
1352 Ga0436364_1419137
1353 Ga0395901_0443569
1354 Ga0242420_001406
1355 Ga0436365_0396058
1356 Ga0439450_003470
1357 Ga0439463_018014
1358 Ga0439464_0007302
1359 Ga0439460_0005008
1360 Ga0451577_0189237
1361 Ga0439440_0023424
1362 Ga0466966_0034416
1363 Ga0466963_0118655
1364 Ga0466963_0357762
1365 Ga0453684_0268649
1366 Ga0466957_0009192
1367 Ga0466957_0020655
1368 Ga0466957_0199630
1369 Ga0466959_0110327
1370 Ga0451576_0004698
1371 Ga0451576_0514279
1372 Ga0466958_0267554
1373 Ga0466967_0377646
1374 Ga0495592_0001184
1375 Ga0495592_0044323
1376 Ga0495592_0055711
1377 Ga0495603_0017601
1378 Ga0495603_0046194
1379 Ga0495603_0096922
1380 Ga0495629_0000062
1381 Ga0495641_0003407
1382 Ga0495641_0061784
1383 Ga0495651_0000895
1384 Ga0495651_0005305
1385 Ga0495651_0092901
1386 Ga0495653_0000987
1387 Ga0495653_0004420
1388 Ga0495653_0012511
1389 Ga0495580_0022207
1390 Ga0495580_0279372
1391 Ga0495582_0027873
1392 Ga0495639_0007730
1393 Ga0495662_0058637
1394 Ga0495664_0007609
1395 Ga0495664_0034445
1396 Ga0495664_0069608
1397 Ga0495584_0035400
1398 Ga0495585_0000389
1399 Ga0495594_0033468
1400 Ga0495594_0098308
1401 Ga0495607_0001903
1402 Ga0495608_0000129
1403 Ga0495608_0013594
1404 Ga0495608_0038785
1405 Ga0495618_0001726
1406 Ga0495618_0052717
1407 Ga0495618_0138521
1408 Ga0495628_0001570
1409 Ga0495628_0004609
1410 Ga0495628_0008485
1411 Ga0495630_0034904
1412 Ga0495630_0081529
1413 Ga0495630_0092520
1414 Ga0495637_0051495
1415 Ga0495666_0006354
1416 Ga0495652_0004520
1417 Ga0495652_0005753
1418 Ga0495652_0055841
1419 Ga0495640_0043252
1420 Ga0495640_0077409
1421 Ga0495586_0052098
1422 Ga0495587_0000354
1423 Ga0495587_0036168
1424 Ga0495598_0040307
1425 Ga0495621_0038339
1426 Ga0495645_0000800
1427 Ga0495645_0001074
1428 Ga0495645_0128873
1429 Ga0495622_0004193
1430 Ga0495633_0011365
1431 Ga0495667_0002315
1432 Ga0495667_0054524
1433 Ga0495667_0062177
1434 Ga0495656_0001813
1435 Ga0495634_0014173
1436 Ga0495634_0035924
1437 Ga0495634_0130384
1438 Ga0495635_0001388
1439 Ga0495635_0008767
1440 Ga0495635_0129123
1441 Ga0495659_0000966
1442 Ga0495661_0012736
1443 Ga0495588_0004563
1444 Ga0495657_0001374
1445 Ga0495657_0035497
1446 Ga0495657_0072817
1447 Ga0495599_0000294
1448 Ga0495599_0011840
1449 Ga0495599_0021018
1450 Ga0495599_0234212
1451 Ga0495623_0000055
1452 Ga0495623_0026535
1453 Ga0495646_0000749
1454 Ga0495646_0003654
1455 Ga0495647_0056855
1456 Ga0495658_0000109
1457 Ga0495613_0043839
1458 Ga0495613_0126968
1459 Ga0495624_0031740
1460 Ga0495670_0000106
1461 Ga0495600_0001208
1462 Ga0495600_0013152
1463 Ga0495600_0014646
1464 Ga0495600_0020004
1465 Ga0495581_0001433
1466 Ga0495604_0004110
1467 Ga0495604_0010002
1468 Ga0495604_0015210
1469 Ga0495674_0005151
1470 Ga0495674_0033478
1471 Ga0495674_0073366
1472 Ga0495680_0003711
1473 Ga0495680_0008181
1474 Ga0495680_0019769
1475 Ga0495680_0056282
1476 Ga0495680_0076363
1477 Ga0495680_0310550
1478 Ga0495675_0000190
1479 Ga0495675_0119547
1480 Ga0495681_0028053
1481 Ga0495684_0010816
1482 Ga0495684_0044448
1483 Ga0495684_0067663
1484 Ga0495593_0001596
1485 Ga0495593_0032614
1486 Ga0495593_0039517
1487 Ga0495602_0000445
1488 Ga0495602_0026002
1489 Ga0495602_0048824
1490 Ga0495614_0013507
1491 Ga0496100_0003227
1492 Ga0496100_0010592
1493 Ga0496100_0125860
1494 Ga0496101_0000756
1495 Ga0496101_0068893
1496 Ga0496101_0070748
1497 Ga0496102_0044759
1498 Ga0496102_0118048
1499 Ga0496102_0118862
1500 Ga0496102_0136069
1501 Ga0496103_0081375
1502 Ga0496104_0000685
1503 Ga0496104_0053372
1504 Ga0496104_0074667
1505 Ga0496104_0149771
1506 Ga0496104_0166282
1507 Ga0496104_0432011
1508 Ga0496105_0001954
1509 Ga0496105_0004757
1510 Ga0496106_0004105
1511 Ga0496106_0042773
1512 Ga0496106_0097826
1513 Ga0496106_0100970
1514 Ga0496106_0121195
1515 Ga0496106_0341667
1516 Ga0496107_0013534
1517 Ga0496107_0013652
1518 Ga0496107_0022645
1519 Ga0496107_0034982
1520 Ga0496107_0050129
1521 Ga0496107_0095041
1522 Ga0496108_0014622
1523 Ga0496109_0000736
1524 Ga0496109_0002526
1525 Ga0496109_0264798
1526 Ga0496109_0475158
1527 Ga0496110_0035374
1528 Ga0496110_0055710
1529 Ga0496110_0069720
1530 Ga0496110_0091186
1531 Ga0496111_0013697
1532 Ga0496111_0051148
1533 Ga0496111_0078320
1534 Ga0496111_0088525
1535 Ga0496112_0005715
1536 Ga0496112_0035592
1537 Ga0496112_0195239
1538 Ga0496113_0000137
1539 Ga0496113_0067149
1540 Ga0496113_0067574
1541 Ga0496114_0029796
1542 Ga0496114_0039419
1543 Ga0496114_0156096
1544 Ga0496115_0001071
1545 Ga0496115_0005562
1546 Ga0496115_0036013
1547 Ga0501031_0165746
1548 Ga0501032_0017503
1549 Ga0501032_0018276
1550 Ga0501032_0029636
1551 Ga0501032_0151188
1552 Ga0501033_0042439
1553 Ga0501033_0072248
1554 Ga0501033_0247293
1555 Ga0501034_0000166
1556 Ga0501034_0002279
1557 Ga0501034_0010525
1558 Ga0501034_0039342
1559 Ga0501034_0046873
1560 Ga0501034_0047608
1561 Ga0501034_0049363
1562 Ga0501034_0056805
1563 Ga0501034_0057543
1564 Ga0501034_0290678
1565 Ga0501034_0317593
1566 Ga0501034_0561415
1567 Ga0501036_0001268
1568 Ga0501036_0001435
1569 Ga0501036_0023356
1570 Ga0501036_0037375
1571 Ga0501036_0050505
1572 Ga0501036_0051817
1573 Ga0501036_0251601
1574 Ga0501037_0003033
1575 Ga0501037_0006762
1576 Ga0501037_0011748
1577 Ga0501037_0020805
1578 Ga0501037_0055834
1579 Ga0501037_0074456
1580 Ga0501038_0011216
1581 Ga0501038_0029585
1582 Ga0501038_0105864
1583 Ga0501038_0129001
1584 Ga0501038_0148738
1585 Ga0501038_0218712
1586 Ga0501039_0000758
1587 Ga0501039_0019466
1588 Ga0501039_0151567
1589 Ga0501039_0289235
1590 Ga0501043_0029469
1591 Ga0501043_0030069
1592 Ga0501046_0003696
1593 Ga0501046_0006647
1594 Ga0501046_0023536
1595 Ga0501047_0002756
1596 Ga0501047_0003470
1597 Ga0501047_0027786
1598 Ga0501047_0101585
1599 Ga0501047_0127248
1600 Ga0501048_0000429
1601 Ga0501048_0264425
1602 Ga0501067_0000345
1603 Ga0501067_0014070
1604 Ga0501067_0037009
1605 Ga0501067_0064908
1606 Ga0501067_0111989
1607 Ga0501068_0132271
1608 Ga0501068_0137551
1609 Ga0501069_0026587
1610 Ga0501070_0001845
1611 Ga0501070_0012498
1612 Ga0501070_0013652
1613 Ga0501070_0026768
1614 Ga0501070_0103505
1615 Ga0501071_0022461
1616 Ga0501071_0026336
1617 Ga0501073_0031245
1618 Ga0501073_0036159
1619 Ga0501073_0141260
1620 Ga0501073_0354884
1621 Ga0501074_0021064
1622 Ga0501074_0036572
1623 Ga0501074_0141093
1624 Ga0501074_0313888
1625 Ga0501074_0420357
1626 Ga0501075_0035258
1627 Ga0501076_0002841
1628 Ga0501077_0053100
1629 Ga0501077_0184536
1630 Ga0501079_0082308
1631 Ga0501079_0132355
1632 Ga0501080_0000383
1633 Ga0501080_0001688
1634 Ga0501080_0020427
1635 Ga0501080_0020834
1636 Ga0501080_0031459
1637 Ga0501080_0049497
1638 Ga0501080_0213614
1639 Ga0501080_0303288
1640 Ga0501081_0091558
1641 Ga0501081_0157860
1642 Ga0501083_0004489
1643 Ga0501083_0044550
1644 Ga0501083_0053402
1645 Ga0501083_0061823
1646 Ga0501083_0077003
1647 Ga0501035_0000084
1648 Ga0501035_0000197
1649 Ga0501035_0032596
1650 Ga0501035_0043306
1651 Ga0501035_0130879
1652 Ga0501035_0333819
1653 Ga0501044_0000073
1654 Ga0501044_0030649
1655 Ga0501044_0032568
1656 Ga0501044_0044299
1657 Ga0501044_0057292
1658 Ga0501044_0088937
1659 Ga0501044_0257880
1660 Ga0501044_0334805
1661 Ga0501044_0409918
1662 Ga0501044_0448892
1663 Ga0501045_0034565
1664 Ga0501045_0154513
1665 nmdc:mga03683_111129_c1
1666 nmdc:mga03n38_31116_c1
1667 nmdc:mga00v17_74252_c1
1668 nmdc:mga0yw44_85728_c1
1669 nmdc:mga0k408_19959_c1
1670 nmdc:mga0k408_61999_c1
1671 nmdc:mga06z11_236772_c1
1672 nmdc:mga07m45_13691_c2
1673 nmdc:mga07m45_49001_c1
1674 nmdc:mga05p37_12681_c1
1675 nmdc:mga05p37_19_c2
1676 nmdc:mga09592_1297_c1
1677 nmdc:mga0qj67_259_c1
1678 nmdc:mga06r32_1133_c1
1679 nmdc:mga08y16_114800_c1
1680 nmdc:mga08y16_21083_c1
1681 nmdc:mga08y16_293458_c1
1682 nmdc:mga08y16_653311_c1
1683 nmdc:mga0n895_112359_c1
1684 nmdc:mga0n895_41918_c1
1685 nmdc:mga0n895_439753_c1
1686 nmdc:mga0n895_68456_c1
1687 nmdc:mga0n895_701_c1
1688 nmdc:mga0rr50_217046_c1
1689 nmdc:mga0rr50_63863_c1
1690 nmdc:mga0rr50_785_c1
1691 nmdc:mga0rr50_83435_c1
1692 nmdc:mga08x19_104497_c1
1693 nmdc:mga08x19_162458_c1
1694 nmdc:mga08x19_182439_c1
1695 nmdc:mga08x19_196928_c1
1696 nmdc:mga08x19_93555_c1
1697 nmdc:mga0a205_11208_c1
1698 nmdc:mga0a205_249_c1
1699 nmdc:mga0a205_284511_c1
1700 nmdc:mga0a205_88929_c2
1701 Ga0495601_0000186
1702 Ga0495601_0000677
1703 Ga0495601_0000798
1704 Ga0495601_0050367
1705 Ga0495601_0127885
1706 Ga0495601_0283553
1707 Ga0495612_0000089
1708 Ga0495612_0001470
1709 Ga0495612_0039065
1710 Ga0495595_0000369
1711 Ga0495595_0005480
1712 Ga0495595_0008524
1713 Ga0495619_0000052
1714 Ga0495619_0000078
1715 Ga0495619_0002831
1716 Ga0495619_0003693
1717 Ga0495619_0004203
1718 Ga0495619_0004787
1719 Ga0500644_0000406
1720 Ga0500651_0019843
1721 Ga0500651_0132785
1722 Ga0500566_0118772
1723 Ga0500641_0004364
1724 Ga0500641_0089619
1725 Ga0500562_034091
1726 Ga0500595_000001
1727 Ga0500595_019094
1728 Ga0500597_054645
1729 Ga0500652_003619
1730 Ga0500616_0000001
1731 Ga0500616_0014708
1732 Ga0500645_002831
1733 Ga0500645_054630
1734 Ga0501084_0379974
1735 Ga0501084_0477523
1736 Ga0501082_0005704
1737 Ga0501082_0061688
1738 Ga0501082_0125079
1739 Ga0501082_0131729
1740 Ga0501082_0268014
1741 Ga0501082_0694731
1742 2643758229

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01678

DAP_epimerase

Diaminopimelate epimerase

160

263

0.95

PF01678

DAP_epimerase

Diaminopimelate epimerase

9

128

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ha4-assembly1.cif.gz_A structure of a diaminopimelate epimerase from acinetobacter baumannii 0.7477 7 277
3ejx-assembly5.cif.gz_D crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap 0.7323 7 269
7vdy-assembly1.cif.gz_B crystal structure of o-ureidoserine racemase 0.7293 7 271
5ha4-assembly1.cif.gz_A structure of a diaminopimelate epimerase from acinetobacter baumannii 0.7251 7 277
6d13-assembly1.cif.gz_A crystal structure of e.coli rpph-dapf complex 0.7243 7 269
ID Description Score Start End Superfamily
af_P0A6K1_1_112_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9001 9 106 3.10.310.10
2q9jA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8951 8 113 3.10.310.10
af_I1NA10_49_204_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8843 9 127 3.10.310.10
3ejxD01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.877 7 121 3.10.310.10
af_Q58519_1_127_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8762 9 124 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A259AH67-F1-model_v4 diaminopimelate epimerase (EC 5.1.1.7) 0.97 1 105 GO:0005829
GO:0008837
GO:0009089
AF-A0A7Z9VGR8-F1-model_v4 Diaminopimelate epimerase (EC 5.1.1.7) 0.9597 7 122 GO:0005829
GO:0008837
GO:0009089
AF-A0A259AH67-F1-model_v4 diaminopimelate epimerase (EC 5.1.1.7) 0.9522 1 105 GO:0005829
GO:0008837
GO:0009089
AF-A0A528TU13-F1-model_v4 diaminopimelate epimerase (EC 5.1.1.7) 0.9495 9 106 GO:0005829
GO:0008837
GO:0009089
AF-A0A6P4GCA4-F1-model_v4 deleted 0.9481 13 106

Map