F484206
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 871 | 414 | 1742 | 287 |
Family's Representative Sequence
| Representative Sequence | 3300050507|nmdc:mga05p37_312467_c1|nmdc:mga05p37_312467_c1_841_1719 |
| Length | 279 |
| Sequence | MGALANHAFVKMNGLGNEIVVVDMRRQPAAISAAEARAAAQPDGAPYDQLMALYPPRTAGTDSYVRIYNSDGSESGACGNGMRCIASLITKETGKDTATFEVDGRVLNCWKHANTGLFTVDMGAPRFAWNEIPLAEKFNDTRKIELQIGPIDKPILHSPSAVNMGNPHAIFWVADVNAYDLGKVGPLLEHHPMFPQRANITLCAVKSPEHIEIRTWERGAGLTKACGSATGRKLKVTLPGGDLAVEWRERDSHVLMTGPVEYEYEGTFDPALFAKMGAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 10 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 17 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 87 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 88 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 89 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 94 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 95 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 103 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 106 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 107 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 109 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 124 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 125 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 141 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 142 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 217 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 218 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 219 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 220 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 222 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 223 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 224 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 225 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 226 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 227 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 228 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 229 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 230 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 236 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 239 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 240 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 244 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 246 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 251 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 252 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 253 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 255 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 256 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 257 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 259 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 260 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 262 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 263 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 264 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 265 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 266 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 267 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 268 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 269 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 270 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 271 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 272 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 273 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 274 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 275 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 276 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 277 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 278 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 279 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 280 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 281 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 341 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 342 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 343 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 344 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 345 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 346 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 349 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 350 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 351 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 352 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 353 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 354 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 384 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 385 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 386 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 387 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 388 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 389 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 390 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 403 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 404 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 405 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 406 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 407 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 408 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 409 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 410 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 411 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 412 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.77 |
| Metatranscriptomes | 0.11 |
| Isolates | 0.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.36 |
| Nodule | 0 |
| Rhizoplane | 6.43 |
| Rhizosphere | 88.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga05p37_312467_c1 | 3300050507 | Bacteria | 1862 |
| 2 | 2214750793 | 2209111006 | Bacteria | 3272 |
| 3 | ARcpr5oldR_c000008 | 3300000041 | Bacteria | 40651 |
| 4 | ARSoilYngRDRAFT_c00021 | 3300000042 | Bacteria | 23635 |
| 5 | ARcpr5yngRDRAFT_c000269 | 3300000043 | Bacteria | 7452 |
| 6 | ARSoilOldRDRAFT_c000004 | 3300000044 | Bacteria | 62556 |
| 7 | ARCol0oldRDRAFT_c00519 | 3300000045 | Bacteria | 3501 |
| 8 | ARCol0yngRDRAFT_1000405 | 3300000652 | Bacteria | 5751 |
| 9 | JGI24739J22299_10000119 | 3300001989 | Bacteria | 24437 |
| 10 | JGI24737J22298_10016402 | 3300001990 | Bacteria | 2391 |
| 11 | JGI24738J21930_10000653 | 3300002075 | Bacteria | 10027 |
| 12 | JGI24749J21850_1000821 | 3300002076 | Bacteria | 4457 |
| 13 | JGI24744J21845_10000855 | 3300002077 | Bacteria | 5755 |
| 14 | JGI24034J26672_10002428 | 3300002239 | Bacteria | 2561 |
| 15 | JGI25153J46596_10001550 | 3300003215 | Bacteria | 13655 |
| 16 | JGI25405J52794_10003987 | 3300003911 | Bacteria | 2615 |
| 17 | Ga0065716_1001943 | 3300005277 | Bacteria | 2685 |
| 18 | Ga0065704_10082626 | 3300005289 | Bacteria | 3574 |
| 19 | Ga0065712_10002667 | 3300005290 | Bacteria | 6357 |
| 20 | Ga0065712_10071402 | 3300005290 | Bacteria | 5290 |
| 21 | Ga0065715_10002782 | 3300005293 | Bacteria | 7282 |
| 22 | Ga0070658_10014072 | 3300005327 | Bacteria | 6424 |
| 23 | Ga0070683_100015125 | 3300005329 | Bacteria | 6772 |
| 24 | Ga0070683_100230825 | 3300005329 | Bacteria | 1759 |
| 25 | Ga0070690_100016228 | 3300005330 | Bacteria | 4457 |
| 26 | Ga0070690_100091164 | 3300005330 | Bacteria | 2008 |
| 27 | Ga0070670_100002160 | 3300005331 | Bacteria | 16146 |
| 28 | Ga0068869_100004994 | 3300005334 | Bacteria | 8305 |
| 29 | Ga0070666_10039476 | 3300005335 | Bacteria | 3147 |
| 30 | Ga0070680_100003115 | 3300005336 | Bacteria | 12309 |
| 31 | Ga0070680_100006411 | 3300005336 | Bacteria | 8939 |
| 32 | Ga0070680_100017168 | 3300005336 | Bacteria | 5703 |
| 33 | Ga0070682_100008882 | 3300005337 | Bacteria | 5675 |
| 34 | Ga0068868_100123546 | 3300005338 | Bacteria | 2112 |
| 35 | Ga0070660_100002712 | 3300005339 | Bacteria | 12162 |
| 36 | Ga0070660_100008655 | 3300005339 | Bacteria | 7128 |
| 37 | Ga0070660_100070972 | 3300005339 | Bacteria | 2719 |
| 38 | Ga0070689_100007061 | 3300005340 | Bacteria | 7818 |
| 39 | Ga0070689_100016827 | 3300005340 | Bacteria | 5359 |
| 40 | Ga0070689_100037360 | 3300005340 | Bacteria | 3713 |
| 41 | Ga0070691_10000519 | 3300005341 | Bacteria | 14524 |
| 42 | Ga0070687_100000762 | 3300005343 | Bacteria | 10689 |
| 43 | Ga0070661_100004148 | 3300005344 | Bacteria | 9994 |
| 44 | Ga0070661_100445464 | 3300005344 | Bacteria | 1030 |
| 45 | Ga0070692_10006740 | 3300005345 | Bacteria | 5006 |
| 46 | Ga0070668_100097991 | 3300005347 | Bacteria | 2319 |
| 47 | Ga0070669_100009605 | 3300005353 | Bacteria | 6888 |
| 48 | Ga0070675_100004458 | 3300005354 | Bacteria | 10679 |
| 49 | Ga0070671_100002139 | 3300005355 | Bacteria | 15248 |
| 50 | Ga0070671_100014975 | 3300005355 | Bacteria | 6263 |
| 51 | Ga0070671_100323004 | 3300005355 | Bacteria | 1315 |
| 52 | Ga0070674_100003695 | 3300005356 | Bacteria | 8622 |
| 53 | Ga0070674_100011100 | 3300005356 | Bacteria | 5470 |
| 54 | Ga0070674_100054945 | 3300005356 | Bacteria | 2756 |
| 55 | Ga0070673_100000278 | 3300005364 | Bacteria | 26473 |
| 56 | Ga0070673_100129073 | 3300005364 | Bacteria | 2118 |
| 57 | Ga0070688_100002472 | 3300005365 | Bacteria | 9344 |
| 58 | Ga0070688_100022886 | 3300005365 | Bacteria | 3669 |
| 59 | Ga0070659_100016217 | 3300005366 | Bacteria | 5591 |
| 60 | Ga0070667_100037839 | 3300005367 | Bacteria | 4045 |
| 61 | Ga0070667_100309820 | 3300005367 | Bacteria | 1423 |
| 62 | Ga0070703_10006001 | 3300005406 | Bacteria | 3400 |
| 63 | Ga0070709_10007640 | 3300005434 | Bacteria | 5933 |
| 64 | Ga0070709_10061034 | 3300005434 | Bacteria | 2399 |
| 65 | Ga0070714_100065202 | 3300005435 | Bacteria | 3137 |
| 66 | Ga0070714_100102072 | 3300005435 | Bacteria | 2528 |
| 67 | Ga0070713_100002202 | 3300005436 | Bacteria | 12626 |
| 68 | Ga0070713_100052565 | 3300005436 | Bacteria | 3373 |
| 69 | Ga0070710_10033061 | 3300005437 | Bacteria | 2806 |
| 70 | Ga0070710_10116315 | 3300005437 | Bacteria | 1612 |
| 71 | Ga0070701_10022153 | 3300005438 | Bacteria | 3043 |
| 72 | Ga0070711_100007031 | 3300005439 | Bacteria | 6827 |
| 73 | Ga0070711_100057039 | 3300005439 | Bacteria | 2702 |
| 74 | Ga0070705_100003982 | 3300005440 | Bacteria | 7219 |
| 75 | Ga0070700_100065143 | 3300005441 | Bacteria | 2309 |
| 76 | Ga0070694_100047324 | 3300005444 | Bacteria | 2890 |
| 77 | Ga0070694_100155820 | 3300005444 | Bacteria | 1672 |
| 78 | Ga0070694_100398195 | 3300005444 | Bacteria | 1077 |
| 79 | Ga0070663_100049191 | 3300005455 | Bacteria | 2992 |
| 80 | Ga0070663_100120175 | 3300005455 | Bacteria | 1984 |
| 81 | Ga0070678_100042719 | 3300005456 | Bacteria | 3224 |
| 82 | Ga0070662_100023146 | 3300005457 | Bacteria | 4264 |
| 83 | Ga0070681_10124512 | 3300005458 | Bacteria | 2510 |
| 84 | Ga0070681_10206665 | 3300005458 | Bacteria | 1880 |
| 85 | Ga0070681_10606952 | 3300005458 | Bacteria | 1009 |
| 86 | Ga0068867_100003764 | 3300005459 | Bacteria | 10677 |
| 87 | Ga0068867_100028355 | 3300005459 | Bacteria | 4031 |
| 88 | Ga0068867_100126057 | 3300005459 | Bacteria | 1984 |
| 89 | Ga0070685_10045920 | 3300005466 | Bacteria | 2507 |
| 90 | Ga0070679_100013963 | 3300005530 | Bacteria | 7697 |
| 91 | Ga0070679_100056479 | 3300005530 | Bacteria | 3912 |
| 92 | Ga0070679_100146290 | 3300005530 | Bacteria | 2341 |
| 93 | Ga0070679_100247411 | 3300005530 | Bacteria | 1740 |
| 94 | Ga0070679_100351995 | 3300005530 | Bacteria | 1420 |
| 95 | Ga0070679_100356422 | 3300005530 | Bacteria | 1410 |
| 96 | Ga0070684_100002161 | 3300005535 | Bacteria | 14516 |
| 97 | Ga0070684_100032052 | 3300005535 | Bacteria | 4477 |
| 98 | Ga0068853_100065701 | 3300005539 | Bacteria | 3148 |
| 99 | Ga0068853_100136870 | 3300005539 | Bacteria | 2196 |
| 100 | Ga0070672_100008897 | 3300005543 | Bacteria | 6897 |
| 101 | Ga0070686_100002376 | 3300005544 | Bacteria | 10368 |
| 102 | Ga0070686_100051856 | 3300005544 | Bacteria | 2613 |
| 103 | Ga0070686_100074409 | 3300005544 | Bacteria | 2232 |
| 104 | Ga0070695_100028064 | 3300005545 | Bacteria | 3491 |
| 105 | Ga0070695_100030233 | 3300005545 | Bacteria | 3371 |
| 106 | Ga0070693_100002348 | 3300005547 | Bacteria | 8698 |
| 107 | Ga0070693_100047618 | 3300005547 | Bacteria | 2440 |
| 108 | Ga0070693_100049315 | 3300005547 | Bacteria | 2401 |
| 109 | Ga0070665_100040827 | 3300005548 | Bacteria | 4663 |
| 110 | Ga0070704_100009589 | 3300005549 | Bacteria | 5860 |
| 111 | Ga0070704_100020522 | 3300005549 | Bacteria | 4262 |
| 112 | Ga0068855_100120810 | 3300005563 | Bacteria | 2998 |
| 113 | Ga0068855_100122447 | 3300005563 | Bacteria | 2976 |
| 114 | Ga0068855_100265043 | 3300005563 | Bacteria | 1912 |
| 115 | Ga0070664_100006568 | 3300005564 | Bacteria | 9381 |
| 116 | Ga0068857_100009381 | 3300005577 | Bacteria | 8494 |
| 117 | Ga0068857_100404457 | 3300005577 | Bacteria | 1271 |
| 118 | Ga0068854_100004762 | 3300005578 | Bacteria | 8555 |
| 119 | Ga0068856_100011377 | 3300005614 | Bacteria | 8632 |
| 120 | Ga0068852_100013724 | 3300005616 | Bacteria | 6209 |
| 121 | Ga0068859_100005699 | 3300005617 | Bacteria | 12674 |
| 122 | Ga0068859_100033770 | 3300005617 | Bacteria | 5136 |
| 123 | Ga0068859_100082374 | 3300005617 | Bacteria | 3260 |
| 124 | Ga0068859_100190634 | 3300005617 | Bacteria | 2134 |
| 125 | Ga0068864_100000715 | 3300005618 | Bacteria | 27854 |
| 126 | Ga0068864_100220189 | 3300005618 | Bacteria | 1751 |
| 127 | Ga0068866_10000992 | 3300005718 | Bacteria | 12484 |
| 128 | Ga0068866_10096179 | 3300005718 | Bacteria | 1624 |
| 129 | Ga0068861_100038639 | 3300005719 | Bacteria | 3557 |
| 130 | Ga0068870_10001034 | 3300005840 | Bacteria | 11000 |
| 131 | Ga0068863_100010345 | 3300005841 | Bacteria | 9061 |
| 132 | Ga0068863_100509401 | 3300005841 | Bacteria | 1186 |
| 133 | Ga0068858_100012900 | 3300005842 | Bacteria | 7881 |
| 134 | Ga0068858_100256457 | 3300005842 | Bacteria | 1662 |
| 135 | Ga0068858_100296281 | 3300005842 | Bacteria | 1542 |
| 136 | Ga0068862_100011703 | 3300005844 | Bacteria | 7240 |
| 137 | Ga0081455_10000002 | 3300005937 | Bacteria | 460472 |
| 138 | Ga0081455_10014993 | 3300005937 | Bacteria | 7549 |
| 139 | Ga0081455_10024073 | 3300005937 | Bacteria | 5648 |
| 140 | Ga0070717_10166008 | 3300006028 | Bacteria | 1918 |
| 141 | Ga0070717_10218361 | 3300006028 | Bacteria | 1675 |
| 142 | Ga0070717_10274337 | 3300006028 | Bacteria | 1494 |
| 143 | Ga0075368_10055549 | 3300006042 | Bacteria | 1578 |
| 144 | Ga0075363_100069748 | 3300006048 | Bacteria | 1907 |
| 145 | Ga0075363_100075300 | 3300006048 | Bacteria | 1839 |
| 146 | Ga0075363_100084473 | 3300006048 | Bacteria | 1741 |
| 147 | Ga0075432_10002282 | 3300006058 | Bacteria | 6384 |
| 148 | Ga0075432_10018616 | 3300006058 | Bacteria | 2369 |
| 149 | Ga0070715_10009757 | 3300006163 | Bacteria | 3396 |
| 150 | Ga0070715_10036612 | 3300006163 | Bacteria | 2025 |
| 151 | Ga0070715_10114076 | 3300006163 | Bacteria | 1279 |
| 152 | Ga0070712_100162115 | 3300006175 | Bacteria | 1727 |
| 153 | Ga0070712_100193545 | 3300006175 | Bacteria | 1593 |
| 154 | Ga0075362_10043769 | 3300006177 | Bacteria | 1983 |
| 155 | Ga0075367_10083936 | 3300006178 | Bacteria | 1930 |
| 156 | Ga0075369_10025847 | 3300006186 | Bacteria | 2444 |
| 157 | Ga0075427_10001160 | 3300006194 | Bacteria | 3337 |
| 158 | Ga0075366_10012706 | 3300006195 | Bacteria | 4783 |
| 159 | Ga0075366_10014070 | 3300006195 | Bacteria | 4565 |
| 160 | Ga0075366_10014999 | 3300006195 | Bacteria | 4431 |
| 161 | Ga0075366_10093437 | 3300006195 | Bacteria | 1802 |
| 162 | Ga0097621_100002611 | 3300006237 | Bacteria | 12347 |
| 163 | Ga0097621_100372225 | 3300006237 | Bacteria | 1274 |
| 164 | Ga0075370_10025998 | 3300006353 | Bacteria | 3240 |
| 165 | Ga0068871_100000012 | 3300006358 | Bacteria | 105267 |
| 166 | Ga0068871_100110227 | 3300006358 | Bacteria | 2314 |
| 167 | Ga0075428_100002408 | 3300006844 | Bacteria | 20309 |
| 168 | Ga0075430_100000032 | 3300006846 | Bacteria | 72679 |
| 169 | Ga0075431_100000903 | 3300006847 | Bacteria | 26158 |
| 170 | Ga0075433_10000976 | 3300006852 | Bacteria | 20309 |
| 171 | Ga0075433_10150031 | 3300006852 | Bacteria | 2073 |
| 172 | Ga0075433_10253362 | 3300006852 | Bacteria | 1561 |
| 173 | Ga0075433_10403970 | 3300006852 | Bacteria | 1205 |
| 174 | Ga0075434_100000341 | 3300006871 | Bacteria | 33666 |
| 175 | Ga0075434_100008227 | 3300006871 | Bacteria | 9681 |
| 176 | Ga0075434_100089709 | 3300006871 | Bacteria | 3075 |
| 177 | Ga0075434_100250439 | 3300006871 | Bacteria | 1791 |
| 178 | Ga0075429_100000561 | 3300006880 | Bacteria | 28469 |
| 179 | Ga0068865_100002705 | 3300006881 | Bacteria | 10514 |
| 180 | Ga0075436_100007663 | 3300006914 | Bacteria | 7377 |
| 181 | Ga0075436_100145082 | 3300006914 | Bacteria | 1669 |
| 182 | Ga0097620_100005699 | 3300006931 | Bacteria | 12674 |
| 183 | Ga0097620_100033767 | 3300006931 | Bacteria | 5136 |
| 184 | Ga0097620_100082374 | 3300006931 | Bacteria | 3260 |
| 185 | Ga0097620_100190625 | 3300006931 | Bacteria | 2134 |
| 186 | Ga0075435_100020155 | 3300007076 | Bacteria | 5103 |
| 187 | Ga0075435_100038297 | 3300007076 | Bacteria | 3823 |
| 188 | Ga0105251_10028097 | 3300009011 | Bacteria | 2845 |
| 189 | Ga0105250_10025741 | 3300009092 | Bacteria | 2371 |
| 190 | Ga0111539_10001270 | 3300009094 | Bacteria | 33682 |
| 191 | Ga0111539_10044176 | 3300009094 | Bacteria | 5339 |
| 192 | Ga0111539_10120803 | 3300009094 | Bacteria | 3070 |
| 193 | Ga0111539_10152872 | 3300009094 | Bacteria | 2701 |
| 194 | Ga0111539_10489501 | 3300009094 | Bacteria | 1432 |
| 195 | Ga0105245_10000460 | 3300009098 | Bacteria | 37264 |
| 196 | Ga0105245_10038487 | 3300009098 | Bacteria | 4255 |
| 197 | Ga0105247_10000881 | 3300009101 | Bacteria | 22689 |
| 198 | Ga0105247_10062048 | 3300009101 | Bacteria | 2318 |
| 199 | Ga0114129_10001035 | 3300009147 | Bacteria | 36374 |
| 200 | Ga0114129_10049815 | 3300009147 | Bacteria | 5885 |
| 201 | Ga0105243_10004739 | 3300009148 | Bacteria | 10698 |
| 202 | Ga0105243_10128115 | 3300009148 | Bacteria | 2150 |
| 203 | Ga0105243_10301587 | 3300009148 | Bacteria | 1452 |
| 204 | Ga0105243_10450285 | 3300009148 | Bacteria | 1208 |
| 205 | Ga0105241_10004650 | 3300009174 | Bacteria | 10147 |
| 206 | Ga0105241_10008370 | 3300009174 | Bacteria | 7618 |
| 207 | Ga0105242_10200826 | 3300009176 | Bacteria | 1771 |
| 208 | Ga0105248_10033712 | 3300009177 | Bacteria | 5722 |
| 209 | Ga0105248_10083081 | 3300009177 | Bacteria | 3603 |
| 210 | Ga0105248_10110218 | 3300009177 | Bacteria | 3103 |
| 211 | Ga0105248_10156104 | 3300009177 | Bacteria | 2575 |
| 212 | Ga0105237_10160826 | 3300009545 | Bacteria | 2244 |
| 213 | Ga0105237_10164073 | 3300009545 | Bacteria | 2220 |
| 214 | Ga0105249_10099335 | 3300009553 | Bacteria | 2735 |
| 215 | Ga0105239_10033955 | 3300010375 | Bacteria | 5601 |
| 216 | Ga0105239_10063805 | 3300010375 | Bacteria | 4044 |
| 217 | Ga0105239_10116695 | 3300010375 | Bacteria | 2962 |
| 218 | Ga0105239_10473927 | 3300010375 | Bacteria | 1422 |
| 219 | Ga0105246_10003054 | 3300011119 | Bacteria | 10161 |
| 220 | Ga0105246_10504659 | 3300011119 | Bacteria | 1028 |
| 221 | Ga0157341_1000565 | 3300012494 | Bacteria | 1923 |
| 222 | Ga0157342_1001832 | 3300012507 | Bacteria | 1643 |
| 223 | Ga0157373_10024356 | 3300013100 | Bacteria | 4385 |
| 224 | Ga0157373_10040293 | 3300013100 | Bacteria | 3343 |
| 225 | Ga0157373_10235188 | 3300013100 | Bacteria | 1294 |
| 226 | Ga0157371_10012799 | 3300013102 | Bacteria | 6395 |
| 227 | Ga0157369_10149116 | 3300013105 | Bacteria | 2472 |
| 228 | Ga0157374_10005485 | 3300013296 | Bacteria | 10651 |
| 229 | Ga0157378_10030471 | 3300013297 | Bacteria | 4767 |
| 230 | Ga0157378_10658225 | 3300013297 | Bacteria | 1064 |
| 231 | Ga0163162_10043904 | 3300013306 | Bacteria | 4475 |
| 232 | Ga0157372_10061874 | 3300013307 | Bacteria | 4192 |
| 233 | Ga0157372_10273924 | 3300013307 | Bacteria | 1961 |
| 234 | Ga0157375_10006955 | 3300013308 | Bacteria | 9875 |
| 235 | Ga0157375_10197306 | 3300013308 | Bacteria | 2168 |
| 236 | Ga0163163_10000824 | 3300014325 | Bacteria | 26424 |
| 237 | Ga0163163_10028743 | 3300014325 | Bacteria | 5343 |
| 238 | Ga0163163_10045150 | 3300014325 | Bacteria | 4325 |
| 239 | Ga0157380_10051367 | 3300014326 | Bacteria | 3261 |
| 240 | Ga0157377_10000747 | 3300014745 | Bacteria | 13471 |
| 241 | Ga0157377_10052187 | 3300014745 | Bacteria | 2308 |
| 242 | Ga0157379_10007473 | 3300014968 | Bacteria | 9462 |
| 243 | Ga0157379_10018294 | 3300014968 | Bacteria | 6176 |
| 244 | Ga0157376_10057154 | 3300014969 | Bacteria | 3262 |
| 245 | Ga0163161_10014113 | 3300017792 | Bacteria | 5564 |
| 246 | Ga0206356_11408241 | 3300020070 | Bacteria | 2136 |
| 247 | Ga0213876_10015539 | 3300021384 | Bacteria | 4028 |
| 248 | Ga0213876_10063571 | 3300021384 | Bacteria | 1949 |
| 249 | Ga0213875_10000033 | 3300021388 | Bacteria | 170944 |
| 250 | Ga0207666_1000321 | 3300025271 | Bacteria | 6685 |
| 251 | Ga0209758_1000469 | 3300025297 | Bacteria | 66568 |
| 252 | Ga0207653_10007479 | 3300025885 | Bacteria | 3405 |
| 253 | Ga0207682_10000011 | 3300025893 | Bacteria | 85533 |
| 254 | Ga0207692_10003084 | 3300025898 | Bacteria | 6471 |
| 255 | Ga0207642_10000524 | 3300025899 | Bacteria | 11752 |
| 256 | Ga0207642_10036802 | 3300025899 | Bacteria | 2104 |
| 257 | Ga0207710_10002624 | 3300025900 | Bacteria | 8291 |
| 258 | Ga0207710_10023925 | 3300025900 | Bacteria | 2628 |
| 259 | Ga0207710_10088397 | 3300025900 | Unclassified | 1447 |
| 260 | Ga0207688_10013082 | 3300025901 | Bacteria | 4510 |
| 261 | Ga0207680_10013942 | 3300025903 | Bacteria | 4144 |
| 262 | Ga0207647_10016450 | 3300025904 | Bacteria | 5049 |
| 263 | Ga0207685_10075112 | 3300025905 | Bacteria | 1382 |
| 264 | Ga0207685_10083721 | 3300025905 | Bacteria | 1326 |
| 265 | Ga0207685_10131663 | 3300025905 | Bacteria | 1111 |
| 266 | Ga0207699_10009636 | 3300025906 | Bacteria | 4819 |
| 267 | Ga0207699_10028372 | 3300025906 | Bacteria | 3110 |
| 268 | Ga0207699_10037784 | 3300025906 | Bacteria | 2763 |
| 269 | Ga0207645_10000788 | 3300025907 | Bacteria | 26477 |
| 270 | Ga0207645_10025475 | 3300025907 | Bacteria | 3827 |
| 271 | Ga0207643_10000284 | 3300025908 | Bacteria | 35172 |
| 272 | Ga0207643_10250228 | 3300025908 | Bacteria | 1091 |
| 273 | Ga0207705_10004585 | 3300025909 | Bacteria | 10439 |
| 274 | Ga0207705_10082151 | 3300025909 | Bacteria | 2349 |
| 275 | Ga0207654_10008933 | 3300025911 | Bacteria | 5082 |
| 276 | Ga0207707_10016051 | 3300025912 | Bacteria | 6530 |
| 277 | Ga0207707_10041522 | 3300025912 | Bacteria | 4017 |
| 278 | Ga0207707_10152501 | 3300025912 | Bacteria | 2020 |
| 279 | Ga0207695_10160029 | 3300025913 | Bacteria | 2184 |
| 280 | Ga0207671_10260053 | 3300025914 | Bacteria | 1366 |
| 281 | Ga0207693_10016842 | 3300025915 | Bacteria | 5835 |
| 282 | Ga0207693_10020112 | 3300025915 | Bacteria | 5310 |
| 283 | Ga0207693_10024473 | 3300025915 | Bacteria | 4791 |
| 284 | Ga0207693_10051020 | 3300025915 | Bacteria | 3248 |
| 285 | Ga0207663_10013091 | 3300025916 | Bacteria | 4501 |
| 286 | Ga0207663_10027630 | 3300025916 | Bacteria | 3310 |
| 287 | Ga0207660_10078958 | 3300025917 | Bacteria | 2413 |
| 288 | Ga0207660_10214577 | 3300025917 | Bacteria | 1508 |
| 289 | Ga0207662_10021432 | 3300025918 | Bacteria | 3693 |
| 290 | Ga0207662_10229285 | 3300025918 | Bacteria | 1212 |
| 291 | Ga0207657_10036437 | 3300025919 | Bacteria | 4403 |
| 292 | Ga0207657_10052478 | 3300025919 | Bacteria | 3538 |
| 293 | Ga0207649_10000057 | 3300025920 | Bacteria | 102314 |
| 294 | Ga0207649_10113866 | 3300025920 | Bacteria | 1812 |
| 295 | Ga0207652_10021510 | 3300025921 | Bacteria | 5323 |
| 296 | Ga0207681_10000181 | 3300025923 | Bacteria | 51755 |
| 297 | Ga0207694_10040270 | 3300025924 | Bacteria | 3596 |
| 298 | Ga0207650_10124772 | 3300025925 | Bacteria | 2009 |
| 299 | Ga0207659_10000028 | 3300025926 | Bacteria | 130804 |
| 300 | Ga0207659_10061296 | 3300025926 | Bacteria | 2711 |
| 301 | Ga0207687_10000061 | 3300025927 | Bacteria | 84113 |
| 302 | Ga0207687_10199537 | 3300025927 | Bacteria | 1563 |
| 303 | Ga0207700_10044738 | 3300025928 | Bacteria | 3261 |
| 304 | Ga0207700_10214544 | 3300025928 | Bacteria | 1629 |
| 305 | Ga0207664_10187902 | 3300025929 | Bacteria | 1777 |
| 306 | Ga0207644_10000315 | 3300025931 | Bacteria | 31527 |
| 307 | Ga0207690_10003360 | 3300025932 | Bacteria | 9568 |
| 308 | Ga0207706_10038800 | 3300025933 | Bacteria | 4224 |
| 309 | Ga0207686_10010685 | 3300025934 | Bacteria | 5000 |
| 310 | Ga0207686_10025623 | 3300025934 | Bacteria | 3433 |
| 311 | Ga0207686_10053137 | 3300025934 | Bacteria | 2531 |
| 312 | Ga0207709_10000539 | 3300025935 | Bacteria | 32486 |
| 313 | Ga0207709_10046250 | 3300025935 | Bacteria | 2640 |
| 314 | Ga0207709_10085023 | 3300025935 | Bacteria | 2050 |
| 315 | Ga0207670_10000217 | 3300025936 | Bacteria | 37598 |
| 316 | Ga0207670_10060747 | 3300025936 | Bacteria | 2576 |
| 317 | Ga0207670_10062944 | 3300025936 | Bacteria | 2537 |
| 318 | Ga0207669_10000147 | 3300025937 | Bacteria | 34031 |
| 319 | Ga0207669_10035654 | 3300025937 | Bacteria | 2833 |
| 320 | Ga0207704_10000299 | 3300025938 | Bacteria | 23415 |
| 321 | Ga0207665_10001292 | 3300025939 | Bacteria | 16913 |
| 322 | Ga0207665_10024608 | 3300025939 | Bacteria | 3971 |
| 323 | Ga0207691_10015666 | 3300025940 | Bacteria | 7206 |
| 324 | Ga0207691_10285750 | 3300025940 | Bacteria | 1419 |
| 325 | Ga0207711_10001580 | 3300025941 | Bacteria | 21028 |
| 326 | Ga0207711_10028537 | 3300025941 | Bacteria | 4696 |
| 327 | Ga0207711_10114282 | 3300025941 | Bacteria | 2404 |
| 328 | Ga0207689_10103768 | 3300025942 | Bacteria | 2336 |
| 329 | Ga0207661_10000215 | 3300025944 | Bacteria | 37435 |
| 330 | Ga0207679_10000026 | 3300025945 | Bacteria | 200073 |
| 331 | Ga0207667_10015965 | 3300025949 | Bacteria | 8504 |
| 332 | Ga0207651_10000173 | 3300025960 | Bacteria | 27970 |
| 333 | Ga0207712_10005574 | 3300025961 | Bacteria | 7941 |
| 334 | Ga0207668_10000242 | 3300025972 | Bacteria | 36700 |
| 335 | Ga0207668_10071828 | 3300025972 | Bacteria | 2474 |
| 336 | Ga0207640_10003534 | 3300025981 | Bacteria | 8427 |
| 337 | Ga0207677_10006056 | 3300026023 | Bacteria | 6597 |
| 338 | Ga0207703_10022834 | 3300026035 | Bacteria | 4914 |
| 339 | Ga0207703_10267695 | 3300026035 | Bacteria | 1547 |
| 340 | Ga0207639_10042423 | 3300026041 | Bacteria | 3409 |
| 341 | Ga0207678_10040853 | 3300026067 | Bacteria | 4021 |
| 342 | Ga0207678_10050370 | 3300026067 | Bacteria | 3598 |
| 343 | Ga0207708_10172949 | 3300026075 | Bacteria | 1712 |
| 344 | Ga0207702_10012057 | 3300026078 | Bacteria | 7188 |
| 345 | Ga0207702_10034120 | 3300026078 | Bacteria | 4253 |
| 346 | Ga0207702_10214522 | 3300026078 | Bacteria | 1791 |
| 347 | Ga0207641_10015438 | 3300026088 | Bacteria | 6257 |
| 348 | Ga0207641_10122423 | 3300026088 | Bacteria | 2323 |
| 349 | Ga0207641_10396813 | 3300026088 | Unclassified | 1324 |
| 350 | Ga0207648_10019819 | 3300026089 | Bacteria | 6070 |
| 351 | Ga0207648_10669775 | 3300026089 | Bacteria | 960 |
| 352 | Ga0207676_10000361 | 3300026095 | Bacteria | 38795 |
| 353 | Ga0207674_10026550 | 3300026116 | Bacteria | 6146 |
| 354 | Ga0207674_10476045 | 3300026116 | Bacteria | 1207 |
| 355 | Ga0207675_100128119 | 3300026118 | Bacteria | 2405 |
| 356 | Ga0207675_100600621 | 3300026118 | Bacteria | 1103 |
| 357 | Ga0207683_10000034 | 3300026121 | Bacteria | 101817 |
| 358 | Ga0207683_10005439 | 3300026121 | Bacteria | 10906 |
| 359 | Ga0207683_10162730 | 3300026121 | Bacteria | 2018 |
| 360 | Ga0207683_10181584 | 3300026121 | Bacteria | 1908 |
| 361 | Ga0207698_10017559 | 3300026142 | Bacteria | 4859 |
| 362 | Ga0207698_10031807 | 3300026142 | Bacteria | 3814 |
| 363 | Ga0207698_10087200 | 3300026142 | Bacteria | 2541 |
| 364 | Ga0207698_10390606 | 3300026142 | Bacteria | 1327 |
| 365 | Ga0209983_1004372 | 3300027665 | Bacteria | 2970 |
| 366 | Ga0209971_1001670 | 3300027682 | Bacteria | 5485 |
| 367 | Ga0209966_1000943 | 3300027695 | Bacteria | 5469 |
| 368 | Ga0207428_10000082 | 3300027907 | Bacteria | 133684 |
| 369 | Ga0207428_10000352 | 3300027907 | Bacteria | 59444 |
| 370 | Ga0207428_10020766 | 3300027907 | Bacteria | 5571 |
| 371 | Ga0268265_10008848 | 3300028380 | Bacteria | 6804 |
| 372 | Ga0268265_10328819 | 3300028380 | Bacteria | 1387 |
| 373 | Ga0268264_10007704 | 3300028381 | Bacteria | 8970 |
| 374 | Ga0268264_10051446 | 3300028381 | Bacteria | 3433 |
| 375 | Ga0265338_10039627 | 3300028800 | Bacteria | 4441 |
| 376 | Ga0265338_10233865 | 3300028800 | Bacteria | 1365 |
| 377 | Ga0265330_10037830 | 3300031235 | Bacteria | 2146 |
| 378 | Ga0265332_10118736 | 3300031238 | Bacteria | 1111 |
| 379 | Ga0265325_10000141 | 3300031241 | Bacteria | 50291 |
| 380 | Ga0265325_10000843 | 3300031241 | Bacteria | 22219 |
| 381 | Ga0265325_10026910 | 3300031241 | Bacteria | 3112 |
| 382 | Ga0265340_10015105 | 3300031247 | Bacteria | 4017 |
| 383 | Ga0265340_10067444 | 3300031247 | Bacteria | 1700 |
| 384 | Ga0265331_10149821 | 3300031250 | Bacteria | 1060 |
| 385 | Ga0265313_10000008 | 3300031595 | Bacteria | 173405 |
| 386 | Ga0265313_10003676 | 3300031595 | Bacteria | 12252 |
| 387 | Ga0265313_10013058 | 3300031595 | Bacteria | 5019 |
| 388 | Ga0265314_10004544 | 3300031711 | Bacteria | 12816 |
| 389 | Ga0265314_10015204 | 3300031711 | Bacteria | 6114 |
| 390 | Ga0265342_10000841 | 3300031712 | Bacteria | 30728 |
| 391 | Ga0265342_10080869 | 3300031712 | Bacteria | 1877 |
| 392 | Ga0265342_10201713 | 3300031712 | Bacteria | 1080 |
| 393 | Ga0316583_10032267 | 3300032133 | Bacteria | 1862 |
| 394 | Ga0373930_0001225 | 3300034816 | Bacteria | 3786 |
| 395 | Ga0373948_0000052 | 3300034817 | Bacteria | 12263 |
| 396 | Ga0373958_0004612 | 3300034819 | Bacteria | 2048 |
| 397 | Ga0373958_0005653 | 3300034819 | Bacteria | 1912 |
| 398 | Ga0373959_0002099 | 3300034820 | Bacteria | 3182 |
| 399 | Ga0373938_0000498 | 3300034957 | Bacteria | 6339 |
| 400 | Ga0373938_0002088 | 3300034957 | Bacteria | 3213 |
| 401 | Ga0373928_0051459 | 3300035084 | Bacteria | 974 |
| 402 | Ga0373929_0000220 | 3300035085 | Bacteria | 10415 |
| 403 | Ga0373934_0064869 | 3300035086 | Bacteria | 1458 |
| 404 | Ga0373940_0000725 | 3300035088 | Bacteria | 5367 |
| 405 | Ga0373940_0008718 | 3300035088 | Bacteria | 2339 |
| 406 | Ga0373944_0006118 | 3300035089 | Bacteria | 3188 |
| 407 | Ga0373949_0001073 | 3300035090 | Bacteria | 8354 |
| 408 | Ga0373949_0001411 | 3300035090 | Bacteria | 6869 |
| 409 | Ga0373949_0021002 | 3300035090 | Bacteria | 1498 |
| 410 | Ga0373951_0000946 | 3300035091 | Bacteria | 7808 |
| 411 | Ga0373951_0008358 | 3300035091 | Bacteria | 2340 |
| 412 | Ga0373951_0041905 | 3300035091 | Bacteria | 1106 |
| 413 | Ga0373952_0001673 | 3300035092 | Bacteria | 4033 |
| 414 | Ga0373952_0059739 | 3300035092 | Bacteria | 929 |
| 415 | Ga0373923_0000447 | 3300035111 | Bacteria | 9774 |
| 416 | Ga0373923_0095622 | 3300035111 | Bacteria | 1304 |
| 417 | Ga0373932_0008422 | 3300035112 | Bacteria | 2465 |
| 418 | Ga0373932_0016104 | 3300035112 | Bacteria | 1904 |
| 419 | Ga0373936_0003030 | 3300035113 | Bacteria | 6279 |
| 420 | Ga0373939_0002953 | 3300035114 | Bacteria | 3995 |
| 421 | Ga0373939_0008951 | 3300035114 | Bacteria | 2468 |
| 422 | Ga0373939_0045159 | 3300035114 | Bacteria | 1343 |
| 423 | Ga0373941_0000374 | 3300035115 | Bacteria | 8935 |
| 424 | Ga0373941_0000572 | 3300035115 | Bacteria | 7395 |
| 425 | Ga0373941_0001591 | 3300035115 | Bacteria | 4829 |
| 426 | Ga0373941_0062799 | 3300035115 | Bacteria | 1213 |
| 427 | Ga0373954_0008903 | 3300035118 | Bacteria | 4416 |
| 428 | Ga0373954_0055607 | 3300035118 | Bacteria | 1862 |
| 429 | Ga0373956_0019915 | 3300035119 | Bacteria | 2850 |
| 430 | Ga0373956_0101575 | 3300035119 | Bacteria | 1334 |
| 431 | Ga0373957_0000582 | 3300035120 | Bacteria | 9224 |
| 432 | Ga0373960_0000735 | 3300035121 | Bacteria | 6847 |
| 433 | Ga0373943_0021918 | 3300035170 | Bacteria | 2953 |
| 434 | Ga0373946_0004134 | 3300035171 | Bacteria | 5169 |
| 435 | Ga0373946_0048357 | 3300035171 | Bacteria | 1770 |
| 436 | Ga0373955_0018189 | 3300035172 | Bacteria | 3491 |
| 437 | Ga0373955_0027707 | 3300035172 | Bacteria | 2932 |
| 438 | Ga0373942_0000845 | 3300035207 | Bacteria | 8411 |
| 439 | Ga0373942_0010376 | 3300035207 | Bacteria | 2192 |
| 440 | Ga0373942_0011864 | 3300035207 | Bacteria | 2072 |
| 441 | Ga0373961_0000729 | 3300035241 | Bacteria | 11431 |
| 442 | Ga0373961_0006236 | 3300035241 | Bacteria | 2866 |
| 443 | Ga0373962_0002348 | 3300035242 | Bacteria | 4514 |
| 444 | Ga0373962_0003814 | 3300035242 | Bacteria | 3622 |
| 445 | Ga0373924_0001555 | 3300035410 | Bacteria | 7489 |
| 446 | Ga0373924_0074916 | 3300035410 | Bacteria | 1432 |
| 447 | Ga0373924_0090277 | 3300035410 | Bacteria | 1310 |
| 448 | Ga0373931_0011579 | 3300035691 | Bacteria | 4260 |
| 449 | Ga0373931_0026325 | 3300035691 | Bacteria | 2960 |
| 450 | Ga0373931_0065181 | 3300035691 | Bacteria | 1973 |
| 451 | Ga0373931_0113467 | 3300035691 | Bacteria | 1540 |
| 452 | Ga0373935_0041438 | 3300035692 | Bacteria | 2892 |
| 453 | Ga0373935_0084760 | 3300035692 | Bacteria | 2064 |
| 454 | Ga0373935_0089813 | 3300035692 | Bacteria | 2010 |
| 455 | Ga0373927_0043006 | 3300035695 | Bacteria | 2926 |
| 456 | Ga0373927_0084349 | 3300035695 | Bacteria | 2060 |
| 457 | Ga0373933_0001723 | 3300035724 | Bacteria | 12691 |
| 458 | Ga0373933_0007095 | 3300035724 | Bacteria | 6102 |
| 459 | Ga0373933_0018872 | 3300035724 | Bacteria | 3885 |
| 460 | Ga0373947_0004938 | 3300035725 | Bacteria | 7800 |
| 461 | Ga0373947_0015425 | 3300035725 | Bacteria | 4385 |
| 462 | Ga0373947_0024258 | 3300035725 | Bacteria | 3534 |
| 463 | Ga0373947_0273392 | 3300035725 | Bacteria | 1122 |
| 464 | Ga0373937_0003184 | 3300036401 | Bacteria | 13739 |
| 465 | Ga0373937_0005156 | 3300036401 | Bacteria | 11139 |
| 466 | Ga0373937_0021697 | 3300036401 | Bacteria | 5764 |
| 467 | Ga0316582_0307827 | 3300036647 | Bacteria | 1089 |
| 468 | Ga0316584_0404667 | 3300036712 | Bacteria | 972 |
| 469 | Ga0373925_0009568 | 3300037068 | Bacteria | 7060 |
| 470 | Ga0373925_0025014 | 3300037068 | Bacteria | 4360 |
| 471 | Ga0373925_0083791 | 3300037068 | Bacteria | 2429 |
| 472 | Ga0373925_0136345 | 3300037068 | Bacteria | 1918 |
| 473 | Ga0373925_0351432 | 3300037068 | Bacteria | 1197 |
| 474 | Ga0395900_0003585 | 3300037418 | Bacteria | 16692 |
| 475 | Ga0395898_0036583 | 3300037466 | Bacteria | 4874 |
| 476 | Ga0395898_0129626 | 3300037466 | Bacteria | 2416 |
| 477 | Ga0395898_0137333 | 3300037466 | Bacteria | 2341 |
| 478 | Ga0436364_0509271 | 3300037853 | Bacteria | 1234 |
| 479 | Ga0436364_0852054 | 3300037853 | Bacteria | 1182 |
| 480 | Ga0436364_1338082 | 3300037853 | Bacteria | 27858 |
| 481 | Ga0436364_1419137 | 3300037853 | Bacteria | 4857 |
| 482 | Ga0395901_0443569 | 3300038443 | Bacteria | 1328 |
| 483 | Ga0242420_001406 | 3300038996 | Bacteria | 3207 |
| 484 | Ga0436365_0396058 | 3300039437 | Bacteria | 4165 |
| 485 | Ga0439450_003470 | 3300042008 | Bacteria | 2609 |
| 486 | Ga0439463_018014 | 3300042016 | Bacteria | 1756 |
| 487 | Ga0439464_0007302 | 3300042439 | Bacteria | 2889 |
| 488 | Ga0439460_0005008 | 3300042461 | Bacteria | 3239 |
| 489 | Ga0451577_0189237 | 3300042876 | Bacteria | 1856 |
| 490 | Ga0439440_0023424 | 3300042993 | Bacteria | 1408 |
| 491 | Ga0466966_0034416 | 3300044684 | Bacteria | 3275 |
| 492 | Ga0466963_0118655 | 3300044694 | Bacteria | 1819 |
| 493 | Ga0466963_0357762 | 3300044694 | Bacteria | 1028 |
| 494 | Ga0453684_0268649 | 3300044712 | Bacteria | 1950 |
| 495 | Ga0466957_0009192 | 3300044842 | Bacteria | 5638 |
| 496 | Ga0466957_0020655 | 3300044842 | Bacteria | 3876 |
| 497 | Ga0466957_0199630 | 3300044842 | Bacteria | 1313 |
| 498 | Ga0466959_0110327 | 3300045049 | Bacteria | 1964 |
| 499 | Ga0451576_0004698 | 3300045051 | Bacteria | 17570 |
| 500 | Ga0451576_0514279 | 3300045051 | Bacteria | 1258 |
| 501 | Ga0466958_0267554 | 3300045836 | Bacteria | 1094 |
| 502 | Ga0466967_0377646 | 3300045976 | Bacteria | 1376 |
| 503 | Ga0495592_0001184 | 3300046454 | Bacteria | 18095 |
| 504 | Ga0495592_0044323 | 3300046454 | Bacteria | 3324 |
| 505 | Ga0495592_0055711 | 3300046454 | Bacteria | 2923 |
| 506 | Ga0495603_0017601 | 3300046455 | Bacteria | 4327 |
| 507 | Ga0495603_0046194 | 3300046455 | Bacteria | 2595 |
| 508 | Ga0495603_0096922 | 3300046455 | Bacteria | 1723 |
| 509 | Ga0495629_0000062 | 3300046459 | Bacteria | 97169 |
| 510 | Ga0495641_0003407 | 3300046461 | Bacteria | 11913 |
| 511 | Ga0495641_0061784 | 3300046461 | Bacteria | 1690 |
| 512 | Ga0495651_0000895 | 3300046462 | Bacteria | 23161 |
| 513 | Ga0495651_0005305 | 3300046462 | Bacteria | 9828 |
| 514 | Ga0495651_0092901 | 3300046462 | Bacteria | 2260 |
| 515 | Ga0495653_0000987 | 3300046463 | Bacteria | 21890 |
| 516 | Ga0495653_0004420 | 3300046463 | Bacteria | 11365 |
| 517 | Ga0495653_0012511 | 3300046463 | Bacteria | 6929 |
| 518 | Ga0495580_0022207 | 3300046472 | Bacteria | 4672 |
| 519 | Ga0495580_0279372 | 3300046472 | Bacteria | 1139 |
| 520 | Ga0495582_0027873 | 3300046473 | Bacteria | 3098 |
| 521 | Ga0495639_0007730 | 3300046475 | Bacteria | 4622 |
| 522 | Ga0495662_0058637 | 3300046476 | Bacteria | 1859 |
| 523 | Ga0495664_0007609 | 3300046477 | Bacteria | 6021 |
| 524 | Ga0495664_0034445 | 3300046477 | Bacteria | 2979 |
| 525 | Ga0495664_0069608 | 3300046477 | Bacteria | 2100 |
| 526 | Ga0495584_0035400 | 3300046491 | Bacteria | 2524 |
| 527 | Ga0495585_0000389 | 3300046492 | Bacteria | 42431 |
| 528 | Ga0495594_0033468 | 3300046499 | Bacteria | 2794 |
| 529 | Ga0495594_0098308 | 3300046499 | Bacteria | 1645 |
| 530 | Ga0495607_0001903 | 3300046501 | Bacteria | 17695 |
| 531 | Ga0495608_0000129 | 3300046511 | Bacteria | 53862 |
| 532 | Ga0495608_0013594 | 3300046511 | Bacteria | 5646 |
| 533 | Ga0495608_0038785 | 3300046511 | Bacteria | 3197 |
| 534 | Ga0495618_0001726 | 3300046514 | Bacteria | 14506 |
| 535 | Ga0495618_0052717 | 3300046514 | Bacteria | 2571 |
| 536 | Ga0495618_0138521 | 3300046514 | Bacteria | 1556 |
| 537 | Ga0495628_0001570 | 3300046516 | Bacteria | 20927 |
| 538 | Ga0495628_0004609 | 3300046516 | Bacteria | 12184 |
| 539 | Ga0495628_0008485 | 3300046516 | Bacteria | 8808 |
| 540 | Ga0495630_0034904 | 3300046517 | Bacteria | 3757 |
| 541 | Ga0495630_0081529 | 3300046517 | Bacteria | 2441 |
| 542 | Ga0495630_0092520 | 3300046517 | Bacteria | 2285 |
| 543 | Ga0495637_0051495 | 3300046520 | Bacteria | 1723 |
| 544 | Ga0495666_0006354 | 3300046526 | Bacteria | 5949 |
| 545 | Ga0495652_0004520 | 3300046529 | Bacteria | 13265 |
| 546 | Ga0495652_0005753 | 3300046529 | Bacteria | 11605 |
| 547 | Ga0495652_0055841 | 3300046529 | Bacteria | 3356 |
| 548 | Ga0495640_0043252 | 3300046533 | Bacteria | 3138 |
| 549 | Ga0495640_0077409 | 3300046533 | Bacteria | 2217 |
| 550 | Ga0495586_0052098 | 3300046535 | Bacteria | 2215 |
| 551 | Ga0495587_0000354 | 3300046536 | Bacteria | 32868 |
| 552 | Ga0495587_0036168 | 3300046536 | Bacteria | 2971 |
| 553 | Ga0495598_0040307 | 3300046537 | Bacteria | 1361 |
| 554 | Ga0495621_0038339 | 3300046539 | Bacteria | 1671 |
| 555 | Ga0495645_0000800 | 3300046543 | Bacteria | 21568 |
| 556 | Ga0495645_0001074 | 3300046543 | Bacteria | 18551 |
| 557 | Ga0495645_0128873 | 3300046543 | Bacteria | 1775 |
| 558 | Ga0495622_0004193 | 3300046557 | Bacteria | 6720 |
| 559 | Ga0495633_0011365 | 3300046558 | Bacteria | 4803 |
| 560 | Ga0495667_0002315 | 3300046559 | Bacteria | 12757 |
| 561 | Ga0495667_0054524 | 3300046559 | Bacteria | 2630 |
| 562 | Ga0495667_0062177 | 3300046559 | Bacteria | 2447 |
| 563 | Ga0495656_0001813 | 3300046615 | Bacteria | 7024 |
| 564 | Ga0495634_0014173 | 3300046642 | Bacteria | 5752 |
| 565 | Ga0495634_0035924 | 3300046642 | Bacteria | 3391 |
| 566 | Ga0495634_0130384 | 3300046642 | Bacteria | 1603 |
| 567 | Ga0495635_0001388 | 3300046663 | Bacteria | 16150 |
| 568 | Ga0495635_0008767 | 3300046663 | Bacteria | 7061 |
| 569 | Ga0495635_0129123 | 3300046663 | Bacteria | 1723 |
| 570 | Ga0495659_0000966 | 3300046664 | Bacteria | 10132 |
| 571 | Ga0495661_0012736 | 3300046665 | Bacteria | 5675 |
| 572 | Ga0495588_0004563 | 3300046674 | Bacteria | 6122 |
| 573 | Ga0495657_0001374 | 3300046675 | Bacteria | 21110 |
| 574 | Ga0495657_0035497 | 3300046675 | Bacteria | 3454 |
| 575 | Ga0495657_0072817 | 3300046675 | Bacteria | 2240 |
| 576 | Ga0495599_0000294 | 3300046678 | Bacteria | 30376 |
| 577 | Ga0495599_0011840 | 3300046678 | Bacteria | 5363 |
| 578 | Ga0495599_0021018 | 3300046678 | Bacteria | 4069 |
| 579 | Ga0495599_0234212 | 3300046678 | Bacteria | 1121 |
| 580 | Ga0495623_0000055 | 3300046679 | Bacteria | 69548 |
| 581 | Ga0495623_0026535 | 3300046679 | Bacteria | 3728 |
| 582 | Ga0495646_0000749 | 3300046680 | Bacteria | 18095 |
| 583 | Ga0495646_0003654 | 3300046680 | Bacteria | 9601 |
| 584 | Ga0495647_0056855 | 3300046681 | Bacteria | 1534 |
| 585 | Ga0495658_0000109 | 3300046683 | Bacteria | 43760 |
| 586 | Ga0495613_0043839 | 3300046689 | Bacteria | 3310 |
| 587 | Ga0495613_0126968 | 3300046689 | Bacteria | 1828 |
| 588 | Ga0495624_0031740 | 3300046690 | Bacteria | 3430 |
| 589 | Ga0495670_0000106 | 3300046691 | Bacteria | 37100 |
| 590 | Ga0495600_0001208 | 3300046809 | Bacteria | 14164 |
| 591 | Ga0495600_0013152 | 3300046809 | Bacteria | 5191 |
| 592 | Ga0495600_0014646 | 3300046809 | Bacteria | 4943 |
| 593 | Ga0495600_0020004 | 3300046809 | Bacteria | 4280 |
| 594 | Ga0495581_0001433 | 3300047315 | Bacteria | 13240 |
| 595 | Ga0495604_0004110 | 3300047317 | Bacteria | 11566 |
| 596 | Ga0495604_0010002 | 3300047317 | Bacteria | 7509 |
| 597 | Ga0495604_0015210 | 3300047317 | Bacteria | 6142 |
| 598 | Ga0495674_0005151 | 3300047319 | Bacteria | 12554 |
| 599 | Ga0495674_0033478 | 3300047319 | Bacteria | 4653 |
| 600 | Ga0495674_0073366 | 3300047319 | Bacteria | 2950 |
| 601 | Ga0495680_0003711 | 3300047322 | Bacteria | 14906 |
| 602 | Ga0495680_0008181 | 3300047322 | Bacteria | 9536 |
| 603 | Ga0495680_0019769 | 3300047322 | Bacteria | 5680 |
| 604 | Ga0495680_0056282 | 3300047322 | Bacteria | 3045 |
| 605 | Ga0495680_0076363 | 3300047322 | Bacteria | 2540 |
| 606 | Ga0495680_0310550 | 3300047322 | Bacteria | 1105 |
| 607 | Ga0495675_0000190 | 3300047444 | Bacteria | 44968 |
| 608 | Ga0495675_0119547 | 3300047444 | Bacteria | 1641 |
| 609 | Ga0495681_0028053 | 3300047470 | Bacteria | 2903 |
| 610 | Ga0495684_0010816 | 3300047471 | Bacteria | 7054 |
| 611 | Ga0495684_0044448 | 3300047471 | Bacteria | 3401 |
| 612 | Ga0495684_0067663 | 3300047471 | Bacteria | 2716 |
| 613 | Ga0495593_0001596 | 3300047673 | Bacteria | 13393 |
| 614 | Ga0495593_0032614 | 3300047673 | Bacteria | 2838 |
| 615 | Ga0495593_0039517 | 3300047673 | Bacteria | 2543 |
| 616 | Ga0495602_0000445 | 3300048088 | Bacteria | 38896 |
| 617 | Ga0495602_0026002 | 3300048088 | Bacteria | 5654 |
| 618 | Ga0495602_0048824 | 3300048088 | Bacteria | 3798 |
| 619 | Ga0495614_0013507 | 3300048089 | Bacteria | 3580 |
| 620 | Ga0496100_0003227 | 3300048903 | Bacteria | 8468 |
| 621 | Ga0496100_0010592 | 3300048903 | Bacteria | 5222 |
| 622 | Ga0496100_0125860 | 3300048903 | Bacteria | 1798 |
| 623 | Ga0496101_0000756 | 3300048904 | Bacteria | 19156 |
| 624 | Ga0496101_0068893 | 3300048904 | Bacteria | 2587 |
| 625 | Ga0496101_0070748 | 3300048904 | Bacteria | 2556 |
| 626 | Ga0496102_0044759 | 3300048905 | Bacteria | 4018 |
| 627 | Ga0496102_0118048 | 3300048905 | Bacteria | 2476 |
| 628 | Ga0496102_0118862 | 3300048905 | Bacteria | 2467 |
| 629 | Ga0496102_0136069 | 3300048905 | Bacteria | 2302 |
| 630 | Ga0496103_0081375 | 3300048906 | Bacteria | 2037 |
| 631 | Ga0496104_0000685 | 3300048907 | Bacteria | 29134 |
| 632 | Ga0496104_0053372 | 3300048907 | Bacteria | 3818 |
| 633 | Ga0496104_0074667 | 3300048907 | Bacteria | 3227 |
| 634 | Ga0496104_0149771 | 3300048907 | Bacteria | 2240 |
| 635 | Ga0496104_0166282 | 3300048907 | Bacteria | 2115 |
| 636 | Ga0496104_0432011 | 3300048907 | Bacteria | 1229 |
| 637 | Ga0496105_0001954 | 3300048908 | Bacteria | 14793 |
| 638 | Ga0496105_0004757 | 3300048908 | Bacteria | 10249 |
| 639 | Ga0496106_0004105 | 3300048909 | Bacteria | 10848 |
| 640 | Ga0496106_0042773 | 3300048909 | Bacteria | 3397 |
| 641 | Ga0496106_0097826 | 3300048909 | Bacteria | 2272 |
| 642 | Ga0496106_0100970 | 3300048909 | Bacteria | 2237 |
| 643 | Ga0496106_0121195 | 3300048909 | Bacteria | 2044 |
| 644 | Ga0496106_0341667 | 3300048909 | Bacteria | 1202 |
| 645 | Ga0496107_0013534 | 3300048910 | Bacteria | 5703 |
| 646 | Ga0496107_0013652 | 3300048910 | Bacteria | 5678 |
| 647 | Ga0496107_0022645 | 3300048910 | Bacteria | 4440 |
| 648 | Ga0496107_0034982 | 3300048910 | Bacteria | 3600 |
| 649 | Ga0496107_0050129 | 3300048910 | Bacteria | 3009 |
| 650 | Ga0496107_0095041 | 3300048910 | Bacteria | 2180 |
| 651 | Ga0496108_0014622 | 3300048911 | Bacteria | 6407 |
| 652 | Ga0496109_0000736 | 3300048912 | Bacteria | 27218 |
| 653 | Ga0496109_0002526 | 3300048912 | Bacteria | 15338 |
| 654 | Ga0496109_0264798 | 3300048912 | Bacteria | 1619 |
| 655 | Ga0496109_0475158 | 3300048912 | Bacteria | 1180 |
| 656 | Ga0496110_0035374 | 3300048913 | Bacteria | 4333 |
| 657 | Ga0496110_0055710 | 3300048913 | Bacteria | 3479 |
| 658 | Ga0496110_0069720 | 3300048913 | Bacteria | 3114 |
| 659 | Ga0496110_0091186 | 3300048913 | Bacteria | 2726 |
| 660 | Ga0496111_0013697 | 3300048914 | Bacteria | 5524 |
| 661 | Ga0496111_0051148 | 3300048914 | Bacteria | 2983 |
| 662 | Ga0496111_0078320 | 3300048914 | Bacteria | 2410 |
| 663 | Ga0496111_0088525 | 3300048914 | Bacteria | 2268 |
| 664 | Ga0496112_0005715 | 3300048915 | Bacteria | 10806 |
| 665 | Ga0496112_0035592 | 3300048915 | Bacteria | 4851 |
| 666 | Ga0496112_0195239 | 3300048915 | Bacteria | 1985 |
| 667 | Ga0496113_0000137 | 3300048916 | Bacteria | 31613 |
| 668 | Ga0496113_0067149 | 3300048916 | Bacteria | 2718 |
| 669 | Ga0496113_0067574 | 3300048916 | Bacteria | 2710 |
| 670 | Ga0496114_0029796 | 3300048917 | Bacteria | 4486 |
| 671 | Ga0496114_0039419 | 3300048917 | Bacteria | 3909 |
| 672 | Ga0496114_0156096 | 3300048917 | Bacteria | 1981 |
| 673 | Ga0496115_0001071 | 3300048918 | Bacteria | 19818 |
| 674 | Ga0496115_0005562 | 3300048918 | Bacteria | 9168 |
| 675 | Ga0496115_0036013 | 3300048918 | Bacteria | 3917 |
| 676 | Ga0501031_0165746 | 3300049568 | Bacteria | 1444 |
| 677 | Ga0501032_0017503 | 3300049569 | Bacteria | 5032 |
| 678 | Ga0501032_0018276 | 3300049569 | Bacteria | 4913 |
| 679 | Ga0501032_0029636 | 3300049569 | Bacteria | 3754 |
| 680 | Ga0501032_0151188 | 3300049569 | Bacteria | 1526 |
| 681 | Ga0501033_0042439 | 3300049570 | Bacteria | 3391 |
| 682 | Ga0501033_0072248 | 3300049570 | Bacteria | 2533 |
| 683 | Ga0501033_0247293 | 3300049570 | Bacteria | 1265 |
| 684 | Ga0501034_0000166 | 3300049571 | Bacteria | 122782 |
| 685 | Ga0501034_0002279 | 3300049571 | Bacteria | 23553 |
| 686 | Ga0501034_0010525 | 3300049571 | Bacteria | 9631 |
| 687 | Ga0501034_0039342 | 3300049571 | Bacteria | 4790 |
| 688 | Ga0501034_0046873 | 3300049571 | Bacteria | 4367 |
| 689 | Ga0501034_0047608 | 3300049571 | Bacteria | 4329 |
| 690 | Ga0501034_0049363 | 3300049571 | Bacteria | 4245 |
| 691 | Ga0501034_0056805 | 3300049571 | Bacteria | 3936 |
| 692 | Ga0501034_0057543 | 3300049571 | Bacteria | 3908 |
| 693 | Ga0501034_0290678 | 3300049571 | Bacteria | 1572 |
| 694 | Ga0501034_0317593 | 3300049571 | Bacteria | 1491 |
| 695 | Ga0501034_0561415 | 3300049571 | Bacteria | 1050 |
| 696 | Ga0501036_0001268 | 3300049572 | Bacteria | 19351 |
| 697 | Ga0501036_0001435 | 3300049572 | Bacteria | 18318 |
| 698 | Ga0501036_0023356 | 3300049572 | Bacteria | 5208 |
| 699 | Ga0501036_0037375 | 3300049572 | Bacteria | 4108 |
| 700 | Ga0501036_0050505 | 3300049572 | Bacteria | 3521 |
| 701 | Ga0501036_0051817 | 3300049572 | Bacteria | 3475 |
| 702 | Ga0501036_0251601 | 3300049572 | Bacteria | 1481 |
| 703 | Ga0501037_0003033 | 3300049573 | Bacteria | 12191 |
| 704 | Ga0501037_0006762 | 3300049573 | Bacteria | 8386 |
| 705 | Ga0501037_0011748 | 3300049573 | Bacteria | 6447 |
| 706 | Ga0501037_0020805 | 3300049573 | Bacteria | 4844 |
| 707 | Ga0501037_0055834 | 3300049573 | Bacteria | 2886 |
| 708 | Ga0501037_0074456 | 3300049573 | Bacteria | 2467 |
| 709 | Ga0501038_0011216 | 3300049574 | Bacteria | 8182 |
| 710 | Ga0501038_0029585 | 3300049574 | Bacteria | 4851 |
| 711 | Ga0501038_0105864 | 3300049574 | Bacteria | 2336 |
| 712 | Ga0501038_0129001 | 3300049574 | Bacteria | 2078 |
| 713 | Ga0501038_0148738 | 3300049574 | Bacteria | 1910 |
| 714 | Ga0501038_0218712 | 3300049574 | Bacteria | 1520 |
| 715 | Ga0501039_0000758 | 3300049575 | Bacteria | 23236 |
| 716 | Ga0501039_0019466 | 3300049575 | Bacteria | 5204 |
| 717 | Ga0501039_0151567 | 3300049575 | Bacteria | 1821 |
| 718 | Ga0501039_0289235 | 3300049575 | Bacteria | 1288 |
| 719 | Ga0501043_0029469 | 3300049579 | Bacteria | 4312 |
| 720 | Ga0501043_0030069 | 3300049579 | Bacteria | 4266 |
| 721 | Ga0501046_0003696 | 3300049580 | Bacteria | 14007 |
| 722 | Ga0501046_0006647 | 3300049580 | Bacteria | 10216 |
| 723 | Ga0501046_0023536 | 3300049580 | Bacteria | 5065 |
| 724 | Ga0501047_0002756 | 3300049581 | Bacteria | 16693 |
| 725 | Ga0501047_0003470 | 3300049581 | Bacteria | 14899 |
| 726 | Ga0501047_0027786 | 3300049581 | Bacteria | 5451 |
| 727 | Ga0501047_0101585 | 3300049581 | Bacteria | 2755 |
| 728 | Ga0501047_0127248 | 3300049581 | Bacteria | 2428 |
| 729 | Ga0501048_0000429 | 3300049582 | Bacteria | 29567 |
| 730 | Ga0501048_0264425 | 3300049582 | Bacteria | 1222 |
| 731 | Ga0501067_0000345 | 3300049583 | Bacteria | 25284 |
| 732 | Ga0501067_0014070 | 3300049583 | Bacteria | 4432 |
| 733 | Ga0501067_0037009 | 3300049583 | Bacteria | 2710 |
| 734 | Ga0501067_0064908 | 3300049583 | Bacteria | 2021 |
| 735 | Ga0501067_0111989 | 3300049583 | Bacteria | 1517 |
| 736 | Ga0501068_0132271 | 3300049584 | Bacteria | 1560 |
| 737 | Ga0501068_0137551 | 3300049584 | Bacteria | 1530 |
| 738 | Ga0501069_0026587 | 3300049585 | Bacteria | 3169 |
| 739 | Ga0501070_0001845 | 3300049586 | Bacteria | 18698 |
| 740 | Ga0501070_0012498 | 3300049586 | Bacteria | 7160 |
| 741 | Ga0501070_0013652 | 3300049586 | Bacteria | 6843 |
| 742 | Ga0501070_0026768 | 3300049586 | Bacteria | 4837 |
| 743 | Ga0501070_0103505 | 3300049586 | Bacteria | 2354 |
| 744 | Ga0501071_0022461 | 3300049587 | Bacteria | 4397 |
| 745 | Ga0501071_0026336 | 3300049587 | Bacteria | 4081 |
| 746 | Ga0501073_0031245 | 3300049589 | Bacteria | 3799 |
| 747 | Ga0501073_0036159 | 3300049589 | Bacteria | 3509 |
| 748 | Ga0501073_0141260 | 3300049589 | Bacteria | 1668 |
| 749 | Ga0501073_0354884 | 3300049589 | Bacteria | 1012 |
| 750 | Ga0501074_0021064 | 3300049590 | Bacteria | 4735 |
| 751 | Ga0501074_0036572 | 3300049590 | Bacteria | 3556 |
| 752 | Ga0501074_0141093 | 3300049590 | Bacteria | 1723 |
| 753 | Ga0501074_0313888 | 3300049590 | Bacteria | 1113 |
| 754 | Ga0501074_0420357 | 3300049590 | Bacteria | 948 |
| 755 | Ga0501075_0035258 | 3300049591 | Bacteria | 3730 |
| 756 | Ga0501076_0002841 | 3300049592 | Bacteria | 11982 |
| 757 | Ga0501077_0053100 | 3300049593 | Bacteria | 2573 |
| 758 | Ga0501077_0184536 | 3300049593 | Bacteria | 1325 |
| 759 | Ga0501079_0082308 | 3300049741 | Bacteria | 2489 |
| 760 | Ga0501079_0132355 | 3300049741 | Bacteria | 1941 |
| 761 | Ga0501080_0000383 | 3300049742 | Bacteria | 34102 |
| 762 | Ga0501080_0001688 | 3300049742 | Bacteria | 18817 |
| 763 | Ga0501080_0020427 | 3300049742 | Bacteria | 6129 |
| 764 | Ga0501080_0020834 | 3300049742 | Bacteria | 6068 |
| 765 | Ga0501080_0031459 | 3300049742 | Bacteria | 4944 |
| 766 | Ga0501080_0049497 | 3300049742 | Bacteria | 3911 |
| 767 | Ga0501080_0213614 | 3300049742 | Bacteria | 1767 |
| 768 | Ga0501080_0303288 | 3300049742 | Bacteria | 1448 |
| 769 | Ga0501081_0091558 | 3300049743 | Bacteria | 2139 |
| 770 | Ga0501081_0157860 | 3300049743 | Bacteria | 1633 |
| 771 | Ga0501083_0004489 | 3300049744 | Bacteria | 9855 |
| 772 | Ga0501083_0044550 | 3300049744 | Bacteria | 3003 |
| 773 | Ga0501083_0053402 | 3300049744 | Bacteria | 2713 |
| 774 | Ga0501083_0061823 | 3300049744 | Bacteria | 2500 |
| 775 | Ga0501083_0077003 | 3300049744 | Bacteria | 2213 |
| 776 | Ga0501035_0000084 | 3300049822 | Bacteria | 116222 |
| 777 | Ga0501035_0000197 | 3300049822 | Bacteria | 73618 |
| 778 | Ga0501035_0032596 | 3300049822 | Bacteria | 4739 |
| 779 | Ga0501035_0043306 | 3300049822 | Bacteria | 4057 |
| 780 | Ga0501035_0130879 | 3300049822 | Bacteria | 2187 |
| 781 | Ga0501035_0333819 | 3300049822 | Bacteria | 1271 |
| 782 | Ga0501044_0000073 | 3300049823 | Bacteria | 122507 |
| 783 | Ga0501044_0030649 | 3300049823 | Bacteria | 5666 |
| 784 | Ga0501044_0032568 | 3300049823 | Bacteria | 5478 |
| 785 | Ga0501044_0044299 | 3300049823 | Bacteria | 4617 |
| 786 | Ga0501044_0057292 | 3300049823 | Bacteria | 3999 |
| 787 | Ga0501044_0088937 | 3300049823 | Bacteria | 3118 |
| 788 | Ga0501044_0257880 | 3300049823 | Bacteria | 1682 |
| 789 | Ga0501044_0334805 | 3300049823 | Bacteria | 1435 |
| 790 | Ga0501044_0409918 | 3300049823 | Bacteria | 1266 |
| 791 | Ga0501044_0448892 | 3300049823 | Bacteria | 1196 |
| 792 | Ga0501045_0034565 | 3300049824 | Bacteria | 3669 |
| 793 | Ga0501045_0154513 | 3300049824 | Bacteria | 1707 |
| 794 | nmdc:mga03683_111129_c1 | 3300050489 | Bacteria | 1212 |
| 795 | nmdc:mga03n38_31116_c1 | 3300050490 | Bacteria | 2249 |
| 796 | nmdc:mga00v17_74252_c1 | 3300050491 | Bacteria | 2113 |
| 797 | nmdc:mga0yw44_85728_c1 | 3300050492 | Bacteria | 1982 |
| 798 | nmdc:mga0k408_19959_c1 | 3300050493 | Bacteria | 3751 |
| 799 | nmdc:mga0k408_61999_c1 | 3300050493 | Bacteria | 2174 |
| 800 | nmdc:mga06z11_236772_c1 | 3300050494 | Bacteria | 1071 |
| 801 | nmdc:mga07m45_13691_c2 | 3300050496 | Bacteria | 3062 |
| 802 | nmdc:mga07m45_49001_c1 | 3300050496 | Bacteria | 2377 |
| 803 | nmdc:mga05p37_12681_c1 | 3300050507 | Bacteria | 10070 |
| 804 | nmdc:mga05p37_19_c2 | 3300050507 | Bacteria | 99994 |
| 805 | nmdc:mga09592_1297_c1 | 3300050508 | Bacteria | 20091 |
| 806 | nmdc:mga0qj67_259_c1 | 3300050509 | Bacteria | 36242 |
| 807 | nmdc:mga06r32_1133_c1 | 3300050510 | Bacteria | 23910 |
| 808 | nmdc:mga08y16_114800_c1 | 3300050511 | Bacteria | 2804 |
| 809 | nmdc:mga08y16_21083_c1 | 3300050511 | Bacteria | 6881 |
| 810 | nmdc:mga08y16_293458_c1 | 3300050511 | Bacteria | 1676 |
| 811 | nmdc:mga08y16_653311_c1 | 3300050511 | Bacteria | 1056 |
| 812 | nmdc:mga0n895_112359_c1 | 3300050512 | Bacteria | 2741 |
| 813 | nmdc:mga0n895_41918_c1 | 3300050512 | Bacteria | 4452 |
| 814 | nmdc:mga0n895_439753_c1 | 3300050512 | Bacteria | 1317 |
| 815 | nmdc:mga0n895_68456_c1 | 3300050512 | Bacteria | 3517 |
| 816 | nmdc:mga0n895_701_c1 | 3300050512 | Bacteria | 23539 |
| 817 | nmdc:mga0rr50_217046_c1 | 3300050513 | Bacteria | 1578 |
| 818 | nmdc:mga0rr50_63863_c1 | 3300050513 | Bacteria | 2782 |
| 819 | nmdc:mga0rr50_785_c1 | 3300050513 | Bacteria | 17098 |
| 820 | nmdc:mga0rr50_83435_c1 | 3300050513 | Bacteria | 2471 |
| 821 | nmdc:mga08x19_104497_c1 | 3300050514 | Bacteria | 1882 |
| 822 | nmdc:mga08x19_162458_c1 | 3300050514 | Bacteria | 1517 |
| 823 | nmdc:mga08x19_182439_c1 | 3300050514 | Bacteria | 1433 |
| 824 | nmdc:mga08x19_196928_c1 | 3300050514 | Bacteria | 1380 |
| 825 | nmdc:mga08x19_93555_c1 | 3300050514 | Bacteria | 1986 |
| 826 | nmdc:mga0a205_11208_c1 | 3300050515 | Bacteria | 7608 |
| 827 | nmdc:mga0a205_249_c1 | 3300050515 | Bacteria | 38472 |
| 828 | nmdc:mga0a205_284511_c1 | 3300050515 | Bacteria | 1528 |
| 829 | nmdc:mga0a205_88929_c2 | 3300050515 | Bacteria | 2383 |
| 830 | Ga0495601_0000186 | 3300053077 | Bacteria | 33078 |
| 831 | Ga0495601_0000677 | 3300053077 | Bacteria | 18186 |
| 832 | Ga0495601_0000798 | 3300053077 | Bacteria | 17006 |
| 833 | Ga0495601_0050367 | 3300053077 | Bacteria | 2626 |
| 834 | Ga0495601_0127885 | 3300053077 | Bacteria | 1653 |
| 835 | Ga0495601_0283553 | 3300053077 | Bacteria | 1080 |
| 836 | Ga0495612_0000089 | 3300053078 | Bacteria | 40250 |
| 837 | Ga0495612_0001470 | 3300053078 | Bacteria | 9700 |
| 838 | Ga0495612_0039065 | 3300053078 | Bacteria | 1929 |
| 839 | Ga0495595_0000369 | 3300053084 | Bacteria | 17095 |
| 840 | Ga0495595_0005480 | 3300053084 | Bacteria | 5140 |
| 841 | Ga0495595_0008524 | 3300053084 | Bacteria | 4212 |
| 842 | Ga0495619_0000052 | 3300053085 | Bacteria | 98882 |
| 843 | Ga0495619_0000078 | 3300053085 | Bacteria | 72749 |
| 844 | Ga0495619_0002831 | 3300053085 | Bacteria | 11298 |
| 845 | Ga0495619_0003693 | 3300053085 | Bacteria | 9866 |
| 846 | Ga0495619_0004203 | 3300053085 | Bacteria | 9187 |
| 847 | Ga0495619_0004787 | 3300053085 | Bacteria | 8603 |
| 848 | Ga0500644_0000406 | 3300053088 | Bacteria | 20485 |
| 849 | Ga0500651_0019843 | 3300053093 | Bacteria | 4183 |
| 850 | Ga0500651_0132785 | 3300053093 | Bacteria | 1505 |
| 851 | Ga0500566_0118772 | 3300053094 | Bacteria | 1428 |
| 852 | Ga0500641_0004364 | 3300053096 | Bacteria | 4995 |
| 853 | Ga0500641_0089619 | 3300053096 | Bacteria | 1312 |
| 854 | Ga0500562_034091 | 3300053108 | Bacteria | 1346 |
| 855 | Ga0500595_000001 | 3300053119 | Bacteria | 1088438 |
| 856 | Ga0500595_019094 | 3300053119 | Bacteria | 2494 |
| 857 | Ga0500597_054645 | 3300053120 | Bacteria | 1707 |
| 858 | Ga0500652_003619 | 3300053131 | Bacteria | 4695 |
| 859 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 860 | Ga0500616_0014708 | 3300053153 | Bacteria | 4489 |
| 861 | Ga0500645_002831 | 3300053730 | Bacteria | 7473 |
| 862 | Ga0500645_054630 | 3300053730 | Bacteria | 1161 |
| 863 | Ga0501084_0379974 | 3300054114 | Bacteria | 1194 |
| 864 | Ga0501084_0477523 | 3300054114 | Bacteria | 1054 |
| 865 | Ga0501082_0005704 | 3300060353 | Bacteria | 10803 |
| 866 | Ga0501082_0061688 | 3300060353 | Bacteria | 3227 |
| 867 | Ga0501082_0125079 | 3300060353 | Bacteria | 2230 |
| 868 | Ga0501082_0131729 | 3300060353 | Bacteria | 2170 |
| 869 | Ga0501082_0268014 | 3300060353 | Bacteria | 1486 |
| 870 | Ga0501082_0694731 | 3300060353 | Bacteria | 890 |
| 871 | 2643758229 | 2643221547 | Bacteria | 4740017 |
| 872 | nmdc:mga05p37_312467_c1 | |||
| 873 | 2214750793 | |||
| 874 | ARcpr5oldR_c000008 | |||
| 875 | ARSoilYngRDRAFT_c00021 | |||
| 876 | ARcpr5yngRDRAFT_c000269 | |||
| 877 | ARSoilOldRDRAFT_c000004 | |||
| 878 | ARCol0oldRDRAFT_c00519 | |||
| 879 | ARCol0yngRDRAFT_1000405 | |||
| 880 | JGI24739J22299_10000119 | |||
| 881 | JGI24737J22298_10016402 | |||
| 882 | JGI24738J21930_10000653 | |||
| 883 | JGI24749J21850_1000821 | |||
| 884 | JGI24744J21845_10000855 | |||
| 885 | JGI24034J26672_10002428 | |||
| 886 | JGI25153J46596_10001550 | |||
| 887 | JGI25405J52794_10003987 | |||
| 888 | Ga0065716_1001943 | |||
| 889 | Ga0065704_10082626 | |||
| 890 | Ga0065712_10002667 | |||
| 891 | Ga0065712_10071402 | |||
| 892 | Ga0065715_10002782 | |||
| 893 | Ga0070658_10014072 | |||
| 894 | Ga0070683_100015125 | |||
| 895 | Ga0070683_100230825 | |||
| 896 | Ga0070690_100016228 | |||
| 897 | Ga0070690_100091164 | |||
| 898 | Ga0070670_100002160 | |||
| 899 | Ga0068869_100004994 | |||
| 900 | Ga0070666_10039476 | |||
| 901 | Ga0070680_100003115 | |||
| 902 | Ga0070680_100006411 | |||
| 903 | Ga0070680_100017168 | |||
| 904 | Ga0070682_100008882 | |||
| 905 | Ga0068868_100123546 | |||
| 906 | Ga0070660_100002712 | |||
| 907 | Ga0070660_100008655 | |||
| 908 | Ga0070660_100070972 | |||
| 909 | Ga0070689_100007061 | |||
| 910 | Ga0070689_100016827 | |||
| 911 | Ga0070689_100037360 | |||
| 912 | Ga0070691_10000519 | |||
| 913 | Ga0070687_100000762 | |||
| 914 | Ga0070661_100004148 | |||
| 915 | Ga0070661_100445464 | |||
| 916 | Ga0070692_10006740 | |||
| 917 | Ga0070668_100097991 | |||
| 918 | Ga0070669_100009605 | |||
| 919 | Ga0070675_100004458 | |||
| 920 | Ga0070671_100002139 | |||
| 921 | Ga0070671_100014975 | |||
| 922 | Ga0070671_100323004 | |||
| 923 | Ga0070674_100003695 | |||
| 924 | Ga0070674_100011100 | |||
| 925 | Ga0070674_100054945 | |||
| 926 | Ga0070673_100000278 | |||
| 927 | Ga0070673_100129073 | |||
| 928 | Ga0070688_100002472 | |||
| 929 | Ga0070688_100022886 | |||
| 930 | Ga0070659_100016217 | |||
| 931 | Ga0070667_100037839 | |||
| 932 | Ga0070667_100309820 | |||
| 933 | Ga0070703_10006001 | |||
| 934 | Ga0070709_10007640 | |||
| 935 | Ga0070709_10061034 | |||
| 936 | Ga0070714_100065202 | |||
| 937 | Ga0070714_100102072 | |||
| 938 | Ga0070713_100002202 | |||
| 939 | Ga0070713_100052565 | |||
| 940 | Ga0070710_10033061 | |||
| 941 | Ga0070710_10116315 | |||
| 942 | Ga0070701_10022153 | |||
| 943 | Ga0070711_100007031 | |||
| 944 | Ga0070711_100057039 | |||
| 945 | Ga0070705_100003982 | |||
| 946 | Ga0070700_100065143 | |||
| 947 | Ga0070694_100047324 | |||
| 948 | Ga0070694_100155820 | |||
| 949 | Ga0070694_100398195 | |||
| 950 | Ga0070663_100049191 | |||
| 951 | Ga0070663_100120175 | |||
| 952 | Ga0070678_100042719 | |||
| 953 | Ga0070662_100023146 | |||
| 954 | Ga0070681_10124512 | |||
| 955 | Ga0070681_10206665 | |||
| 956 | Ga0070681_10606952 | |||
| 957 | Ga0068867_100003764 | |||
| 958 | Ga0068867_100028355 | |||
| 959 | Ga0068867_100126057 | |||
| 960 | Ga0070685_10045920 | |||
| 961 | Ga0070679_100013963 | |||
| 962 | Ga0070679_100056479 | |||
| 963 | Ga0070679_100146290 | |||
| 964 | Ga0070679_100247411 | |||
| 965 | Ga0070679_100351995 | |||
| 966 | Ga0070679_100356422 | |||
| 967 | Ga0070684_100002161 | |||
| 968 | Ga0070684_100032052 | |||
| 969 | Ga0068853_100065701 | |||
| 970 | Ga0068853_100136870 | |||
| 971 | Ga0070672_100008897 | |||
| 972 | Ga0070686_100002376 | |||
| 973 | Ga0070686_100051856 | |||
| 974 | Ga0070686_100074409 | |||
| 975 | Ga0070695_100028064 | |||
| 976 | Ga0070695_100030233 | |||
| 977 | Ga0070693_100002348 | |||
| 978 | Ga0070693_100047618 | |||
| 979 | Ga0070693_100049315 | |||
| 980 | Ga0070665_100040827 | |||
| 981 | Ga0070704_100009589 | |||
| 982 | Ga0070704_100020522 | |||
| 983 | Ga0068855_100120810 | |||
| 984 | Ga0068855_100122447 | |||
| 985 | Ga0068855_100265043 | |||
| 986 | Ga0070664_100006568 | |||
| 987 | Ga0068857_100009381 | |||
| 988 | Ga0068857_100404457 | |||
| 989 | Ga0068854_100004762 | |||
| 990 | Ga0068856_100011377 | |||
| 991 | Ga0068852_100013724 | |||
| 992 | Ga0068859_100005699 | |||
| 993 | Ga0068859_100033770 | |||
| 994 | Ga0068859_100082374 | |||
| 995 | Ga0068859_100190634 | |||
| 996 | Ga0068864_100000715 | |||
| 997 | Ga0068864_100220189 | |||
| 998 | Ga0068866_10000992 | |||
| 999 | Ga0068866_10096179 | |||
| 1000 | Ga0068861_100038639 | |||
| 1001 | Ga0068870_10001034 | |||
| 1002 | Ga0068863_100010345 | |||
| 1003 | Ga0068863_100509401 | |||
| 1004 | Ga0068858_100012900 | |||
| 1005 | Ga0068858_100256457 | |||
| 1006 | Ga0068858_100296281 | |||
| 1007 | Ga0068862_100011703 | |||
| 1008 | Ga0081455_10000002 | |||
| 1009 | Ga0081455_10014993 | |||
| 1010 | Ga0081455_10024073 | |||
| 1011 | Ga0070717_10166008 | |||
| 1012 | Ga0070717_10218361 | |||
| 1013 | Ga0070717_10274337 | |||
| 1014 | Ga0075368_10055549 | |||
| 1015 | Ga0075363_100069748 | |||
| 1016 | Ga0075363_100075300 | |||
| 1017 | Ga0075363_100084473 | |||
| 1018 | Ga0075432_10002282 | |||
| 1019 | Ga0075432_10018616 | |||
| 1020 | Ga0070715_10009757 | |||
| 1021 | Ga0070715_10036612 | |||
| 1022 | Ga0070715_10114076 | |||
| 1023 | Ga0070712_100162115 | |||
| 1024 | Ga0070712_100193545 | |||
| 1025 | Ga0075362_10043769 | |||
| 1026 | Ga0075367_10083936 | |||
| 1027 | Ga0075369_10025847 | |||
| 1028 | Ga0075427_10001160 | |||
| 1029 | Ga0075366_10012706 | |||
| 1030 | Ga0075366_10014070 | |||
| 1031 | Ga0075366_10014999 | |||
| 1032 | Ga0075366_10093437 | |||
| 1033 | Ga0097621_100002611 | |||
| 1034 | Ga0097621_100372225 | |||
| 1035 | Ga0075370_10025998 | |||
| 1036 | Ga0068871_100000012 | |||
| 1037 | Ga0068871_100110227 | |||
| 1038 | Ga0075428_100002408 | |||
| 1039 | Ga0075430_100000032 | |||
| 1040 | Ga0075431_100000903 | |||
| 1041 | Ga0075433_10000976 | |||
| 1042 | Ga0075433_10150031 | |||
| 1043 | Ga0075433_10253362 | |||
| 1044 | Ga0075433_10403970 | |||
| 1045 | Ga0075434_100000341 | |||
| 1046 | Ga0075434_100008227 | |||
| 1047 | Ga0075434_100089709 | |||
| 1048 | Ga0075434_100250439 | |||
| 1049 | Ga0075429_100000561 | |||
| 1050 | Ga0068865_100002705 | |||
| 1051 | Ga0075436_100007663 | |||
| 1052 | Ga0075436_100145082 | |||
| 1053 | Ga0097620_100005699 | |||
| 1054 | Ga0097620_100033767 | |||
| 1055 | Ga0097620_100082374 | |||
| 1056 | Ga0097620_100190625 | |||
| 1057 | Ga0075435_100020155 | |||
| 1058 | Ga0075435_100038297 | |||
| 1059 | Ga0105251_10028097 | |||
| 1060 | Ga0105250_10025741 | |||
| 1061 | Ga0111539_10001270 | |||
| 1062 | Ga0111539_10044176 | |||
| 1063 | Ga0111539_10120803 | |||
| 1064 | Ga0111539_10152872 | |||
| 1065 | Ga0111539_10489501 | |||
| 1066 | Ga0105245_10000460 | |||
| 1067 | Ga0105245_10038487 | |||
| 1068 | Ga0105247_10000881 | |||
| 1069 | Ga0105247_10062048 | |||
| 1070 | Ga0114129_10001035 | |||
| 1071 | Ga0114129_10049815 | |||
| 1072 | Ga0105243_10004739 | |||
| 1073 | Ga0105243_10128115 | |||
| 1074 | Ga0105243_10301587 | |||
| 1075 | Ga0105243_10450285 | |||
| 1076 | Ga0105241_10004650 | |||
| 1077 | Ga0105241_10008370 | |||
| 1078 | Ga0105242_10200826 | |||
| 1079 | Ga0105248_10033712 | |||
| 1080 | Ga0105248_10083081 | |||
| 1081 | Ga0105248_10110218 | |||
| 1082 | Ga0105248_10156104 | |||
| 1083 | Ga0105237_10160826 | |||
| 1084 | Ga0105237_10164073 | |||
| 1085 | Ga0105249_10099335 | |||
| 1086 | Ga0105239_10033955 | |||
| 1087 | Ga0105239_10063805 | |||
| 1088 | Ga0105239_10116695 | |||
| 1089 | Ga0105239_10473927 | |||
| 1090 | Ga0105246_10003054 | |||
| 1091 | Ga0105246_10504659 | |||
| 1092 | Ga0157341_1000565 | |||
| 1093 | Ga0157342_1001832 | |||
| 1094 | Ga0157373_10024356 | |||
| 1095 | Ga0157373_10040293 | |||
| 1096 | Ga0157373_10235188 | |||
| 1097 | Ga0157371_10012799 | |||
| 1098 | Ga0157369_10149116 | |||
| 1099 | Ga0157374_10005485 | |||
| 1100 | Ga0157378_10030471 | |||
| 1101 | Ga0157378_10658225 | |||
| 1102 | Ga0163162_10043904 | |||
| 1103 | Ga0157372_10061874 | |||
| 1104 | Ga0157372_10273924 | |||
| 1105 | Ga0157375_10006955 | |||
| 1106 | Ga0157375_10197306 | |||
| 1107 | Ga0163163_10000824 | |||
| 1108 | Ga0163163_10028743 | |||
| 1109 | Ga0163163_10045150 | |||
| 1110 | Ga0157380_10051367 | |||
| 1111 | Ga0157377_10000747 | |||
| 1112 | Ga0157377_10052187 | |||
| 1113 | Ga0157379_10007473 | |||
| 1114 | Ga0157379_10018294 | |||
| 1115 | Ga0157376_10057154 | |||
| 1116 | Ga0163161_10014113 | |||
| 1117 | Ga0206356_11408241 | |||
| 1118 | Ga0213876_10015539 | |||
| 1119 | Ga0213876_10063571 | |||
| 1120 | Ga0213875_10000033 | |||
| 1121 | Ga0207666_1000321 | |||
| 1122 | Ga0209758_1000469 | |||
| 1123 | Ga0207653_10007479 | |||
| 1124 | Ga0207682_10000011 | |||
| 1125 | Ga0207692_10003084 | |||
| 1126 | Ga0207642_10000524 | |||
| 1127 | Ga0207642_10036802 | |||
| 1128 | Ga0207710_10002624 | |||
| 1129 | Ga0207710_10023925 | |||
| 1130 | Ga0207710_10088397 | |||
| 1131 | Ga0207688_10013082 | |||
| 1132 | Ga0207680_10013942 | |||
| 1133 | Ga0207647_10016450 | |||
| 1134 | Ga0207685_10075112 | |||
| 1135 | Ga0207685_10083721 | |||
| 1136 | Ga0207685_10131663 | |||
| 1137 | Ga0207699_10009636 | |||
| 1138 | Ga0207699_10028372 | |||
| 1139 | Ga0207699_10037784 | |||
| 1140 | Ga0207645_10000788 | |||
| 1141 | Ga0207645_10025475 | |||
| 1142 | Ga0207643_10000284 | |||
| 1143 | Ga0207643_10250228 | |||
| 1144 | Ga0207705_10004585 | |||
| 1145 | Ga0207705_10082151 | |||
| 1146 | Ga0207654_10008933 | |||
| 1147 | Ga0207707_10016051 | |||
| 1148 | Ga0207707_10041522 | |||
| 1149 | Ga0207707_10152501 | |||
| 1150 | Ga0207695_10160029 | |||
| 1151 | Ga0207671_10260053 | |||
| 1152 | Ga0207693_10016842 | |||
| 1153 | Ga0207693_10020112 | |||
| 1154 | Ga0207693_10024473 | |||
| 1155 | Ga0207693_10051020 | |||
| 1156 | Ga0207663_10013091 | |||
| 1157 | Ga0207663_10027630 | |||
| 1158 | Ga0207660_10078958 | |||
| 1159 | Ga0207660_10214577 | |||
| 1160 | Ga0207662_10021432 | |||
| 1161 | Ga0207662_10229285 | |||
| 1162 | Ga0207657_10036437 | |||
| 1163 | Ga0207657_10052478 | |||
| 1164 | Ga0207649_10000057 | |||
| 1165 | Ga0207649_10113866 | |||
| 1166 | Ga0207652_10021510 | |||
| 1167 | Ga0207681_10000181 | |||
| 1168 | Ga0207694_10040270 | |||
| 1169 | Ga0207650_10124772 | |||
| 1170 | Ga0207659_10000028 | |||
| 1171 | Ga0207659_10061296 | |||
| 1172 | Ga0207687_10000061 | |||
| 1173 | Ga0207687_10199537 | |||
| 1174 | Ga0207700_10044738 | |||
| 1175 | Ga0207700_10214544 | |||
| 1176 | Ga0207664_10187902 | |||
| 1177 | Ga0207644_10000315 | |||
| 1178 | Ga0207690_10003360 | |||
| 1179 | Ga0207706_10038800 | |||
| 1180 | Ga0207686_10010685 | |||
| 1181 | Ga0207686_10025623 | |||
| 1182 | Ga0207686_10053137 | |||
| 1183 | Ga0207709_10000539 | |||
| 1184 | Ga0207709_10046250 | |||
| 1185 | Ga0207709_10085023 | |||
| 1186 | Ga0207670_10000217 | |||
| 1187 | Ga0207670_10060747 | |||
| 1188 | Ga0207670_10062944 | |||
| 1189 | Ga0207669_10000147 | |||
| 1190 | Ga0207669_10035654 | |||
| 1191 | Ga0207704_10000299 | |||
| 1192 | Ga0207665_10001292 | |||
| 1193 | Ga0207665_10024608 | |||
| 1194 | Ga0207691_10015666 | |||
| 1195 | Ga0207691_10285750 | |||
| 1196 | Ga0207711_10001580 | |||
| 1197 | Ga0207711_10028537 | |||
| 1198 | Ga0207711_10114282 | |||
| 1199 | Ga0207689_10103768 | |||
| 1200 | Ga0207661_10000215 | |||
| 1201 | Ga0207679_10000026 | |||
| 1202 | Ga0207667_10015965 | |||
| 1203 | Ga0207651_10000173 | |||
| 1204 | Ga0207712_10005574 | |||
| 1205 | Ga0207668_10000242 | |||
| 1206 | Ga0207668_10071828 | |||
| 1207 | Ga0207640_10003534 | |||
| 1208 | Ga0207677_10006056 | |||
| 1209 | Ga0207703_10022834 | |||
| 1210 | Ga0207703_10267695 | |||
| 1211 | Ga0207639_10042423 | |||
| 1212 | Ga0207678_10040853 | |||
| 1213 | Ga0207678_10050370 | |||
| 1214 | Ga0207708_10172949 | |||
| 1215 | Ga0207702_10012057 | |||
| 1216 | Ga0207702_10034120 | |||
| 1217 | Ga0207702_10214522 | |||
| 1218 | Ga0207641_10015438 | |||
| 1219 | Ga0207641_10122423 | |||
| 1220 | Ga0207641_10396813 | |||
| 1221 | Ga0207648_10019819 | |||
| 1222 | Ga0207648_10669775 | |||
| 1223 | Ga0207676_10000361 | |||
| 1224 | Ga0207674_10026550 | |||
| 1225 | Ga0207674_10476045 | |||
| 1226 | Ga0207675_100128119 | |||
| 1227 | Ga0207675_100600621 | |||
| 1228 | Ga0207683_10000034 | |||
| 1229 | Ga0207683_10005439 | |||
| 1230 | Ga0207683_10162730 | |||
| 1231 | Ga0207683_10181584 | |||
| 1232 | Ga0207698_10017559 | |||
| 1233 | Ga0207698_10031807 | |||
| 1234 | Ga0207698_10087200 | |||
| 1235 | Ga0207698_10390606 | |||
| 1236 | Ga0209983_1004372 | |||
| 1237 | Ga0209971_1001670 | |||
| 1238 | Ga0209966_1000943 | |||
| 1239 | Ga0207428_10000082 | |||
| 1240 | Ga0207428_10000352 | |||
| 1241 | Ga0207428_10020766 | |||
| 1242 | Ga0268265_10008848 | |||
| 1243 | Ga0268265_10328819 | |||
| 1244 | Ga0268264_10007704 | |||
| 1245 | Ga0268264_10051446 | |||
| 1246 | Ga0265338_10039627 | |||
| 1247 | Ga0265338_10233865 | |||
| 1248 | Ga0265330_10037830 | |||
| 1249 | Ga0265332_10118736 | |||
| 1250 | Ga0265325_10000141 | |||
| 1251 | Ga0265325_10000843 | |||
| 1252 | Ga0265325_10026910 | |||
| 1253 | Ga0265340_10015105 | |||
| 1254 | Ga0265340_10067444 | |||
| 1255 | Ga0265331_10149821 | |||
| 1256 | Ga0265313_10000008 | |||
| 1257 | Ga0265313_10003676 | |||
| 1258 | Ga0265313_10013058 | |||
| 1259 | Ga0265314_10004544 | |||
| 1260 | Ga0265314_10015204 | |||
| 1261 | Ga0265342_10000841 | |||
| 1262 | Ga0265342_10080869 | |||
| 1263 | Ga0265342_10201713 | |||
| 1264 | Ga0316583_10032267 | |||
| 1265 | Ga0373930_0001225 | |||
| 1266 | Ga0373948_0000052 | |||
| 1267 | Ga0373958_0004612 | |||
| 1268 | Ga0373958_0005653 | |||
| 1269 | Ga0373959_0002099 | |||
| 1270 | Ga0373938_0000498 | |||
| 1271 | Ga0373938_0002088 | |||
| 1272 | Ga0373928_0051459 | |||
| 1273 | Ga0373929_0000220 | |||
| 1274 | Ga0373934_0064869 | |||
| 1275 | Ga0373940_0000725 | |||
| 1276 | Ga0373940_0008718 | |||
| 1277 | Ga0373944_0006118 | |||
| 1278 | Ga0373949_0001073 | |||
| 1279 | Ga0373949_0001411 | |||
| 1280 | Ga0373949_0021002 | |||
| 1281 | Ga0373951_0000946 | |||
| 1282 | Ga0373951_0008358 | |||
| 1283 | Ga0373951_0041905 | |||
| 1284 | Ga0373952_0001673 | |||
| 1285 | Ga0373952_0059739 | |||
| 1286 | Ga0373923_0000447 | |||
| 1287 | Ga0373923_0095622 | |||
| 1288 | Ga0373932_0008422 | |||
| 1289 | Ga0373932_0016104 | |||
| 1290 | Ga0373936_0003030 | |||
| 1291 | Ga0373939_0002953 | |||
| 1292 | Ga0373939_0008951 | |||
| 1293 | Ga0373939_0045159 | |||
| 1294 | Ga0373941_0000374 | |||
| 1295 | Ga0373941_0000572 | |||
| 1296 | Ga0373941_0001591 | |||
| 1297 | Ga0373941_0062799 | |||
| 1298 | Ga0373954_0008903 | |||
| 1299 | Ga0373954_0055607 | |||
| 1300 | Ga0373956_0019915 | |||
| 1301 | Ga0373956_0101575 | |||
| 1302 | Ga0373957_0000582 | |||
| 1303 | Ga0373960_0000735 | |||
| 1304 | Ga0373943_0021918 | |||
| 1305 | Ga0373946_0004134 | |||
| 1306 | Ga0373946_0048357 | |||
| 1307 | Ga0373955_0018189 | |||
| 1308 | Ga0373955_0027707 | |||
| 1309 | Ga0373942_0000845 | |||
| 1310 | Ga0373942_0010376 | |||
| 1311 | Ga0373942_0011864 | |||
| 1312 | Ga0373961_0000729 | |||
| 1313 | Ga0373961_0006236 | |||
| 1314 | Ga0373962_0002348 | |||
| 1315 | Ga0373962_0003814 | |||
| 1316 | Ga0373924_0001555 | |||
| 1317 | Ga0373924_0074916 | |||
| 1318 | Ga0373924_0090277 | |||
| 1319 | Ga0373931_0011579 | |||
| 1320 | Ga0373931_0026325 | |||
| 1321 | Ga0373931_0065181 | |||
| 1322 | Ga0373931_0113467 | |||
| 1323 | Ga0373935_0041438 | |||
| 1324 | Ga0373935_0084760 | |||
| 1325 | Ga0373935_0089813 | |||
| 1326 | Ga0373927_0043006 | |||
| 1327 | Ga0373927_0084349 | |||
| 1328 | Ga0373933_0001723 | |||
| 1329 | Ga0373933_0007095 | |||
| 1330 | Ga0373933_0018872 | |||
| 1331 | Ga0373947_0004938 | |||
| 1332 | Ga0373947_0015425 | |||
| 1333 | Ga0373947_0024258 | |||
| 1334 | Ga0373947_0273392 | |||
| 1335 | Ga0373937_0003184 | |||
| 1336 | Ga0373937_0005156 | |||
| 1337 | Ga0373937_0021697 | |||
| 1338 | Ga0316582_0307827 | |||
| 1339 | Ga0316584_0404667 | |||
| 1340 | Ga0373925_0009568 | |||
| 1341 | Ga0373925_0025014 | |||
| 1342 | Ga0373925_0083791 | |||
| 1343 | Ga0373925_0136345 | |||
| 1344 | Ga0373925_0351432 | |||
| 1345 | Ga0395900_0003585 | |||
| 1346 | Ga0395898_0036583 | |||
| 1347 | Ga0395898_0129626 | |||
| 1348 | Ga0395898_0137333 | |||
| 1349 | Ga0436364_0509271 | |||
| 1350 | Ga0436364_0852054 | |||
| 1351 | Ga0436364_1338082 | |||
| 1352 | Ga0436364_1419137 | |||
| 1353 | Ga0395901_0443569 | |||
| 1354 | Ga0242420_001406 | |||
| 1355 | Ga0436365_0396058 | |||
| 1356 | Ga0439450_003470 | |||
| 1357 | Ga0439463_018014 | |||
| 1358 | Ga0439464_0007302 | |||
| 1359 | Ga0439460_0005008 | |||
| 1360 | Ga0451577_0189237 | |||
| 1361 | Ga0439440_0023424 | |||
| 1362 | Ga0466966_0034416 | |||
| 1363 | Ga0466963_0118655 | |||
| 1364 | Ga0466963_0357762 | |||
| 1365 | Ga0453684_0268649 | |||
| 1366 | Ga0466957_0009192 | |||
| 1367 | Ga0466957_0020655 | |||
| 1368 | Ga0466957_0199630 | |||
| 1369 | Ga0466959_0110327 | |||
| 1370 | Ga0451576_0004698 | |||
| 1371 | Ga0451576_0514279 | |||
| 1372 | Ga0466958_0267554 | |||
| 1373 | Ga0466967_0377646 | |||
| 1374 | Ga0495592_0001184 | |||
| 1375 | Ga0495592_0044323 | |||
| 1376 | Ga0495592_0055711 | |||
| 1377 | Ga0495603_0017601 | |||
| 1378 | Ga0495603_0046194 | |||
| 1379 | Ga0495603_0096922 | |||
| 1380 | Ga0495629_0000062 | |||
| 1381 | Ga0495641_0003407 | |||
| 1382 | Ga0495641_0061784 | |||
| 1383 | Ga0495651_0000895 | |||
| 1384 | Ga0495651_0005305 | |||
| 1385 | Ga0495651_0092901 | |||
| 1386 | Ga0495653_0000987 | |||
| 1387 | Ga0495653_0004420 | |||
| 1388 | Ga0495653_0012511 | |||
| 1389 | Ga0495580_0022207 | |||
| 1390 | Ga0495580_0279372 | |||
| 1391 | Ga0495582_0027873 | |||
| 1392 | Ga0495639_0007730 | |||
| 1393 | Ga0495662_0058637 | |||
| 1394 | Ga0495664_0007609 | |||
| 1395 | Ga0495664_0034445 | |||
| 1396 | Ga0495664_0069608 | |||
| 1397 | Ga0495584_0035400 | |||
| 1398 | Ga0495585_0000389 | |||
| 1399 | Ga0495594_0033468 | |||
| 1400 | Ga0495594_0098308 | |||
| 1401 | Ga0495607_0001903 | |||
| 1402 | Ga0495608_0000129 | |||
| 1403 | Ga0495608_0013594 | |||
| 1404 | Ga0495608_0038785 | |||
| 1405 | Ga0495618_0001726 | |||
| 1406 | Ga0495618_0052717 | |||
| 1407 | Ga0495618_0138521 | |||
| 1408 | Ga0495628_0001570 | |||
| 1409 | Ga0495628_0004609 | |||
| 1410 | Ga0495628_0008485 | |||
| 1411 | Ga0495630_0034904 | |||
| 1412 | Ga0495630_0081529 | |||
| 1413 | Ga0495630_0092520 | |||
| 1414 | Ga0495637_0051495 | |||
| 1415 | Ga0495666_0006354 | |||
| 1416 | Ga0495652_0004520 | |||
| 1417 | Ga0495652_0005753 | |||
| 1418 | Ga0495652_0055841 | |||
| 1419 | Ga0495640_0043252 | |||
| 1420 | Ga0495640_0077409 | |||
| 1421 | Ga0495586_0052098 | |||
| 1422 | Ga0495587_0000354 | |||
| 1423 | Ga0495587_0036168 | |||
| 1424 | Ga0495598_0040307 | |||
| 1425 | Ga0495621_0038339 | |||
| 1426 | Ga0495645_0000800 | |||
| 1427 | Ga0495645_0001074 | |||
| 1428 | Ga0495645_0128873 | |||
| 1429 | Ga0495622_0004193 | |||
| 1430 | Ga0495633_0011365 | |||
| 1431 | Ga0495667_0002315 | |||
| 1432 | Ga0495667_0054524 | |||
| 1433 | Ga0495667_0062177 | |||
| 1434 | Ga0495656_0001813 | |||
| 1435 | Ga0495634_0014173 | |||
| 1436 | Ga0495634_0035924 | |||
| 1437 | Ga0495634_0130384 | |||
| 1438 | Ga0495635_0001388 | |||
| 1439 | Ga0495635_0008767 | |||
| 1440 | Ga0495635_0129123 | |||
| 1441 | Ga0495659_0000966 | |||
| 1442 | Ga0495661_0012736 | |||
| 1443 | Ga0495588_0004563 | |||
| 1444 | Ga0495657_0001374 | |||
| 1445 | Ga0495657_0035497 | |||
| 1446 | Ga0495657_0072817 | |||
| 1447 | Ga0495599_0000294 | |||
| 1448 | Ga0495599_0011840 | |||
| 1449 | Ga0495599_0021018 | |||
| 1450 | Ga0495599_0234212 | |||
| 1451 | Ga0495623_0000055 | |||
| 1452 | Ga0495623_0026535 | |||
| 1453 | Ga0495646_0000749 | |||
| 1454 | Ga0495646_0003654 | |||
| 1455 | Ga0495647_0056855 | |||
| 1456 | Ga0495658_0000109 | |||
| 1457 | Ga0495613_0043839 | |||
| 1458 | Ga0495613_0126968 | |||
| 1459 | Ga0495624_0031740 | |||
| 1460 | Ga0495670_0000106 | |||
| 1461 | Ga0495600_0001208 | |||
| 1462 | Ga0495600_0013152 | |||
| 1463 | Ga0495600_0014646 | |||
| 1464 | Ga0495600_0020004 | |||
| 1465 | Ga0495581_0001433 | |||
| 1466 | Ga0495604_0004110 | |||
| 1467 | Ga0495604_0010002 | |||
| 1468 | Ga0495604_0015210 | |||
| 1469 | Ga0495674_0005151 | |||
| 1470 | Ga0495674_0033478 | |||
| 1471 | Ga0495674_0073366 | |||
| 1472 | Ga0495680_0003711 | |||
| 1473 | Ga0495680_0008181 | |||
| 1474 | Ga0495680_0019769 | |||
| 1475 | Ga0495680_0056282 | |||
| 1476 | Ga0495680_0076363 | |||
| 1477 | Ga0495680_0310550 | |||
| 1478 | Ga0495675_0000190 | |||
| 1479 | Ga0495675_0119547 | |||
| 1480 | Ga0495681_0028053 | |||
| 1481 | Ga0495684_0010816 | |||
| 1482 | Ga0495684_0044448 | |||
| 1483 | Ga0495684_0067663 | |||
| 1484 | Ga0495593_0001596 | |||
| 1485 | Ga0495593_0032614 | |||
| 1486 | Ga0495593_0039517 | |||
| 1487 | Ga0495602_0000445 | |||
| 1488 | Ga0495602_0026002 | |||
| 1489 | Ga0495602_0048824 | |||
| 1490 | Ga0495614_0013507 | |||
| 1491 | Ga0496100_0003227 | |||
| 1492 | Ga0496100_0010592 | |||
| 1493 | Ga0496100_0125860 | |||
| 1494 | Ga0496101_0000756 | |||
| 1495 | Ga0496101_0068893 | |||
| 1496 | Ga0496101_0070748 | |||
| 1497 | Ga0496102_0044759 | |||
| 1498 | Ga0496102_0118048 | |||
| 1499 | Ga0496102_0118862 | |||
| 1500 | Ga0496102_0136069 | |||
| 1501 | Ga0496103_0081375 | |||
| 1502 | Ga0496104_0000685 | |||
| 1503 | Ga0496104_0053372 | |||
| 1504 | Ga0496104_0074667 | |||
| 1505 | Ga0496104_0149771 | |||
| 1506 | Ga0496104_0166282 | |||
| 1507 | Ga0496104_0432011 | |||
| 1508 | Ga0496105_0001954 | |||
| 1509 | Ga0496105_0004757 | |||
| 1510 | Ga0496106_0004105 | |||
| 1511 | Ga0496106_0042773 | |||
| 1512 | Ga0496106_0097826 | |||
| 1513 | Ga0496106_0100970 | |||
| 1514 | Ga0496106_0121195 | |||
| 1515 | Ga0496106_0341667 | |||
| 1516 | Ga0496107_0013534 | |||
| 1517 | Ga0496107_0013652 | |||
| 1518 | Ga0496107_0022645 | |||
| 1519 | Ga0496107_0034982 | |||
| 1520 | Ga0496107_0050129 | |||
| 1521 | Ga0496107_0095041 | |||
| 1522 | Ga0496108_0014622 | |||
| 1523 | Ga0496109_0000736 | |||
| 1524 | Ga0496109_0002526 | |||
| 1525 | Ga0496109_0264798 | |||
| 1526 | Ga0496109_0475158 | |||
| 1527 | Ga0496110_0035374 | |||
| 1528 | Ga0496110_0055710 | |||
| 1529 | Ga0496110_0069720 | |||
| 1530 | Ga0496110_0091186 | |||
| 1531 | Ga0496111_0013697 | |||
| 1532 | Ga0496111_0051148 | |||
| 1533 | Ga0496111_0078320 | |||
| 1534 | Ga0496111_0088525 | |||
| 1535 | Ga0496112_0005715 | |||
| 1536 | Ga0496112_0035592 | |||
| 1537 | Ga0496112_0195239 | |||
| 1538 | Ga0496113_0000137 | |||
| 1539 | Ga0496113_0067149 | |||
| 1540 | Ga0496113_0067574 | |||
| 1541 | Ga0496114_0029796 | |||
| 1542 | Ga0496114_0039419 | |||
| 1543 | Ga0496114_0156096 | |||
| 1544 | Ga0496115_0001071 | |||
| 1545 | Ga0496115_0005562 | |||
| 1546 | Ga0496115_0036013 | |||
| 1547 | Ga0501031_0165746 | |||
| 1548 | Ga0501032_0017503 | |||
| 1549 | Ga0501032_0018276 | |||
| 1550 | Ga0501032_0029636 | |||
| 1551 | Ga0501032_0151188 | |||
| 1552 | Ga0501033_0042439 | |||
| 1553 | Ga0501033_0072248 | |||
| 1554 | Ga0501033_0247293 | |||
| 1555 | Ga0501034_0000166 | |||
| 1556 | Ga0501034_0002279 | |||
| 1557 | Ga0501034_0010525 | |||
| 1558 | Ga0501034_0039342 | |||
| 1559 | Ga0501034_0046873 | |||
| 1560 | Ga0501034_0047608 | |||
| 1561 | Ga0501034_0049363 | |||
| 1562 | Ga0501034_0056805 | |||
| 1563 | Ga0501034_0057543 | |||
| 1564 | Ga0501034_0290678 | |||
| 1565 | Ga0501034_0317593 | |||
| 1566 | Ga0501034_0561415 | |||
| 1567 | Ga0501036_0001268 | |||
| 1568 | Ga0501036_0001435 | |||
| 1569 | Ga0501036_0023356 | |||
| 1570 | Ga0501036_0037375 | |||
| 1571 | Ga0501036_0050505 | |||
| 1572 | Ga0501036_0051817 | |||
| 1573 | Ga0501036_0251601 | |||
| 1574 | Ga0501037_0003033 | |||
| 1575 | Ga0501037_0006762 | |||
| 1576 | Ga0501037_0011748 | |||
| 1577 | Ga0501037_0020805 | |||
| 1578 | Ga0501037_0055834 | |||
| 1579 | Ga0501037_0074456 | |||
| 1580 | Ga0501038_0011216 | |||
| 1581 | Ga0501038_0029585 | |||
| 1582 | Ga0501038_0105864 | |||
| 1583 | Ga0501038_0129001 | |||
| 1584 | Ga0501038_0148738 | |||
| 1585 | Ga0501038_0218712 | |||
| 1586 | Ga0501039_0000758 | |||
| 1587 | Ga0501039_0019466 | |||
| 1588 | Ga0501039_0151567 | |||
| 1589 | Ga0501039_0289235 | |||
| 1590 | Ga0501043_0029469 | |||
| 1591 | Ga0501043_0030069 | |||
| 1592 | Ga0501046_0003696 | |||
| 1593 | Ga0501046_0006647 | |||
| 1594 | Ga0501046_0023536 | |||
| 1595 | Ga0501047_0002756 | |||
| 1596 | Ga0501047_0003470 | |||
| 1597 | Ga0501047_0027786 | |||
| 1598 | Ga0501047_0101585 | |||
| 1599 | Ga0501047_0127248 | |||
| 1600 | Ga0501048_0000429 | |||
| 1601 | Ga0501048_0264425 | |||
| 1602 | Ga0501067_0000345 | |||
| 1603 | Ga0501067_0014070 | |||
| 1604 | Ga0501067_0037009 | |||
| 1605 | Ga0501067_0064908 | |||
| 1606 | Ga0501067_0111989 | |||
| 1607 | Ga0501068_0132271 | |||
| 1608 | Ga0501068_0137551 | |||
| 1609 | Ga0501069_0026587 | |||
| 1610 | Ga0501070_0001845 | |||
| 1611 | Ga0501070_0012498 | |||
| 1612 | Ga0501070_0013652 | |||
| 1613 | Ga0501070_0026768 | |||
| 1614 | Ga0501070_0103505 | |||
| 1615 | Ga0501071_0022461 | |||
| 1616 | Ga0501071_0026336 | |||
| 1617 | Ga0501073_0031245 | |||
| 1618 | Ga0501073_0036159 | |||
| 1619 | Ga0501073_0141260 | |||
| 1620 | Ga0501073_0354884 | |||
| 1621 | Ga0501074_0021064 | |||
| 1622 | Ga0501074_0036572 | |||
| 1623 | Ga0501074_0141093 | |||
| 1624 | Ga0501074_0313888 | |||
| 1625 | Ga0501074_0420357 | |||
| 1626 | Ga0501075_0035258 | |||
| 1627 | Ga0501076_0002841 | |||
| 1628 | Ga0501077_0053100 | |||
| 1629 | Ga0501077_0184536 | |||
| 1630 | Ga0501079_0082308 | |||
| 1631 | Ga0501079_0132355 | |||
| 1632 | Ga0501080_0000383 | |||
| 1633 | Ga0501080_0001688 | |||
| 1634 | Ga0501080_0020427 | |||
| 1635 | Ga0501080_0020834 | |||
| 1636 | Ga0501080_0031459 | |||
| 1637 | Ga0501080_0049497 | |||
| 1638 | Ga0501080_0213614 | |||
| 1639 | Ga0501080_0303288 | |||
| 1640 | Ga0501081_0091558 | |||
| 1641 | Ga0501081_0157860 | |||
| 1642 | Ga0501083_0004489 | |||
| 1643 | Ga0501083_0044550 | |||
| 1644 | Ga0501083_0053402 | |||
| 1645 | Ga0501083_0061823 | |||
| 1646 | Ga0501083_0077003 | |||
| 1647 | Ga0501035_0000084 | |||
| 1648 | Ga0501035_0000197 | |||
| 1649 | Ga0501035_0032596 | |||
| 1650 | Ga0501035_0043306 | |||
| 1651 | Ga0501035_0130879 | |||
| 1652 | Ga0501035_0333819 | |||
| 1653 | Ga0501044_0000073 | |||
| 1654 | Ga0501044_0030649 | |||
| 1655 | Ga0501044_0032568 | |||
| 1656 | Ga0501044_0044299 | |||
| 1657 | Ga0501044_0057292 | |||
| 1658 | Ga0501044_0088937 | |||
| 1659 | Ga0501044_0257880 | |||
| 1660 | Ga0501044_0334805 | |||
| 1661 | Ga0501044_0409918 | |||
| 1662 | Ga0501044_0448892 | |||
| 1663 | Ga0501045_0034565 | |||
| 1664 | Ga0501045_0154513 | |||
| 1665 | nmdc:mga03683_111129_c1 | |||
| 1666 | nmdc:mga03n38_31116_c1 | |||
| 1667 | nmdc:mga00v17_74252_c1 | |||
| 1668 | nmdc:mga0yw44_85728_c1 | |||
| 1669 | nmdc:mga0k408_19959_c1 | |||
| 1670 | nmdc:mga0k408_61999_c1 | |||
| 1671 | nmdc:mga06z11_236772_c1 | |||
| 1672 | nmdc:mga07m45_13691_c2 | |||
| 1673 | nmdc:mga07m45_49001_c1 | |||
| 1674 | nmdc:mga05p37_12681_c1 | |||
| 1675 | nmdc:mga05p37_19_c2 | |||
| 1676 | nmdc:mga09592_1297_c1 | |||
| 1677 | nmdc:mga0qj67_259_c1 | |||
| 1678 | nmdc:mga06r32_1133_c1 | |||
| 1679 | nmdc:mga08y16_114800_c1 | |||
| 1680 | nmdc:mga08y16_21083_c1 | |||
| 1681 | nmdc:mga08y16_293458_c1 | |||
| 1682 | nmdc:mga08y16_653311_c1 | |||
| 1683 | nmdc:mga0n895_112359_c1 | |||
| 1684 | nmdc:mga0n895_41918_c1 | |||
| 1685 | nmdc:mga0n895_439753_c1 | |||
| 1686 | nmdc:mga0n895_68456_c1 | |||
| 1687 | nmdc:mga0n895_701_c1 | |||
| 1688 | nmdc:mga0rr50_217046_c1 | |||
| 1689 | nmdc:mga0rr50_63863_c1 | |||
| 1690 | nmdc:mga0rr50_785_c1 | |||
| 1691 | nmdc:mga0rr50_83435_c1 | |||
| 1692 | nmdc:mga08x19_104497_c1 | |||
| 1693 | nmdc:mga08x19_162458_c1 | |||
| 1694 | nmdc:mga08x19_182439_c1 | |||
| 1695 | nmdc:mga08x19_196928_c1 | |||
| 1696 | nmdc:mga08x19_93555_c1 | |||
| 1697 | nmdc:mga0a205_11208_c1 | |||
| 1698 | nmdc:mga0a205_249_c1 | |||
| 1699 | nmdc:mga0a205_284511_c1 | |||
| 1700 | nmdc:mga0a205_88929_c2 | |||
| 1701 | Ga0495601_0000186 | |||
| 1702 | Ga0495601_0000677 | |||
| 1703 | Ga0495601_0000798 | |||
| 1704 | Ga0495601_0050367 | |||
| 1705 | Ga0495601_0127885 | |||
| 1706 | Ga0495601_0283553 | |||
| 1707 | Ga0495612_0000089 | |||
| 1708 | Ga0495612_0001470 | |||
| 1709 | Ga0495612_0039065 | |||
| 1710 | Ga0495595_0000369 | |||
| 1711 | Ga0495595_0005480 | |||
| 1712 | Ga0495595_0008524 | |||
| 1713 | Ga0495619_0000052 | |||
| 1714 | Ga0495619_0000078 | |||
| 1715 | Ga0495619_0002831 | |||
| 1716 | Ga0495619_0003693 | |||
| 1717 | Ga0495619_0004203 | |||
| 1718 | Ga0495619_0004787 | |||
| 1719 | Ga0500644_0000406 | |||
| 1720 | Ga0500651_0019843 | |||
| 1721 | Ga0500651_0132785 | |||
| 1722 | Ga0500566_0118772 | |||
| 1723 | Ga0500641_0004364 | |||
| 1724 | Ga0500641_0089619 | |||
| 1725 | Ga0500562_034091 | |||
| 1726 | Ga0500595_000001 | |||
| 1727 | Ga0500595_019094 | |||
| 1728 | Ga0500597_054645 | |||
| 1729 | Ga0500652_003619 | |||
| 1730 | Ga0500616_0000001 | |||
| 1731 | Ga0500616_0014708 | |||
| 1732 | Ga0500645_002831 | |||
| 1733 | Ga0500645_054630 | |||
| 1734 | Ga0501084_0379974 | |||
| 1735 | Ga0501084_0477523 | |||
| 1736 | Ga0501082_0005704 | |||
| 1737 | Ga0501082_0061688 | |||
| 1738 | Ga0501082_0125079 | |||
| 1739 | Ga0501082_0131729 | |||
| 1740 | Ga0501082_0268014 | |||
| 1741 | Ga0501082_0694731 | |||
| 1742 | 2643758229 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ha4-assembly1.cif.gz_A | structure of a diaminopimelate epimerase from acinetobacter baumannii | 0.7477 | 7 | 277 |
| 3ejx-assembly5.cif.gz_D | crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap | 0.7323 | 7 | 269 |
| 7vdy-assembly1.cif.gz_B | crystal structure of o-ureidoserine racemase | 0.7293 | 7 | 271 |
| 5ha4-assembly1.cif.gz_A | structure of a diaminopimelate epimerase from acinetobacter baumannii | 0.7251 | 7 | 277 |
| 6d13-assembly1.cif.gz_A | crystal structure of e.coli rpph-dapf complex | 0.7243 | 7 | 269 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A6K1_1_112_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9001 | 9 | 106 | 3.10.310.10 |
| 2q9jA01 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.8951 | 8 | 113 | 3.10.310.10 |
| af_I1NA10_49_204_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.8843 | 9 | 127 | 3.10.310.10 |
| 3ejxD01 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.877 | 7 | 121 | 3.10.310.10 |
| af_Q58519_1_127_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.8762 | 9 | 124 | 3.10.310.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A259AH67-F1-model_v4 | diaminopimelate epimerase (EC 5.1.1.7) | 0.97 | 1 | 105 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-A0A7Z9VGR8-F1-model_v4 | Diaminopimelate epimerase (EC 5.1.1.7) | 0.9597 | 7 | 122 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-A0A259AH67-F1-model_v4 | diaminopimelate epimerase (EC 5.1.1.7) | 0.9522 | 1 | 105 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-A0A528TU13-F1-model_v4 | diaminopimelate epimerase (EC 5.1.1.7) | 0.9495 | 9 | 106 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-A0A6P4GCA4-F1-model_v4 | deleted | 0.9481 | 13 | 106 |
|