F484209
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 872 | 390 | 1745 | 275 |
Family's Representative Sequence
| Representative Sequence | 3300002704|JGI25155J39150_1001042|JGI25155J39150_10010422 |
| Length | 288 |
| Sequence | MADQAAHAADSGKEAQEPRQSKFGRLLLTGAGGGLGKVLRPRLAAFADVLRVSDLEAALTGEPAAHEEVMPCNLADRAAMDALIAGCDAIVHLGGVSVERPFEEILEANIKGVFHVYEAARRHGVKRVVFASSNHVTGFYRQDEKIDVRDLRRPDGYYGLSKSYGEDMAQFNFDRYGIETVSIRIGWSFPEPKDRRSLASWLSYDDLTELLRCCLFTPNVGHTVVYGMSDNPSTWWSNRYAAHLGFQARDSSEAFRAKIEAQPMPAADDPVRVYQGGVFTATGPFDPQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 2 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 15 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 39 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 124 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 134 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 205 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 207 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 211 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 212 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 213 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 214 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 215 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 216 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 217 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 218 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 219 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 220 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 222 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 223 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 227 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 228 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 229 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 230 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 231 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 232 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 237 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 238 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 239 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 240 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 243 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 244 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 249 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 250 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 251 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 252 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 253 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 254 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 255 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 256 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 257 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 258 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 259 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 260 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 261 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 262 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 263 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 264 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 265 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 266 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 267 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 268 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 269 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 270 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 309 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 310 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 311 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 312 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 313 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 315 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 316 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 317 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 324 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 325 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 326 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 330 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 331 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 332 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 333 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 334 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 335 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 339 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 341 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 342 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 343 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 344 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 345 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 346 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 347 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 348 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 349 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 350 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 351 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 352 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 353 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 354 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 355 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 356 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 357 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 358 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 359 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 360 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 361 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 362 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 363 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 364 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 365 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 366 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 367 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 368 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 369 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 370 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 371 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 372 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 373 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 374 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 375 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 376 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 377 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 378 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 379 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 380 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 381 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 382 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 383 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 384 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 385 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 386 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 387 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 388 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 389 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 390 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.33 |
| Metatranscriptomes | 0 |
| Isolates | 3.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.11 |
| Bulb | 0 |
| Endosphere | 19.27 |
| Nodule | 0.46 |
| Rhizoplane | 1.95 |
| Rhizosphere | 68.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1001042 | 3300002704 | Bacteria | 2929 |
| 2 | JGI25155J39150_1000123 | 3300002704 | Bacteria | 37730 |
| 3 | JGI25156J39149_1000052 | 3300002705 | Bacteria | 89046 |
| 4 | JGI25162J39368_1000414 | 3300002737 | Bacteria | 34857 |
| 5 | JGI25154J39366_1000081 | 3300002738 | Bacteria | 89046 |
| 6 | JGI25154J39366_1000128 | 3300002738 | Bacteria | 59551 |
| 7 | JGI25157J39369_1000006 | 3300002741 | Bacteria | 226861 |
| 8 | JGI25152J39213_1002063 | 3300002773 | Bacteria | 7909 |
| 9 | JGI25150J39212_1007965 | 3300002774 | Bacteria | 2099 |
| 10 | JGI25150J39212_1008331 | 3300002774 | Bacteria | 2033 |
| 11 | JGI25159J45721_1005943 | 3300002987 | Bacteria | 3743 |
| 12 | JGI25159J45721_1010857 | 3300002987 | Bacteria | 2281 |
| 13 | JGI25151J46595_10007771 | 3300003187 | Bacteria | 5217 |
| 14 | JGI25151J46595_10033260 | 3300003187 | Bacteria | 1988 |
| 15 | JGI25165J46597_1000135 | 3300003214 | Bacteria | 122924 |
| 16 | JGI25153J46596_10011901 | 3300003215 | Bacteria | 3809 |
| 17 | JGI25153J46596_10016520 | 3300003215 | Bacteria | 2950 |
| 18 | rootH1_10020400 | 3300003316 | Bacteria | 6751 |
| 19 | rootH1_10062309 | 3300003316 | Bacteria | 4463 |
| 20 | rootH1_10062309 | 3300003323 | Unclassified | 2756 |
| 21 | JGI25160J50197_1000071 | 3300003354 | Bacteria | 108301 |
| 22 | JGI25161J50226_1000144 | 3300003374 | Bacteria | 49457 |
| 23 | Ga0055538_1000055 | 3300003751 | Bacteria | 122924 |
| 24 | Ga0055539_1000080 | 3300003752 | Bacteria | 122924 |
| 25 | Ga0055533_1000086 | 3300003756 | Bacteria | 122924 |
| 26 | Ga0055525_1000114 | 3300003759 | Bacteria | 122924 |
| 27 | Ga0055535_1000891 | 3300003761 | Bacteria | 20502 |
| 28 | Ga0055529_1000622 | 3300003763 | Bacteria | 26539 |
| 29 | Ga0055526_1008751 | 3300003771 | Bacteria | 4991 |
| 30 | Ga0055537_1000689 | 3300003773 | Bacteria | 17610 |
| 31 | Ga0055537_1016026 | 3300003773 | Bacteria | 1286 |
| 32 | Ga0055524_1000006 | 3300003775 | Bacteria | 324702 |
| 33 | Ga0055524_1000033 | 3300003775 | Bacteria | 180833 |
| 34 | Ga0055536_1025617 | 3300003781 | Bacteria | 1675 |
| 35 | Ga0055534_1000850 | 3300003784 | Bacteria | 14043 |
| 36 | Ga0055528_1000432 | 3300003790 | Bacteria | 33611 |
| 37 | Ga0055530_10001172 | 3300003791 | Bacteria | 20267 |
| 38 | Ga0055530_10002040 | 3300003791 | Bacteria | 13623 |
| 39 | Ga0055540_1000005 | 3300003792 | Bacteria | 378126 |
| 40 | Ga0055540_1000007 | 3300003792 | Bacteria | 318178 |
| 41 | Ga0055540_1007509 | 3300003792 | Bacteria | 4097 |
| 42 | Ga0055531_10001249 | 3300003794 | Bacteria | 19299 |
| 43 | Ga0055531_10004316 | 3300003794 | Bacteria | 8709 |
| 44 | Ga0055531_10005581 | 3300003794 | Bacteria | 7338 |
| 45 | Ga0055541_1000057 | 3300003841 | Bacteria | 122924 |
| 46 | Ga0055543_1000162 | 3300004625 | Bacteria | 55480 |
| 47 | Ga0065165_1003473 | 3300005262 | Bacteria | 11008 |
| 48 | Ga0065165_1036109 | 3300005262 | Bacteria | 1511 |
| 49 | Ga0070658_10061636 | 3300005327 | Bacteria | 3056 |
| 50 | Ga0070658_10141954 | 3300005327 | Bacteria | 2007 |
| 51 | Ga0070676_10006595 | 3300005328 | Bacteria | 6207 |
| 52 | Ga0070676_10021803 | 3300005328 | Bacteria | 3587 |
| 53 | Ga0070676_10035514 | 3300005328 | Bacteria | 2868 |
| 54 | Ga0070676_10066798 | 3300005328 | Bacteria | 2149 |
| 55 | Ga0070690_100001452 | 3300005330 | Bacteria | 12372 |
| 56 | Ga0070690_100022429 | 3300005330 | Bacteria | 3863 |
| 57 | Ga0070690_100122522 | 3300005330 | Bacteria | 1747 |
| 58 | Ga0070670_100003877 | 3300005331 | Bacteria | 12476 |
| 59 | Ga0070670_100006300 | 3300005331 | Bacteria | 10047 |
| 60 | Ga0070670_100029278 | 3300005331 | Bacteria | 4739 |
| 61 | Ga0070670_100037863 | 3300005331 | Bacteria | 4149 |
| 62 | Ga0070670_100161566 | 3300005331 | Bacteria | 1941 |
| 63 | Ga0070670_100219464 | 3300005331 | Bacteria | 1654 |
| 64 | Ga0070670_100346801 | 3300005331 | Bacteria | 1304 |
| 65 | Ga0070670_100365812 | 3300005331 | Bacteria | 1269 |
| 66 | Ga0070677_10001476 | 3300005333 | Bacteria | 7436 |
| 67 | Ga0070677_10004019 | 3300005333 | Bacteria | 4776 |
| 68 | Ga0070677_10006747 | 3300005333 | Bacteria | 3821 |
| 69 | Ga0070677_10009993 | 3300005333 | Bacteria | 3232 |
| 70 | Ga0068869_100007843 | 3300005334 | Bacteria | 6851 |
| 71 | Ga0068869_100009960 | 3300005334 | Bacteria | 6178 |
| 72 | Ga0068869_100109806 | 3300005334 | Bacteria | 2097 |
| 73 | Ga0068869_100382916 | 3300005334 | Bacteria | 1153 |
| 74 | Ga0070666_10001342 | 3300005335 | Bacteria | 14927 |
| 75 | Ga0070666_10029664 | 3300005335 | Bacteria | 3598 |
| 76 | Ga0070666_10104785 | 3300005335 | Bacteria | 1953 |
| 77 | Ga0070682_100050395 | 3300005337 | Bacteria | 2599 |
| 78 | Ga0068868_100000930 | 3300005338 | Bacteria | 19942 |
| 79 | Ga0068868_100059254 | 3300005338 | Bacteria | 3028 |
| 80 | Ga0068868_100141609 | 3300005338 | Bacteria | 1974 |
| 81 | Ga0068868_100143353 | 3300005338 | Bacteria | 1963 |
| 82 | Ga0070689_100026477 | 3300005340 | Bacteria | 4367 |
| 83 | Ga0070687_100026010 | 3300005343 | Bacteria | 2813 |
| 84 | Ga0070661_100000421 | 3300005344 | Bacteria | 32488 |
| 85 | Ga0070661_100020513 | 3300005344 | Bacteria | 4714 |
| 86 | Ga0070661_100067019 | 3300005344 | Bacteria | 2638 |
| 87 | Ga0070661_100150333 | 3300005344 | Bacteria | 1760 |
| 88 | Ga0070661_100168852 | 3300005344 | Bacteria | 1660 |
| 89 | Ga0070668_100063241 | 3300005347 | Bacteria | 2868 |
| 90 | Ga0070669_100008965 | 3300005353 | Bacteria | 7140 |
| 91 | Ga0070669_100254237 | 3300005353 | Bacteria | 1400 |
| 92 | Ga0070675_100000926 | 3300005354 | Bacteria | 20887 |
| 93 | Ga0070675_100006716 | 3300005354 | Bacteria | 8846 |
| 94 | Ga0070675_100023645 | 3300005354 | Bacteria | 4915 |
| 95 | Ga0070675_100082173 | 3300005354 | Bacteria | 2687 |
| 96 | Ga0070675_100219449 | 3300005354 | Bacteria | 1655 |
| 97 | Ga0070671_100005287 | 3300005355 | Bacteria | 10298 |
| 98 | Ga0070671_100006545 | 3300005355 | Bacteria | 9314 |
| 99 | Ga0070671_100008975 | 3300005355 | Bacteria | 8023 |
| 100 | Ga0070671_100119488 | 3300005355 | Bacteria | 2217 |
| 101 | Ga0070671_100169798 | 3300005355 | Bacteria | 1845 |
| 102 | Ga0070671_100268378 | 3300005355 | Bacteria | 1450 |
| 103 | Ga0070671_100336060 | 3300005355 | Bacteria | 1288 |
| 104 | Ga0070674_100012835 | 3300005356 | Bacteria | 5157 |
| 105 | Ga0070674_100014454 | 3300005356 | Bacteria | 4907 |
| 106 | Ga0070674_100031292 | 3300005356 | Bacteria | 3525 |
| 107 | Ga0070674_100123469 | 3300005356 | Bacteria | 1920 |
| 108 | Ga0070673_100031264 | 3300005364 | Bacteria | 3993 |
| 109 | Ga0070673_100054845 | 3300005364 | Bacteria | 3138 |
| 110 | Ga0070659_100001131 | 3300005366 | Bacteria | 19448 |
| 111 | Ga0070659_100021789 | 3300005366 | Bacteria | 4885 |
| 112 | Ga0070667_100011038 | 3300005367 | Bacteria | 7472 |
| 113 | Ga0070667_100017549 | 3300005367 | Bacteria | 5932 |
| 114 | Ga0070667_100063167 | 3300005367 | Bacteria | 3137 |
| 115 | Ga0070667_100254418 | 3300005367 | Bacteria | 1571 |
| 116 | Ga0070701_10067747 | 3300005438 | Bacteria | 1900 |
| 117 | Ga0070700_100322159 | 3300005441 | Bacteria | 1136 |
| 118 | Ga0070678_100013269 | 3300005456 | Bacteria | 5158 |
| 119 | Ga0070678_100038573 | 3300005456 | Bacteria | 3364 |
| 120 | Ga0070678_100050929 | 3300005456 | Bacteria | 2998 |
| 121 | Ga0070678_100129140 | 3300005456 | Bacteria | 2005 |
| 122 | Ga0070678_100226481 | 3300005456 | Bacteria | 1557 |
| 123 | Ga0070678_100229716 | 3300005456 | Bacteria | 1546 |
| 124 | Ga0070678_100284977 | 3300005456 | Bacteria | 1398 |
| 125 | Ga0070678_100350956 | 3300005456 | Bacteria | 1268 |
| 126 | Ga0070662_100025220 | 3300005457 | Bacteria | 4103 |
| 127 | Ga0070662_100047086 | 3300005457 | Bacteria | 3100 |
| 128 | Ga0070662_100065813 | 3300005457 | Bacteria | 2658 |
| 129 | Ga0070662_100076490 | 3300005457 | Bacteria | 2481 |
| 130 | Ga0068867_100000048 | 3300005459 | Bacteria | 73813 |
| 131 | Ga0068867_100001383 | 3300005459 | Bacteria | 16772 |
| 132 | Ga0068867_100002855 | 3300005459 | Bacteria | 12149 |
| 133 | Ga0068867_100004608 | 3300005459 | Bacteria | 9701 |
| 134 | Ga0068867_100007763 | 3300005459 | Bacteria | 7585 |
| 135 | Ga0068867_100024081 | 3300005459 | Bacteria | 4362 |
| 136 | Ga0068867_100068350 | 3300005459 | Bacteria | 2651 |
| 137 | Ga0068867_100112679 | 3300005459 | Bacteria | 2092 |
| 138 | Ga0068867_100190352 | 3300005459 | Bacteria | 1637 |
| 139 | Ga0070685_10286535 | 3300005466 | Bacteria | 1105 |
| 140 | Ga0070706_100002704 | 3300005467 | Bacteria | 17739 |
| 141 | Ga0070699_100233632 | 3300005518 | Bacteria | 1640 |
| 142 | Ga0070684_100004660 | 3300005535 | Bacteria | 10467 |
| 143 | Ga0070684_100527755 | 3300005535 | Bacteria | 1094 |
| 144 | Ga0068853_100037028 | 3300005539 | Bacteria | 4150 |
| 145 | Ga0068853_100053921 | 3300005539 | Bacteria | 3464 |
| 146 | Ga0068853_100118152 | 3300005539 | Bacteria | 2363 |
| 147 | Ga0068853_100347362 | 3300005539 | Bacteria | 1379 |
| 148 | Ga0070672_100016710 | 3300005543 | Bacteria | 5260 |
| 149 | Ga0070672_100026178 | 3300005543 | Bacteria | 4336 |
| 150 | Ga0070672_100051192 | 3300005543 | Bacteria | 3219 |
| 151 | Ga0070672_100068603 | 3300005543 | Bacteria | 2813 |
| 152 | Ga0070672_100100057 | 3300005543 | Bacteria | 2351 |
| 153 | Ga0070672_100112023 | 3300005543 | Bacteria | 2225 |
| 154 | Ga0070672_100158352 | 3300005543 | Bacteria | 1877 |
| 155 | Ga0070672_100180274 | 3300005543 | Bacteria | 1760 |
| 156 | Ga0070672_100183062 | 3300005543 | Bacteria | 1746 |
| 157 | Ga0070672_100199760 | 3300005543 | Bacteria | 1672 |
| 158 | Ga0070672_100369935 | 3300005543 | Bacteria | 1224 |
| 159 | Ga0070693_100077521 | 3300005547 | Bacteria | 1972 |
| 160 | Ga0070693_100161165 | 3300005547 | Bacteria | 1429 |
| 161 | Ga0070665_100016102 | 3300005548 | Bacteria | 7503 |
| 162 | Ga0070665_100200321 | 3300005548 | Bacteria | 1997 |
| 163 | Ga0070665_100278976 | 3300005548 | Bacteria | 1673 |
| 164 | Ga0070665_100426083 | 3300005548 | Bacteria | 1336 |
| 165 | Ga0068855_100044323 | 3300005563 | Bacteria | 5264 |
| 166 | Ga0070664_100001426 | 3300005564 | Bacteria | 19072 |
| 167 | Ga0070664_100050396 | 3300005564 | Bacteria | 3523 |
| 168 | Ga0070664_100078785 | 3300005564 | Bacteria | 2834 |
| 169 | Ga0070664_100105483 | 3300005564 | Bacteria | 2455 |
| 170 | Ga0070664_100120375 | 3300005564 | Bacteria | 2298 |
| 171 | Ga0070664_100147680 | 3300005564 | Bacteria | 2074 |
| 172 | Ga0070664_100163631 | 3300005564 | Bacteria | 1970 |
| 173 | Ga0070664_100289543 | 3300005564 | Bacteria | 1478 |
| 174 | Ga0068857_100119625 | 3300005577 | Bacteria | 2371 |
| 175 | Ga0068857_100237252 | 3300005577 | Bacteria | 1669 |
| 176 | Ga0068857_100438830 | 3300005577 | Bacteria | 1219 |
| 177 | Ga0068854_100018851 | 3300005578 | Bacteria | 4639 |
| 178 | Ga0068854_100019957 | 3300005578 | Bacteria | 4525 |
| 179 | Ga0068854_100115693 | 3300005578 | Bacteria | 2029 |
| 180 | Ga0068856_100008227 | 3300005614 | Bacteria | 10167 |
| 181 | Ga0068856_100047733 | 3300005614 | Bacteria | 4219 |
| 182 | Ga0068856_100055782 | 3300005614 | Bacteria | 3899 |
| 183 | Ga0068856_100166397 | 3300005614 | Bacteria | 2216 |
| 184 | Ga0068852_100045508 | 3300005616 | Bacteria | 3733 |
| 185 | Ga0068852_100052239 | 3300005616 | Bacteria | 3512 |
| 186 | Ga0068852_100063558 | 3300005616 | Bacteria | 3214 |
| 187 | Ga0068852_100089038 | 3300005616 | Bacteria | 2758 |
| 188 | Ga0068852_100113517 | 3300005616 | Bacteria | 2467 |
| 189 | Ga0068852_100255769 | 3300005616 | Bacteria | 1679 |
| 190 | Ga0068852_100270354 | 3300005616 | Bacteria | 1635 |
| 191 | Ga0068859_100001157 | 3300005617 | Bacteria | 26939 |
| 192 | Ga0068859_100166879 | 3300005617 | Bacteria | 2281 |
| 193 | Ga0068864_100043931 | 3300005618 | Bacteria | 3827 |
| 194 | Ga0068864_100120199 | 3300005618 | Bacteria | 2348 |
| 195 | Ga0068864_100228811 | 3300005618 | Bacteria | 1719 |
| 196 | Ga0068866_10016531 | 3300005718 | Bacteria | 3300 |
| 197 | Ga0068866_10197080 | 3300005718 | Bacteria | 1201 |
| 198 | Ga0068861_100013043 | 3300005719 | Bacteria | 5811 |
| 199 | Ga0068861_100021750 | 3300005719 | Bacteria | 4612 |
| 200 | Ga0068861_100038148 | 3300005719 | Bacteria | 3575 |
| 201 | Ga0068851_10009512 | 3300005834 | Bacteria | 4522 |
| 202 | Ga0068851_10023882 | 3300005834 | Bacteria | 2990 |
| 203 | Ga0068851_10027772 | 3300005834 | Bacteria | 2791 |
| 204 | Ga0068870_10016501 | 3300005840 | Bacteria | 3530 |
| 205 | Ga0068870_10041145 | 3300005840 | Bacteria | 2400 |
| 206 | Ga0068870_10199416 | 3300005840 | Bacteria | 1213 |
| 207 | Ga0068863_100008961 | 3300005841 | Bacteria | 9770 |
| 208 | Ga0068863_100036313 | 3300005841 | Bacteria | 4694 |
| 209 | Ga0068863_100072562 | 3300005841 | Bacteria | 3257 |
| 210 | Ga0068863_100216288 | 3300005841 | Bacteria | 1845 |
| 211 | Ga0068858_100001292 | 3300005842 | Bacteria | 25859 |
| 212 | Ga0068858_100024788 | 3300005842 | Bacteria | 5586 |
| 213 | Ga0068858_100035096 | 3300005842 | Bacteria | 4651 |
| 214 | Ga0068858_100062309 | 3300005842 | Bacteria | 3448 |
| 215 | Ga0068858_100378133 | 3300005842 | Bacteria | 1359 |
| 216 | Ga0068860_100001127 | 3300005843 | Bacteria | 29390 |
| 217 | Ga0068860_100003662 | 3300005843 | Bacteria | 15820 |
| 218 | Ga0068860_100089173 | 3300005843 | Bacteria | 2936 |
| 219 | Ga0068860_100101804 | 3300005843 | Bacteria | 2740 |
| 220 | Ga0068860_100313647 | 3300005843 | Bacteria | 1538 |
| 221 | Ga0068862_100008423 | 3300005844 | Bacteria | 8534 |
| 222 | Ga0068862_100028683 | 3300005844 | Bacteria | 4687 |
| 223 | Ga0075365_10018586 | 3300006038 | Bacteria | 4276 |
| 224 | Ga0075368_10025717 | 3300006042 | Bacteria | 2259 |
| 225 | Ga0075363_100196934 | 3300006048 | Bacteria | 1150 |
| 226 | Ga0075432_10008161 | 3300006058 | Bacteria | 3570 |
| 227 | Ga0075362_10106075 | 3300006177 | Bacteria | 1318 |
| 228 | Ga0075367_10137791 | 3300006178 | Bacteria | 1510 |
| 229 | Ga0075367_10274220 | 3300006178 | Bacteria | 1060 |
| 230 | Ga0075366_10000654 | 3300006195 | Bacteria | 16309 |
| 231 | Ga0075366_10001569 | 3300006195 | Bacteria | 11425 |
| 232 | Ga0075366_10003793 | 3300006195 | Bacteria | 8040 |
| 233 | Ga0075366_10004637 | 3300006195 | Bacteria | 7387 |
| 234 | Ga0075366_10035988 | 3300006195 | Bacteria | 2918 |
| 235 | Ga0075366_10061848 | 3300006195 | Bacteria | 2226 |
| 236 | Ga0075366_10067831 | 3300006195 | Bacteria | 2123 |
| 237 | Ga0075366_10077136 | 3300006195 | Bacteria | 1989 |
| 238 | Ga0075366_10168042 | 3300006195 | Bacteria | 1330 |
| 239 | Ga0097621_100004797 | 3300006237 | Bacteria | 9464 |
| 240 | Ga0097621_100010187 | 3300006237 | Bacteria | 6863 |
| 241 | Ga0097621_100012909 | 3300006237 | Bacteria | 6208 |
| 242 | Ga0097621_100092078 | 3300006237 | Bacteria | 2538 |
| 243 | Ga0097621_100171084 | 3300006237 | Bacteria | 1872 |
| 244 | Ga0097621_100227161 | 3300006237 | Bacteria | 1629 |
| 245 | Ga0075370_10000414 | 3300006353 | Bacteria | 15762 |
| 246 | Ga0075370_10009474 | 3300006353 | Bacteria | 5059 |
| 247 | Ga0075370_10010350 | 3300006353 | Bacteria | 4874 |
| 248 | Ga0068871_100008231 | 3300006358 | Bacteria | 7494 |
| 249 | Ga0068871_100021423 | 3300006358 | Bacteria | 4967 |
| 250 | Ga0068871_100022718 | 3300006358 | Bacteria | 4840 |
| 251 | Ga0068871_100249243 | 3300006358 | Bacteria | 1546 |
| 252 | Ga0068865_100049806 | 3300006881 | Bacteria | 2890 |
| 253 | Ga0068865_100296794 | 3300006881 | Bacteria | 1292 |
| 254 | Ga0097620_100001157 | 3300006931 | Bacteria | 26939 |
| 255 | Ga0097620_100166881 | 3300006931 | Bacteria | 2281 |
| 256 | Ga0079104_1000009 | 3300006946 | Bacteria | 367015 |
| 257 | Ga0079104_1023974 | 3300006946 | Bacteria | 1614 |
| 258 | Ga0105240_10007990 | 3300009093 | Bacteria | 15247 |
| 259 | Ga0105240_10105835 | 3300009093 | Bacteria | 3414 |
| 260 | Ga0105245_10018033 | 3300009098 | Bacteria | 6166 |
| 261 | Ga0105245_10077730 | 3300009098 | Bacteria | 3026 |
| 262 | Ga0105245_10187891 | 3300009098 | Bacteria | 1977 |
| 263 | Ga0114129_10052547 | 3300009147 | Bacteria | 5719 |
| 264 | Ga0105243_10002356 | 3300009148 | Bacteria | 15815 |
| 265 | Ga0105243_10035260 | 3300009148 | Bacteria | 3878 |
| 266 | Ga0105243_10047878 | 3300009148 | Bacteria | 3368 |
| 267 | Ga0105243_10161102 | 3300009148 | Bacteria | 1934 |
| 268 | Ga0105243_10232486 | 3300009148 | Bacteria | 1636 |
| 269 | Ga0105243_10321976 | 3300009148 | Bacteria | 1409 |
| 270 | Ga0105241_10152463 | 3300009174 | Bacteria | 1892 |
| 271 | Ga0105241_10333168 | 3300009174 | Bacteria | 1312 |
| 272 | Ga0105242_10077752 | 3300009176 | Bacteria | 2768 |
| 273 | Ga0105248_10024871 | 3300009177 | Bacteria | 6656 |
| 274 | Ga0105248_10107672 | 3300009177 | Bacteria | 3143 |
| 275 | Ga0105248_10243677 | 3300009177 | Bacteria | 2023 |
| 276 | Ga0105237_10003295 | 3300009545 | Bacteria | 19281 |
| 277 | Ga0105237_10007089 | 3300009545 | Bacteria | 12323 |
| 278 | Ga0105237_10034334 | 3300009545 | Bacteria | 5137 |
| 279 | Ga0105238_10003365 | 3300009551 | Bacteria | 15955 |
| 280 | Ga0105238_10020203 | 3300009551 | Bacteria | 6779 |
| 281 | Ga0105238_10084345 | 3300009551 | Bacteria | 3167 |
| 282 | Ga0105238_10114737 | 3300009551 | Bacteria | 2673 |
| 283 | Ga0105249_10020909 | 3300009553 | Bacteria | 5852 |
| 284 | Ga0105249_10021079 | 3300009553 | Bacteria | 5832 |
| 285 | Ga0105249_10039647 | 3300009553 | Bacteria | 4277 |
| 286 | Ga0105239_10003389 | 3300010375 | Bacteria | 19552 |
| 287 | Ga0105246_10071672 | 3300011119 | Bacteria | 2440 |
| 288 | Ga0105246_10341246 | 3300011119 | Bacteria | 1224 |
| 289 | Ga0157371_10047043 | 3300013102 | Bacteria | 3066 |
| 290 | Ga0157370_10290950 | 3300013104 | Bacteria | 1509 |
| 291 | Ga0157369_10030192 | 3300013105 | Bacteria | 5979 |
| 292 | Ga0157374_10027813 | 3300013296 | Bacteria | 5105 |
| 293 | Ga0157374_10077836 | 3300013296 | Bacteria | 3140 |
| 294 | Ga0157374_10189723 | 3300013296 | Bacteria | 2010 |
| 295 | Ga0157378_10009787 | 3300013297 | Bacteria | 8356 |
| 296 | Ga0157378_10092187 | 3300013297 | Bacteria | 2756 |
| 297 | Ga0157378_10179808 | 3300013297 | Bacteria | 1989 |
| 298 | Ga0157378_10397212 | 3300013297 | Bacteria | 1358 |
| 299 | Ga0163162_10005175 | 3300013306 | Bacteria | 12577 |
| 300 | Ga0163162_10039622 | 3300013306 | Bacteria | 4709 |
| 301 | Ga0157372_10020531 | 3300013307 | Bacteria | 7127 |
| 302 | Ga0157375_10009940 | 3300013308 | Bacteria | 8369 |
| 303 | Ga0157375_10020576 | 3300013308 | Bacteria | 6031 |
| 304 | Ga0157375_10025372 | 3300013308 | Bacteria | 5506 |
| 305 | Ga0157375_10028162 | 3300013308 | Bacteria | 5261 |
| 306 | Ga0157375_10036459 | 3300013308 | Bacteria | 4705 |
| 307 | Ga0157375_10045990 | 3300013308 | Bacteria | 4252 |
| 308 | Ga0157375_10076855 | 3300013308 | Bacteria | 3367 |
| 309 | Ga0157375_10154757 | 3300013308 | Bacteria | 2431 |
| 310 | Ga0163163_10002538 | 3300014325 | Bacteria | 15454 |
| 311 | Ga0157380_10001789 | 3300014326 | Bacteria | 14180 |
| 312 | Ga0157380_10047723 | 3300014326 | Bacteria | 3369 |
| 313 | Ga0157380_10071376 | 3300014326 | Bacteria | 2809 |
| 314 | Ga0157380_10071794 | 3300014326 | Bacteria | 2801 |
| 315 | Ga0157380_10076095 | 3300014326 | Bacteria | 2730 |
| 316 | Ga0157380_10409599 | 3300014326 | Bacteria | 1289 |
| 317 | Ga0157377_10000056 | 3300014745 | Bacteria | 87608 |
| 318 | Ga0157377_10072267 | 3300014745 | Bacteria | 1996 |
| 319 | Ga0157379_10013243 | 3300014968 | Bacteria | 7223 |
| 320 | Ga0157379_10020433 | 3300014968 | Bacteria | 5855 |
| 321 | Ga0157379_10025235 | 3300014968 | Bacteria | 5278 |
| 322 | Ga0157379_10130102 | 3300014968 | Bacteria | 2265 |
| 323 | Ga0157379_10135880 | 3300014968 | Bacteria | 2215 |
| 324 | Ga0157376_10014590 | 3300014969 | Bacteria | 5903 |
| 325 | Ga0157376_10021252 | 3300014969 | Bacteria | 5040 |
| 326 | Ga0157376_10051769 | 3300014969 | Bacteria | 3411 |
| 327 | Ga0182006_1015134 | 3300015261 | Bacteria | 3311 |
| 328 | Ga0182005_1000541 | 3300015265 | Bacteria | 19062 |
| 329 | Ga0163161_10033652 | 3300017792 | Bacteria | 3662 |
| 330 | Ga0163161_10113786 | 3300017792 | Bacteria | 2026 |
| 331 | Ga0163161_10162904 | 3300017792 | Bacteria | 1701 |
| 332 | Ga0163161_10343620 | 3300017792 | Bacteria | 1184 |
| 333 | Ga0213876_10052025 | 3300021384 | Bacteria | 2165 |
| 334 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 335 | Ga0209435_100034 | 3300025206 | Bacteria | 144486 |
| 336 | Ga0209435_100115 | 3300025206 | Bacteria | 30475 |
| 337 | Ga0209784_100010 | 3300025224 | Bacteria | 683664 |
| 338 | Ga0209566_100008 | 3300025225 | Bacteria | 683664 |
| 339 | Ga0209674_100019 | 3300025226 | Bacteria | 683664 |
| 340 | Ga0209563_100021 | 3300025230 | Bacteria | 683764 |
| 341 | Ga0207427_100570 | 3300025231 | Bacteria | 18553 |
| 342 | Ga0209437_100019 | 3300025233 | Bacteria | 683764 |
| 343 | Ga0209258_100342 | 3300025242 | Bacteria | 68390 |
| 344 | Ga0207425_1001772 | 3300025245 | Bacteria | 8404 |
| 345 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 346 | Ga0209646_1000155 | 3300025246 | Bacteria | 95204 |
| 347 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 348 | Ga0209026_1000769 | 3300025250 | Bacteria | 17972 |
| 349 | Ga0209677_100011 | 3300025253 | Bacteria | 683664 |
| 350 | Ga0209677_104403 | 3300025253 | Bacteria | 4079 |
| 351 | Ga0209148_1004217 | 3300025254 | Bacteria | 3604 |
| 352 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 353 | Ga0209759_1000375 | 3300025256 | Bacteria | 55963 |
| 354 | Ga0209759_1004950 | 3300025256 | Bacteria | 4815 |
| 355 | Ga0209759_1005146 | 3300025256 | Bacteria | 4661 |
| 356 | Ga0209759_1014038 | 3300025256 | Bacteria | 2138 |
| 357 | Ga0209129_1000062 | 3300025258 | Bacteria | 240655 |
| 358 | Ga0209233_1000025 | 3300025261 | Bacteria | 683764 |
| 359 | Ga0209565_1000124 | 3300025263 | Bacteria | 110789 |
| 360 | Ga0209565_1000910 | 3300025263 | Bacteria | 15931 |
| 361 | Ga0209565_1005822 | 3300025263 | Bacteria | 3537 |
| 362 | Ga0209455_1000511 | 3300025272 | Bacteria | 27782 |
| 363 | Ga0209673_1000043 | 3300025273 | Bacteria | 291503 |
| 364 | Ga0209673_1010877 | 3300025273 | Bacteria | 3799 |
| 365 | Ga0209673_1058334 | 3300025273 | Bacteria | 978 |
| 366 | Ga0209130_1000060 | 3300025284 | Bacteria | 201501 |
| 367 | Ga0209130_1000114 | 3300025284 | Bacteria | 130381 |
| 368 | Ga0209675_1000269 | 3300025291 | Bacteria | 49713 |
| 369 | Ga0209675_1009012 | 3300025291 | Bacteria | 3579 |
| 370 | Ga0209676_1000007 | 3300025292 | Bacteria | 1029371 |
| 371 | Ga0209025_1004701 | 3300025294 | Bacteria | 11654 |
| 372 | Ga0209025_1007436 | 3300025294 | Bacteria | 8167 |
| 373 | Ga0209025_1025947 | 3300025294 | Bacteria | 2961 |
| 374 | Ga0209564_1000176 | 3300025295 | Bacteria | 152363 |
| 375 | Ga0209564_1000268 | 3300025295 | Bacteria | 109101 |
| 376 | Ga0209564_1002616 | 3300025295 | Bacteria | 13766 |
| 377 | Ga0209564_1007511 | 3300025295 | Bacteria | 5616 |
| 378 | Ga0209758_1000378 | 3300025297 | Bacteria | 77514 |
| 379 | Ga0209758_1000517 | 3300025297 | Bacteria | 61999 |
| 380 | Ga0209758_1025948 | 3300025297 | Bacteria | 2554 |
| 381 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 382 | Ga0209050_1000118 | 3300025298 | Bacteria | 202586 |
| 383 | Ga0209050_1000243 | 3300025298 | Bacteria | 117715 |
| 384 | Ga0209050_1002216 | 3300025298 | Bacteria | 17437 |
| 385 | Ga0209050_1002992 | 3300025298 | Bacteria | 13147 |
| 386 | Ga0209050_1016204 | 3300025298 | Bacteria | 3067 |
| 387 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 388 | Ga0209256_1000019 | 3300025299 | Bacteria | 558627 |
| 389 | Ga0209256_1021803 | 3300025299 | Bacteria | 1956 |
| 390 | Ga0207426_1000308 | 3300025302 | Bacteria | 96061 |
| 391 | Ga0207426_1002574 | 3300025302 | Bacteria | 11305 |
| 392 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 393 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 394 | Ga0209051_1000853 | 3300025303 | Bacteria | 31106 |
| 395 | Ga0209051_1044684 | 3300025303 | Bacteria | 1541 |
| 396 | Ga0209257_1000020 | 3300025304 | Bacteria | 773356 |
| 397 | Ga0209257_1000022 | 3300025304 | Bacteria | 765258 |
| 398 | Ga0209257_1000038 | 3300025304 | Bacteria | 609032 |
| 399 | Ga0209257_1000044 | 3300025304 | Bacteria | 486709 |
| 400 | Ga0209257_1024509 | 3300025304 | Bacteria | 2087 |
| 401 | Ga0209257_1035649 | 3300025304 | Bacteria | 1537 |
| 402 | Ga0207697_10007005 | 3300025315 | Bacteria | 5053 |
| 403 | Ga0207697_10093659 | 3300025315 | Bacteria | 1275 |
| 404 | Ga0207697_10098244 | 3300025315 | Bacteria | 1246 |
| 405 | Ga0207682_10000706 | 3300025893 | Bacteria | 15485 |
| 406 | Ga0207682_10007480 | 3300025893 | Bacteria | 4349 |
| 407 | Ga0207682_10009359 | 3300025893 | Bacteria | 3868 |
| 408 | Ga0207682_10012804 | 3300025893 | Bacteria | 3272 |
| 409 | Ga0207642_10098719 | 3300025899 | Bacteria | 1461 |
| 410 | Ga0207688_10200887 | 3300025901 | Bacteria | 1195 |
| 411 | Ga0207680_10005283 | 3300025903 | Bacteria | 6164 |
| 412 | Ga0207680_10026030 | 3300025903 | Bacteria | 3236 |
| 413 | Ga0207680_10080108 | 3300025903 | Bacteria | 2050 |
| 414 | Ga0207680_10085564 | 3300025903 | Bacteria | 1992 |
| 415 | Ga0207645_10000932 | 3300025907 | Bacteria | 24250 |
| 416 | Ga0207645_10016574 | 3300025907 | Bacteria | 4875 |
| 417 | Ga0207645_10032773 | 3300025907 | Bacteria | 3340 |
| 418 | Ga0207645_10075710 | 3300025907 | Bacteria | 2154 |
| 419 | Ga0207645_10114838 | 3300025907 | Bacteria | 1745 |
| 420 | Ga0207643_10044753 | 3300025908 | Bacteria | 2499 |
| 421 | Ga0207705_10191138 | 3300025909 | Bacteria | 1548 |
| 422 | Ga0207684_10006839 | 3300025910 | Bacteria | 10329 |
| 423 | Ga0207654_10184247 | 3300025911 | Bacteria | 1364 |
| 424 | Ga0207695_10099229 | 3300025913 | Bacteria | 2910 |
| 425 | Ga0207695_10318048 | 3300025913 | Bacteria | 1446 |
| 426 | Ga0207671_10002336 | 3300025914 | Bacteria | 20461 |
| 427 | Ga0207671_10005664 | 3300025914 | Bacteria | 11427 |
| 428 | Ga0207671_10050729 | 3300025914 | Bacteria | 3073 |
| 429 | Ga0207662_10093519 | 3300025918 | Bacteria | 1852 |
| 430 | Ga0207657_10009129 | 3300025919 | Bacteria | 10006 |
| 431 | Ga0207657_10045289 | 3300025919 | Bacteria | 3863 |
| 432 | Ga0207649_10000751 | 3300025920 | Bacteria | 21186 |
| 433 | Ga0207649_10287549 | 3300025920 | Bacteria | 1197 |
| 434 | Ga0207681_10005730 | 3300025923 | Bacteria | 7618 |
| 435 | Ga0207681_10069573 | 3300025923 | Bacteria | 2448 |
| 436 | Ga0207681_10070963 | 3300025923 | Bacteria | 2428 |
| 437 | Ga0207681_10098776 | 3300025923 | Bacteria | 2101 |
| 438 | Ga0207681_10321395 | 3300025923 | Bacteria | 1231 |
| 439 | Ga0207694_10072469 | 3300025924 | Bacteria | 2693 |
| 440 | Ga0207650_10002868 | 3300025925 | Bacteria | 11906 |
| 441 | Ga0207650_10054584 | 3300025925 | Bacteria | 2964 |
| 442 | Ga0207650_10073437 | 3300025925 | Bacteria | 2576 |
| 443 | Ga0207650_10173189 | 3300025925 | Bacteria | 1716 |
| 444 | Ga0207650_10210795 | 3300025925 | Bacteria | 1560 |
| 445 | Ga0207650_10300768 | 3300025925 | Bacteria | 1310 |
| 446 | Ga0207659_10001257 | 3300025926 | Bacteria | 15167 |
| 447 | Ga0207659_10013518 | 3300025926 | Bacteria | 5232 |
| 448 | Ga0207659_10015146 | 3300025926 | Bacteria | 4989 |
| 449 | Ga0207659_10028703 | 3300025926 | Bacteria | 3783 |
| 450 | Ga0207659_10036528 | 3300025926 | Bacteria | 3404 |
| 451 | Ga0207659_10044324 | 3300025926 | Bacteria | 3129 |
| 452 | Ga0207659_10142958 | 3300025926 | Bacteria | 1859 |
| 453 | Ga0207687_10102244 | 3300025927 | Bacteria | 2111 |
| 454 | Ga0207644_10000042 | 3300025931 | Bacteria | 112685 |
| 455 | Ga0207644_10006910 | 3300025931 | Bacteria | 7392 |
| 456 | Ga0207644_10007260 | 3300025931 | Bacteria | 7212 |
| 457 | Ga0207644_10088580 | 3300025931 | Bacteria | 2302 |
| 458 | Ga0207644_10153838 | 3300025931 | Bacteria | 1782 |
| 459 | Ga0207644_10358606 | 3300025931 | Bacteria | 1185 |
| 460 | Ga0207690_10000481 | 3300025932 | Bacteria | 25729 |
| 461 | Ga0207690_10018234 | 3300025932 | Bacteria | 4303 |
| 462 | Ga0207690_10170216 | 3300025932 | Bacteria | 1631 |
| 463 | Ga0207706_10017151 | 3300025933 | Bacteria | 6530 |
| 464 | Ga0207706_10020343 | 3300025933 | Bacteria | 5965 |
| 465 | Ga0207706_10066467 | 3300025933 | Bacteria | 3173 |
| 466 | Ga0207706_10067288 | 3300025933 | Bacteria | 3152 |
| 467 | Ga0207706_10099056 | 3300025933 | Bacteria | 2564 |
| 468 | Ga0207706_10201758 | 3300025933 | Bacteria | 1744 |
| 469 | Ga0207709_10002673 | 3300025935 | Bacteria | 11055 |
| 470 | Ga0207709_10115691 | 3300025935 | Bacteria | 1802 |
| 471 | Ga0207709_10119377 | 3300025935 | Bacteria | 1778 |
| 472 | Ga0207669_10013145 | 3300025937 | Bacteria | 4100 |
| 473 | Ga0207669_10133926 | 3300025937 | Bacteria | 1708 |
| 474 | Ga0207669_10370037 | 3300025937 | Bacteria | 1113 |
| 475 | Ga0207704_10195320 | 3300025938 | Bacteria | 1476 |
| 476 | Ga0207691_10000318 | 3300025940 | Bacteria | 47853 |
| 477 | Ga0207691_10017977 | 3300025940 | Bacteria | 6696 |
| 478 | Ga0207691_10027795 | 3300025940 | Bacteria | 5301 |
| 479 | Ga0207691_10036077 | 3300025940 | Bacteria | 4582 |
| 480 | Ga0207691_10037444 | 3300025940 | Bacteria | 4492 |
| 481 | Ga0207691_10045199 | 3300025940 | Bacteria | 4049 |
| 482 | Ga0207691_10047603 | 3300025940 | Bacteria | 3934 |
| 483 | Ga0207691_10074299 | 3300025940 | Bacteria | 3066 |
| 484 | Ga0207691_10084554 | 3300025940 | Bacteria | 2848 |
| 485 | Ga0207711_10004017 | 3300025941 | Bacteria | 12629 |
| 486 | Ga0207711_10010123 | 3300025941 | Bacteria | 7835 |
| 487 | Ga0207711_10014423 | 3300025941 | Bacteria | 6563 |
| 488 | Ga0207711_10101817 | 3300025941 | Bacteria | 2542 |
| 489 | Ga0207689_10013142 | 3300025942 | Bacteria | 7065 |
| 490 | Ga0207689_10058064 | 3300025942 | Bacteria | 3182 |
| 491 | Ga0207689_10060170 | 3300025942 | Bacteria | 3123 |
| 492 | Ga0207661_10037817 | 3300025944 | Bacteria | 3777 |
| 493 | Ga0207679_10000501 | 3300025945 | Bacteria | 26940 |
| 494 | Ga0207679_10046009 | 3300025945 | Bacteria | 3160 |
| 495 | Ga0207679_10072585 | 3300025945 | Bacteria | 2600 |
| 496 | Ga0207679_10335360 | 3300025945 | Bacteria | 1314 |
| 497 | Ga0207679_10444667 | 3300025945 | Bacteria | 1148 |
| 498 | Ga0207667_10046590 | 3300025949 | Bacteria | 4591 |
| 499 | Ga0207667_10497322 | 3300025949 | Bacteria | 1237 |
| 500 | Ga0207651_10000364 | 3300025960 | Bacteria | 19183 |
| 501 | Ga0207651_10006026 | 3300025960 | Bacteria | 6292 |
| 502 | Ga0207651_10041858 | 3300025960 | Bacteria | 3044 |
| 503 | Ga0207651_10046578 | 3300025960 | Bacteria | 2917 |
| 504 | Ga0207651_10054979 | 3300025960 | Bacteria | 2731 |
| 505 | Ga0207712_10041521 | 3300025961 | Bacteria | 3162 |
| 506 | Ga0207712_10194330 | 3300025961 | Bacteria | 1604 |
| 507 | Ga0207668_10012084 | 3300025972 | Bacteria | 5273 |
| 508 | Ga0207668_10012507 | 3300025972 | Bacteria | 5197 |
| 509 | Ga0207640_10013763 | 3300025981 | Bacteria | 4645 |
| 510 | Ga0207658_10002924 | 3300025986 | Bacteria | 12231 |
| 511 | Ga0207658_10004551 | 3300025986 | Bacteria | 9620 |
| 512 | Ga0207658_10005021 | 3300025986 | Bacteria | 9118 |
| 513 | Ga0207658_10072003 | 3300025986 | Bacteria | 2619 |
| 514 | Ga0207658_10077603 | 3300025986 | Bacteria | 2535 |
| 515 | Ga0207658_10288563 | 3300025986 | Bacteria | 1409 |
| 516 | Ga0207677_10013173 | 3300026023 | Bacteria | 4782 |
| 517 | Ga0207677_10083998 | 3300026023 | Bacteria | 2294 |
| 518 | Ga0207677_10084366 | 3300026023 | Bacteria | 2290 |
| 519 | Ga0207677_10133083 | 3300026023 | Bacteria | 1891 |
| 520 | Ga0207677_10593200 | 3300026023 | Bacteria | 971 |
| 521 | Ga0207703_10001647 | 3300026035 | Bacteria | 20096 |
| 522 | Ga0207703_10010862 | 3300026035 | Bacteria | 7100 |
| 523 | Ga0207703_10081473 | 3300026035 | Bacteria | 2698 |
| 524 | Ga0207703_10352718 | 3300026035 | Bacteria | 1355 |
| 525 | Ga0207639_10046131 | 3300026041 | Bacteria | 3286 |
| 526 | Ga0207639_10071881 | 3300026041 | Bacteria | 2708 |
| 527 | Ga0207639_10151636 | 3300026041 | Bacteria | 1942 |
| 528 | Ga0207678_10013097 | 3300026067 | Bacteria | 7275 |
| 529 | Ga0207678_10303781 | 3300026067 | Bacteria | 1371 |
| 530 | Ga0207708_10022289 | 3300026075 | Bacteria | 4782 |
| 531 | Ga0207702_10002308 | 3300026078 | Bacteria | 18242 |
| 532 | Ga0207702_10116578 | 3300026078 | Bacteria | 2383 |
| 533 | Ga0207702_10198726 | 3300026078 | Bacteria | 1857 |
| 534 | Ga0207641_10005423 | 3300026088 | Bacteria | 10888 |
| 535 | Ga0207641_10007604 | 3300026088 | Bacteria | 9011 |
| 536 | Ga0207641_10012523 | 3300026088 | Bacteria | 6952 |
| 537 | Ga0207641_10031474 | 3300026088 | Bacteria | 4401 |
| 538 | Ga0207641_10162836 | 3300026088 | Bacteria | 2029 |
| 539 | Ga0207641_10170410 | 3300026088 | Bacteria | 1986 |
| 540 | Ga0207648_10000492 | 3300026089 | Bacteria | 44104 |
| 541 | Ga0207648_10002026 | 3300026089 | Bacteria | 22125 |
| 542 | Ga0207648_10006568 | 3300026089 | Bacteria | 11552 |
| 543 | Ga0207648_10020730 | 3300026089 | Bacteria | 5917 |
| 544 | Ga0207648_10041853 | 3300026089 | Bacteria | 4023 |
| 545 | Ga0207648_10043392 | 3300026089 | Bacteria | 3947 |
| 546 | Ga0207648_10080809 | 3300026089 | Bacteria | 2836 |
| 547 | Ga0207648_10177524 | 3300026089 | Bacteria | 1884 |
| 548 | Ga0207676_10001498 | 3300026095 | Bacteria | 17239 |
| 549 | Ga0207676_10017299 | 3300026095 | Bacteria | 5226 |
| 550 | Ga0207676_10021790 | 3300026095 | Bacteria | 4705 |
| 551 | Ga0207676_10227678 | 3300026095 | Bacteria | 1664 |
| 552 | Ga0207674_10049675 | 3300026116 | Bacteria | 4288 |
| 553 | Ga0207674_10063382 | 3300026116 | Bacteria | 3731 |
| 554 | Ga0207674_10106917 | 3300026116 | Bacteria | 2775 |
| 555 | Ga0207674_10384556 | 3300026116 | Bacteria | 1357 |
| 556 | Ga0207675_100008838 | 3300026118 | Bacteria | 9453 |
| 557 | Ga0207675_100011212 | 3300026118 | Bacteria | 8394 |
| 558 | Ga0207675_100074019 | 3300026118 | Bacteria | 3187 |
| 559 | Ga0207675_100404798 | 3300026118 | Bacteria | 1345 |
| 560 | Ga0207683_10010653 | 3300026121 | Bacteria | 7837 |
| 561 | Ga0207683_10016734 | 3300026121 | Bacteria | 6241 |
| 562 | Ga0207683_10033147 | 3300026121 | Bacteria | 4486 |
| 563 | Ga0207683_10038389 | 3300026121 | Bacteria | 4174 |
| 564 | Ga0207683_10049633 | 3300026121 | Bacteria | 3675 |
| 565 | Ga0207683_10050334 | 3300026121 | Bacteria | 3649 |
| 566 | Ga0207683_10058883 | 3300026121 | Bacteria | 3373 |
| 567 | Ga0207683_10111670 | 3300026121 | Bacteria | 2448 |
| 568 | Ga0207683_10299106 | 3300026121 | Bacteria | 1472 |
| 569 | Ga0207698_10025392 | 3300026142 | Bacteria | 4174 |
| 570 | Ga0207698_10028570 | 3300026142 | Bacteria | 3979 |
| 571 | Ga0207698_10073233 | 3300026142 | Bacteria | 2727 |
| 572 | Ga0207698_10073649 | 3300026142 | Bacteria | 2720 |
| 573 | Ga0207698_10074629 | 3300026142 | Bacteria | 2706 |
| 574 | Ga0207698_10142792 | 3300026142 | Bacteria | 2065 |
| 575 | Ga0207698_10230582 | 3300026142 | Bacteria | 1681 |
| 576 | Ga0209281_1000023 | 3300027111 | Bacteria | 519955 |
| 577 | Ga0209974_10013298 | 3300027876 | Bacteria | 2742 |
| 578 | Ga0207428_10215834 | 3300027907 | Bacteria | 1440 |
| 579 | Ga0268266_10092747 | 3300028379 | Bacteria | 2650 |
| 580 | Ga0268265_10045405 | 3300028380 | Bacteria | 3278 |
| 581 | Ga0268265_10054590 | 3300028380 | Bacteria | 3033 |
| 582 | Ga0268265_10068611 | 3300028380 | Bacteria | 2750 |
| 583 | Ga0268264_10001710 | 3300028381 | Bacteria | 20233 |
| 584 | Ga0268264_10018493 | 3300028381 | Bacteria | 5699 |
| 585 | Ga0268264_10105160 | 3300028381 | Bacteria | 2462 |
| 586 | Ga0268264_10305606 | 3300028381 | Bacteria | 1499 |
| 587 | Ga0268264_10726154 | 3300028381 | Bacteria | 988 |
| 588 | Ga0307517_10000228 | 3300028786 | Bacteria | 94852 |
| 589 | Ga0307517_10053504 | 3300028786 | Bacteria | 4018 |
| 590 | Ga0307517_10205333 | 3300028786 | Bacteria | 1224 |
| 591 | Ga0307515_10000458 | 3300028794 | Bacteria | 97523 |
| 592 | Ga0307515_10004357 | 3300028794 | Bacteria | 29345 |
| 593 | Ga0307515_10020859 | 3300028794 | Bacteria | 11649 |
| 594 | Ga0307515_10036443 | 3300028794 | Bacteria | 7956 |
| 595 | Ga0307515_10038277 | 3300028794 | Bacteria | 7679 |
| 596 | Ga0307515_10397660 | 3300028794 | Bacteria | 1004 |
| 597 | Ga0307512_10059122 | 3300030522 | Bacteria | 2978 |
| 598 | Ga0307512_10121533 | 3300030522 | Bacteria | 1675 |
| 599 | Ga0307512_10170525 | 3300030522 | Bacteria | 1249 |
| 600 | Ga0316181_1181538 | 3300030744 | Bacteria | 1482 |
| 601 | Ga0307513_10000006 | 3300031456 | Bacteria | 470848 |
| 602 | Ga0307513_10000094 | 3300031456 | Bacteria | 127685 |
| 603 | Ga0307513_10001393 | 3300031456 | Bacteria | 34808 |
| 604 | Ga0307513_10006563 | 3300031456 | Bacteria | 15193 |
| 605 | Ga0307513_10030687 | 3300031456 | Bacteria | 6102 |
| 606 | Ga0307513_10032666 | 3300031456 | Bacteria | 5865 |
| 607 | Ga0307513_10135388 | 3300031456 | Bacteria | 2400 |
| 608 | Ga0307509_10000426 | 3300031507 | Bacteria | 70899 |
| 609 | Ga0307408_100000288 | 3300031548 | Bacteria | 49765 |
| 610 | Ga0307408_100016115 | 3300031548 | Bacteria | 4984 |
| 611 | Ga0307408_100088275 | 3300031548 | Bacteria | 2335 |
| 612 | Ga0307408_100140129 | 3300031548 | Bacteria | 1897 |
| 613 | Ga0307508_10000040 | 3300031616 | Bacteria | 149333 |
| 614 | Ga0307508_10003969 | 3300031616 | Bacteria | 14667 |
| 615 | Ga0307514_10011867 | 3300031649 | Bacteria | 7248 |
| 616 | Ga0307514_10014681 | 3300031649 | Bacteria | 6479 |
| 617 | Ga0307514_10070063 | 3300031649 | Bacteria | 2635 |
| 618 | Ga0307516_10000460 | 3300031730 | Bacteria | 53821 |
| 619 | Ga0307516_10001446 | 3300031730 | Bacteria | 32808 |
| 620 | Ga0307516_10012998 | 3300031730 | Bacteria | 8919 |
| 621 | Ga0307516_10020589 | 3300031730 | Bacteria | 6812 |
| 622 | Ga0307516_10022952 | 3300031730 | Bacteria | 6403 |
| 623 | Ga0307516_10161191 | 3300031730 | Bacteria | 1992 |
| 624 | Ga0307516_10237526 | 3300031730 | Bacteria | 1523 |
| 625 | Ga0307516_10353488 | 3300031730 | Bacteria | 1135 |
| 626 | Ga0307405_10290392 | 3300031731 | Bacteria | 1235 |
| 627 | Ga0307413_10040120 | 3300031824 | Bacteria | 2729 |
| 628 | Ga0307413_10314011 | 3300031824 | Bacteria | 1194 |
| 629 | Ga0307406_10001222 | 3300031901 | Bacteria | 14379 |
| 630 | Ga0307406_10006272 | 3300031901 | Bacteria | 6553 |
| 631 | Ga0307406_10022081 | 3300031901 | Bacteria | 3773 |
| 632 | Ga0307412_10034844 | 3300031911 | Bacteria | 3211 |
| 633 | Ga0307412_10123600 | 3300031911 | Bacteria | 1867 |
| 634 | Ga0307409_100012808 | 3300031995 | Bacteria | 5362 |
| 635 | Ga0307409_100306137 | 3300031995 | Bacteria | 1481 |
| 636 | Ga0307416_100009118 | 3300032002 | Bacteria | 6466 |
| 637 | Ga0307416_100020199 | 3300032002 | Bacteria | 4746 |
| 638 | Ga0307416_100127951 | 3300032002 | Bacteria | 2279 |
| 639 | Ga0307414_10209979 | 3300032004 | Bacteria | 1590 |
| 640 | Ga0307411_10239000 | 3300032005 | Bacteria | 1421 |
| 641 | Ga0307411_10395953 | 3300032005 | Bacteria | 1140 |
| 642 | Ga0307415_100000538 | 3300032126 | Bacteria | 16532 |
| 643 | Ga0307510_10000109 | 3300033180 | Bacteria | 65353 |
| 644 | Ga0307510_10167982 | 3300033180 | Bacteria | 1778 |
| 645 | Ga0307510_10251031 | 3300033180 | Bacteria | 1257 |
| 646 | Ga0373930_0056600 | 3300034816 | Bacteria | 867 |
| 647 | Ga0373943_0041563 | 3300035170 | Bacteria | 2224 |
| 648 | Ga0373931_0000491 | 3300035691 | Bacteria | 16121 |
| 649 | Ga0373931_0011931 | 3300035691 | Bacteria | 4204 |
| 650 | Ga0373935_0200366 | 3300035692 | Bacteria | 1379 |
| 651 | Ga0373937_0206953 | 3300036401 | Bacteria | 1845 |
| 652 | Ga0373925_0023538 | 3300037068 | Bacteria | 4494 |
| 653 | Ga0373925_0061260 | 3300037068 | Bacteria | 2826 |
| 654 | Ga0395899_0016249 | 3300037312 | Bacteria | 5673 |
| 655 | Ga0395900_0004795 | 3300037418 | Bacteria | 14248 |
| 656 | Ga0395898_0008778 | 3300037466 | Bacteria | 10652 |
| 657 | Ga0395898_0396716 | 3300037466 | Bacteria | 1315 |
| 658 | Ga0395905_0010964 | 3300037471 | Bacteria | 8772 |
| 659 | Ga0395905_0031340 | 3300037471 | Bacteria | 5005 |
| 660 | Ga0395905_0122445 | 3300037471 | Bacteria | 2445 |
| 661 | Ga0395905_0261614 | 3300037471 | Bacteria | 1615 |
| 662 | Ga0395901_0320256 | 3300038443 | Bacteria | 1604 |
| 663 | Ga0436365_1021472 | 3300039437 | Bacteria | 4110 |
| 664 | Ga0436363_0446142 | 3300039450 | Bacteria | 1817 |
| 665 | Ga0439436_0062788 | 3300041404 | Bacteria | 1038 |
| 666 | Ga0451793_0083691 | 3300041452 | Bacteria | 1235 |
| 667 | Ga0451793_1251237 | 3300041452 | Bacteria | 1350 |
| 668 | Ga0451795_0141978 | 3300041456 | Bacteria | 2099 |
| 669 | Ga0451802_1322629 | 3300041460 | Bacteria | 1046 |
| 670 | Ga0451804_0097481 | 3300041463 | Bacteria | 1968 |
| 671 | Ga0451845_0950226 | 3300041501 | Bacteria | 1661 |
| 672 | Ga0451853_0207789 | 3300041512 | Bacteria | 1180 |
| 673 | Ga0451853_2068177 | 3300041512 | Bacteria | 3154 |
| 674 | Ga0439449_0029115 | 3300042007 | Bacteria | 2058 |
| 675 | Ga0450906_002330 | 3300042145 | Bacteria | 4161 |
| 676 | Ga0450909_009266 | 3300042185 | Bacteria | 1437 |
| 677 | Ga0439464_0019340 | 3300042439 | Bacteria | 1859 |
| 678 | Ga0450918_000096 | 3300042531 | Bacteria | 18894 |
| 679 | Ga0451577_0106204 | 3300042876 | Bacteria | 2510 |
| 680 | Ga0451577_0125429 | 3300042876 | Bacteria | 2301 |
| 681 | Ga0451577_0137658 | 3300042876 | Bacteria | 2193 |
| 682 | Ga0466969_0016680 | 3300044656 | Bacteria | 3841 |
| 683 | Ga0466965_0005472 | 3300044683 | Bacteria | 5726 |
| 684 | Ga0466965_0007760 | 3300044683 | Bacteria | 4939 |
| 685 | Ga0466966_0002799 | 3300044684 | Bacteria | 11467 |
| 686 | Ga0466961_0054732 | 3300044693 | Bacteria | 2544 |
| 687 | Ga0466961_0064566 | 3300044693 | Bacteria | 2326 |
| 688 | Ga0466961_0090729 | 3300044693 | Bacteria | 1929 |
| 689 | Ga0466963_0004270 | 3300044694 | Bacteria | 8290 |
| 690 | Ga0466963_0049304 | 3300044694 | Bacteria | 2785 |
| 691 | Ga0466964_0007355 | 3300044706 | Bacteria | 4117 |
| 692 | Ga0453684_0030595 | 3300044712 | Bacteria | 7600 |
| 693 | Ga0466971_0007914 | 3300044719 | Bacteria | 4629 |
| 694 | Ga0466971_0008150 | 3300044719 | Bacteria | 4568 |
| 695 | Ga0466971_0011994 | 3300044719 | Bacteria | 3796 |
| 696 | Ga0466968_0009338 | 3300044735 | Bacteria | 3771 |
| 697 | Ga0466968_0064515 | 3300044735 | Bacteria | 1584 |
| 698 | Ga0466957_0004305 | 3300044842 | Bacteria | 7901 |
| 699 | Ga0466957_0023494 | 3300044842 | Bacteria | 3644 |
| 700 | Ga0466959_0004285 | 3300045049 | Bacteria | 9516 |
| 701 | Ga0466959_0233439 | 3300045049 | Bacteria | 1272 |
| 702 | Ga0451576_0006080 | 3300045051 | Bacteria | 14882 |
| 703 | Ga0451576_0015848 | 3300045051 | Bacteria | 8336 |
| 704 | Ga0451576_0738451 | 3300045051 | Bacteria | 1034 |
| 705 | Ga0466958_0006879 | 3300045836 | Bacteria | 6218 |
| 706 | Ga0466967_0047961 | 3300045976 | Bacteria | 3727 |
| 707 | Ga0466967_0564764 | 3300045976 | Bacteria | 1121 |
| 708 | Ga0495590_0001358 | 3300046457 | Bacteria | 10646 |
| 709 | Ga0495590_0003934 | 3300046457 | Bacteria | 6041 |
| 710 | Ga0495638_0067412 | 3300046460 | Bacteria | 2198 |
| 711 | Ga0495651_0217798 | 3300046462 | Bacteria | 1323 |
| 712 | Ga0495653_0052358 | 3300046463 | Bacteria | 3128 |
| 713 | Ga0495639_0004493 | 3300046475 | Bacteria | 5981 |
| 714 | Ga0495606_0213550 | 3300046507 | Bacteria | 1091 |
| 715 | Ga0495608_0009282 | 3300046511 | Bacteria | 6877 |
| 716 | Ga0495610_0025940 | 3300046512 | Bacteria | 3136 |
| 717 | Ga0495610_0032346 | 3300046512 | Bacteria | 2718 |
| 718 | Ga0495618_0131615 | 3300046514 | Bacteria | 1600 |
| 719 | Ga0495620_0047397 | 3300046515 | Bacteria | 1850 |
| 720 | Ga0495620_0055463 | 3300046515 | Bacteria | 1670 |
| 721 | Ga0495628_0033268 | 3300046516 | Bacteria | 4156 |
| 722 | Ga0495632_0012595 | 3300046519 | Bacteria | 4871 |
| 723 | Ga0495632_0015796 | 3300046519 | Bacteria | 4220 |
| 724 | Ga0495643_0024642 | 3300046522 | Bacteria | 3411 |
| 725 | Ga0495654_0006531 | 3300046530 | Bacteria | 6611 |
| 726 | Ga0495586_0222037 | 3300046535 | Bacteria | 1074 |
| 727 | Ga0495598_0038421 | 3300046537 | Bacteria | 1386 |
| 728 | Ga0495621_0014745 | 3300046539 | Bacteria | 2480 |
| 729 | Ga0495645_0058781 | 3300046543 | Bacteria | 2789 |
| 730 | Ga0495622_0030748 | 3300046557 | Bacteria | 2510 |
| 731 | Ga0495668_0025704 | 3300046616 | Bacteria | 3344 |
| 732 | Ga0495625_0008288 | 3300046660 | Bacteria | 8882 |
| 733 | Ga0495625_0044809 | 3300046660 | Bacteria | 3201 |
| 734 | Ga0495625_0058675 | 3300046660 | Bacteria | 2734 |
| 735 | Ga0495625_0060922 | 3300046660 | Bacteria | 2672 |
| 736 | Ga0495635_0015601 | 3300046663 | Bacteria | 5309 |
| 737 | Ga0495599_0007092 | 3300046678 | Bacteria | 6784 |
| 738 | Ga0495623_0113673 | 3300046679 | Bacteria | 1638 |
| 739 | Ga0495646_0020960 | 3300046680 | Bacteria | 4133 |
| 740 | Ga0495647_0034445 | 3300046681 | Bacteria | 1896 |
| 741 | Ga0495658_0061800 | 3300046683 | Bacteria | 2152 |
| 742 | Ga0495671_0048442 | 3300046692 | Bacteria | 2120 |
| 743 | Ga0495671_0061709 | 3300046692 | Bacteria | 1849 |
| 744 | Ga0495649_0007205 | 3300046694 | Bacteria | 6820 |
| 745 | Ga0495600_0006804 | 3300046809 | Bacteria | 6971 |
| 746 | Ga0495660_0004975 | 3300046810 | Bacteria | 7999 |
| 747 | Ga0495660_0085796 | 3300046810 | Bacteria | 1644 |
| 748 | Ga0495604_0082818 | 3300047317 | Bacteria | 2398 |
| 749 | Ga0495687_000330 | 3300047443 | Bacteria | 60838 |
| 750 | Ga0495687_010702 | 3300047443 | Bacteria | 5005 |
| 751 | Ga0495687_010712 | 3300047443 | Bacteria | 5002 |
| 752 | Ga0495686_0001339 | 3300047472 | Bacteria | 27571 |
| 753 | Ga0495593_0115921 | 3300047673 | Bacteria | 1365 |
| 754 | Ga0495626_0029363 | 3300048091 | Bacteria | 2662 |
| 755 | Ga0496100_0056009 | 3300048903 | Bacteria | 2578 |
| 756 | Ga0496101_0276550 | 3300048904 | Bacteria | 1312 |
| 757 | Ga0496102_0013220 | 3300048905 | Bacteria | 7144 |
| 758 | Ga0496102_0314520 | 3300048905 | Bacteria | 1475 |
| 759 | Ga0496103_0095754 | 3300048906 | Bacteria | 1876 |
| 760 | Ga0496104_0009568 | 3300048907 | Bacteria | 8628 |
| 761 | Ga0496105_0024505 | 3300048908 | Bacteria | 4903 |
| 762 | Ga0496106_0002439 | 3300048909 | Bacteria | 13854 |
| 763 | Ga0496106_0095037 | 3300048909 | Bacteria | 2305 |
| 764 | Ga0496108_0029986 | 3300048911 | Bacteria | 4508 |
| 765 | Ga0496114_0001104 | 3300048917 | Bacteria | 20372 |
| 766 | Ga0496114_0086473 | 3300048917 | Bacteria | 2657 |
| 767 | Ga0496121_0019081 | 3300048924 | Bacteria | 6878 |
| 768 | Ga0496121_0260646 | 3300048924 | Bacteria | 1197 |
| 769 | Ga0501298_003130 | 3300049521 | Bacteria | 2552 |
| 770 | Ga0501038_0055025 | 3300049574 | Bacteria | 3420 |
| 771 | Ga0501042_0420896 | 3300049578 | Bacteria | 968 |
| 772 | Ga0501043_0000075 | 3300049579 | Bacteria | 86156 |
| 773 | Ga0501046_0000195 | 3300049580 | Bacteria | 62300 |
| 774 | Ga0501047_0000145 | 3300049581 | Bacteria | 86319 |
| 775 | Ga0501048_0003268 | 3300049582 | Bacteria | 12345 |
| 776 | Ga0501252_001117 | 3300049682 | Bacteria | 2384 |
| 777 | Ga0501262_000604 | 3300049759 | Bacteria | 4231 |
| 778 | Ga0501265_000800 | 3300049762 | Bacteria | 3462 |
| 779 | Ga0501035_0014603 | 3300049822 | Bacteria | 7249 |
| 780 | Ga0501044_0016149 | 3300049823 | Bacteria | 8025 |
| 781 | Ga0501044_0126233 | 3300049823 | Bacteria | 2556 |
| 782 | Ga0501045_0000705 | 3300049824 | Bacteria | 21244 |
| 783 | nmdc:mga03683_142028_c1 | 3300050489 | Bacteria | 1080 |
| 784 | nmdc:mga03683_89997_c1 | 3300050489 | Bacteria | 1337 |
| 785 | nmdc:mga03n38_55236_c1 | 3300050490 | Bacteria | 1788 |
| 786 | nmdc:mga00v17_184574_c1 | 3300050491 | Bacteria | 1346 |
| 787 | nmdc:mga0k408_1110_c1 | 3300050493 | Bacteria | 14744 |
| 788 | nmdc:mga0k408_1324_c1 | 3300050493 | Bacteria | 13382 |
| 789 | nmdc:mga0k408_133098_c1 | 3300050493 | Bacteria | 1476 |
| 790 | nmdc:mga0k408_153219_c1 | 3300050493 | Bacteria | 996 |
| 791 | nmdc:mga0k408_20845_c1 | 3300050493 | Bacteria | 3678 |
| 792 | nmdc:mga0k408_231687_c1 | 3300050493 | Bacteria | 1102 |
| 793 | nmdc:mga0k408_260504_c1 | 3300050493 | Bacteria | 1035 |
| 794 | nmdc:mga0k408_2870_c2 | 3300050493 | Bacteria | 2153 |
| 795 | nmdc:mga0k408_3826_c1 | 3300050493 | Bacteria | 7982 |
| 796 | nmdc:mga0k408_41858_c1 | 3300050493 | Bacteria | 2638 |
| 797 | nmdc:mga0k408_4731_c1 | 3300050493 | Bacteria | 7210 |
| 798 | nmdc:mga0k408_54342_c1 | 3300050493 | Bacteria | 2321 |
| 799 | nmdc:mga0k408_8116_c1 | 3300050493 | Bacteria | 5627 |
| 800 | nmdc:mga0k408_96600_c1 | 3300050493 | Bacteria | 1739 |
| 801 | nmdc:mga0k408_9794_c1 | 3300050493 | Bacteria | 5174 |
| 802 | nmdc:mga06z11_37018_c1 | 3300050494 | Bacteria | 2414 |
| 803 | nmdc:mga07m45_122534_c1 | 3300050496 | Bacteria | 1502 |
| 804 | nmdc:mga07m45_12663_c1 | 3300050496 | Bacteria | 4462 |
| 805 | nmdc:mga07m45_1430_c1 | 3300050496 | Bacteria | 10947 |
| 806 | nmdc:mga07m45_46844_c1 | 3300050496 | Bacteria | 2430 |
| 807 | nmdc:mga07m45_630_c1 | 3300050496 | Bacteria | 14978 |
| 808 | nmdc:mga07m45_93107_c1 | 3300050496 | Bacteria | 1728 |
| 809 | nmdc:mga08y16_380860_c1 | 3300050511 | Bacteria | 1446 |
| 810 | nmdc:mga0a205_389312_c1 | 3300050515 | Bacteria | 1258 |
| 811 | Ga0495601_0120521 | 3300053077 | Bacteria | 1703 |
| 812 | Ga0500578_0003366 | 3300053086 | Bacteria | 12051 |
| 813 | Ga0500578_0044897 | 3300053086 | Bacteria | 2836 |
| 814 | Ga0500578_0057270 | 3300053086 | Bacteria | 2492 |
| 815 | Ga0500644_0026585 | 3300053088 | Bacteria | 1792 |
| 816 | Ga0500583_0071088 | 3300053092 | Bacteria | 1664 |
| 817 | Ga0500651_0007902 | 3300053093 | Bacteria | 6222 |
| 818 | Ga0500651_0017641 | 3300053093 | Bacteria | 4409 |
| 819 | Ga0500641_0098199 | 3300053096 | Bacteria | 1255 |
| 820 | Ga0500562_006072 | 3300053108 | Bacteria | 3041 |
| 821 | Ga0500592_010134 | 3300053116 | Bacteria | 1501 |
| 822 | Ga0500593_003969 | 3300053117 | Bacteria | 5672 |
| 823 | Ga0500594_0002948 | 3300053118 | Bacteria | 3718 |
| 824 | Ga0500594_0066153 | 3300053118 | Bacteria | 1053 |
| 825 | Ga0500628_013444 | 3300053129 | Bacteria | 1528 |
| 826 | Ga0500642_0094420 | 3300053130 | Bacteria | 1385 |
| 827 | Ga0500652_000521 | 3300053131 | Bacteria | 13564 |
| 828 | Ga0500559_0001509 | 3300053136 | Bacteria | 13100 |
| 829 | Ga0500568_0015935 | 3300053139 | Bacteria | 3353 |
| 830 | Ga0500574_000842 | 3300053141 | Bacteria | 4171 |
| 831 | Ga0500604_0051911 | 3300053151 | Bacteria | 1267 |
| 832 | Ga0500616_0050109 | 3300053153 | Bacteria | 2206 |
| 833 | Ga0500622_0001293 | 3300053156 | Bacteria | 20363 |
| 834 | Ga0500570_087793 | 3300053724 | Bacteria | 1369 |
| 835 | Ga0500645_001182 | 3300053730 | Bacteria | 13909 |
| 836 | Ga0500645_002947 | 3300053730 | Bacteria | 7230 |
| 837 | Ga0500645_012277 | 3300053730 | Bacteria | 2770 |
| 838 | Ga0500645_014969 | 3300053730 | Bacteria | 2464 |
| 839 | Ga0500587_000635 | 3300053739 | Bacteria | 4434 |
| 840 | Ga0500587_007104 | 3300053739 | Bacteria | 1466 |
| 841 | Ga0466962_0012516 | 3300061719 | Bacteria | 4078 |
| 842 | 2511244827 | 2511231002 | Bacteria | 5042903 |
| 843 | 2511250395 | 2511231003 | Bacteria | 5606035 |
| 844 | 2548497741 | 2547132374 | Bacteria | 5530232 |
| 845 | 2587728019 | 2585428057 | Bacteria | 6737412 |
| 846 | 2587731083 | 2585428058 | Bacteria | 6853932 |
| 847 | 2587760282 | 2585428062 | Bacteria | 6842168 |
| 848 | 2588289835 | 2588253510 | Bacteria | 6901809 |
| 849 | 2643867205 | 2643221570 | Bacteria | 5103772 |
| 850 | 2643972366 | 2643221592 | Bacteria | 6608788 |
| 851 | 2643990127 | 2643221596 | Bacteria | 5006805 |
| 852 | 2644059346 | 2643221609 | Bacteria | 6756331 |
| 853 | 2644075615 | 2643221611 | Bacteria | 6820941 |
| 854 | 2644141523 | 2643221625 | Bacteria | 6512927 |
| 855 | 2644245233 | 2643221644 | Bacteria | 6865017 |
| 856 | 2644275706 | 2643221648 | Bacteria | 6521465 |
| 857 | 2644295611 | 2643221652 | Bacteria | 5140275 |
| 858 | 2644645149 | 2643221717 | Bacteria | 5676132 |
| 859 | 2739240844 | 2738543012 | Bacteria | 7115078 |
| 860 | 2816472082 | 2816332133 | Bacteria | 7249298 |
| 861 | 2819541922 | 2818991436 | Bacteria | 5376622 |
| 862 | 2842857764 | 2842854478 | Bacteria | 6143501 |
| 863 | 2881101514 | 2881101125 | Bacteria | 4590519 |
| 864 | 2885269105 | 2885266251 | Bacteria | 4796748 |
| 865 | 2904483350 | 2904479285 | Bacteria | 5073931 |
| 866 | 2904483818 | 2904479285 | Bacteria | 5073931 |
| 867 | 2917836477 | 2917832318 | Bacteria | 5346010 |
| 868 | 2919126497 | 2919125081 | Bacteria | 5385106 |
| 869 | 2919706540 | 2919704043 | Bacteria | 5560311 |
| 870 | 2984506853 | 2984504281 | Bacteria | 5262371 |
| 871 | 2990711157 | 2990710928 | Bacteria | 5002431 |
| 872 | 8016731100 | 8016728285 | Bacteria | 5263933 |
| 873 | 8056145425 | 8056143049 | Bacteria | 6307666 |
| 874 | JGI25155J39150_1001042 | |||
| 875 | JGI25155J39150_1000123 | |||
| 876 | JGI25156J39149_1000052 | |||
| 877 | JGI25162J39368_1000414 | |||
| 878 | JGI25154J39366_1000081 | |||
| 879 | JGI25154J39366_1000128 | |||
| 880 | JGI25157J39369_1000006 | |||
| 881 | JGI25152J39213_1002063 | |||
| 882 | JGI25150J39212_1007965 | |||
| 883 | JGI25150J39212_1008331 | |||
| 884 | JGI25159J45721_1005943 | |||
| 885 | JGI25159J45721_1010857 | |||
| 886 | JGI25151J46595_10007771 | |||
| 887 | JGI25151J46595_10033260 | |||
| 888 | JGI25165J46597_1000135 | |||
| 889 | JGI25153J46596_10011901 | |||
| 890 | JGI25153J46596_10016520 | |||
| 891 | rootH1_10020400 | |||
| 892 | rootH1_10062309 | |||
| 893 | JGI25160J50197_1000071 | |||
| 894 | JGI25161J50226_1000144 | |||
| 895 | Ga0055538_1000055 | |||
| 896 | Ga0055539_1000080 | |||
| 897 | Ga0055533_1000086 | |||
| 898 | Ga0055525_1000114 | |||
| 899 | Ga0055535_1000891 | |||
| 900 | Ga0055529_1000622 | |||
| 901 | Ga0055526_1008751 | |||
| 902 | Ga0055537_1000689 | |||
| 903 | Ga0055537_1016026 | |||
| 904 | Ga0055524_1000006 | |||
| 905 | Ga0055524_1000033 | |||
| 906 | Ga0055536_1025617 | |||
| 907 | Ga0055534_1000850 | |||
| 908 | Ga0055528_1000432 | |||
| 909 | Ga0055530_10001172 | |||
| 910 | Ga0055530_10002040 | |||
| 911 | Ga0055540_1000005 | |||
| 912 | Ga0055540_1000007 | |||
| 913 | Ga0055540_1007509 | |||
| 914 | Ga0055531_10001249 | |||
| 915 | Ga0055531_10004316 | |||
| 916 | Ga0055531_10005581 | |||
| 917 | Ga0055541_1000057 | |||
| 918 | Ga0055543_1000162 | |||
| 919 | Ga0065165_1003473 | |||
| 920 | Ga0065165_1036109 | |||
| 921 | Ga0070658_10061636 | |||
| 922 | Ga0070658_10141954 | |||
| 923 | Ga0070676_10006595 | |||
| 924 | Ga0070676_10021803 | |||
| 925 | Ga0070676_10035514 | |||
| 926 | Ga0070676_10066798 | |||
| 927 | Ga0070690_100001452 | |||
| 928 | Ga0070690_100022429 | |||
| 929 | Ga0070690_100122522 | |||
| 930 | Ga0070670_100003877 | |||
| 931 | Ga0070670_100006300 | |||
| 932 | Ga0070670_100029278 | |||
| 933 | Ga0070670_100037863 | |||
| 934 | Ga0070670_100161566 | |||
| 935 | Ga0070670_100219464 | |||
| 936 | Ga0070670_100346801 | |||
| 937 | Ga0070670_100365812 | |||
| 938 | Ga0070677_10001476 | |||
| 939 | Ga0070677_10004019 | |||
| 940 | Ga0070677_10006747 | |||
| 941 | Ga0070677_10009993 | |||
| 942 | Ga0068869_100007843 | |||
| 943 | Ga0068869_100009960 | |||
| 944 | Ga0068869_100109806 | |||
| 945 | Ga0068869_100382916 | |||
| 946 | Ga0070666_10001342 | |||
| 947 | Ga0070666_10029664 | |||
| 948 | Ga0070666_10104785 | |||
| 949 | Ga0070682_100050395 | |||
| 950 | Ga0068868_100000930 | |||
| 951 | Ga0068868_100059254 | |||
| 952 | Ga0068868_100141609 | |||
| 953 | Ga0068868_100143353 | |||
| 954 | Ga0070689_100026477 | |||
| 955 | Ga0070687_100026010 | |||
| 956 | Ga0070661_100000421 | |||
| 957 | Ga0070661_100020513 | |||
| 958 | Ga0070661_100067019 | |||
| 959 | Ga0070661_100150333 | |||
| 960 | Ga0070661_100168852 | |||
| 961 | Ga0070668_100063241 | |||
| 962 | Ga0070669_100008965 | |||
| 963 | Ga0070669_100254237 | |||
| 964 | Ga0070675_100000926 | |||
| 965 | Ga0070675_100006716 | |||
| 966 | Ga0070675_100023645 | |||
| 967 | Ga0070675_100082173 | |||
| 968 | Ga0070675_100219449 | |||
| 969 | Ga0070671_100005287 | |||
| 970 | Ga0070671_100006545 | |||
| 971 | Ga0070671_100008975 | |||
| 972 | Ga0070671_100119488 | |||
| 973 | Ga0070671_100169798 | |||
| 974 | Ga0070671_100268378 | |||
| 975 | Ga0070671_100336060 | |||
| 976 | Ga0070674_100012835 | |||
| 977 | Ga0070674_100014454 | |||
| 978 | Ga0070674_100031292 | |||
| 979 | Ga0070674_100123469 | |||
| 980 | Ga0070673_100031264 | |||
| 981 | Ga0070673_100054845 | |||
| 982 | Ga0070659_100001131 | |||
| 983 | Ga0070659_100021789 | |||
| 984 | Ga0070667_100011038 | |||
| 985 | Ga0070667_100017549 | |||
| 986 | Ga0070667_100063167 | |||
| 987 | Ga0070667_100254418 | |||
| 988 | Ga0070701_10067747 | |||
| 989 | Ga0070700_100322159 | |||
| 990 | Ga0070678_100013269 | |||
| 991 | Ga0070678_100038573 | |||
| 992 | Ga0070678_100050929 | |||
| 993 | Ga0070678_100129140 | |||
| 994 | Ga0070678_100226481 | |||
| 995 | Ga0070678_100229716 | |||
| 996 | Ga0070678_100284977 | |||
| 997 | Ga0070678_100350956 | |||
| 998 | Ga0070662_100025220 | |||
| 999 | Ga0070662_100047086 | |||
| 1000 | Ga0070662_100065813 | |||
| 1001 | Ga0070662_100076490 | |||
| 1002 | Ga0068867_100000048 | |||
| 1003 | Ga0068867_100001383 | |||
| 1004 | Ga0068867_100002855 | |||
| 1005 | Ga0068867_100004608 | |||
| 1006 | Ga0068867_100007763 | |||
| 1007 | Ga0068867_100024081 | |||
| 1008 | Ga0068867_100068350 | |||
| 1009 | Ga0068867_100112679 | |||
| 1010 | Ga0068867_100190352 | |||
| 1011 | Ga0070685_10286535 | |||
| 1012 | Ga0070706_100002704 | |||
| 1013 | Ga0070699_100233632 | |||
| 1014 | Ga0070684_100004660 | |||
| 1015 | Ga0070684_100527755 | |||
| 1016 | Ga0068853_100037028 | |||
| 1017 | Ga0068853_100053921 | |||
| 1018 | Ga0068853_100118152 | |||
| 1019 | Ga0068853_100347362 | |||
| 1020 | Ga0070672_100016710 | |||
| 1021 | Ga0070672_100026178 | |||
| 1022 | Ga0070672_100051192 | |||
| 1023 | Ga0070672_100068603 | |||
| 1024 | Ga0070672_100100057 | |||
| 1025 | Ga0070672_100112023 | |||
| 1026 | Ga0070672_100158352 | |||
| 1027 | Ga0070672_100180274 | |||
| 1028 | Ga0070672_100183062 | |||
| 1029 | Ga0070672_100199760 | |||
| 1030 | Ga0070672_100369935 | |||
| 1031 | Ga0070693_100077521 | |||
| 1032 | Ga0070693_100161165 | |||
| 1033 | Ga0070665_100016102 | |||
| 1034 | Ga0070665_100200321 | |||
| 1035 | Ga0070665_100278976 | |||
| 1036 | Ga0070665_100426083 | |||
| 1037 | Ga0068855_100044323 | |||
| 1038 | Ga0070664_100001426 | |||
| 1039 | Ga0070664_100050396 | |||
| 1040 | Ga0070664_100078785 | |||
| 1041 | Ga0070664_100105483 | |||
| 1042 | Ga0070664_100120375 | |||
| 1043 | Ga0070664_100147680 | |||
| 1044 | Ga0070664_100163631 | |||
| 1045 | Ga0070664_100289543 | |||
| 1046 | Ga0068857_100119625 | |||
| 1047 | Ga0068857_100237252 | |||
| 1048 | Ga0068857_100438830 | |||
| 1049 | Ga0068854_100018851 | |||
| 1050 | Ga0068854_100019957 | |||
| 1051 | Ga0068854_100115693 | |||
| 1052 | Ga0068856_100008227 | |||
| 1053 | Ga0068856_100047733 | |||
| 1054 | Ga0068856_100055782 | |||
| 1055 | Ga0068856_100166397 | |||
| 1056 | Ga0068852_100045508 | |||
| 1057 | Ga0068852_100052239 | |||
| 1058 | Ga0068852_100063558 | |||
| 1059 | Ga0068852_100089038 | |||
| 1060 | Ga0068852_100113517 | |||
| 1061 | Ga0068852_100255769 | |||
| 1062 | Ga0068852_100270354 | |||
| 1063 | Ga0068859_100001157 | |||
| 1064 | Ga0068859_100166879 | |||
| 1065 | Ga0068864_100043931 | |||
| 1066 | Ga0068864_100120199 | |||
| 1067 | Ga0068864_100228811 | |||
| 1068 | Ga0068866_10016531 | |||
| 1069 | Ga0068866_10197080 | |||
| 1070 | Ga0068861_100013043 | |||
| 1071 | Ga0068861_100021750 | |||
| 1072 | Ga0068861_100038148 | |||
| 1073 | Ga0068851_10009512 | |||
| 1074 | Ga0068851_10023882 | |||
| 1075 | Ga0068851_10027772 | |||
| 1076 | Ga0068870_10016501 | |||
| 1077 | Ga0068870_10041145 | |||
| 1078 | Ga0068870_10199416 | |||
| 1079 | Ga0068863_100008961 | |||
| 1080 | Ga0068863_100036313 | |||
| 1081 | Ga0068863_100072562 | |||
| 1082 | Ga0068863_100216288 | |||
| 1083 | Ga0068858_100001292 | |||
| 1084 | Ga0068858_100024788 | |||
| 1085 | Ga0068858_100035096 | |||
| 1086 | Ga0068858_100062309 | |||
| 1087 | Ga0068858_100378133 | |||
| 1088 | Ga0068860_100001127 | |||
| 1089 | Ga0068860_100003662 | |||
| 1090 | Ga0068860_100089173 | |||
| 1091 | Ga0068860_100101804 | |||
| 1092 | Ga0068860_100313647 | |||
| 1093 | Ga0068862_100008423 | |||
| 1094 | Ga0068862_100028683 | |||
| 1095 | Ga0075365_10018586 | |||
| 1096 | Ga0075368_10025717 | |||
| 1097 | Ga0075363_100196934 | |||
| 1098 | Ga0075432_10008161 | |||
| 1099 | Ga0075362_10106075 | |||
| 1100 | Ga0075367_10137791 | |||
| 1101 | Ga0075367_10274220 | |||
| 1102 | Ga0075366_10000654 | |||
| 1103 | Ga0075366_10001569 | |||
| 1104 | Ga0075366_10003793 | |||
| 1105 | Ga0075366_10004637 | |||
| 1106 | Ga0075366_10035988 | |||
| 1107 | Ga0075366_10061848 | |||
| 1108 | Ga0075366_10067831 | |||
| 1109 | Ga0075366_10077136 | |||
| 1110 | Ga0075366_10168042 | |||
| 1111 | Ga0097621_100004797 | |||
| 1112 | Ga0097621_100010187 | |||
| 1113 | Ga0097621_100012909 | |||
| 1114 | Ga0097621_100092078 | |||
| 1115 | Ga0097621_100171084 | |||
| 1116 | Ga0097621_100227161 | |||
| 1117 | Ga0075370_10000414 | |||
| 1118 | Ga0075370_10009474 | |||
| 1119 | Ga0075370_10010350 | |||
| 1120 | Ga0068871_100008231 | |||
| 1121 | Ga0068871_100021423 | |||
| 1122 | Ga0068871_100022718 | |||
| 1123 | Ga0068871_100249243 | |||
| 1124 | Ga0068865_100049806 | |||
| 1125 | Ga0068865_100296794 | |||
| 1126 | Ga0097620_100001157 | |||
| 1127 | Ga0097620_100166881 | |||
| 1128 | Ga0079104_1000009 | |||
| 1129 | Ga0079104_1023974 | |||
| 1130 | Ga0105240_10007990 | |||
| 1131 | Ga0105240_10105835 | |||
| 1132 | Ga0105245_10018033 | |||
| 1133 | Ga0105245_10077730 | |||
| 1134 | Ga0105245_10187891 | |||
| 1135 | Ga0114129_10052547 | |||
| 1136 | Ga0105243_10002356 | |||
| 1137 | Ga0105243_10035260 | |||
| 1138 | Ga0105243_10047878 | |||
| 1139 | Ga0105243_10161102 | |||
| 1140 | Ga0105243_10232486 | |||
| 1141 | Ga0105243_10321976 | |||
| 1142 | Ga0105241_10152463 | |||
| 1143 | Ga0105241_10333168 | |||
| 1144 | Ga0105242_10077752 | |||
| 1145 | Ga0105248_10024871 | |||
| 1146 | Ga0105248_10107672 | |||
| 1147 | Ga0105248_10243677 | |||
| 1148 | Ga0105237_10003295 | |||
| 1149 | Ga0105237_10007089 | |||
| 1150 | Ga0105237_10034334 | |||
| 1151 | Ga0105238_10003365 | |||
| 1152 | Ga0105238_10020203 | |||
| 1153 | Ga0105238_10084345 | |||
| 1154 | Ga0105238_10114737 | |||
| 1155 | Ga0105249_10020909 | |||
| 1156 | Ga0105249_10021079 | |||
| 1157 | Ga0105249_10039647 | |||
| 1158 | Ga0105239_10003389 | |||
| 1159 | Ga0105246_10071672 | |||
| 1160 | Ga0105246_10341246 | |||
| 1161 | Ga0157371_10047043 | |||
| 1162 | Ga0157370_10290950 | |||
| 1163 | Ga0157369_10030192 | |||
| 1164 | Ga0157374_10027813 | |||
| 1165 | Ga0157374_10077836 | |||
| 1166 | Ga0157374_10189723 | |||
| 1167 | Ga0157378_10009787 | |||
| 1168 | Ga0157378_10092187 | |||
| 1169 | Ga0157378_10179808 | |||
| 1170 | Ga0157378_10397212 | |||
| 1171 | Ga0163162_10005175 | |||
| 1172 | Ga0163162_10039622 | |||
| 1173 | Ga0157372_10020531 | |||
| 1174 | Ga0157375_10009940 | |||
| 1175 | Ga0157375_10020576 | |||
| 1176 | Ga0157375_10025372 | |||
| 1177 | Ga0157375_10028162 | |||
| 1178 | Ga0157375_10036459 | |||
| 1179 | Ga0157375_10045990 | |||
| 1180 | Ga0157375_10076855 | |||
| 1181 | Ga0157375_10154757 | |||
| 1182 | Ga0163163_10002538 | |||
| 1183 | Ga0157380_10001789 | |||
| 1184 | Ga0157380_10047723 | |||
| 1185 | Ga0157380_10071376 | |||
| 1186 | Ga0157380_10071794 | |||
| 1187 | Ga0157380_10076095 | |||
| 1188 | Ga0157380_10409599 | |||
| 1189 | Ga0157377_10000056 | |||
| 1190 | Ga0157377_10072267 | |||
| 1191 | Ga0157379_10013243 | |||
| 1192 | Ga0157379_10020433 | |||
| 1193 | Ga0157379_10025235 | |||
| 1194 | Ga0157379_10130102 | |||
| 1195 | Ga0157379_10135880 | |||
| 1196 | Ga0157376_10014590 | |||
| 1197 | Ga0157376_10021252 | |||
| 1198 | Ga0157376_10051769 | |||
| 1199 | Ga0182006_1015134 | |||
| 1200 | Ga0182005_1000541 | |||
| 1201 | Ga0163161_10033652 | |||
| 1202 | Ga0163161_10113786 | |||
| 1203 | Ga0163161_10162904 | |||
| 1204 | Ga0163161_10343620 | |||
| 1205 | Ga0213876_10052025 | |||
| 1206 | Ga0209435_100001 | |||
| 1207 | Ga0209435_100034 | |||
| 1208 | Ga0209435_100115 | |||
| 1209 | Ga0209784_100010 | |||
| 1210 | Ga0209566_100008 | |||
| 1211 | Ga0209674_100019 | |||
| 1212 | Ga0209563_100021 | |||
| 1213 | Ga0207427_100570 | |||
| 1214 | Ga0209437_100019 | |||
| 1215 | Ga0209258_100342 | |||
| 1216 | Ga0207425_1001772 | |||
| 1217 | Ga0209646_1000001 | |||
| 1218 | Ga0209646_1000155 | |||
| 1219 | Ga0209026_1000003 | |||
| 1220 | Ga0209026_1000769 | |||
| 1221 | Ga0209677_100011 | |||
| 1222 | Ga0209677_104403 | |||
| 1223 | Ga0209148_1004217 | |||
| 1224 | Ga0209759_1000001 | |||
| 1225 | Ga0209759_1000375 | |||
| 1226 | Ga0209759_1004950 | |||
| 1227 | Ga0209759_1005146 | |||
| 1228 | Ga0209759_1014038 | |||
| 1229 | Ga0209129_1000062 | |||
| 1230 | Ga0209233_1000025 | |||
| 1231 | Ga0209565_1000124 | |||
| 1232 | Ga0209565_1000910 | |||
| 1233 | Ga0209565_1005822 | |||
| 1234 | Ga0209455_1000511 | |||
| 1235 | Ga0209673_1000043 | |||
| 1236 | Ga0209673_1010877 | |||
| 1237 | Ga0209673_1058334 | |||
| 1238 | Ga0209130_1000060 | |||
| 1239 | Ga0209130_1000114 | |||
| 1240 | Ga0209675_1000269 | |||
| 1241 | Ga0209675_1009012 | |||
| 1242 | Ga0209676_1000007 | |||
| 1243 | Ga0209025_1004701 | |||
| 1244 | Ga0209025_1007436 | |||
| 1245 | Ga0209025_1025947 | |||
| 1246 | Ga0209564_1000176 | |||
| 1247 | Ga0209564_1000268 | |||
| 1248 | Ga0209564_1002616 | |||
| 1249 | Ga0209564_1007511 | |||
| 1250 | Ga0209758_1000378 | |||
| 1251 | Ga0209758_1000517 | |||
| 1252 | Ga0209758_1025948 | |||
| 1253 | Ga0209050_1000003 | |||
| 1254 | Ga0209050_1000118 | |||
| 1255 | Ga0209050_1000243 | |||
| 1256 | Ga0209050_1002216 | |||
| 1257 | Ga0209050_1002992 | |||
| 1258 | Ga0209050_1016204 | |||
| 1259 | Ga0209256_1000001 | |||
| 1260 | Ga0209256_1000019 | |||
| 1261 | Ga0209256_1021803 | |||
| 1262 | Ga0207426_1000308 | |||
| 1263 | Ga0207426_1002574 | |||
| 1264 | Ga0209051_1000003 | |||
| 1265 | Ga0209051_1000004 | |||
| 1266 | Ga0209051_1000853 | |||
| 1267 | Ga0209051_1044684 | |||
| 1268 | Ga0209257_1000020 | |||
| 1269 | Ga0209257_1000022 | |||
| 1270 | Ga0209257_1000038 | |||
| 1271 | Ga0209257_1000044 | |||
| 1272 | Ga0209257_1024509 | |||
| 1273 | Ga0209257_1035649 | |||
| 1274 | Ga0207697_10007005 | |||
| 1275 | Ga0207697_10093659 | |||
| 1276 | Ga0207697_10098244 | |||
| 1277 | Ga0207682_10000706 | |||
| 1278 | Ga0207682_10007480 | |||
| 1279 | Ga0207682_10009359 | |||
| 1280 | Ga0207682_10012804 | |||
| 1281 | Ga0207642_10098719 | |||
| 1282 | Ga0207688_10200887 | |||
| 1283 | Ga0207680_10005283 | |||
| 1284 | Ga0207680_10026030 | |||
| 1285 | Ga0207680_10080108 | |||
| 1286 | Ga0207680_10085564 | |||
| 1287 | Ga0207645_10000932 | |||
| 1288 | Ga0207645_10016574 | |||
| 1289 | Ga0207645_10032773 | |||
| 1290 | Ga0207645_10075710 | |||
| 1291 | Ga0207645_10114838 | |||
| 1292 | Ga0207643_10044753 | |||
| 1293 | Ga0207705_10191138 | |||
| 1294 | Ga0207684_10006839 | |||
| 1295 | Ga0207654_10184247 | |||
| 1296 | Ga0207695_10099229 | |||
| 1297 | Ga0207695_10318048 | |||
| 1298 | Ga0207671_10002336 | |||
| 1299 | Ga0207671_10005664 | |||
| 1300 | Ga0207671_10050729 | |||
| 1301 | Ga0207662_10093519 | |||
| 1302 | Ga0207657_10009129 | |||
| 1303 | Ga0207657_10045289 | |||
| 1304 | Ga0207649_10000751 | |||
| 1305 | Ga0207649_10287549 | |||
| 1306 | Ga0207681_10005730 | |||
| 1307 | Ga0207681_10069573 | |||
| 1308 | Ga0207681_10070963 | |||
| 1309 | Ga0207681_10098776 | |||
| 1310 | Ga0207681_10321395 | |||
| 1311 | Ga0207694_10072469 | |||
| 1312 | Ga0207650_10002868 | |||
| 1313 | Ga0207650_10054584 | |||
| 1314 | Ga0207650_10073437 | |||
| 1315 | Ga0207650_10173189 | |||
| 1316 | Ga0207650_10210795 | |||
| 1317 | Ga0207650_10300768 | |||
| 1318 | Ga0207659_10001257 | |||
| 1319 | Ga0207659_10013518 | |||
| 1320 | Ga0207659_10015146 | |||
| 1321 | Ga0207659_10028703 | |||
| 1322 | Ga0207659_10036528 | |||
| 1323 | Ga0207659_10044324 | |||
| 1324 | Ga0207659_10142958 | |||
| 1325 | Ga0207687_10102244 | |||
| 1326 | Ga0207644_10000042 | |||
| 1327 | Ga0207644_10006910 | |||
| 1328 | Ga0207644_10007260 | |||
| 1329 | Ga0207644_10088580 | |||
| 1330 | Ga0207644_10153838 | |||
| 1331 | Ga0207644_10358606 | |||
| 1332 | Ga0207690_10000481 | |||
| 1333 | Ga0207690_10018234 | |||
| 1334 | Ga0207690_10170216 | |||
| 1335 | Ga0207706_10017151 | |||
| 1336 | Ga0207706_10020343 | |||
| 1337 | Ga0207706_10066467 | |||
| 1338 | Ga0207706_10067288 | |||
| 1339 | Ga0207706_10099056 | |||
| 1340 | Ga0207706_10201758 | |||
| 1341 | Ga0207709_10002673 | |||
| 1342 | Ga0207709_10115691 | |||
| 1343 | Ga0207709_10119377 | |||
| 1344 | Ga0207669_10013145 | |||
| 1345 | Ga0207669_10133926 | |||
| 1346 | Ga0207669_10370037 | |||
| 1347 | Ga0207704_10195320 | |||
| 1348 | Ga0207691_10000318 | |||
| 1349 | Ga0207691_10017977 | |||
| 1350 | Ga0207691_10027795 | |||
| 1351 | Ga0207691_10036077 | |||
| 1352 | Ga0207691_10037444 | |||
| 1353 | Ga0207691_10045199 | |||
| 1354 | Ga0207691_10047603 | |||
| 1355 | Ga0207691_10074299 | |||
| 1356 | Ga0207691_10084554 | |||
| 1357 | Ga0207711_10004017 | |||
| 1358 | Ga0207711_10010123 | |||
| 1359 | Ga0207711_10014423 | |||
| 1360 | Ga0207711_10101817 | |||
| 1361 | Ga0207689_10013142 | |||
| 1362 | Ga0207689_10058064 | |||
| 1363 | Ga0207689_10060170 | |||
| 1364 | Ga0207661_10037817 | |||
| 1365 | Ga0207679_10000501 | |||
| 1366 | Ga0207679_10046009 | |||
| 1367 | Ga0207679_10072585 | |||
| 1368 | Ga0207679_10335360 | |||
| 1369 | Ga0207679_10444667 | |||
| 1370 | Ga0207667_10046590 | |||
| 1371 | Ga0207667_10497322 | |||
| 1372 | Ga0207651_10000364 | |||
| 1373 | Ga0207651_10006026 | |||
| 1374 | Ga0207651_10041858 | |||
| 1375 | Ga0207651_10046578 | |||
| 1376 | Ga0207651_10054979 | |||
| 1377 | Ga0207712_10041521 | |||
| 1378 | Ga0207712_10194330 | |||
| 1379 | Ga0207668_10012084 | |||
| 1380 | Ga0207668_10012507 | |||
| 1381 | Ga0207640_10013763 | |||
| 1382 | Ga0207658_10002924 | |||
| 1383 | Ga0207658_10004551 | |||
| 1384 | Ga0207658_10005021 | |||
| 1385 | Ga0207658_10072003 | |||
| 1386 | Ga0207658_10077603 | |||
| 1387 | Ga0207658_10288563 | |||
| 1388 | Ga0207677_10013173 | |||
| 1389 | Ga0207677_10083998 | |||
| 1390 | Ga0207677_10084366 | |||
| 1391 | Ga0207677_10133083 | |||
| 1392 | Ga0207677_10593200 | |||
| 1393 | Ga0207703_10001647 | |||
| 1394 | Ga0207703_10010862 | |||
| 1395 | Ga0207703_10081473 | |||
| 1396 | Ga0207703_10352718 | |||
| 1397 | Ga0207639_10046131 | |||
| 1398 | Ga0207639_10071881 | |||
| 1399 | Ga0207639_10151636 | |||
| 1400 | Ga0207678_10013097 | |||
| 1401 | Ga0207678_10303781 | |||
| 1402 | Ga0207708_10022289 | |||
| 1403 | Ga0207702_10002308 | |||
| 1404 | Ga0207702_10116578 | |||
| 1405 | Ga0207702_10198726 | |||
| 1406 | Ga0207641_10005423 | |||
| 1407 | Ga0207641_10007604 | |||
| 1408 | Ga0207641_10012523 | |||
| 1409 | Ga0207641_10031474 | |||
| 1410 | Ga0207641_10162836 | |||
| 1411 | Ga0207641_10170410 | |||
| 1412 | Ga0207648_10000492 | |||
| 1413 | Ga0207648_10002026 | |||
| 1414 | Ga0207648_10006568 | |||
| 1415 | Ga0207648_10020730 | |||
| 1416 | Ga0207648_10041853 | |||
| 1417 | Ga0207648_10043392 | |||
| 1418 | Ga0207648_10080809 | |||
| 1419 | Ga0207648_10177524 | |||
| 1420 | Ga0207676_10001498 | |||
| 1421 | Ga0207676_10017299 | |||
| 1422 | Ga0207676_10021790 | |||
| 1423 | Ga0207676_10227678 | |||
| 1424 | Ga0207674_10049675 | |||
| 1425 | Ga0207674_10063382 | |||
| 1426 | Ga0207674_10106917 | |||
| 1427 | Ga0207674_10384556 | |||
| 1428 | Ga0207675_100008838 | |||
| 1429 | Ga0207675_100011212 | |||
| 1430 | Ga0207675_100074019 | |||
| 1431 | Ga0207675_100404798 | |||
| 1432 | Ga0207683_10010653 | |||
| 1433 | Ga0207683_10016734 | |||
| 1434 | Ga0207683_10033147 | |||
| 1435 | Ga0207683_10038389 | |||
| 1436 | Ga0207683_10049633 | |||
| 1437 | Ga0207683_10050334 | |||
| 1438 | Ga0207683_10058883 | |||
| 1439 | Ga0207683_10111670 | |||
| 1440 | Ga0207683_10299106 | |||
| 1441 | Ga0207698_10025392 | |||
| 1442 | Ga0207698_10028570 | |||
| 1443 | Ga0207698_10073233 | |||
| 1444 | Ga0207698_10073649 | |||
| 1445 | Ga0207698_10074629 | |||
| 1446 | Ga0207698_10142792 | |||
| 1447 | Ga0207698_10230582 | |||
| 1448 | Ga0209281_1000023 | |||
| 1449 | Ga0209974_10013298 | |||
| 1450 | Ga0207428_10215834 | |||
| 1451 | Ga0268266_10092747 | |||
| 1452 | Ga0268265_10045405 | |||
| 1453 | Ga0268265_10054590 | |||
| 1454 | Ga0268265_10068611 | |||
| 1455 | Ga0268264_10001710 | |||
| 1456 | Ga0268264_10018493 | |||
| 1457 | Ga0268264_10105160 | |||
| 1458 | Ga0268264_10305606 | |||
| 1459 | Ga0268264_10726154 | |||
| 1460 | Ga0307517_10000228 | |||
| 1461 | Ga0307517_10053504 | |||
| 1462 | Ga0307517_10205333 | |||
| 1463 | Ga0307515_10000458 | |||
| 1464 | Ga0307515_10004357 | |||
| 1465 | Ga0307515_10020859 | |||
| 1466 | Ga0307515_10036443 | |||
| 1467 | Ga0307515_10038277 | |||
| 1468 | Ga0307515_10397660 | |||
| 1469 | Ga0307512_10059122 | |||
| 1470 | Ga0307512_10121533 | |||
| 1471 | Ga0307512_10170525 | |||
| 1472 | Ga0316181_1181538 | |||
| 1473 | Ga0307513_10000006 | |||
| 1474 | Ga0307513_10000094 | |||
| 1475 | Ga0307513_10001393 | |||
| 1476 | Ga0307513_10006563 | |||
| 1477 | Ga0307513_10030687 | |||
| 1478 | Ga0307513_10032666 | |||
| 1479 | Ga0307513_10135388 | |||
| 1480 | Ga0307509_10000426 | |||
| 1481 | Ga0307408_100000288 | |||
| 1482 | Ga0307408_100016115 | |||
| 1483 | Ga0307408_100088275 | |||
| 1484 | Ga0307408_100140129 | |||
| 1485 | Ga0307508_10000040 | |||
| 1486 | Ga0307508_10003969 | |||
| 1487 | Ga0307514_10011867 | |||
| 1488 | Ga0307514_10014681 | |||
| 1489 | Ga0307514_10070063 | |||
| 1490 | Ga0307516_10000460 | |||
| 1491 | Ga0307516_10001446 | |||
| 1492 | Ga0307516_10012998 | |||
| 1493 | Ga0307516_10020589 | |||
| 1494 | Ga0307516_10022952 | |||
| 1495 | Ga0307516_10161191 | |||
| 1496 | Ga0307516_10237526 | |||
| 1497 | Ga0307516_10353488 | |||
| 1498 | Ga0307405_10290392 | |||
| 1499 | Ga0307413_10040120 | |||
| 1500 | Ga0307413_10314011 | |||
| 1501 | Ga0307406_10001222 | |||
| 1502 | Ga0307406_10006272 | |||
| 1503 | Ga0307406_10022081 | |||
| 1504 | Ga0307412_10034844 | |||
| 1505 | Ga0307412_10123600 | |||
| 1506 | Ga0307409_100012808 | |||
| 1507 | Ga0307409_100306137 | |||
| 1508 | Ga0307416_100009118 | |||
| 1509 | Ga0307416_100020199 | |||
| 1510 | Ga0307416_100127951 | |||
| 1511 | Ga0307414_10209979 | |||
| 1512 | Ga0307411_10239000 | |||
| 1513 | Ga0307411_10395953 | |||
| 1514 | Ga0307415_100000538 | |||
| 1515 | Ga0307510_10000109 | |||
| 1516 | Ga0307510_10167982 | |||
| 1517 | Ga0307510_10251031 | |||
| 1518 | Ga0373930_0056600 | |||
| 1519 | Ga0373943_0041563 | |||
| 1520 | Ga0373931_0000491 | |||
| 1521 | Ga0373931_0011931 | |||
| 1522 | Ga0373935_0200366 | |||
| 1523 | Ga0373937_0206953 | |||
| 1524 | Ga0373925_0023538 | |||
| 1525 | Ga0373925_0061260 | |||
| 1526 | Ga0395899_0016249 | |||
| 1527 | Ga0395900_0004795 | |||
| 1528 | Ga0395898_0008778 | |||
| 1529 | Ga0395898_0396716 | |||
| 1530 | Ga0395905_0010964 | |||
| 1531 | Ga0395905_0031340 | |||
| 1532 | Ga0395905_0122445 | |||
| 1533 | Ga0395905_0261614 | |||
| 1534 | Ga0395901_0320256 | |||
| 1535 | Ga0436365_1021472 | |||
| 1536 | Ga0436363_0446142 | |||
| 1537 | Ga0439436_0062788 | |||
| 1538 | Ga0451793_0083691 | |||
| 1539 | Ga0451793_1251237 | |||
| 1540 | Ga0451795_0141978 | |||
| 1541 | Ga0451802_1322629 | |||
| 1542 | Ga0451804_0097481 | |||
| 1543 | Ga0451845_0950226 | |||
| 1544 | Ga0451853_0207789 | |||
| 1545 | Ga0451853_2068177 | |||
| 1546 | Ga0439449_0029115 | |||
| 1547 | Ga0450906_002330 | |||
| 1548 | Ga0450909_009266 | |||
| 1549 | Ga0439464_0019340 | |||
| 1550 | Ga0450918_000096 | |||
| 1551 | Ga0451577_0106204 | |||
| 1552 | Ga0451577_0125429 | |||
| 1553 | Ga0451577_0137658 | |||
| 1554 | Ga0466969_0016680 | |||
| 1555 | Ga0466965_0005472 | |||
| 1556 | Ga0466965_0007760 | |||
| 1557 | Ga0466966_0002799 | |||
| 1558 | Ga0466961_0054732 | |||
| 1559 | Ga0466961_0064566 | |||
| 1560 | Ga0466961_0090729 | |||
| 1561 | Ga0466963_0004270 | |||
| 1562 | Ga0466963_0049304 | |||
| 1563 | Ga0466964_0007355 | |||
| 1564 | Ga0453684_0030595 | |||
| 1565 | Ga0466971_0007914 | |||
| 1566 | Ga0466971_0008150 | |||
| 1567 | Ga0466971_0011994 | |||
| 1568 | Ga0466968_0009338 | |||
| 1569 | Ga0466968_0064515 | |||
| 1570 | Ga0466957_0004305 | |||
| 1571 | Ga0466957_0023494 | |||
| 1572 | Ga0466959_0004285 | |||
| 1573 | Ga0466959_0233439 | |||
| 1574 | Ga0451576_0006080 | |||
| 1575 | Ga0451576_0015848 | |||
| 1576 | Ga0451576_0738451 | |||
| 1577 | Ga0466958_0006879 | |||
| 1578 | Ga0466967_0047961 | |||
| 1579 | Ga0466967_0564764 | |||
| 1580 | Ga0495590_0001358 | |||
| 1581 | Ga0495590_0003934 | |||
| 1582 | Ga0495638_0067412 | |||
| 1583 | Ga0495651_0217798 | |||
| 1584 | Ga0495653_0052358 | |||
| 1585 | Ga0495639_0004493 | |||
| 1586 | Ga0495606_0213550 | |||
| 1587 | Ga0495608_0009282 | |||
| 1588 | Ga0495610_0025940 | |||
| 1589 | Ga0495610_0032346 | |||
| 1590 | Ga0495618_0131615 | |||
| 1591 | Ga0495620_0047397 | |||
| 1592 | Ga0495620_0055463 | |||
| 1593 | Ga0495628_0033268 | |||
| 1594 | Ga0495632_0012595 | |||
| 1595 | Ga0495632_0015796 | |||
| 1596 | Ga0495643_0024642 | |||
| 1597 | Ga0495654_0006531 | |||
| 1598 | Ga0495586_0222037 | |||
| 1599 | Ga0495598_0038421 | |||
| 1600 | Ga0495621_0014745 | |||
| 1601 | Ga0495645_0058781 | |||
| 1602 | Ga0495622_0030748 | |||
| 1603 | Ga0495668_0025704 | |||
| 1604 | Ga0495625_0008288 | |||
| 1605 | Ga0495625_0044809 | |||
| 1606 | Ga0495625_0058675 | |||
| 1607 | Ga0495625_0060922 | |||
| 1608 | Ga0495635_0015601 | |||
| 1609 | Ga0495599_0007092 | |||
| 1610 | Ga0495623_0113673 | |||
| 1611 | Ga0495646_0020960 | |||
| 1612 | Ga0495647_0034445 | |||
| 1613 | Ga0495658_0061800 | |||
| 1614 | Ga0495671_0048442 | |||
| 1615 | Ga0495671_0061709 | |||
| 1616 | Ga0495649_0007205 | |||
| 1617 | Ga0495600_0006804 | |||
| 1618 | Ga0495660_0004975 | |||
| 1619 | Ga0495660_0085796 | |||
| 1620 | Ga0495604_0082818 | |||
| 1621 | Ga0495687_000330 | |||
| 1622 | Ga0495687_010702 | |||
| 1623 | Ga0495687_010712 | |||
| 1624 | Ga0495686_0001339 | |||
| 1625 | Ga0495593_0115921 | |||
| 1626 | Ga0495626_0029363 | |||
| 1627 | Ga0496100_0056009 | |||
| 1628 | Ga0496101_0276550 | |||
| 1629 | Ga0496102_0013220 | |||
| 1630 | Ga0496102_0314520 | |||
| 1631 | Ga0496103_0095754 | |||
| 1632 | Ga0496104_0009568 | |||
| 1633 | Ga0496105_0024505 | |||
| 1634 | Ga0496106_0002439 | |||
| 1635 | Ga0496106_0095037 | |||
| 1636 | Ga0496108_0029986 | |||
| 1637 | Ga0496114_0001104 | |||
| 1638 | Ga0496114_0086473 | |||
| 1639 | Ga0496121_0019081 | |||
| 1640 | Ga0496121_0260646 | |||
| 1641 | Ga0501298_003130 | |||
| 1642 | Ga0501038_0055025 | |||
| 1643 | Ga0501042_0420896 | |||
| 1644 | Ga0501043_0000075 | |||
| 1645 | Ga0501046_0000195 | |||
| 1646 | Ga0501047_0000145 | |||
| 1647 | Ga0501048_0003268 | |||
| 1648 | Ga0501252_001117 | |||
| 1649 | Ga0501262_000604 | |||
| 1650 | Ga0501265_000800 | |||
| 1651 | Ga0501035_0014603 | |||
| 1652 | Ga0501044_0016149 | |||
| 1653 | Ga0501044_0126233 | |||
| 1654 | Ga0501045_0000705 | |||
| 1655 | nmdc:mga03683_142028_c1 | |||
| 1656 | nmdc:mga03683_89997_c1 | |||
| 1657 | nmdc:mga03n38_55236_c1 | |||
| 1658 | nmdc:mga00v17_184574_c1 | |||
| 1659 | nmdc:mga0k408_1110_c1 | |||
| 1660 | nmdc:mga0k408_1324_c1 | |||
| 1661 | nmdc:mga0k408_133098_c1 | |||
| 1662 | nmdc:mga0k408_153219_c1 | |||
| 1663 | nmdc:mga0k408_20845_c1 | |||
| 1664 | nmdc:mga0k408_231687_c1 | |||
| 1665 | nmdc:mga0k408_260504_c1 | |||
| 1666 | nmdc:mga0k408_2870_c2 | |||
| 1667 | nmdc:mga0k408_3826_c1 | |||
| 1668 | nmdc:mga0k408_41858_c1 | |||
| 1669 | nmdc:mga0k408_4731_c1 | |||
| 1670 | nmdc:mga0k408_54342_c1 | |||
| 1671 | nmdc:mga0k408_8116_c1 | |||
| 1672 | nmdc:mga0k408_96600_c1 | |||
| 1673 | nmdc:mga0k408_9794_c1 | |||
| 1674 | nmdc:mga06z11_37018_c1 | |||
| 1675 | nmdc:mga07m45_122534_c1 | |||
| 1676 | nmdc:mga07m45_12663_c1 | |||
| 1677 | nmdc:mga07m45_1430_c1 | |||
| 1678 | nmdc:mga07m45_46844_c1 | |||
| 1679 | nmdc:mga07m45_630_c1 | |||
| 1680 | nmdc:mga07m45_93107_c1 | |||
| 1681 | nmdc:mga08y16_380860_c1 | |||
| 1682 | nmdc:mga0a205_389312_c1 | |||
| 1683 | Ga0495601_0120521 | |||
| 1684 | Ga0500578_0003366 | |||
| 1685 | Ga0500578_0044897 | |||
| 1686 | Ga0500578_0057270 | |||
| 1687 | Ga0500644_0026585 | |||
| 1688 | Ga0500583_0071088 | |||
| 1689 | Ga0500651_0007902 | |||
| 1690 | Ga0500651_0017641 | |||
| 1691 | Ga0500641_0098199 | |||
| 1692 | Ga0500562_006072 | |||
| 1693 | Ga0500592_010134 | |||
| 1694 | Ga0500593_003969 | |||
| 1695 | Ga0500594_0002948 | |||
| 1696 | Ga0500594_0066153 | |||
| 1697 | Ga0500628_013444 | |||
| 1698 | Ga0500642_0094420 | |||
| 1699 | Ga0500652_000521 | |||
| 1700 | Ga0500559_0001509 | |||
| 1701 | Ga0500568_0015935 | |||
| 1702 | Ga0500574_000842 | |||
| 1703 | Ga0500604_0051911 | |||
| 1704 | Ga0500616_0050109 | |||
| 1705 | Ga0500622_0001293 | |||
| 1706 | Ga0500570_087793 | |||
| 1707 | Ga0500645_001182 | |||
| 1708 | Ga0500645_002947 | |||
| 1709 | Ga0500645_012277 | |||
| 1710 | Ga0500645_014969 | |||
| 1711 | Ga0500587_000635 | |||
| 1712 | Ga0500587_007104 | |||
| 1713 | Ga0466962_0012516 | |||
| 1714 | 2511244827 | |||
| 1715 | 2511250395 | |||
| 1716 | 2548497741 | |||
| 1717 | 2587728019 | |||
| 1718 | 2587731083 | |||
| 1719 | 2587760282 | |||
| 1720 | 2588289835 | |||
| 1721 | 2643867205 | |||
| 1722 | 2643972366 | |||
| 1723 | 2643990127 | |||
| 1724 | 2644059346 | |||
| 1725 | 2644075615 | |||
| 1726 | 2644141523 | |||
| 1727 | 2644245233 | |||
| 1728 | 2644275706 | |||
| 1729 | 2644295611 | |||
| 1730 | 2644645149 | |||
| 1731 | 2739240844 | |||
| 1732 | 2816472082 | |||
| 1733 | 2819541922 | |||
| 1734 | 2842857764 | |||
| 1735 | 2881101514 | |||
| 1736 | 2885269105 | |||
| 1737 | 2904483350 | |||
| 1738 | 2904483818 | |||
| 1739 | 2917836477 | |||
| 1740 | 2919126497 | |||
| 1741 | 2919706540 | |||
| 1742 | 2984506853 | |||
| 1743 | 2990711157 | |||
| 1744 | 8016731100 | |||
| 1745 | 8056145425 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ay3-assembly2.cif.gz_D | crystal structure of glucuronic acid dehydrogeanse from chromohalobacter salexigens | 0.9899 | 5 | 265 |
| 6mfh-assembly1.cif.gz_A | mutated uronate dehydrogenase | 0.9898 | 5 | 265 |
| 3rfx-assembly1.cif.gz_A | crystal structure of uronate dehydrogenase from agrobacterium tumefaciens, y136a mutant complexed with nad | 0.9784 | 7 | 269 |
| 3rft-assembly1.cif.gz_A | crystal structure of uronate dehydrogenase from agrobacterium tumefaciens | 0.9774 | 7 | 269 |
| 3ay3-assembly2.cif.gz_D | crystal structure of glucuronic acid dehydrogeanse from chromohalobacter salexigens | 0.9678 | 5 | 265 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3rftA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9872 | 7 | 231 | 3.40.50.720 |
| 3rftA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9701 | 7 | 231 | 3.40.50.720 |
| 4id9A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8887 | 9 | 231 | 3.40.50.720 |
| 4id9A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8808 | 9 | 231 | 3.40.50.720 |
| af_Q4DUZ8_1_205_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8789 | 8 | 165 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N2TDF1-F1-model_v4 | NAD-dependent dehydratase | 1 | 3 | 267 |
|
| AF-A0A2N2TDF1-F1-model_v4 | NAD-dependent dehydratase | 0.9962 | 3 | 267 |
|
| AF-A0A4V1TD39-F1-model_v4 | deleted | 0.9959 | 7 | 183 |
|
| AF-A0A529XPF8-F1-model_v4 | NAD(P)-dependent oxidoreductase | 0.995 | 139 | 265 |
|
| AF-A0A530A7Q5-F1-model_v4 | NAD(P)-dependent oxidoreductase | 0.9937 | 90 | 254 |
|