F484229

General Info

Members Datasets Scaffolds Average Seq Length
872 210 1744 279

Family's Representative Sequence

Representative Sequence 3300044706|Ga0466964_0038125|Ga0466964_0038125_1004_1918
Length 304
Sequence MCAGRNVGYIPKPISTGGPMDSVEELQREPEPVRSSDAVQVQAGAYLLELSLDWIVLRASENIHQLLHESHVTLIDEPLGRFVHAQALHDLRNLFSRLSGTTGIGRAYGIRLTDDPDLVDVAFQLSGGCVILEIVPSVGAFGECFGSVGXXXSGLSSTHGRALLDNAVRRMRALTGYDRVTLVCGNERAESSRGAFVAPNAMEDVPIILADVDAKSVPLFPRDAEDASAAAALMRAPDPAPLGRLRDQDIRACIRVPFAFDGISGEFRCDSRTPREPCFELHAAAELFAQLFAMRLEIDELKNG

Samples

Sample ID Description Type Environment
1 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
172 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
173 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
208 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.08
Rhizosphere 93.58
Stem 0
Stem Tuber 0
Unclassified 1.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466964_0038125 3300044706 Bacteria 1932
2 JGI24736J21556_1002638 3300001904 Bacteria 3145
3 JGI24741J21665_1003963 3300001915 Bacteria 3389
4 JGI24740J21852_10000524 3300001979 Bacteria 16364
5 JGI24739J22299_10003933 3300001989 Bacteria 5684
6 JGI24739J22299_10022381 3300001989 Bacteria 2243
7 JGI24737J22298_10000013 3300001990 Bacteria 50248
8 JGI24737J22298_10004701 3300001990 Bacteria 4747
9 JGI24737J22298_10011601 3300001990 Bacteria 2884
10 JGI24737J22298_10033652 3300001990 Bacteria 1591
11 JGI24735J21928_10007239 3300002067 Bacteria 3620
12 JGI24735J21928_10021938 3300002067 Bacteria 1947
13 JGI24745J21846_1000406 3300002073 Bacteria 3796
14 JGI24744J21845_10000820 3300002077 Bacteria 5849
15 rootH1_10202900 3300003323 Bacteria 1243
16 Ga0070658_10005366 3300005327 Bacteria 10403
17 Ga0070658_10015623 3300005327 Bacteria 6071
18 Ga0070658_10018278 3300005327 Bacteria 5611
19 Ga0070658_10036564 3300005327 Bacteria 3958
20 Ga0070658_10038774 3300005327 Bacteria 3842
21 Ga0070658_10052230 3300005327 Bacteria 3314
22 Ga0070658_10085350 3300005327 Bacteria 2596
23 Ga0070658_10172212 3300005327 Bacteria 1819
24 Ga0070658_10243857 3300005327 Bacteria 1523
25 Ga0070658_10455538 3300005327 Bacteria 1102
26 Ga0070676_10026474 3300005328 Bacteria 3284
27 Ga0070676_10038899 3300005328 Bacteria 2749
28 Ga0070676_10113521 3300005328 Bacteria 1691
29 Ga0070683_100004214 3300005329 Bacteria 11788
30 Ga0070683_100019383 3300005329 Bacteria 6041
31 Ga0070683_100395403 3300005329 Bacteria 1318
32 Ga0070690_100078537 3300005330 Bacteria 2156
33 Ga0070670_100008324 3300005331 Bacteria 8840
34 Ga0070670_100015506 3300005331 Bacteria 6544
35 Ga0070670_100059784 3300005331 Bacteria 3271
36 Ga0070670_100160232 3300005331 Bacteria 1950
37 Ga0070670_100192242 3300005331 Bacteria 1773
38 Ga0070677_10008665 3300005333 Bacteria 3430
39 Ga0068869_100017634 3300005334 Bacteria 4844
40 Ga0068869_100300457 3300005334 Bacteria 1296
41 Ga0070666_10000676 3300005335 Bacteria 20635
42 Ga0070666_10005096 3300005335 Bacteria 8039
43 Ga0070666_10012189 3300005335 Bacteria 5416
44 Ga0070666_10056343 3300005335 Bacteria 2654
45 Ga0070666_10258447 3300005335 Bacteria 1234
46 Ga0070680_100009837 3300005336 Bacteria 7360
47 Ga0070680_100015497 3300005336 Bacteria 5978
48 Ga0070680_100023111 3300005336 Bacteria 4956
49 Ga0070680_100046334 3300005336 Bacteria 3537
50 Ga0070680_100087880 3300005336 Bacteria 2571
51 Ga0070680_100227350 3300005336 Bacteria 1575
52 Ga0070680_100344839 3300005336 Bacteria 1266
53 Ga0070682_100156184 3300005337 Bacteria 1571
54 Ga0068868_100001197 3300005338 Bacteria 17815
55 Ga0068868_100005097 3300005338 Bacteria 9220
56 Ga0068868_100170341 3300005338 Bacteria 1802
57 Ga0070660_100002755 3300005339 Bacteria 12069
58 Ga0070660_100039600 3300005339 Bacteria 3583
59 Ga0070660_100074699 3300005339 Bacteria 2652
60 Ga0070660_100150219 3300005339 Bacteria 1873
61 Ga0070660_100163330 3300005339 Bacteria 1795
62 Ga0070660_100196960 3300005339 Bacteria 1633
63 Ga0070660_100241684 3300005339 Bacteria 1471
64 Ga0070660_100263745 3300005339 Bacteria 1407
65 Ga0070660_100316924 3300005339 Bacteria 1280
66 Ga0070660_100322021 3300005339 Bacteria 1270
67 Ga0070660_100483902 3300005339 Bacteria 1028
68 Ga0070661_100016675 3300005344 Bacteria 5197
69 Ga0070661_100043607 3300005344 Bacteria 3276
70 Ga0070661_100060728 3300005344 Bacteria 2773
71 Ga0070661_100091662 3300005344 Bacteria 2251
72 Ga0070661_100207239 3300005344 Bacteria 1500
73 Ga0070661_100221700 3300005344 Bacteria 1451
74 Ga0070661_100276005 3300005344 Bacteria 1303
75 Ga0070661_100399998 3300005344 Bacteria 1086
76 Ga0070661_100503560 3300005344 Unclassified 970
77 Ga0070692_10009097 3300005345 Bacteria 4463
78 Ga0070692_10096125 3300005345 Bacteria 1618
79 Ga0070692_10111785 3300005345 Bacteria 1512
80 Ga0070668_100197844 3300005347 Bacteria 1649
81 Ga0070668_100333857 3300005347 Bacteria 1279
82 Ga0070668_100463393 3300005347 Unclassified 1092
83 Ga0070669_100048989 3300005353 Bacteria 3085
84 Ga0070669_100083839 3300005353 Bacteria 2377
85 Ga0070675_100056604 3300005354 Bacteria 3231
86 Ga0070675_100075957 3300005354 Bacteria 2794
87 Ga0070675_100211219 3300005354 Bacteria 1687
88 Ga0070671_100000664 3300005355 Bacteria 24709
89 Ga0070671_100000884 3300005355 Bacteria 21921
90 Ga0070671_100001626 3300005355 Bacteria 16939
91 Ga0070671_100002896 3300005355 Bacteria 13357
92 Ga0070671_100003087 3300005355 Bacteria 12960
93 Ga0070671_100030518 3300005355 Bacteria 4448
94 Ga0070671_100056620 3300005355 Bacteria 3262
95 Ga0070671_100062806 3300005355 Bacteria 3092
96 Ga0070671_100082777 3300005355 Bacteria 2684
97 Ga0070671_100215920 3300005355 Bacteria 1627
98 Ga0070674_100011775 3300005356 Bacteria 5338
99 Ga0070674_100061405 3300005356 Bacteria 2623
100 Ga0070674_100130024 3300005356 Bacteria 1876
101 Ga0070673_100015057 3300005364 Bacteria 5414
102 Ga0070673_100021034 3300005364 Bacteria 4720
103 Ga0070673_100062799 3300005364 Bacteria 2953
104 Ga0070673_100330222 3300005364 Bacteria 1349
105 Ga0070673_100382049 3300005364 Bacteria 1256
106 Ga0070659_100012489 3300005366 Bacteria 6298
107 Ga0070659_100028070 3300005366 Bacteria 4343
108 Ga0070659_100032340 3300005366 Bacteria 4056
109 Ga0070659_100162611 3300005366 Bacteria 1826
110 Ga0070659_100348733 3300005366 Bacteria 1241
111 Ga0070659_100371080 3300005366 Bacteria 1204
112 Ga0070667_100005169 3300005367 Bacteria 10915
113 Ga0070667_100005732 3300005367 Bacteria 10377
114 Ga0070667_100005958 3300005367 Bacteria 10137
115 Ga0070667_100017920 3300005367 Bacteria 5869
116 Ga0070667_100026954 3300005367 Bacteria 4780
117 Ga0070667_100036617 3300005367 Bacteria 4114
118 Ga0070667_100171827 3300005367 Bacteria 1914
119 Ga0070667_100176152 3300005367 Bacteria 1890
120 Ga0070709_10004417 3300005434 Bacteria 7585
121 Ga0070714_100023934 3300005435 Bacteria 5023
122 Ga0070714_100037609 3300005435 Bacteria 4068
123 Ga0070714_100064796 3300005435 Bacteria 3146
124 Ga0070714_100150835 3300005435 Bacteria 2095
125 Ga0070713_100308898 3300005436 Bacteria 1458
126 Ga0070713_100423523 3300005436 Bacteria 1246
127 Ga0070663_100011022 3300005455 Bacteria 5657
128 Ga0070663_100013613 3300005455 Bacteria 5192
129 Ga0070663_100028501 3300005455 Bacteria 3802
130 Ga0070663_100066675 3300005455 Bacteria 2609
131 Ga0070663_100101816 3300005455 Bacteria 2144
132 Ga0070663_100457815 3300005455 Bacteria 1053
133 Ga0070678_100002351 3300005456 Bacteria 10333
134 Ga0070678_100003214 3300005456 Bacteria 9068
135 Ga0070678_100056269 3300005456 Bacteria 2876
136 Ga0070678_100080405 3300005456 Bacteria 2468
137 Ga0070662_100011952 3300005457 Bacteria 5741
138 Ga0070662_100016897 3300005457 Bacteria 4905
139 Ga0070662_100039121 3300005457 Bacteria 3373
140 Ga0070662_100109320 3300005457 Bacteria 2104
141 Ga0070662_100136256 3300005457 Bacteria 1898
142 Ga0070662_100269653 3300005457 Bacteria 1374
143 Ga0070681_10049774 3300005458 Bacteria 4183
144 Ga0070681_10074862 3300005458 Bacteria 3347
145 Ga0070681_10314258 3300005458 Bacteria 1476
146 Ga0070681_10343364 3300005458 Bacteria 1403
147 Ga0068867_100057431 3300005459 Bacteria 2882
148 Ga0068867_100077433 3300005459 Bacteria 2499
149 Ga0070685_10313855 3300005466 Bacteria 1060
150 Ga0070679_100140850 3300005530 Bacteria 2391
151 Ga0070679_100156215 3300005530 Bacteria 2256
152 Ga0070679_100213358 3300005530 Bacteria 1893
153 Ga0070679_100323750 3300005530 Bacteria 1490
154 Ga0070684_100033771 3300005535 Bacteria 4371
155 Ga0070684_100129989 3300005535 Bacteria 2271
156 Ga0070684_100166981 3300005535 Bacteria 1998
157 Ga0068853_100034134 3300005539 Bacteria 4317
158 Ga0068853_100058528 3300005539 Bacteria 3326
159 Ga0068853_100066522 3300005539 Bacteria 3130
160 Ga0068853_100220830 3300005539 Bacteria 1730
161 Ga0068853_100283103 3300005539 Bacteria 1529
162 Ga0068853_100283753 3300005539 Bacteria 1527
163 Ga0068853_100717263 3300005539 Unclassified 954
164 Ga0070672_100021632 3300005543 Bacteria 4710
165 Ga0070672_100038203 3300005543 Bacteria 3667
166 Ga0070672_100377224 3300005543 Bacteria 1212
167 Ga0070672_100393883 3300005543 Bacteria 1186
168 Ga0070696_100304558 3300005546 Bacteria 1221
169 Ga0070693_100196213 3300005547 Bacteria 1308
170 Ga0070665_100007593 3300005548 Bacteria 11027
171 Ga0070665_100032978 3300005548 Bacteria 5210
172 Ga0070665_100170233 3300005548 Bacteria 2179
173 Ga0070665_100200788 3300005548 Bacteria 1994
174 Ga0068855_100082151 3300005563 Bacteria 3735
175 Ga0068855_100162666 3300005563 Bacteria 2532
176 Ga0068855_100301565 3300005563 Bacteria 1774
177 Ga0068855_100310754 3300005563 Bacteria 1744
178 Ga0070664_100001029 3300005564 Bacteria 21907
179 Ga0070664_100004698 3300005564 Bacteria 10954
180 Ga0070664_100005620 3300005564 Bacteria 10089
181 Ga0070664_100010503 3300005564 Bacteria 7503
182 Ga0070664_100022153 3300005564 Bacteria 5241
183 Ga0070664_100046784 3300005564 Bacteria 3655
184 Ga0070664_100052712 3300005564 Bacteria 3446
185 Ga0070664_100061139 3300005564 Bacteria 3209
186 Ga0070664_100070073 3300005564 Bacteria 3002
187 Ga0070664_100214000 3300005564 Bacteria 1722
188 Ga0070664_100429283 3300005564 Bacteria 1211
189 Ga0068857_100006626 3300005577 Bacteria 9948
190 Ga0068857_100042369 3300005577 Bacteria 4038
191 Ga0068857_100223251 3300005577 Bacteria 1721
192 Ga0068857_100457837 3300005577 Bacteria 1193
193 Ga0068854_100010446 3300005578 Bacteria 6021
194 Ga0068854_100022935 3300005578 Bacteria 4259
195 Ga0068854_100034546 3300005578 Bacteria 3533
196 Ga0068854_100089106 3300005578 Bacteria 2292
197 Ga0068854_100122320 3300005578 Bacteria 1978
198 Ga0068854_100239537 3300005578 Bacteria 1444
199 Ga0068856_100037398 3300005614 Bacteria 4763
200 Ga0068856_100117722 3300005614 Bacteria 2658
201 Ga0068856_100125251 3300005614 Bacteria 2572
202 Ga0068856_100249193 3300005614 Bacteria 1791
203 Ga0068856_100327452 3300005614 Bacteria 1550
204 Ga0068856_100334534 3300005614 Bacteria 1532
205 Ga0068856_100433279 3300005614 Bacteria 1335
206 Ga0068856_100519778 3300005614 Bacteria 1211
207 Ga0068856_100545126 3300005614 Bacteria 1181
208 Ga0068852_100000577 3300005616 Bacteria 24126
209 Ga0068852_100003793 3300005616 Bacteria 10601
210 Ga0068852_100031038 3300005616 Bacteria 4404
211 Ga0068852_100042423 3300005616 Bacteria 3852
212 Ga0068852_100070324 3300005616 Bacteria 3070
213 Ga0068852_100075881 3300005616 Bacteria 2967
214 Ga0068852_100174400 3300005616 Bacteria 2018
215 Ga0068852_100202793 3300005616 Bacteria 1877
216 Ga0068852_100340511 3300005616 Bacteria 1461
217 Ga0068859_100000689 3300005617 Bacteria 33880
218 Ga0068859_100033751 3300005617 Bacteria 5138
219 Ga0068859_100104271 3300005617 Bacteria 2895
220 Ga0068859_100126120 3300005617 Bacteria 2629
221 Ga0068859_100339635 3300005617 Bacteria 1596
222 Ga0068864_100001152 3300005618 Bacteria 21995
223 Ga0068864_100009641 3300005618 Bacteria 7966
224 Ga0068864_100019212 3300005618 Bacteria 5712
225 Ga0068864_100041771 3300005618 Bacteria 3922
226 Ga0068864_100087574 3300005618 Bacteria 2742
227 Ga0068864_100094296 3300005618 Bacteria 2645
228 Ga0068864_100257891 3300005618 Bacteria 1621
229 Ga0068864_100383637 3300005618 Unclassified 1332
230 Ga0068864_100497469 3300005618 Bacteria 1172
231 Ga0068866_10102341 3300005718 Bacteria 1582
232 Ga0068866_10162074 3300005718 Bacteria 1305
233 Ga0068851_10016082 3300005834 Bacteria 3575
234 Ga0068851_10035033 3300005834 Bacteria 2508
235 Ga0068851_10191352 3300005834 Bacteria 1137
236 Ga0068863_100004516 3300005841 Bacteria 13729
237 Ga0068863_100006440 3300005841 Bacteria 11514
238 Ga0068863_100034025 3300005841 Bacteria 4854
239 Ga0068863_100058157 3300005841 Bacteria 3659
240 Ga0068863_100371655 3300005841 Bacteria 1395
241 Ga0068858_100000956 3300005842 Bacteria 29895
242 Ga0068858_100014786 3300005842 Bacteria 7343
243 Ga0068858_100015797 3300005842 Bacteria 7100
244 Ga0068858_100065826 3300005842 Bacteria 3354
245 Ga0068858_100079042 3300005842 Bacteria 3056
246 Ga0068858_100138989 3300005842 Bacteria 2280
247 Ga0068860_100020647 3300005843 Bacteria 6381
248 Ga0068860_100039503 3300005843 Bacteria 4514
249 Ga0068860_100101168 3300005843 Bacteria 2750
250 Ga0068860_100105955 3300005843 Bacteria 2685
251 Ga0068862_100007859 3300005844 Bacteria 8823
252 Ga0068862_100013464 3300005844 Bacteria 6771
253 Ga0068862_100069269 3300005844 Bacteria 3045
254 Ga0081539_10039556 3300005985 Bacteria 2780
255 Ga0070717_10029647 3300006028 Bacteria 4391
256 Ga0070717_10373070 3300006028 Bacteria 1278
257 Ga0097621_100026196 3300006237 Bacteria 4571
258 Ga0097621_100031637 3300006237 Bacteria 4200
259 Ga0068871_100012548 3300006358 Bacteria 6254
260 Ga0068871_100025919 3300006358 Bacteria 4569
261 Ga0068871_100098606 3300006358 Bacteria 2445
262 Ga0068865_100001644 3300006881 Bacteria 13101
263 Ga0068865_100224798 3300006881 Bacteria 1469
264 Ga0097620_100000689 3300006931 Bacteria 33880
265 Ga0097620_100033752 3300006931 Bacteria 5138
266 Ga0097620_100104266 3300006931 Bacteria 2895
267 Ga0097620_100126116 3300006931 Bacteria 2629
268 Ga0097620_100339649 3300006931 Bacteria 1596
269 Ga0105250_10015441 3300009092 Bacteria 3126
270 Ga0105240_10035361 3300009093 Bacteria 6440
271 Ga0105240_10065735 3300009093 Bacteria 4501
272 Ga0111539_10122757 3300009094 Bacteria 3044
273 Ga0105245_10022225 3300009098 Bacteria 5568
274 Ga0105245_10122449 3300009098 Bacteria 2431
275 Ga0105245_10479925 3300009098 Bacteria 1256
276 Ga0105245_10642608 3300009098 Unclassified 1091
277 Ga0105247_10191850 3300009101 Unclassified 1368
278 Ga0114129_10364199 3300009147 Bacteria 1912
279 Ga0105243_10227272 3300009148 Bacteria 1653
280 Ga0105243_10353928 3300009148 Bacteria 1349
281 Ga0105243_10524241 3300009148 Bacteria 1127
282 Ga0105242_10018851 3300009176 Bacteria 5403
283 Ga0105248_10001002 3300009177 Bacteria 31241
284 Ga0105248_10005826 3300009177 Bacteria 13544
285 Ga0105248_10030936 3300009177 Bacteria 5980
286 Ga0105248_10067362 3300009177 Bacteria 4019
287 Ga0105248_10070621 3300009177 Bacteria 3921
288 Ga0105248_10077998 3300009177 Bacteria 3725
289 Ga0105248_10084103 3300009177 Bacteria 3579
290 Ga0105248_10090603 3300009177 Bacteria 3443
291 Ga0105248_10093609 3300009177 Bacteria 3384
292 Ga0105248_10112097 3300009177 Bacteria 3077
293 Ga0105248_10488538 3300009177 Bacteria 1388
294 Ga0105237_10018421 3300009545 Bacteria 7225
295 Ga0105237_10035498 3300009545 Bacteria 5045
296 Ga0105237_10269410 3300009545 Bacteria 1706
297 Ga0105238_10037548 3300009551 Bacteria 4924
298 Ga0105238_10040241 3300009551 Bacteria 4737
299 Ga0105238_10042416 3300009551 Bacteria 4606
300 Ga0105238_10051640 3300009551 Bacteria 4135
301 Ga0105238_10067836 3300009551 Bacteria 3568
302 Ga0105238_10110112 3300009551 Bacteria 2735
303 Ga0105249_10001380 3300009553 Bacteria 21246
304 Ga0105246_10083280 3300011119 Bacteria 2285
305 Ga0157373_10023244 3300013100 Bacteria 4495
306 Ga0157373_10061431 3300013100 Bacteria 2661
307 Ga0157373_10066352 3300013100 Bacteria 2553
308 Ga0157373_10069473 3300013100 Bacteria 2490
309 Ga0157373_10075737 3300013100 Bacteria 2374
310 Ga0157373_10112484 3300013100 Bacteria 1914
311 Ga0157373_10120726 3300013100 Bacteria 1842
312 Ga0157373_10128495 3300013100 Bacteria 1782
313 Ga0157373_10261453 3300013100 Bacteria 1225
314 Ga0157371_10040984 3300013102 Bacteria 3306
315 Ga0157371_10041654 3300013102 Bacteria 3277
316 Ga0157371_10052053 3300013102 Bacteria 2908
317 Ga0157371_10054334 3300013102 Bacteria 2844
318 Ga0157371_10073995 3300013102 Bacteria 2413
319 Ga0157371_10160322 3300013102 Bacteria 1606
320 Ga0157371_10283807 3300013102 Bacteria 1196
321 Ga0157370_10080853 3300013104 Bacteria 3059
322 Ga0157370_10155594 3300013104 Bacteria 2127
323 Ga0157370_10191926 3300013104 Bacteria 1896
324 Ga0157370_10322617 3300013104 Bacteria 1424
325 Ga0157369_10010390 3300013105 Bacteria 10608
326 Ga0157369_10011942 3300013105 Bacteria 9866
327 Ga0157369_10035441 3300013105 Bacteria 5471
328 Ga0157369_10038821 3300013105 Bacteria 5205
329 Ga0157369_10055708 3300013105 Bacteria 4268
330 Ga0157369_10061040 3300013105 Bacteria 4065
331 Ga0157369_10133596 3300013105 Bacteria 2628
332 Ga0157369_10376586 3300013105 Bacteria 1473
333 Ga0157374_10007222 3300013296 Bacteria 9465
334 Ga0157374_10110356 3300013296 Bacteria 2645
335 Ga0157374_10246770 3300013296 Bacteria 1756
336 Ga0157374_10247914 3300013296 Bacteria 1752
337 Ga0157378_10037238 3300013297 Bacteria 4308
338 Ga0163162_10042791 3300013306 Bacteria 4534
339 Ga0163162_10213197 3300013306 Bacteria 2061
340 Ga0163162_10219784 3300013306 Bacteria 2030
341 Ga0163162_10246790 3300013306 Bacteria 1917
342 Ga0163162_10689459 3300013306 Bacteria 1144
343 Ga0157372_10007422 3300013307 Bacteria 11660
344 Ga0157372_10083422 3300013307 Bacteria 3620
345 Ga0157372_10210930 3300013307 Bacteria 2251
346 Ga0157372_10275577 3300013307 Bacteria 1955
347 Ga0157372_10364220 3300013307 Bacteria 1684
348 Ga0157375_10010594 3300013308 Bacteria 8118
349 Ga0157375_10135660 3300013308 Bacteria 2584
350 Ga0157375_10365258 3300013308 Bacteria 1610
351 Ga0157375_10600699 3300013308 Bacteria 1259
352 Ga0163163_10020424 3300014325 Bacteria 6235
353 Ga0163163_10040748 3300014325 Bacteria 4538
354 Ga0163163_10131304 3300014325 Bacteria 2545
355 Ga0157377_10018471 3300014745 Bacteria 3624
356 Ga0157379_10006841 3300014968 Bacteria 9857
357 Ga0157379_10033779 3300014968 Bacteria 4562
358 Ga0157379_10213413 3300014968 Bacteria 1748
359 Ga0157376_10039502 3300014969 Bacteria 3850
360 Ga0157376_10224855 3300014969 Bacteria 1740
361 Ga0213876_10006690 3300021384 Bacteria 6290
362 Ga0207697_10057005 3300025315 Bacteria 1621
363 Ga0207656_10024973 3300025321 Bacteria 2422
364 Ga0207682_10007943 3300025893 Bacteria 4212
365 Ga0207642_10049318 3300025899 Bacteria 1892
366 Ga0207642_10079403 3300025899 Bacteria 1589
367 Ga0207642_10195273 3300025899 Bacteria 1114
368 Ga0207688_10060406 3300025901 Bacteria 2135
369 Ga0207680_10002229 3300025903 Bacteria 9038
370 Ga0207680_10003700 3300025903 Bacteria 7187
371 Ga0207680_10040423 3300025903 Bacteria 2713
372 Ga0207680_10049908 3300025903 Bacteria 2494
373 Ga0207680_10227541 3300025903 Bacteria 1281
374 Ga0207647_10003811 3300025904 Bacteria 11268
375 Ga0207647_10008425 3300025904 Bacteria 7395
376 Ga0207647_10013267 3300025904 Bacteria 5719
377 Ga0207647_10016504 3300025904 Bacteria 5038
378 Ga0207647_10029232 3300025904 Bacteria 3569
379 Ga0207699_10047346 3300025906 Bacteria 2521
380 Ga0207645_10008330 3300025907 Bacteria 7240
381 Ga0207705_10000411 3300025909 Bacteria 37615
382 Ga0207705_10014958 3300025909 Bacteria 5577
383 Ga0207705_10019381 3300025909 Bacteria 4864
384 Ga0207705_10030597 3300025909 Bacteria 3841
385 Ga0207705_10035273 3300025909 Bacteria 3579
386 Ga0207705_10040619 3300025909 Bacteria 3337
387 Ga0207705_10100402 3300025909 Bacteria 2128
388 Ga0207705_10192418 3300025909 Bacteria 1543
389 Ga0207705_10223356 3300025909 Bacteria 1431
390 Ga0207705_10353249 3300025909 Bacteria 1133
391 Ga0207707_10150726 3300025912 Bacteria 2033
392 Ga0207707_10151296 3300025912 Bacteria 2029
393 Ga0207695_10088310 3300025913 Bacteria 3121
394 Ga0207695_10098154 3300025913 Bacteria 2929
395 Ga0207671_10204783 3300025914 Bacteria 1542
396 Ga0207660_10000036 3300025917 Bacteria 65280
397 Ga0207660_10001501 3300025917 Bacteria 15725
398 Ga0207660_10051929 3300025917 Bacteria 2916
399 Ga0207660_10075252 3300025917 Bacteria 2466
400 Ga0207660_10367520 3300025917 Bacteria 1155
401 Ga0207662_10072605 3300025918 Bacteria 2086
402 Ga0207657_10007272 3300025919 Bacteria 11370
403 Ga0207657_10010450 3300025919 Bacteria 9262
404 Ga0207657_10016388 3300025919 Bacteria 7150
405 Ga0207657_10019147 3300025919 Bacteria 6509
406 Ga0207657_10023458 3300025919 Bacteria 5744
407 Ga0207657_10023914 3300025919 Bacteria 5674
408 Ga0207657_10028629 3300025919 Bacteria 5079
409 Ga0207657_10056094 3300025919 Bacteria 3400
410 Ga0207657_10057021 3300025919 Bacteria 3368
411 Ga0207657_10067205 3300025919 Bacteria 3049
412 Ga0207657_10069615 3300025919 Bacteria 2985
413 Ga0207657_10071442 3300025919 Bacteria 2939
414 Ga0207657_10078578 3300025919 Bacteria 2778
415 Ga0207657_10150130 3300025919 Bacteria 1899
416 Ga0207657_10213360 3300025919 Bacteria 1548
417 Ga0207657_10249069 3300025919 Bacteria 1417
418 Ga0207657_10253108 3300025919 Bacteria 1403
419 Ga0207657_10332226 3300025919 Bacteria 1200
420 Ga0207649_10006427 3300025920 Bacteria 6381
421 Ga0207649_10017384 3300025920 Bacteria 4075
422 Ga0207649_10029313 3300025920 Bacteria 3250
423 Ga0207649_10036279 3300025920 Bacteria 2968
424 Ga0207649_10044459 3300025920 Bacteria 2719
425 Ga0207649_10052003 3300025920 Bacteria 2539
426 Ga0207649_10053207 3300025920 Bacteria 2515
427 Ga0207649_10161134 3300025920 Bacteria 1554
428 Ga0207649_10181229 3300025920 Bacteria 1474
429 Ga0207649_10202153 3300025920 Bacteria 1404
430 Ga0207649_10328697 3300025920 Unclassified 1125
431 Ga0207652_10071163 3300025921 Bacteria 3022
432 Ga0207652_10235671 3300025921 Bacteria 1649
433 Ga0207681_10015054 3300025923 Bacteria 4821
434 Ga0207681_10100821 3300025923 Bacteria 2082
435 Ga0207681_10178126 3300025923 Bacteria 1617
436 Ga0207694_10002513 3300025924 Bacteria 14900
437 Ga0207694_10021915 3300025924 Bacteria 4844
438 Ga0207694_10151306 3300025924 Bacteria 1870
439 Ga0207650_10066095 3300025925 Bacteria 2711
440 Ga0207650_10123074 3300025925 Bacteria 2022
441 Ga0207650_10135604 3300025925 Bacteria 1930
442 Ga0207650_10427091 3300025925 Bacteria 1100
443 Ga0207659_10035972 3300025926 Bacteria 3426
444 Ga0207659_10049072 3300025926 Bacteria 2992
445 Ga0207659_10195652 3300025926 Bacteria 1611
446 Ga0207659_10222125 3300025926 Bacteria 1519
447 Ga0207687_10019493 3300025927 Bacteria 4494
448 Ga0207687_10093741 3300025927 Bacteria 2196
449 Ga0207687_10231362 3300025927 Bacteria 1460
450 Ga0207700_10199742 3300025928 Bacteria 1684
451 Ga0207700_10386356 3300025928 Bacteria 1225
452 Ga0207664_10018003 3300025929 Bacteria 5190
453 Ga0207664_10034182 3300025929 Bacteria 3914
454 Ga0207664_10038150 3300025929 Bacteria 3724
455 Ga0207664_10083082 3300025929 Bacteria 2610
456 Ga0207664_10258131 3300025929 Bacteria 1523
457 Ga0207644_10000363 3300025931 Bacteria 29548
458 Ga0207644_10002454 3300025931 Bacteria 11961
459 Ga0207644_10002516 3300025931 Bacteria 11787
460 Ga0207644_10011287 3300025931 Bacteria 5905
461 Ga0207644_10024987 3300025931 Bacteria 4104
462 Ga0207644_10028945 3300025931 Bacteria 3839
463 Ga0207644_10040839 3300025931 Bacteria 3280
464 Ga0207644_10104735 3300025931 Bacteria 2130
465 Ga0207644_10156215 3300025931 Bacteria 1769
466 Ga0207644_10171595 3300025931 Bacteria 1693
467 Ga0207644_10221671 3300025931 Bacteria 1499
468 Ga0207644_10440397 3300025931 Bacteria 1069
469 Ga0207690_10008457 3300025932 Bacteria 6111
470 Ga0207690_10029438 3300025932 Bacteria 3492
471 Ga0207690_10096763 3300025932 Bacteria 2100
472 Ga0207690_10097813 3300025932 Bacteria 2089
473 Ga0207690_10199008 3300025932 Bacteria 1520
474 Ga0207706_10000675 3300025933 Bacteria 35813
475 Ga0207706_10002920 3300025933 Bacteria 16518
476 Ga0207706_10003928 3300025933 Bacteria 14103
477 Ga0207706_10023469 3300025933 Bacteria 5539
478 Ga0207706_10070662 3300025933 Bacteria 3071
479 Ga0207706_10072826 3300025933 Bacteria 3021
480 Ga0207706_10169561 3300025933 Bacteria 1918
481 Ga0207706_10226593 3300025933 Bacteria 1636
482 Ga0207706_10288140 3300025933 Bacteria 1432
483 Ga0207706_10343857 3300025933 Bacteria 1297
484 Ga0207709_10044907 3300025935 Bacteria 2673
485 Ga0207669_10006534 3300025937 Bacteria 5340
486 Ga0207669_10022578 3300025937 Bacteria 3345
487 Ga0207704_10005890 3300025938 Bacteria 5675
488 Ga0207704_10013434 3300025938 Bacteria 4097
489 Ga0207704_10051393 3300025938 Bacteria 2492
490 Ga0207691_10003690 3300025940 Bacteria 14849
491 Ga0207691_10012624 3300025940 Bacteria 8095
492 Ga0207691_10077969 3300025940 Bacteria 2983
493 Ga0207691_10078995 3300025940 Bacteria 2961
494 Ga0207691_10152350 3300025940 Bacteria 2032
495 Ga0207691_10309403 3300025940 Bacteria 1356
496 Ga0207711_10000044 3300025941 Bacteria 157113
497 Ga0207711_10000823 3300025941 Bacteria 30322
498 Ga0207711_10003130 3300025941 Bacteria 14420
499 Ga0207711_10012411 3300025941 Bacteria 7083
500 Ga0207711_10020573 3300025941 Bacteria 5505
501 Ga0207711_10026745 3300025941 Bacteria 4843
502 Ga0207711_10028040 3300025941 Bacteria 4735
503 Ga0207711_10030719 3300025941 Bacteria 4531
504 Ga0207711_10050920 3300025941 Bacteria 3546
505 Ga0207689_10222549 3300025942 Bacteria 1559
506 Ga0207661_10004518 3300025944 Bacteria 9755
507 Ga0207661_10005086 3300025944 Bacteria 9228
508 Ga0207661_10133387 3300025944 Bacteria 2130
509 Ga0207679_10009063 3300025945 Bacteria 6358
510 Ga0207679_10009330 3300025945 Bacteria 6282
511 Ga0207679_10013192 3300025945 Bacteria 5413
512 Ga0207679_10052797 3300025945 Bacteria 2983
513 Ga0207679_10135252 3300025945 Bacteria 1984
514 Ga0207679_10139830 3300025945 Bacteria 1955
515 Ga0207679_10475026 3300025945 Bacteria 1112
516 Ga0207667_10056687 3300025949 Bacteria 4115
517 Ga0207667_10066211 3300025949 Bacteria 3766
518 Ga0207667_10067634 3300025949 Bacteria 3721
519 Ga0207667_10185552 3300025949 Bacteria 2135
520 Ga0207667_10216208 3300025949 Bacteria 1964
521 Ga0207667_10270232 3300025949 Bacteria 1738
522 Ga0207667_10284314 3300025949 Bacteria 1690
523 Ga0207667_10286467 3300025949 Bacteria 1683
524 Ga0207667_10435479 3300025949 Bacteria 1333
525 Ga0207651_10000166 3300025960 Bacteria 28419
526 Ga0207651_10006858 3300025960 Bacteria 6012
527 Ga0207651_10031851 3300025960 Bacteria 3377
528 Ga0207651_10032128 3300025960 Bacteria 3367
529 Ga0207712_10020548 3300025961 Bacteria 4325
530 Ga0207668_10039580 3300025972 Bacteria 3175
531 Ga0207668_10253601 3300025972 Bacteria 1430
532 Ga0207668_10384916 3300025972 Bacteria 1182
533 Ga0207640_10016302 3300025981 Bacteria 4319
534 Ga0207640_10040849 3300025981 Bacteria 2946
535 Ga0207640_10173358 3300025981 Bacteria 1610
536 Ga0207640_10291379 3300025981 Bacteria 1287
537 Ga0207658_10002505 3300025986 Bacteria 13372
538 Ga0207658_10003675 3300025986 Bacteria 10817
539 Ga0207658_10014302 3300025986 Bacteria 5434
540 Ga0207658_10018292 3300025986 Bacteria 4837
541 Ga0207658_10018346 3300025986 Bacteria 4831
542 Ga0207658_10018749 3300025986 Bacteria 4783
543 Ga0207658_10201571 3300025986 Bacteria 1661
544 Ga0207677_10002780 3300026023 Bacteria 9243
545 Ga0207677_10004055 3300026023 Bacteria 7823
546 Ga0207677_10004994 3300026023 Bacteria 7161
547 Ga0207677_10136302 3300026023 Bacteria 1872
548 Ga0207703_10000661 3300026035 Bacteria 34492
549 Ga0207703_10006599 3300026035 Bacteria 9258
550 Ga0207703_10023410 3300026035 Bacteria 4851
551 Ga0207703_10142077 3300026035 Bacteria 2084
552 Ga0207639_10000306 3300026041 Bacteria 34858
553 Ga0207639_10026561 3300026041 Bacteria 4207
554 Ga0207639_10027036 3300026041 Bacteria 4175
555 Ga0207639_10048078 3300026041 Bacteria 3227
556 Ga0207639_10148182 3300026041 Bacteria 1963
557 Ga0207639_10360184 3300026041 Bacteria 1301
558 Ga0207678_10000439 3300026067 Bacteria 37786
559 Ga0207678_10024959 3300026067 Bacteria 5220
560 Ga0207678_10028951 3300026067 Bacteria 4834
561 Ga0207678_10050246 3300026067 Bacteria 3603
562 Ga0207678_10073557 3300026067 Bacteria 2929
563 Ga0207678_10087063 3300026067 Bacteria 2669
564 Ga0207678_10099193 3300026067 Bacteria 2488
565 Ga0207678_10124660 3300026067 Bacteria 2198
566 Ga0207678_10143426 3300026067 Bacteria 2038
567 Ga0207678_10550519 3300026067 Bacteria 1009
568 Ga0207702_10030767 3300026078 Bacteria 4472
569 Ga0207702_10043546 3300026078 Bacteria 3769
570 Ga0207702_10057480 3300026078 Bacteria 3306
571 Ga0207702_10092036 3300026078 Bacteria 2657
572 Ga0207702_10198823 3300026078 Bacteria 1857
573 Ga0207702_10285936 3300026078 Bacteria 1560
574 Ga0207702_10392289 3300026078 Bacteria 1337
575 Ga0207702_10719838 3300026078 Bacteria 984
576 Ga0207641_10002463 3300026088 Bacteria 17101
577 Ga0207641_10010171 3300026088 Bacteria 7736
578 Ga0207641_10024243 3300026088 Bacteria 5002
579 Ga0207641_10097244 3300026088 Bacteria 2587
580 Ga0207641_10158041 3300026088 Bacteria 2058
581 Ga0207641_10352923 3300026088 Bacteria 1402
582 Ga0207648_10014845 3300026089 Bacteria 7183
583 Ga0207648_10024765 3300026089 Bacteria 5353
584 Ga0207648_10218253 3300026089 Bacteria 1694
585 Ga0207648_10331052 3300026089 Bacteria 1370
586 Ga0207676_10001310 3300026095 Bacteria 18517
587 Ga0207676_10007642 3300026095 Bacteria 7671
588 Ga0207676_10035878 3300026095 Bacteria 3768
589 Ga0207676_10052624 3300026095 Bacteria 3184
590 Ga0207676_10100444 3300026095 Bacteria 2397
591 Ga0207676_10253464 3300026095 Bacteria 1585
592 Ga0207674_10002878 3300026116 Bacteria 21384
593 Ga0207674_10030328 3300026116 Bacteria 5686
594 Ga0207674_10052967 3300026116 Bacteria 4137
595 Ga0207674_10064009 3300026116 Bacteria 3710
596 Ga0207674_10066654 3300026116 Bacteria 3626
597 Ga0207675_100317564 3300026118 Bacteria 1520
598 Ga0207683_10002606 3300026121 Bacteria 15748
599 Ga0207683_10012389 3300026121 Bacteria 7276
600 Ga0207683_10025493 3300026121 Bacteria 5102
601 Ga0207683_10078373 3300026121 Bacteria 2928
602 Ga0207683_10100638 3300026121 Bacteria 2580
603 Ga0207698_10004929 3300026142 Bacteria 8183
604 Ga0207698_10015731 3300026142 Bacteria 5078
605 Ga0207698_10020927 3300026142 Bacteria 4514
606 Ga0207698_10042826 3300026142 Bacteria 3387
607 Ga0207698_10044848 3300026142 Bacteria 3326
608 Ga0207698_10121640 3300026142 Bacteria 2211
609 Ga0207698_10129410 3300026142 Bacteria 2154
610 Ga0207698_10157482 3300026142 Bacteria 1981
611 Ga0207698_10444922 3300026142 Bacteria 1249
612 Ga0207698_10544565 3300026142 Bacteria 1136
613 Ga0268266_10093477 3300028379 Bacteria 2639
614 Ga0268265_10003541 3300028380 Bacteria 11174
615 Ga0268265_10010882 3300028380 Bacteria 6145
616 Ga0268265_10012680 3300028380 Bacteria 5719
617 Ga0268264_10001254 3300028381 Bacteria 24199
618 Ga0268264_10028624 3300028381 Bacteria 4559
619 Ga0268264_10039179 3300028381 Bacteria 3916
620 Ga0268264_10077941 3300028381 Bacteria 2824
621 Ga0268264_10156223 3300028381 Bacteria 2050
622 Ga0307405_10162015 3300031731 Bacteria 1585
623 Ga0307405_10225825 3300031731 Bacteria 1377
624 Ga0307413_10133598 3300031824 Bacteria 1702
625 Ga0307410_10005338 3300031852 Bacteria 6790
626 Ga0307412_10062488 3300031911 Bacteria 2508
627 Ga0307412_10070165 3300031911 Bacteria 2388
628 Ga0307409_100005503 3300031995 Bacteria 7305
629 Ga0307409_100061489 3300031995 Bacteria 2935
630 Ga0307409_100160550 3300031995 Bacteria 1965
631 Ga0307409_100188457 3300031995 Bacteria 1833
632 Ga0307414_10126656 3300032004 Bacteria 1974
633 Ga0307411_10018942 3300032005 Bacteria 3962
634 Ga0307411_10030159 3300032005 Bacteria 3321
635 Ga0307411_10186745 3300032005 Bacteria 1578
636 Ga0307411_10504383 3300032005 Bacteria 1023
637 Ga0307415_100019430 3300032126 Bacteria 4125
638 Ga0307415_100043061 3300032126 Bacteria 3009
639 Ga0373935_0013853 3300035692 Bacteria 4869
640 Ga0373935_0132785 3300035692 Bacteria 1674
641 Ga0373947_0121493 3300035725 Bacteria 1659
642 Ga0373937_0279096 3300036401 Bacteria 1577
643 Ga0373925_0350685 3300037068 Bacteria 1198
644 Ga0395899_0000103 3300037312 Bacteria 147274
645 Ga0395899_0001279 3300037312 Bacteria 21800
646 Ga0395899_0005202 3300037312 Bacteria 10122
647 Ga0395899_0010498 3300037312 Bacteria 7092
648 Ga0395899_0023741 3300037312 Bacteria 4640
649 Ga0395899_0025159 3300037312 Bacteria 4496
650 Ga0395899_0053577 3300037312 Bacteria 2986
651 Ga0395899_0054910 3300037312 Bacteria 2946
652 Ga0395899_0062624 3300037312 Bacteria 2739
653 Ga0395899_0063581 3300037312 Bacteria 2714
654 Ga0395899_0078481 3300037312 Bacteria 2406
655 Ga0395899_0085344 3300037312 Bacteria 2294
656 Ga0395899_0106990 3300037312 Bacteria 2013
657 Ga0395899_0119727 3300037312 Bacteria 1887
658 Ga0395899_0139245 3300037312 Bacteria 1728
659 Ga0395899_0156233 3300037312 Bacteria 1614
660 Ga0395900_0000093 3300037418 Bacteria 166505
661 Ga0395900_0001087 3300037418 Bacteria 34570
662 Ga0395900_0003281 3300037418 Bacteria 17510
663 Ga0395900_0003905 3300037418 Bacteria 15923
664 Ga0395900_0004026 3300037418 Bacteria 15685
665 Ga0395900_0004347 3300037418 Bacteria 15032
666 Ga0395900_0009855 3300037418 Bacteria 9788
667 Ga0395900_0010507 3300037418 Bacteria 9469
668 Ga0395900_0033598 3300037418 Bacteria 5279
669 Ga0395900_0037815 3300037418 Bacteria 4975
670 Ga0395900_0046196 3300037418 Bacteria 4484
671 Ga0395900_0050830 3300037418 Bacteria 4269
672 Ga0395900_0053572 3300037418 Bacteria 4152
673 Ga0395900_0057572 3300037418 Bacteria 4001
674 Ga0395900_0060445 3300037418 Bacteria 3899
675 Ga0395900_0070212 3300037418 Bacteria 3601
676 Ga0395900_0075454 3300037418 Bacteria 3466
677 Ga0395900_0094640 3300037418 Bacteria 3069
678 Ga0395900_0104546 3300037418 Bacteria 2909
679 Ga0395900_0132636 3300037418 Bacteria 2552
680 Ga0395900_0228092 3300037418 Bacteria 1874
681 Ga0395900_0240935 3300037418 Bacteria 1814
682 Ga0395900_0289679 3300037418 Bacteria 1626
683 Ga0395900_0358796 3300037418 Bacteria 1429
684 Ga0395900_0530119 3300037418 Bacteria 1124
685 Ga0395900_0551028 3300037418 Bacteria 1098
686 Ga0395898_0000053 3300037466 Bacteria 279600
687 Ga0395898_0001084 3300037466 Bacteria 42107
688 Ga0395898_0008724 3300037466 Bacteria 10696
689 Ga0395898_0009735 3300037466 Bacteria 10077
690 Ga0395898_0011199 3300037466 Bacteria 9335
691 Ga0395898_0029949 3300037466 Bacteria 5449
692 Ga0395898_0031048 3300037466 Bacteria 5343
693 Ga0395898_0045522 3300037466 Bacteria 4313
694 Ga0395898_0068570 3300037466 Bacteria 3432
695 Ga0395898_0127017 3300037466 Bacteria 2443
696 Ga0395898_0137692 3300037466 Bacteria 2337
697 Ga0395898_0143023 3300037466 Bacteria 2290
698 Ga0395898_0150867 3300037466 Bacteria 2224
699 Ga0395898_0163653 3300037466 Bacteria 2128
700 Ga0395898_0853863 3300037466 Unclassified 849
701 Ga0395905_0000031 3300037471 Bacteria 286757
702 Ga0395905_0001373 3300037471 Bacteria 29537
703 Ga0395905_0001557 3300037471 Bacteria 27411
704 Ga0395905_0002160 3300037471 Bacteria 22295
705 Ga0395905_0003217 3300037471 Bacteria 17577
706 Ga0395905_0003655 3300037471 Bacteria 16315
707 Ga0395905_0006008 3300037471 Bacteria 12291
708 Ga0395905_0009029 3300037471 Bacteria 9781
709 Ga0395905_0009309 3300037471 Bacteria 9608
710 Ga0395905_0016575 3300037471 Bacteria 7004
711 Ga0395905_0018649 3300037471 Bacteria 6581
712 Ga0395905_0035726 3300037471 Bacteria 4667
713 Ga0395905_0045471 3300037471 Bacteria 4117
714 Ga0395905_0049113 3300037471 Bacteria 3953
715 Ga0395905_0058079 3300037471 Bacteria 3618
716 Ga0395905_0117745 3300037471 Bacteria 2496
717 Ga0395905_0120051 3300037471 Bacteria 2471
718 Ga0395905_0147441 3300037471 Bacteria 2214
719 Ga0395905_0174780 3300037471 Bacteria 2016
720 Ga0395905_0204795 3300037471 Bacteria 1849
721 Ga0395905_0235046 3300037471 Bacteria 1713
722 Ga0395905_0239784 3300037471 Bacteria 1694
723 Ga0395905_0270354 3300037471 Bacteria 1585
724 Ga0395905_0317169 3300037471 Bacteria 1448
725 Ga0395905_0321342 3300037471 Bacteria 1437
726 Ga0395905_0352208 3300037471 Bacteria 1365
727 Ga0395905_0478752 3300037471 Bacteria 1144
728 Ga0395901_0000603 3300038443 Bacteria 41824
729 Ga0395901_0001133 3300038443 Bacteria 28265
730 Ga0395901_0002677 3300038443 Bacteria 17972
731 Ga0395901_0003099 3300038443 Bacteria 16722
732 Ga0395901_0008972 3300038443 Bacteria 10122
733 Ga0395901_0014644 3300038443 Bacteria 7969
734 Ga0395901_0039195 3300038443 Bacteria 4903
735 Ga0395901_0042522 3300038443 Bacteria 4711
736 Ga0395901_0057939 3300038443 Bacteria 4029
737 Ga0395901_0096675 3300038443 Bacteria 3095
738 Ga0395901_0108522 3300038443 Bacteria 2914
739 Ga0395901_0119578 3300038443 Bacteria 2768
740 Ga0395901_0123436 3300038443 Bacteria 2721
741 Ga0395901_0123755 3300038443 Bacteria 2717
742 Ga0395901_0131462 3300038443 Bacteria 2630
743 Ga0395901_0142096 3300038443 Bacteria 2522
744 Ga0395901_0188260 3300038443 Bacteria 2164
745 Ga0395901_0225536 3300038443 Bacteria 1957
746 Ga0395901_0366808 3300038443 Bacteria 1484
747 Ga0395901_0367007 3300038443 Viruses 1483
748 Ga0395901_0382061 3300038443 Bacteria 1449
749 Ga0395901_0404813 3300038443 Bacteria 1401
750 Ga0395901_0484144 3300038443 Bacteria 1262
751 Ga0395901_0907418 3300038443 Bacteria 862
752 Ga0436365_1031341 3300039437 Bacteria 7602
753 Ga0450905_002771 3300042142 Bacteria 2272
754 Ga0450889_000038 3300042144 Bacteria 11551
755 Ga0466969_0072363 3300044656 Bacteria 1656
756 Ga0466969_0114136 3300044656 Bacteria 1262
757 Ga0466972_0068038 3300044658 Bacteria 1701
758 Ga0466966_0011567 3300044684 Bacteria 5852
759 Ga0466966_0018719 3300044684 Bacteria 4562
760 Ga0466966_0023517 3300044684 Bacteria 4033
761 Ga0466966_0025227 3300044684 Bacteria 3884
762 Ga0466966_0142584 3300044684 Bacteria 1463
763 Ga0466961_0008318 3300044693 Bacteria 6604
764 Ga0466961_0035591 3300044693 Bacteria 3198
765 Ga0466961_0045566 3300044693 Bacteria 2806
766 Ga0466961_0100530 3300044693 Bacteria 1822
767 Ga0466961_0170275 3300044693 Bacteria 1355
768 Ga0466963_0004008 3300044694 Bacteria 8513
769 Ga0466963_0017722 3300044694 Bacteria 4441
770 Ga0466963_0023766 3300044694 Bacteria 3897
771 Ga0466963_0027163 3300044694 Bacteria 3663
772 Ga0466963_0047120 3300044694 Bacteria 2845
773 Ga0466963_0053549 3300044694 Bacteria 2679
774 Ga0466963_0098974 3300044694 Bacteria 1994
775 Ga0466964_0050661 3300044706 Bacteria 1703
776 Ga0466964_0068795 3300044706 Bacteria 1492
777 Ga0466971_0065103 3300044719 Bacteria 1650
778 Ga0466970_0027973 3300044765 Bacteria 2961
779 Ga0466970_0050934 3300044765 Bacteria 2209
780 Ga0466970_0052142 3300044765 Bacteria 2184
781 Ga0466957_0002767 3300044842 Bacteria 9490
782 Ga0466957_0003104 3300044842 Bacteria 9038
783 Ga0466957_0067746 3300044842 Bacteria 2202
784 Ga0466960_0041486 3300044901 Bacteria 2180
785 Ga0466959_0003260 3300045049 Bacteria 10572
786 Ga0466959_0006304 3300045049 Bacteria 8201
787 Ga0466959_0043161 3300045049 Bacteria 3326
788 Ga0466959_0141605 3300045049 Bacteria 1699
789 Ga0466959_0142840 3300045049 Bacteria 1690
790 Ga0466958_0015633 3300045836 Bacteria 4353
791 Ga0466958_0040231 3300045836 Bacteria 2809
792 Ga0466958_0062872 3300045836 Bacteria 2263
793 Ga0466958_0066236 3300045836 Bacteria 2205
794 Ga0466958_0073248 3300045836 Bacteria 2098
795 Ga0466958_0123034 3300045836 Bacteria 1625
796 Ga0466967_0001599 3300045976 Bacteria 13345
797 Ga0466967_0017957 3300045976 Bacteria 5638
798 Ga0466967_0049403 3300045976 Bacteria 3678
799 Ga0466967_0079338 3300045976 Bacteria 2959
800 Ga0466967_0173482 3300045976 Bacteria 2030
801 Ga0466967_0210490 3300045976 Bacteria 1844
802 Ga0466967_0319203 3300045976 Bacteria 1498
803 Ga0466967_0326438 3300045976 Bacteria 1481
804 Ga0466967_0332547 3300045976 Bacteria 1467
805 Ga0466967_0596232 3300045976 Bacteria 1090
806 Ga0495642_0017894 3300046528 Bacteria 2770
807 Ga0495598_0024174 3300046537 Bacteria 1644
808 Ga0495621_0001481 3300046539 Bacteria 6088
809 Ga0495621_0001498 3300046539 Bacteria 6061
810 Ga0495668_0115368 3300046616 Bacteria 1469
811 Ga0495669_0004007 3300046684 Bacteria 6057
812 Ga0495669_0022875 3300046684 Bacteria 2717
813 Ga0495669_0023118 3300046684 Bacteria 2704
814 Ga0495669_0108540 3300046684 Bacteria 1294
815 Ga0495677_0100070 3300047445 Bacteria 1097
816 Ga0496100_0014032 3300048903 Bacteria 4641
817 Ga0496100_0030457 3300048903 Bacteria 3347
818 Ga0496101_0000292 3300048904 Bacteria 34928
819 Ga0496101_0019936 3300048904 Bacteria 4586
820 Ga0496101_0031499 3300048904 Bacteria 3729
821 Ga0496101_0036190 3300048904 Bacteria 3496
822 Ga0496101_0192162 3300048904 Bacteria 1576
823 Ga0496102_0218082 3300048905 Bacteria 1798
824 Ga0496102_0642680 3300048905 Unclassified 984
825 Ga0496103_0080772 3300048906 Bacteria 2045
826 Ga0496103_0166562 3300048906 Bacteria 1414
827 Ga0496104_0256284 3300048907 Bacteria 1662
828 Ga0496104_0682709 3300048907 Unclassified 935
829 Ga0496105_0115489 3300048908 Bacteria 2214
830 Ga0496105_0135825 3300048908 Bacteria 2026
831 Ga0496106_0022837 3300048909 Bacteria 4647
832 Ga0496106_0046123 3300048909 Bacteria 3275
833 Ga0496106_0078986 3300048909 Bacteria 2526
834 Ga0496107_0017907 3300048910 Bacteria 4987
835 Ga0496107_0025777 3300048910 Bacteria 4165
836 Ga0496107_0050258 3300048910 Bacteria 3005
837 Ga0496107_0080830 3300048910 Bacteria 2370
838 Ga0496107_0166045 3300048910 Bacteria 1637
839 Ga0496108_0001754 3300048911 Bacteria 17237
840 Ga0496108_0003426 3300048911 Bacteria 12718
841 Ga0496108_0007959 3300048911 Bacteria 8596
842 Ga0496108_0093312 3300048911 Bacteria 2560
843 Ga0496108_0225836 3300048911 Bacteria 1627
844 Ga0496109_0007818 3300048912 Bacteria 9057
845 Ga0496109_0020230 3300048912 Bacteria 5878
846 Ga0496109_0054181 3300048912 Bacteria 3659
847 Ga0496110_0002222 3300048913 Bacteria 14506
848 Ga0496110_0038385 3300048913 Bacteria 4167
849 Ga0496110_0053278 3300048913 Bacteria 3556
850 Ga0496110_0207002 3300048913 Bacteria 1783
851 Ga0496111_0000323 3300048914 Bacteria 23780
852 Ga0496112_0000161 3300048915 Bacteria 42407
853 Ga0496112_0016491 3300048915 Bacteria 6922
854 Ga0496112_0023708 3300048915 Bacteria 5870
855 Ga0496112_0027774 3300048915 Bacteria 5458
856 Ga0496112_0036040 3300048915 Bacteria 4822
857 Ga0496112_0067070 3300048915 Bacteria 3541
858 Ga0496112_0144277 3300048915 Bacteria 2349
859 Ga0496112_0236047 3300048915 Bacteria 1782
860 Ga0496112_0472434 3300048915 Unclassified 1191
861 Ga0496113_0003356 3300048916 Bacteria 9561
862 Ga0496113_0005013 3300048916 Bacteria 8210
863 Ga0496113_0008314 3300048916 Bacteria 6754
864 Ga0496113_0099405 3300048916 Bacteria 2253
865 Ga0496114_0000019 3300048917 Bacteria 244365
866 Ga0496114_0071166 3300048917 Bacteria 2922
867 Ga0496114_0489477 3300048917 Bacteria 1088
868 Ga0496115_0000488 3300048918 Bacteria 31339
869 Ga0501225_0006056 3300049705 Bacteria 3535
870 Ga0501268_011181 3300049765 Bacteria 1412
871 nmdc:mga08y16_161643_c1 3300050511 Bacteria 2327
872 Ga0466962_0003431 3300061719 Bacteria 7545
873 Ga0466964_0038125
874 JGI24736J21556_1002638
875 JGI24741J21665_1003963
876 JGI24740J21852_10000524
877 JGI24739J22299_10003933
878 JGI24739J22299_10022381
879 JGI24737J22298_10000013
880 JGI24737J22298_10004701
881 JGI24737J22298_10011601
882 JGI24737J22298_10033652
883 JGI24735J21928_10007239
884 JGI24735J21928_10021938
885 JGI24745J21846_1000406
886 JGI24744J21845_10000820
887 rootH1_10202900
888 Ga0070658_10005366
889 Ga0070658_10015623
890 Ga0070658_10018278
891 Ga0070658_10036564
892 Ga0070658_10038774
893 Ga0070658_10052230
894 Ga0070658_10085350
895 Ga0070658_10172212
896 Ga0070658_10243857
897 Ga0070658_10455538
898 Ga0070676_10026474
899 Ga0070676_10038899
900 Ga0070676_10113521
901 Ga0070683_100004214
902 Ga0070683_100019383
903 Ga0070683_100395403
904 Ga0070690_100078537
905 Ga0070670_100008324
906 Ga0070670_100015506
907 Ga0070670_100059784
908 Ga0070670_100160232
909 Ga0070670_100192242
910 Ga0070677_10008665
911 Ga0068869_100017634
912 Ga0068869_100300457
913 Ga0070666_10000676
914 Ga0070666_10005096
915 Ga0070666_10012189
916 Ga0070666_10056343
917 Ga0070666_10258447
918 Ga0070680_100009837
919 Ga0070680_100015497
920 Ga0070680_100023111
921 Ga0070680_100046334
922 Ga0070680_100087880
923 Ga0070680_100227350
924 Ga0070680_100344839
925 Ga0070682_100156184
926 Ga0068868_100001197
927 Ga0068868_100005097
928 Ga0068868_100170341
929 Ga0070660_100002755
930 Ga0070660_100039600
931 Ga0070660_100074699
932 Ga0070660_100150219
933 Ga0070660_100163330
934 Ga0070660_100196960
935 Ga0070660_100241684
936 Ga0070660_100263745
937 Ga0070660_100316924
938 Ga0070660_100322021
939 Ga0070660_100483902
940 Ga0070661_100016675
941 Ga0070661_100043607
942 Ga0070661_100060728
943 Ga0070661_100091662
944 Ga0070661_100207239
945 Ga0070661_100221700
946 Ga0070661_100276005
947 Ga0070661_100399998
948 Ga0070661_100503560
949 Ga0070692_10009097
950 Ga0070692_10096125
951 Ga0070692_10111785
952 Ga0070668_100197844
953 Ga0070668_100333857
954 Ga0070668_100463393
955 Ga0070669_100048989
956 Ga0070669_100083839
957 Ga0070675_100056604
958 Ga0070675_100075957
959 Ga0070675_100211219
960 Ga0070671_100000664
961 Ga0070671_100000884
962 Ga0070671_100001626
963 Ga0070671_100002896
964 Ga0070671_100003087
965 Ga0070671_100030518
966 Ga0070671_100056620
967 Ga0070671_100062806
968 Ga0070671_100082777
969 Ga0070671_100215920
970 Ga0070674_100011775
971 Ga0070674_100061405
972 Ga0070674_100130024
973 Ga0070673_100015057
974 Ga0070673_100021034
975 Ga0070673_100062799
976 Ga0070673_100330222
977 Ga0070673_100382049
978 Ga0070659_100012489
979 Ga0070659_100028070
980 Ga0070659_100032340
981 Ga0070659_100162611
982 Ga0070659_100348733
983 Ga0070659_100371080
984 Ga0070667_100005169
985 Ga0070667_100005732
986 Ga0070667_100005958
987 Ga0070667_100017920
988 Ga0070667_100026954
989 Ga0070667_100036617
990 Ga0070667_100171827
991 Ga0070667_100176152
992 Ga0070709_10004417
993 Ga0070714_100023934
994 Ga0070714_100037609
995 Ga0070714_100064796
996 Ga0070714_100150835
997 Ga0070713_100308898
998 Ga0070713_100423523
999 Ga0070663_100011022
1000 Ga0070663_100013613
1001 Ga0070663_100028501
1002 Ga0070663_100066675
1003 Ga0070663_100101816
1004 Ga0070663_100457815
1005 Ga0070678_100002351
1006 Ga0070678_100003214
1007 Ga0070678_100056269
1008 Ga0070678_100080405
1009 Ga0070662_100011952
1010 Ga0070662_100016897
1011 Ga0070662_100039121
1012 Ga0070662_100109320
1013 Ga0070662_100136256
1014 Ga0070662_100269653
1015 Ga0070681_10049774
1016 Ga0070681_10074862
1017 Ga0070681_10314258
1018 Ga0070681_10343364
1019 Ga0068867_100057431
1020 Ga0068867_100077433
1021 Ga0070685_10313855
1022 Ga0070679_100140850
1023 Ga0070679_100156215
1024 Ga0070679_100213358
1025 Ga0070679_100323750
1026 Ga0070684_100033771
1027 Ga0070684_100129989
1028 Ga0070684_100166981
1029 Ga0068853_100034134
1030 Ga0068853_100058528
1031 Ga0068853_100066522
1032 Ga0068853_100220830
1033 Ga0068853_100283103
1034 Ga0068853_100283753
1035 Ga0068853_100717263
1036 Ga0070672_100021632
1037 Ga0070672_100038203
1038 Ga0070672_100377224
1039 Ga0070672_100393883
1040 Ga0070696_100304558
1041 Ga0070693_100196213
1042 Ga0070665_100007593
1043 Ga0070665_100032978
1044 Ga0070665_100170233
1045 Ga0070665_100200788
1046 Ga0068855_100082151
1047 Ga0068855_100162666
1048 Ga0068855_100301565
1049 Ga0068855_100310754
1050 Ga0070664_100001029
1051 Ga0070664_100004698
1052 Ga0070664_100005620
1053 Ga0070664_100010503
1054 Ga0070664_100022153
1055 Ga0070664_100046784
1056 Ga0070664_100052712
1057 Ga0070664_100061139
1058 Ga0070664_100070073
1059 Ga0070664_100214000
1060 Ga0070664_100429283
1061 Ga0068857_100006626
1062 Ga0068857_100042369
1063 Ga0068857_100223251
1064 Ga0068857_100457837
1065 Ga0068854_100010446
1066 Ga0068854_100022935
1067 Ga0068854_100034546
1068 Ga0068854_100089106
1069 Ga0068854_100122320
1070 Ga0068854_100239537
1071 Ga0068856_100037398
1072 Ga0068856_100117722
1073 Ga0068856_100125251
1074 Ga0068856_100249193
1075 Ga0068856_100327452
1076 Ga0068856_100334534
1077 Ga0068856_100433279
1078 Ga0068856_100519778
1079 Ga0068856_100545126
1080 Ga0068852_100000577
1081 Ga0068852_100003793
1082 Ga0068852_100031038
1083 Ga0068852_100042423
1084 Ga0068852_100070324
1085 Ga0068852_100075881
1086 Ga0068852_100174400
1087 Ga0068852_100202793
1088 Ga0068852_100340511
1089 Ga0068859_100000689
1090 Ga0068859_100033751
1091 Ga0068859_100104271
1092 Ga0068859_100126120
1093 Ga0068859_100339635
1094 Ga0068864_100001152
1095 Ga0068864_100009641
1096 Ga0068864_100019212
1097 Ga0068864_100041771
1098 Ga0068864_100087574
1099 Ga0068864_100094296
1100 Ga0068864_100257891
1101 Ga0068864_100383637
1102 Ga0068864_100497469
1103 Ga0068866_10102341
1104 Ga0068866_10162074
1105 Ga0068851_10016082
1106 Ga0068851_10035033
1107 Ga0068851_10191352
1108 Ga0068863_100004516
1109 Ga0068863_100006440
1110 Ga0068863_100034025
1111 Ga0068863_100058157
1112 Ga0068863_100371655
1113 Ga0068858_100000956
1114 Ga0068858_100014786
1115 Ga0068858_100015797
1116 Ga0068858_100065826
1117 Ga0068858_100079042
1118 Ga0068858_100138989
1119 Ga0068860_100020647
1120 Ga0068860_100039503
1121 Ga0068860_100101168
1122 Ga0068860_100105955
1123 Ga0068862_100007859
1124 Ga0068862_100013464
1125 Ga0068862_100069269
1126 Ga0081539_10039556
1127 Ga0070717_10029647
1128 Ga0070717_10373070
1129 Ga0097621_100026196
1130 Ga0097621_100031637
1131 Ga0068871_100012548
1132 Ga0068871_100025919
1133 Ga0068871_100098606
1134 Ga0068865_100001644
1135 Ga0068865_100224798
1136 Ga0097620_100000689
1137 Ga0097620_100033752
1138 Ga0097620_100104266
1139 Ga0097620_100126116
1140 Ga0097620_100339649
1141 Ga0105250_10015441
1142 Ga0105240_10035361
1143 Ga0105240_10065735
1144 Ga0111539_10122757
1145 Ga0105245_10022225
1146 Ga0105245_10122449
1147 Ga0105245_10479925
1148 Ga0105245_10642608
1149 Ga0105247_10191850
1150 Ga0114129_10364199
1151 Ga0105243_10227272
1152 Ga0105243_10353928
1153 Ga0105243_10524241
1154 Ga0105242_10018851
1155 Ga0105248_10001002
1156 Ga0105248_10005826
1157 Ga0105248_10030936
1158 Ga0105248_10067362
1159 Ga0105248_10070621
1160 Ga0105248_10077998
1161 Ga0105248_10084103
1162 Ga0105248_10090603
1163 Ga0105248_10093609
1164 Ga0105248_10112097
1165 Ga0105248_10488538
1166 Ga0105237_10018421
1167 Ga0105237_10035498
1168 Ga0105237_10269410
1169 Ga0105238_10037548
1170 Ga0105238_10040241
1171 Ga0105238_10042416
1172 Ga0105238_10051640
1173 Ga0105238_10067836
1174 Ga0105238_10110112
1175 Ga0105249_10001380
1176 Ga0105246_10083280
1177 Ga0157373_10023244
1178 Ga0157373_10061431
1179 Ga0157373_10066352
1180 Ga0157373_10069473
1181 Ga0157373_10075737
1182 Ga0157373_10112484
1183 Ga0157373_10120726
1184 Ga0157373_10128495
1185 Ga0157373_10261453
1186 Ga0157371_10040984
1187 Ga0157371_10041654
1188 Ga0157371_10052053
1189 Ga0157371_10054334
1190 Ga0157371_10073995
1191 Ga0157371_10160322
1192 Ga0157371_10283807
1193 Ga0157370_10080853
1194 Ga0157370_10155594
1195 Ga0157370_10191926
1196 Ga0157370_10322617
1197 Ga0157369_10010390
1198 Ga0157369_10011942
1199 Ga0157369_10035441
1200 Ga0157369_10038821
1201 Ga0157369_10055708
1202 Ga0157369_10061040
1203 Ga0157369_10133596
1204 Ga0157369_10376586
1205 Ga0157374_10007222
1206 Ga0157374_10110356
1207 Ga0157374_10246770
1208 Ga0157374_10247914
1209 Ga0157378_10037238
1210 Ga0163162_10042791
1211 Ga0163162_10213197
1212 Ga0163162_10219784
1213 Ga0163162_10246790
1214 Ga0163162_10689459
1215 Ga0157372_10007422
1216 Ga0157372_10083422
1217 Ga0157372_10210930
1218 Ga0157372_10275577
1219 Ga0157372_10364220
1220 Ga0157375_10010594
1221 Ga0157375_10135660
1222 Ga0157375_10365258
1223 Ga0157375_10600699
1224 Ga0163163_10020424
1225 Ga0163163_10040748
1226 Ga0163163_10131304
1227 Ga0157377_10018471
1228 Ga0157379_10006841
1229 Ga0157379_10033779
1230 Ga0157379_10213413
1231 Ga0157376_10039502
1232 Ga0157376_10224855
1233 Ga0213876_10006690
1234 Ga0207697_10057005
1235 Ga0207656_10024973
1236 Ga0207682_10007943
1237 Ga0207642_10049318
1238 Ga0207642_10079403
1239 Ga0207642_10195273
1240 Ga0207688_10060406
1241 Ga0207680_10002229
1242 Ga0207680_10003700
1243 Ga0207680_10040423
1244 Ga0207680_10049908
1245 Ga0207680_10227541
1246 Ga0207647_10003811
1247 Ga0207647_10008425
1248 Ga0207647_10013267
1249 Ga0207647_10016504
1250 Ga0207647_10029232
1251 Ga0207699_10047346
1252 Ga0207645_10008330
1253 Ga0207705_10000411
1254 Ga0207705_10014958
1255 Ga0207705_10019381
1256 Ga0207705_10030597
1257 Ga0207705_10035273
1258 Ga0207705_10040619
1259 Ga0207705_10100402
1260 Ga0207705_10192418
1261 Ga0207705_10223356
1262 Ga0207705_10353249
1263 Ga0207707_10150726
1264 Ga0207707_10151296
1265 Ga0207695_10088310
1266 Ga0207695_10098154
1267 Ga0207671_10204783
1268 Ga0207660_10000036
1269 Ga0207660_10001501
1270 Ga0207660_10051929
1271 Ga0207660_10075252
1272 Ga0207660_10367520
1273 Ga0207662_10072605
1274 Ga0207657_10007272
1275 Ga0207657_10010450
1276 Ga0207657_10016388
1277 Ga0207657_10019147
1278 Ga0207657_10023458
1279 Ga0207657_10023914
1280 Ga0207657_10028629
1281 Ga0207657_10056094
1282 Ga0207657_10057021
1283 Ga0207657_10067205
1284 Ga0207657_10069615
1285 Ga0207657_10071442
1286 Ga0207657_10078578
1287 Ga0207657_10150130
1288 Ga0207657_10213360
1289 Ga0207657_10249069
1290 Ga0207657_10253108
1291 Ga0207657_10332226
1292 Ga0207649_10006427
1293 Ga0207649_10017384
1294 Ga0207649_10029313
1295 Ga0207649_10036279
1296 Ga0207649_10044459
1297 Ga0207649_10052003
1298 Ga0207649_10053207
1299 Ga0207649_10161134
1300 Ga0207649_10181229
1301 Ga0207649_10202153
1302 Ga0207649_10328697
1303 Ga0207652_10071163
1304 Ga0207652_10235671
1305 Ga0207681_10015054
1306 Ga0207681_10100821
1307 Ga0207681_10178126
1308 Ga0207694_10002513
1309 Ga0207694_10021915
1310 Ga0207694_10151306
1311 Ga0207650_10066095
1312 Ga0207650_10123074
1313 Ga0207650_10135604
1314 Ga0207650_10427091
1315 Ga0207659_10035972
1316 Ga0207659_10049072
1317 Ga0207659_10195652
1318 Ga0207659_10222125
1319 Ga0207687_10019493
1320 Ga0207687_10093741
1321 Ga0207687_10231362
1322 Ga0207700_10199742
1323 Ga0207700_10386356
1324 Ga0207664_10018003
1325 Ga0207664_10034182
1326 Ga0207664_10038150
1327 Ga0207664_10083082
1328 Ga0207664_10258131
1329 Ga0207644_10000363
1330 Ga0207644_10002454
1331 Ga0207644_10002516
1332 Ga0207644_10011287
1333 Ga0207644_10024987
1334 Ga0207644_10028945
1335 Ga0207644_10040839
1336 Ga0207644_10104735
1337 Ga0207644_10156215
1338 Ga0207644_10171595
1339 Ga0207644_10221671
1340 Ga0207644_10440397
1341 Ga0207690_10008457
1342 Ga0207690_10029438
1343 Ga0207690_10096763
1344 Ga0207690_10097813
1345 Ga0207690_10199008
1346 Ga0207706_10000675
1347 Ga0207706_10002920
1348 Ga0207706_10003928
1349 Ga0207706_10023469
1350 Ga0207706_10070662
1351 Ga0207706_10072826
1352 Ga0207706_10169561
1353 Ga0207706_10226593
1354 Ga0207706_10288140
1355 Ga0207706_10343857
1356 Ga0207709_10044907
1357 Ga0207669_10006534
1358 Ga0207669_10022578
1359 Ga0207704_10005890
1360 Ga0207704_10013434
1361 Ga0207704_10051393
1362 Ga0207691_10003690
1363 Ga0207691_10012624
1364 Ga0207691_10077969
1365 Ga0207691_10078995
1366 Ga0207691_10152350
1367 Ga0207691_10309403
1368 Ga0207711_10000044
1369 Ga0207711_10000823
1370 Ga0207711_10003130
1371 Ga0207711_10012411
1372 Ga0207711_10020573
1373 Ga0207711_10026745
1374 Ga0207711_10028040
1375 Ga0207711_10030719
1376 Ga0207711_10050920
1377 Ga0207689_10222549
1378 Ga0207661_10004518
1379 Ga0207661_10005086
1380 Ga0207661_10133387
1381 Ga0207679_10009063
1382 Ga0207679_10009330
1383 Ga0207679_10013192
1384 Ga0207679_10052797
1385 Ga0207679_10135252
1386 Ga0207679_10139830
1387 Ga0207679_10475026
1388 Ga0207667_10056687
1389 Ga0207667_10066211
1390 Ga0207667_10067634
1391 Ga0207667_10185552
1392 Ga0207667_10216208
1393 Ga0207667_10270232
1394 Ga0207667_10284314
1395 Ga0207667_10286467
1396 Ga0207667_10435479
1397 Ga0207651_10000166
1398 Ga0207651_10006858
1399 Ga0207651_10031851
1400 Ga0207651_10032128
1401 Ga0207712_10020548
1402 Ga0207668_10039580
1403 Ga0207668_10253601
1404 Ga0207668_10384916
1405 Ga0207640_10016302
1406 Ga0207640_10040849
1407 Ga0207640_10173358
1408 Ga0207640_10291379
1409 Ga0207658_10002505
1410 Ga0207658_10003675
1411 Ga0207658_10014302
1412 Ga0207658_10018292
1413 Ga0207658_10018346
1414 Ga0207658_10018749
1415 Ga0207658_10201571
1416 Ga0207677_10002780
1417 Ga0207677_10004055
1418 Ga0207677_10004994
1419 Ga0207677_10136302
1420 Ga0207703_10000661
1421 Ga0207703_10006599
1422 Ga0207703_10023410
1423 Ga0207703_10142077
1424 Ga0207639_10000306
1425 Ga0207639_10026561
1426 Ga0207639_10027036
1427 Ga0207639_10048078
1428 Ga0207639_10148182
1429 Ga0207639_10360184
1430 Ga0207678_10000439
1431 Ga0207678_10024959
1432 Ga0207678_10028951
1433 Ga0207678_10050246
1434 Ga0207678_10073557
1435 Ga0207678_10087063
1436 Ga0207678_10099193
1437 Ga0207678_10124660
1438 Ga0207678_10143426
1439 Ga0207678_10550519
1440 Ga0207702_10030767
1441 Ga0207702_10043546
1442 Ga0207702_10057480
1443 Ga0207702_10092036
1444 Ga0207702_10198823
1445 Ga0207702_10285936
1446 Ga0207702_10392289
1447 Ga0207702_10719838
1448 Ga0207641_10002463
1449 Ga0207641_10010171
1450 Ga0207641_10024243
1451 Ga0207641_10097244
1452 Ga0207641_10158041
1453 Ga0207641_10352923
1454 Ga0207648_10014845
1455 Ga0207648_10024765
1456 Ga0207648_10218253
1457 Ga0207648_10331052
1458 Ga0207676_10001310
1459 Ga0207676_10007642
1460 Ga0207676_10035878
1461 Ga0207676_10052624
1462 Ga0207676_10100444
1463 Ga0207676_10253464
1464 Ga0207674_10002878
1465 Ga0207674_10030328
1466 Ga0207674_10052967
1467 Ga0207674_10064009
1468 Ga0207674_10066654
1469 Ga0207675_100317564
1470 Ga0207683_10002606
1471 Ga0207683_10012389
1472 Ga0207683_10025493
1473 Ga0207683_10078373
1474 Ga0207683_10100638
1475 Ga0207698_10004929
1476 Ga0207698_10015731
1477 Ga0207698_10020927
1478 Ga0207698_10042826
1479 Ga0207698_10044848
1480 Ga0207698_10121640
1481 Ga0207698_10129410
1482 Ga0207698_10157482
1483 Ga0207698_10444922
1484 Ga0207698_10544565
1485 Ga0268266_10093477
1486 Ga0268265_10003541
1487 Ga0268265_10010882
1488 Ga0268265_10012680
1489 Ga0268264_10001254
1490 Ga0268264_10028624
1491 Ga0268264_10039179
1492 Ga0268264_10077941
1493 Ga0268264_10156223
1494 Ga0307405_10162015
1495 Ga0307405_10225825
1496 Ga0307413_10133598
1497 Ga0307410_10005338
1498 Ga0307412_10062488
1499 Ga0307412_10070165
1500 Ga0307409_100005503
1501 Ga0307409_100061489
1502 Ga0307409_100160550
1503 Ga0307409_100188457
1504 Ga0307414_10126656
1505 Ga0307411_10018942
1506 Ga0307411_10030159
1507 Ga0307411_10186745
1508 Ga0307411_10504383
1509 Ga0307415_100019430
1510 Ga0307415_100043061
1511 Ga0373935_0013853
1512 Ga0373935_0132785
1513 Ga0373947_0121493
1514 Ga0373937_0279096
1515 Ga0373925_0350685
1516 Ga0395899_0000103
1517 Ga0395899_0001279
1518 Ga0395899_0005202
1519 Ga0395899_0010498
1520 Ga0395899_0023741
1521 Ga0395899_0025159
1522 Ga0395899_0053577
1523 Ga0395899_0054910
1524 Ga0395899_0062624
1525 Ga0395899_0063581
1526 Ga0395899_0078481
1527 Ga0395899_0085344
1528 Ga0395899_0106990
1529 Ga0395899_0119727
1530 Ga0395899_0139245
1531 Ga0395899_0156233
1532 Ga0395900_0000093
1533 Ga0395900_0001087
1534 Ga0395900_0003281
1535 Ga0395900_0003905
1536 Ga0395900_0004026
1537 Ga0395900_0004347
1538 Ga0395900_0009855
1539 Ga0395900_0010507
1540 Ga0395900_0033598
1541 Ga0395900_0037815
1542 Ga0395900_0046196
1543 Ga0395900_0050830
1544 Ga0395900_0053572
1545 Ga0395900_0057572
1546 Ga0395900_0060445
1547 Ga0395900_0070212
1548 Ga0395900_0075454
1549 Ga0395900_0094640
1550 Ga0395900_0104546
1551 Ga0395900_0132636
1552 Ga0395900_0228092
1553 Ga0395900_0240935
1554 Ga0395900_0289679
1555 Ga0395900_0358796
1556 Ga0395900_0530119
1557 Ga0395900_0551028
1558 Ga0395898_0000053
1559 Ga0395898_0001084
1560 Ga0395898_0008724
1561 Ga0395898_0009735
1562 Ga0395898_0011199
1563 Ga0395898_0029949
1564 Ga0395898_0031048
1565 Ga0395898_0045522
1566 Ga0395898_0068570
1567 Ga0395898_0127017
1568 Ga0395898_0137692
1569 Ga0395898_0143023
1570 Ga0395898_0150867
1571 Ga0395898_0163653
1572 Ga0395898_0853863
1573 Ga0395905_0000031
1574 Ga0395905_0001373
1575 Ga0395905_0001557
1576 Ga0395905_0002160
1577 Ga0395905_0003217
1578 Ga0395905_0003655
1579 Ga0395905_0006008
1580 Ga0395905_0009029
1581 Ga0395905_0009309
1582 Ga0395905_0016575
1583 Ga0395905_0018649
1584 Ga0395905_0035726
1585 Ga0395905_0045471
1586 Ga0395905_0049113
1587 Ga0395905_0058079
1588 Ga0395905_0117745
1589 Ga0395905_0120051
1590 Ga0395905_0147441
1591 Ga0395905_0174780
1592 Ga0395905_0204795
1593 Ga0395905_0235046
1594 Ga0395905_0239784
1595 Ga0395905_0270354
1596 Ga0395905_0317169
1597 Ga0395905_0321342
1598 Ga0395905_0352208
1599 Ga0395905_0478752
1600 Ga0395901_0000603
1601 Ga0395901_0001133
1602 Ga0395901_0002677
1603 Ga0395901_0003099
1604 Ga0395901_0008972
1605 Ga0395901_0014644
1606 Ga0395901_0039195
1607 Ga0395901_0042522
1608 Ga0395901_0057939
1609 Ga0395901_0096675
1610 Ga0395901_0108522
1611 Ga0395901_0119578
1612 Ga0395901_0123436
1613 Ga0395901_0123755
1614 Ga0395901_0131462
1615 Ga0395901_0142096
1616 Ga0395901_0188260
1617 Ga0395901_0225536
1618 Ga0395901_0366808
1619 Ga0395901_0367007
1620 Ga0395901_0382061
1621 Ga0395901_0404813
1622 Ga0395901_0484144
1623 Ga0395901_0907418
1624 Ga0436365_1031341
1625 Ga0450905_002771
1626 Ga0450889_000038
1627 Ga0466969_0072363
1628 Ga0466969_0114136
1629 Ga0466972_0068038
1630 Ga0466966_0011567
1631 Ga0466966_0018719
1632 Ga0466966_0023517
1633 Ga0466966_0025227
1634 Ga0466966_0142584
1635 Ga0466961_0008318
1636 Ga0466961_0035591
1637 Ga0466961_0045566
1638 Ga0466961_0100530
1639 Ga0466961_0170275
1640 Ga0466963_0004008
1641 Ga0466963_0017722
1642 Ga0466963_0023766
1643 Ga0466963_0027163
1644 Ga0466963_0047120
1645 Ga0466963_0053549
1646 Ga0466963_0098974
1647 Ga0466964_0050661
1648 Ga0466964_0068795
1649 Ga0466971_0065103
1650 Ga0466970_0027973
1651 Ga0466970_0050934
1652 Ga0466970_0052142
1653 Ga0466957_0002767
1654 Ga0466957_0003104
1655 Ga0466957_0067746
1656 Ga0466960_0041486
1657 Ga0466959_0003260
1658 Ga0466959_0006304
1659 Ga0466959_0043161
1660 Ga0466959_0141605
1661 Ga0466959_0142840
1662 Ga0466958_0015633
1663 Ga0466958_0040231
1664 Ga0466958_0062872
1665 Ga0466958_0066236
1666 Ga0466958_0073248
1667 Ga0466958_0123034
1668 Ga0466967_0001599
1669 Ga0466967_0017957
1670 Ga0466967_0049403
1671 Ga0466967_0079338
1672 Ga0466967_0173482
1673 Ga0466967_0210490
1674 Ga0466967_0319203
1675 Ga0466967_0326438
1676 Ga0466967_0332547
1677 Ga0466967_0596232
1678 Ga0495642_0017894
1679 Ga0495598_0024174
1680 Ga0495621_0001481
1681 Ga0495621_0001498
1682 Ga0495668_0115368
1683 Ga0495669_0004007
1684 Ga0495669_0022875
1685 Ga0495669_0023118
1686 Ga0495669_0108540
1687 Ga0495677_0100070
1688 Ga0496100_0014032
1689 Ga0496100_0030457
1690 Ga0496101_0000292
1691 Ga0496101_0019936
1692 Ga0496101_0031499
1693 Ga0496101_0036190
1694 Ga0496101_0192162
1695 Ga0496102_0218082
1696 Ga0496102_0642680
1697 Ga0496103_0080772
1698 Ga0496103_0166562
1699 Ga0496104_0256284
1700 Ga0496104_0682709
1701 Ga0496105_0115489
1702 Ga0496105_0135825
1703 Ga0496106_0022837
1704 Ga0496106_0046123
1705 Ga0496106_0078986
1706 Ga0496107_0017907
1707 Ga0496107_0025777
1708 Ga0496107_0050258
1709 Ga0496107_0080830
1710 Ga0496107_0166045
1711 Ga0496108_0001754
1712 Ga0496108_0003426
1713 Ga0496108_0007959
1714 Ga0496108_0093312
1715 Ga0496108_0225836
1716 Ga0496109_0007818
1717 Ga0496109_0020230
1718 Ga0496109_0054181
1719 Ga0496110_0002222
1720 Ga0496110_0038385
1721 Ga0496110_0053278
1722 Ga0496110_0207002
1723 Ga0496111_0000323
1724 Ga0496112_0000161
1725 Ga0496112_0016491
1726 Ga0496112_0023708
1727 Ga0496112_0027774
1728 Ga0496112_0036040
1729 Ga0496112_0067070
1730 Ga0496112_0144277
1731 Ga0496112_0236047
1732 Ga0496112_0472434
1733 Ga0496113_0003356
1734 Ga0496113_0005013
1735 Ga0496113_0008314
1736 Ga0496113_0099405
1737 Ga0496114_0000019
1738 Ga0496114_0071166
1739 Ga0496114_0489477
1740 Ga0496115_0000488
1741 Ga0501225_0006056
1742 Ga0501268_011181
1743 nmdc:mga08y16_161643_c1
1744 Ga0466962_0003431

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e04-assembly1.cif.gz_A rpbphp2 chromophore-binding domain crystallized by homologue-directed mutagenesis. 0.7598 4 269
6g1y-assembly1.cif.gz_B crystal structure of the photosensory core module (pcm) of a bathy phytochrome from agrobacterium fabrum in the pfr state. 0.754 4 274
8afk-assembly1.cif.gz_A structure of irfp variant c15s/n136r/v256c in complex with phycocyanobilin 0.7478 4 270
3zq5-assembly1.cif.gz_A-2 structure of the y263f mutant of the cyanobacterial phytochrome cph1 0.7448 60 274
6g1y-assembly1.cif.gz_B crystal structure of the photosensory core module (pcm) of a bathy phytochrome from agrobacterium fabrum in the pfr state. 0.7413 4 274
ID Description Score Start End Superfamily
af_P52052_1_96_3.30.450.90 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.7938 57 100 3.30.450.90
5llyA02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.7902 107 268 3.30.450.40
af_I1N9G7_9_192_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.7338 210 259 3.30.450.40
af_I1MKI1_51_235_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.7249 211 259 3.30.450.40
4rq9A02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.7246 101 268 3.30.450.40
ID Description Score Start End GO Terms
AF-A0A2U1FXZ3-F1-model_v4 deleted 0.8862 2 274
AF-A0A2U1FXZ3-F1-model_v4 deleted 0.8769 2 274
AF-A0A7G9SGN0-F1-model_v4 GAF domain-containing protein 0.8608 1 267 GO:0006355
AF-A0A7G9SGN0-F1-model_v4 GAF domain-containing protein 0.8483 1 267 GO:0006355
AF-A0A2T5H1A2-F1-model_v4 Light-regulated signal transduction histidine kinase (Bacteriophytochrome) 0.837 108 274 GO:0006355
GO:0009584
GO:0009881
GO:0016301

Map