F484247
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 873 | 372 | 1746 | 186 |
Family's Representative Sequence
| Representative Sequence | 3300005335|Ga0070666_10017949|Ga0070666_100179492 |
| Length | 193 |
| Sequence | MNVLPSFVELSLPDWVFREVDAAKIYASDEERVALAIRLANRNVEEKTGGPFGAAVFTRTGKLVSAGVNRVVPHSCSVAHAEMVAYMLAQAKLRRFRLNEPAPGEAREEFVLATSAQPCCQCYGATVWAGVDELLIGARSEDVEELSEFDEGPLPADWIGELEKRGVRVKRDILRDAAREVFLRYRAAGGTSY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 10 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 11 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 12 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 13 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 14 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 16 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 17 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 18 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 19 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 20 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 21 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 22 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 23 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 24 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 25 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 32 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 33 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 34 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 35 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 37 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 38 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 108 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 110 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 111 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 118 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 129 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 194 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 195 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 196 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 197 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 200 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 201 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 202 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 205 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 207 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 208 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 209 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 210 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 211 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 212 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 213 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 220 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 221 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 222 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 223 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 224 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 225 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 226 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 227 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 228 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 229 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 230 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 231 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 232 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 233 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 234 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 235 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 236 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 237 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 238 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 278 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 279 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 280 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 281 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 282 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 283 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 284 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 285 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 286 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 287 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 288 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 289 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 290 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 291 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 292 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 293 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 294 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 295 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 322 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 323 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 324 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 325 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 326 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 327 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 328 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 329 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 331 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 332 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 333 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 334 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 335 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 336 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 337 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 338 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 339 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 340 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 341 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 342 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 343 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 344 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 345 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 346 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 347 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 348 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 349 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 350 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 351 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 352 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 353 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 354 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 355 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 356 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 357 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 358 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 359 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 360 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 361 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 362 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 363 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 364 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 365 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 366 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 367 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 368 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 369 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 370 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 371 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 372 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.81 |
| Metatranscriptomes | 1.37 |
| Isolates | 4.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.11 |
| Bulb | 0 |
| Endosphere | 11.34 |
| Nodule | 0.11 |
| Rhizoplane | 2.41 |
| Rhizosphere | 71.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070666_10017949 | 3300005335 | Bacteria | 4541 |
| 2 | SwRhRL2b_contig_437430 | 2162886007 | Bacteria | 4363 |
| 3 | JGI24741J21665_1001083 | 3300001915 | Bacteria | 8133 |
| 4 | JGI24741J21665_1001160 | 3300001915 | Bacteria | 7779 |
| 5 | JGI24741J21665_1019418 | 3300001915 | Bacteria | 1077 |
| 6 | JGI24740J21852_10000202 | 3300001979 | Bacteria | 24620 |
| 7 | JGI24739J22299_10000106 | 3300001989 | Bacteria | 25422 |
| 8 | JGI24739J22299_10009578 | 3300001989 | Bacteria | 3606 |
| 9 | JGI24737J22298_10003313 | 3300001990 | Bacteria | 5705 |
| 10 | JGI24737J22298_10012599 | 3300001990 | Bacteria | 2756 |
| 11 | JGI24738J21930_10000629 | 3300002075 | Bacteria | 10165 |
| 12 | JGI24744J21845_10011202 | 3300002077 | Bacteria | 1836 |
| 13 | JGI25156J39149_1004204 | 3300002705 | Bacteria | 4442 |
| 14 | JGI25156J39149_1004457 | 3300002705 | Bacteria | 4264 |
| 15 | JGI25162J39368_1000189 | 3300002737 | Bacteria | 64599 |
| 16 | JGI25162J39368_1001211 | 3300002737 | Bacteria | 15019 |
| 17 | JGI25154J39366_1005767 | 3300002738 | Bacteria | 1917 |
| 18 | JGI25154J39366_1007499 | 3300002738 | Bacteria | 1488 |
| 19 | JGI25157J39369_1000343 | 3300002741 | Bacteria | 32869 |
| 20 | JGI25157J39369_1001906 | 3300002741 | Bacteria | 6323 |
| 21 | JGI25163J39215_1000482 | 3300002771 | Bacteria | 12006 |
| 22 | JGI25164J39214_1000093 | 3300002772 | Bacteria | 89262 |
| 23 | JGI25164J39214_1007042 | 3300002772 | Bacteria | 1156 |
| 24 | JGI25152J39213_1000100 | 3300002773 | Bacteria | 60649 |
| 25 | JGI25152J39213_1021261 | 3300002773 | Bacteria | 1141 |
| 26 | JGI25150J39212_1001361 | 3300002774 | Bacteria | 6941 |
| 27 | JGI25151J46595_10000286 | 3300003187 | Bacteria | 57223 |
| 28 | JGI25406J46586_10043374 | 3300003203 | Bacteria | 1566 |
| 29 | JGI25165J46597_1000283 | 3300003214 | Bacteria | 64612 |
| 30 | JGI25153J46596_10000185 | 3300003215 | Bacteria | 60646 |
| 31 | rootH1_10026426 | 3300003316 | Bacteria | 7677 |
| 32 | rootH2_10067014 | 3300003320 | Bacteria | 2675 |
| 33 | rootH1_10095898 | 3300003323 | Bacteria | 1222 |
| 34 | Ga0006562J51391_1006439 | 3300003578 | Bacteria | 12519 |
| 35 | Ga0006562J51391_1006443 | 3300003578 | Bacteria | 7179 |
| 36 | Ga0006562J51391_1010698 | 3300003578 | Bacteria | 14220 |
| 37 | Ga0006562J51391_1010700 | 3300003578 | Bacteria | 5840 |
| 38 | Ga0055533_1000863 | 3300003756 | Bacteria | 9260 |
| 39 | Ga0055535_1000070 | 3300003761 | Bacteria | 114467 |
| 40 | Ga0055535_1000152 | 3300003761 | Bacteria | 73843 |
| 41 | Ga0055542_1000232 | 3300003762 | Bacteria | 64691 |
| 42 | Ga0055542_1000606 | 3300003762 | Bacteria | 30638 |
| 43 | Ga0055529_1000024 | 3300003763 | Bacteria | 305218 |
| 44 | Ga0055529_1000082 | 3300003763 | Bacteria | 146912 |
| 45 | Ga0055537_1001012 | 3300003773 | Bacteria | 12744 |
| 46 | Ga0055524_1016880 | 3300003775 | Bacteria | 2596 |
| 47 | Ga0055536_1002151 | 3300003781 | Bacteria | 11232 |
| 48 | Ga0055536_1002439 | 3300003781 | Bacteria | 10441 |
| 49 | Ga0055534_1000665 | 3300003784 | Bacteria | 17303 |
| 50 | Ga0055528_1000354 | 3300003790 | Bacteria | 37304 |
| 51 | Ga0055530_10001405 | 3300003791 | Bacteria | 17745 |
| 52 | Ga0055530_10002266 | 3300003791 | Bacteria | 12649 |
| 53 | Ga0055531_10004756 | 3300003794 | Bacteria | 8111 |
| 54 | Ga0055531_10004760 | 3300003794 | Bacteria | 8109 |
| 55 | Ga0055531_10017670 | 3300003794 | Bacteria | 2995 |
| 56 | Ga0055531_10026916 | 3300003794 | Bacteria | 2035 |
| 57 | Ga0058692_1000032 | 3300003856 | Bacteria | 179581 |
| 58 | Ga0058692_1000107 | 3300003856 | Bacteria | 55344 |
| 59 | Ga0065165_1003415 | 3300005262 | Bacteria | 11194 |
| 60 | Ga0065704_10086549 | 3300005289 | Bacteria | 3107 |
| 61 | Ga0070658_10010741 | 3300005327 | Bacteria | 7338 |
| 62 | Ga0070658_10548958 | 3300005327 | Bacteria | 1000 |
| 63 | Ga0070658_10964599 | 3300005327 | Bacteria | 741 |
| 64 | Ga0070670_100005468 | 3300005331 | Bacteria | 10716 |
| 65 | Ga0070670_100151637 | 3300005331 | Bacteria | 2006 |
| 66 | Ga0070666_10000037 | 3300005335 | Bacteria | 116528 |
| 67 | Ga0070666_10000113 | 3300005335 | Bacteria | 55648 |
| 68 | Ga0070666_10364491 | 3300005335 | Bacteria | 1036 |
| 69 | Ga0070680_100005860 | 3300005336 | Bacteria | 9323 |
| 70 | Ga0070680_100836145 | 3300005336 | Bacteria | 794 |
| 71 | Ga0070682_100004836 | 3300005337 | Bacteria | 7481 |
| 72 | Ga0068868_100209877 | 3300005338 | Bacteria | 1627 |
| 73 | Ga0070660_100444267 | 3300005339 | Bacteria | 1075 |
| 74 | Ga0070689_100110565 | 3300005340 | Bacteria | 2185 |
| 75 | Ga0070691_10001898 | 3300005341 | Bacteria | 9163 |
| 76 | Ga0070691_10022492 | 3300005341 | Bacteria | 2925 |
| 77 | Ga0070661_100008749 | 3300005344 | Bacteria | 7006 |
| 78 | Ga0070661_100008845 | 3300005344 | Bacteria | 6969 |
| 79 | Ga0070661_100029838 | 3300005344 | Bacteria | 3938 |
| 80 | Ga0070661_100251997 | 3300005344 | Bacteria | 1363 |
| 81 | Ga0070661_100577904 | 3300005344 | Bacteria | 906 |
| 82 | Ga0070692_10002113 | 3300005345 | Bacteria | 7592 |
| 83 | Ga0070692_10007608 | 3300005345 | Bacteria | 4782 |
| 84 | Ga0070668_100048978 | 3300005347 | Bacteria | 3251 |
| 85 | Ga0070668_100191937 | 3300005347 | Bacteria | 1673 |
| 86 | Ga0070659_100221998 | 3300005366 | Bacteria | 1560 |
| 87 | Ga0070667_100011381 | 3300005367 | Bacteria | 7357 |
| 88 | Ga0070667_100307227 | 3300005367 | Bacteria | 1429 |
| 89 | Ga0070663_100029834 | 3300005455 | Bacteria | 3731 |
| 90 | Ga0070663_100030244 | 3300005455 | Bacteria | 3709 |
| 91 | Ga0070663_100039060 | 3300005455 | Bacteria | 3315 |
| 92 | Ga0070663_100157631 | 3300005455 | Bacteria | 1745 |
| 93 | Ga0070663_100166556 | 3300005455 | Bacteria | 1700 |
| 94 | Ga0070663_100310810 | 3300005455 | Bacteria | 1264 |
| 95 | Ga0070663_100556927 | 3300005455 | Bacteria | 959 |
| 96 | Ga0070678_100035902 | 3300005456 | Bacteria | 3465 |
| 97 | Ga0070662_100007404 | 3300005457 | Bacteria | 7117 |
| 98 | Ga0070662_100023092 | 3300005457 | Bacteria | 4268 |
| 99 | Ga0070662_100276898 | 3300005457 | Bacteria | 1357 |
| 100 | Ga0070662_100453922 | 3300005457 | Bacteria | 1064 |
| 101 | Ga0068867_100218406 | 3300005459 | Bacteria | 1535 |
| 102 | Ga0070685_10034140 | 3300005466 | Bacteria | 2863 |
| 103 | Ga0070684_100034303 | 3300005535 | Bacteria | 4338 |
| 104 | Ga0068853_100020190 | 3300005539 | Bacteria | 5538 |
| 105 | Ga0068853_100037221 | 3300005539 | Bacteria | 4140 |
| 106 | Ga0068853_100037482 | 3300005539 | Bacteria | 4125 |
| 107 | Ga0068853_100490069 | 3300005539 | Bacteria | 1159 |
| 108 | Ga0068853_100510672 | 3300005539 | Bacteria | 1135 |
| 109 | Ga0070696_100026308 | 3300005546 | Bacteria | 3958 |
| 110 | Ga0070696_100108501 | 3300005546 | Bacteria | 1997 |
| 111 | Ga0070693_100057268 | 3300005547 | Bacteria | 2252 |
| 112 | Ga0070693_100102935 | 3300005547 | Bacteria | 1743 |
| 113 | Ga0070665_100001464 | 3300005548 | Bacteria | 27669 |
| 114 | Ga0070665_100017618 | 3300005548 | Bacteria | 7174 |
| 115 | Ga0070665_100055875 | 3300005548 | Bacteria | 3959 |
| 116 | Ga0070665_100066955 | 3300005548 | Bacteria | 3602 |
| 117 | Ga0068855_100014993 | 3300005563 | Bacteria | 9334 |
| 118 | Ga0068855_100025540 | 3300005563 | Bacteria | 7066 |
| 119 | Ga0068855_100137820 | 3300005563 | Bacteria | 2783 |
| 120 | Ga0068855_100147646 | 3300005563 | Bacteria | 2675 |
| 121 | Ga0068855_100214274 | 3300005563 | Bacteria | 2163 |
| 122 | Ga0068855_100649128 | 3300005563 | Bacteria | 1133 |
| 123 | Ga0068855_101050884 | 3300005563 | Bacteria | 853 |
| 124 | Ga0070664_100037277 | 3300005564 | Bacteria | 4087 |
| 125 | Ga0068857_100050914 | 3300005577 | Bacteria | 3673 |
| 126 | Ga0068857_100065226 | 3300005577 | Bacteria | 3237 |
| 127 | Ga0068857_100066638 | 3300005577 | Bacteria | 3204 |
| 128 | Ga0068857_100476578 | 3300005577 | Bacteria | 1169 |
| 129 | Ga0068857_100535088 | 3300005577 | Bacteria | 1102 |
| 130 | Ga0068857_100563357 | 3300005577 | Bacteria | 1074 |
| 131 | Ga0068854_100000327 | 3300005578 | Bacteria | 31304 |
| 132 | Ga0068854_100017753 | 3300005578 | Bacteria | 4766 |
| 133 | Ga0068854_100032577 | 3300005578 | Bacteria | 3627 |
| 134 | Ga0068854_100042596 | 3300005578 | Bacteria | 3214 |
| 135 | Ga0068854_100053732 | 3300005578 | Bacteria | 2894 |
| 136 | Ga0068854_100069788 | 3300005578 | Bacteria | 2567 |
| 137 | Ga0068856_100000465 | 3300005614 | Bacteria | 44705 |
| 138 | Ga0068856_100015047 | 3300005614 | Bacteria | 7472 |
| 139 | Ga0068856_100062516 | 3300005614 | Bacteria | 3678 |
| 140 | Ga0068856_100210733 | 3300005614 | Bacteria | 1958 |
| 141 | Ga0068856_101251107 | 3300005614 | Bacteria | 758 |
| 142 | Ga0068852_100005072 | 3300005616 | Bacteria | 9370 |
| 143 | Ga0068852_100009214 | 3300005616 | Bacteria | 7314 |
| 144 | Ga0068852_100021345 | 3300005616 | Bacteria | 5169 |
| 145 | Ga0068852_100040858 | 3300005616 | Bacteria | 3916 |
| 146 | Ga0068852_100082600 | 3300005616 | Bacteria | 2855 |
| 147 | Ga0068852_100271558 | 3300005616 | Bacteria | 1632 |
| 148 | Ga0068852_100974690 | 3300005616 | Bacteria | 866 |
| 149 | Ga0068851_10004227 | 3300005834 | Bacteria | 6463 |
| 150 | Ga0068851_10111674 | 3300005834 | Bacteria | 1460 |
| 151 | Ga0068863_100010577 | 3300005841 | Bacteria | 8956 |
| 152 | Ga0068863_100302374 | 3300005841 | Bacteria | 1552 |
| 153 | Ga0068863_100803708 | 3300005841 | Bacteria | 938 |
| 154 | Ga0068858_100001617 | 3300005842 | Bacteria | 22975 |
| 155 | Ga0068858_100078878 | 3300005842 | Bacteria | 3060 |
| 156 | Ga0068858_100156022 | 3300005842 | Bacteria | 2148 |
| 157 | Ga0068858_100175553 | 3300005842 | Bacteria | 2022 |
| 158 | Ga0068858_100762189 | 3300005842 | Bacteria | 943 |
| 159 | Ga0068860_100016312 | 3300005843 | Bacteria | 7243 |
| 160 | Ga0068860_100021300 | 3300005843 | Bacteria | 6279 |
| 161 | Ga0068860_100028649 | 3300005843 | Bacteria | 5360 |
| 162 | Ga0068860_100088614 | 3300005843 | Bacteria | 2946 |
| 163 | Ga0068860_100088656 | 3300005843 | Bacteria | 2945 |
| 164 | Ga0068862_100134261 | 3300005844 | Bacteria | 2192 |
| 165 | Ga0068862_100715261 | 3300005844 | Bacteria | 971 |
| 166 | Ga0081539_10102567 | 3300005985 | Bacteria | 1455 |
| 167 | Ga0075364_10071742 | 3300006051 | Bacteria | 2281 |
| 168 | Ga0075364_10103757 | 3300006051 | Bacteria | 1894 |
| 169 | Ga0075367_10021354 | 3300006178 | Bacteria | 3617 |
| 170 | Ga0075369_10041635 | 3300006186 | Bacteria | 1967 |
| 171 | Ga0075369_10078466 | 3300006186 | Bacteria | 1462 |
| 172 | Ga0097621_100034951 | 3300006237 | Bacteria | 4012 |
| 173 | Ga0097621_100797273 | 3300006237 | Bacteria | 875 |
| 174 | Ga0068871_100209860 | 3300006358 | Bacteria | 1684 |
| 175 | Ga0068865_100001874 | 3300006881 | Bacteria | 12363 |
| 176 | Ga0105251_10001430 | 3300009011 | Bacteria | 20577 |
| 177 | Ga0105251_10006046 | 3300009011 | Bacteria | 7801 |
| 178 | Ga0105240_10002550 | 3300009093 | Bacteria | 29197 |
| 179 | Ga0105240_10031555 | 3300009093 | Bacteria | 6870 |
| 180 | Ga0105240_10068928 | 3300009093 | Bacteria | 4380 |
| 181 | Ga0105240_10088182 | 3300009093 | Bacteria | 3797 |
| 182 | Ga0105240_10120708 | 3300009093 | Bacteria | 3156 |
| 183 | Ga0105240_10132563 | 3300009093 | Bacteria | 2987 |
| 184 | Ga0105240_10172895 | 3300009093 | Bacteria | 2557 |
| 185 | Ga0105240_10231302 | 3300009093 | Bacteria | 2148 |
| 186 | Ga0105240_10241267 | 3300009093 | Bacteria | 2095 |
| 187 | Ga0105245_10038052 | 3300009098 | Bacteria | 4278 |
| 188 | Ga0105247_10000850 | 3300009101 | Bacteria | 23141 |
| 189 | Ga0105243_10003698 | 3300009148 | Bacteria | 12293 |
| 190 | Ga0105243_10192227 | 3300009148 | Bacteria | 1783 |
| 191 | Ga0105241_10003077 | 3300009174 | Bacteria | 12440 |
| 192 | Ga0105241_10016891 | 3300009174 | Bacteria | 5357 |
| 193 | Ga0105241_10216749 | 3300009174 | Bacteria | 1606 |
| 194 | Ga0105241_10235485 | 3300009174 | Bacteria | 1545 |
| 195 | Ga0105241_10306209 | 3300009174 | Bacteria | 1365 |
| 196 | Ga0105242_10007774 | 3300009176 | Bacteria | 8249 |
| 197 | Ga0105242_10167833 | 3300009176 | Bacteria | 1926 |
| 198 | Ga0105248_10106625 | 3300009177 | Bacteria | 3159 |
| 199 | Ga0105248_10166189 | 3300009177 | Bacteria | 2488 |
| 200 | Ga0105248_10253635 | 3300009177 | Bacteria | 1980 |
| 201 | Ga0105237_10000145 | 3300009545 | Bacteria | 99941 |
| 202 | Ga0105237_10000351 | 3300009545 | Bacteria | 64886 |
| 203 | Ga0105237_10002004 | 3300009545 | Bacteria | 25915 |
| 204 | Ga0105237_10021391 | 3300009545 | Bacteria | 6650 |
| 205 | Ga0105237_10626920 | 3300009545 | Bacteria | 1082 |
| 206 | Ga0105238_10000154 | 3300009551 | Bacteria | 75243 |
| 207 | Ga0105238_10001816 | 3300009551 | Bacteria | 21405 |
| 208 | Ga0105238_10003169 | 3300009551 | Bacteria | 16399 |
| 209 | Ga0105238_10003482 | 3300009551 | Bacteria | 15670 |
| 210 | Ga0105238_10004755 | 3300009551 | Bacteria | 13434 |
| 211 | Ga0105238_10014221 | 3300009551 | Bacteria | 8048 |
| 212 | Ga0105238_10098946 | 3300009551 | Bacteria | 2900 |
| 213 | Ga0105238_10115874 | 3300009551 | Bacteria | 2659 |
| 214 | Ga0105238_10240295 | 3300009551 | Bacteria | 1788 |
| 215 | Ga0105249_10016822 | 3300009553 | Bacteria | 6489 |
| 216 | Ga0105249_11158488 | 3300009553 | Bacteria | 844 |
| 217 | Ga0105147_114136 | 3300009982 | Bacteria | 680 |
| 218 | Ga0105239_10008021 | 3300010375 | Bacteria | 12056 |
| 219 | Ga0105239_10009128 | 3300010375 | Bacteria | 11218 |
| 220 | Ga0105239_10010310 | 3300010375 | Bacteria | 10466 |
| 221 | Ga0105239_10010456 | 3300010375 | Bacteria | 10374 |
| 222 | Ga0105239_10055563 | 3300010375 | Bacteria | 4342 |
| 223 | Ga0105239_10098555 | 3300010375 | Bacteria | 3231 |
| 224 | Ga0105239_10128279 | 3300010375 | Bacteria | 2820 |
| 225 | Ga0105246_10111959 | 3300011119 | Bacteria | 2007 |
| 226 | Ga0157314_1000050 | 3300012500 | Bacteria | 12280 |
| 227 | Ga0157373_10026468 | 3300013100 | Bacteria | 4190 |
| 228 | Ga0157373_10028498 | 3300013100 | Bacteria | 4029 |
| 229 | Ga0157373_10143012 | 3300013100 | Unclassified | 1682 |
| 230 | Ga0157373_10236918 | 3300013100 | Bacteria | 1290 |
| 231 | Ga0157373_10686945 | 3300013100 | Bacteria | 749 |
| 232 | Ga0157371_10052237 | 3300013102 | Bacteria | 2903 |
| 233 | Ga0157371_10093649 | 3300013102 | Bacteria | 2129 |
| 234 | Ga0157371_10311578 | 3300013102 | Bacteria | 1141 |
| 235 | Ga0157370_10002475 | 3300013104 | Bacteria | 22277 |
| 236 | Ga0157370_10002903 | 3300013104 | Bacteria | 20440 |
| 237 | Ga0157370_10020888 | 3300013104 | Bacteria | 6532 |
| 238 | Ga0157370_10025503 | 3300013104 | Bacteria | 5853 |
| 239 | Ga0157370_10051703 | 3300013104 | Bacteria | 3924 |
| 240 | Ga0157370_10131718 | 3300013104 | Bacteria | 2332 |
| 241 | Ga0157370_10198283 | 3300013104 | Bacteria | 1863 |
| 242 | Ga0157370_10225923 | 3300013104 | Bacteria | 1733 |
| 243 | Ga0157370_10750810 | 3300013104 | Bacteria | 889 |
| 244 | Ga0157369_10000030 | 3300013105 | Bacteria | 203569 |
| 245 | Ga0157369_10001038 | 3300013105 | Bacteria | 35108 |
| 246 | Ga0157369_10004259 | 3300013105 | Bacteria | 16926 |
| 247 | Ga0157369_10021621 | 3300013105 | Bacteria | 7194 |
| 248 | Ga0157369_10049276 | 3300013105 | Bacteria | 4567 |
| 249 | Ga0157369_10069025 | 3300013105 | Bacteria | 3797 |
| 250 | Ga0157369_10121709 | 3300013105 | Bacteria | 2768 |
| 251 | Ga0157369_10171067 | 3300013105 | Bacteria | 2289 |
| 252 | Ga0157369_10377154 | 3300013105 | Bacteria | 1472 |
| 253 | Ga0157374_10005891 | 3300013296 | Bacteria | 10353 |
| 254 | Ga0157374_10047351 | 3300013296 | Bacteria | 3987 |
| 255 | Ga0157374_10422732 | 3300013296 | Bacteria | 1332 |
| 256 | Ga0157378_10015806 | 3300013297 | Bacteria | 6609 |
| 257 | Ga0163162_10000739 | 3300013306 | Bacteria | 30363 |
| 258 | Ga0163162_10001975 | 3300013306 | Bacteria | 19266 |
| 259 | Ga0163162_10108673 | 3300013306 | Bacteria | 2870 |
| 260 | Ga0163162_10160052 | 3300013306 | Bacteria | 2373 |
| 261 | Ga0157372_10001632 | 3300013307 | Bacteria | 24352 |
| 262 | Ga0157372_10015710 | 3300013307 | Bacteria | 8119 |
| 263 | Ga0157372_10174703 | 3300013307 | Bacteria | 2486 |
| 264 | Ga0157372_10184716 | 3300013307 | Bacteria | 2414 |
| 265 | Ga0157372_10224411 | 3300013307 | Bacteria | 2178 |
| 266 | Ga0157372_10258002 | 3300013307 | Bacteria | 2024 |
| 267 | Ga0157372_10773255 | 3300013307 | Bacteria | 1116 |
| 268 | Ga0157372_11136813 | 3300013307 | Bacteria | 903 |
| 269 | Ga0163163_10000143 | 3300014325 | Bacteria | 74622 |
| 270 | Ga0163163_10227563 | 3300014325 | Bacteria | 1914 |
| 271 | Ga0182008_10003207 | 3300014497 | Bacteria | 9994 |
| 272 | Ga0182008_10004013 | 3300014497 | Bacteria | 8698 |
| 273 | Ga0182008_10006474 | 3300014497 | Bacteria | 6542 |
| 274 | Ga0182008_10043509 | 3300014497 | Bacteria | 2235 |
| 275 | Ga0157379_10005653 | 3300014968 | Bacteria | 10743 |
| 276 | Ga0157376_10004843 | 3300014969 | Bacteria | 9382 |
| 277 | Ga0157376_10018257 | 3300014969 | Bacteria | 5372 |
| 278 | Ga0157376_10032656 | 3300014969 | Bacteria | 4182 |
| 279 | Ga0182006_1000031 | 3300015261 | Bacteria | 240055 |
| 280 | Ga0182006_1000362 | 3300015261 | Bacteria | 37875 |
| 281 | Ga0182006_1009502 | 3300015261 | Bacteria | 4355 |
| 282 | Ga0182006_1012885 | 3300015261 | Bacteria | 3648 |
| 283 | Ga0182006_1013105 | 3300015261 | Bacteria | 3607 |
| 284 | Ga0182007_10002222 | 3300015262 | Bacteria | 9832 |
| 285 | Ga0182005_1000049 | 3300015265 | Bacteria | 123003 |
| 286 | Ga0182005_1001834 | 3300015265 | Bacteria | 8090 |
| 287 | Ga0182005_1001840 | 3300015265 | Bacteria | 8068 |
| 288 | Ga0182005_1001908 | 3300015265 | Bacteria | 7896 |
| 289 | Ga0182005_1046616 | 3300015265 | Bacteria | 1177 |
| 290 | Ga0183369_1003 | 3300015685 | Bacteria | 726443 |
| 291 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 292 | Ga0163161_10001105 | 3300017792 | Bacteria | 20371 |
| 293 | Ga0163161_10017339 | 3300017792 | Bacteria | 5039 |
| 294 | Ga0163161_10061666 | 3300017792 | Bacteria | 2730 |
| 295 | Ga0163161_10114656 | 3300017792 | Bacteria | 2019 |
| 296 | Ga0163161_10146788 | 3300017792 | Bacteria | 1790 |
| 297 | Ga0163161_10363144 | 3300017792 | Bacteria | 1154 |
| 298 | Ga0206356_11026814 | 3300020070 | Bacteria | 1872 |
| 299 | Ga0206356_11707498 | 3300020070 | Bacteria | 3246 |
| 300 | Ga0206354_10866433 | 3300020081 | Unclassified | 1812 |
| 301 | Ga0206354_11324804 | 3300020081 | Bacteria | 1826 |
| 302 | Ga0206353_11004208 | 3300020082 | Bacteria | 4683 |
| 303 | Ga0206353_11518548 | 3300020082 | Bacteria | 3562 |
| 304 | Ga0206353_11951358 | 3300020082 | Bacteria | 6885 |
| 305 | Ga0154015_1130650 | 3300020610 | Bacteria | 2015 |
| 306 | Ga0213876_10122365 | 3300021384 | Bacteria | 1382 |
| 307 | Ga0209435_100965 | 3300025206 | Bacteria | 4202 |
| 308 | Ga0209760_100330 | 3300025207 | Bacteria | 14198 |
| 309 | Ga0209784_100011 | 3300025224 | Bacteria | 546770 |
| 310 | Ga0209566_105487 | 3300025225 | Bacteria | 1592 |
| 311 | Ga0209674_100012 | 3300025226 | Bacteria | 950162 |
| 312 | Ga0209674_100389 | 3300025226 | Bacteria | 23167 |
| 313 | Ga0207427_100026 | 3300025231 | Bacteria | 412764 |
| 314 | Ga0207427_105025 | 3300025231 | Bacteria | 1986 |
| 315 | Ga0209437_100241 | 3300025233 | Bacteria | 89459 |
| 316 | Ga0209437_100340 | 3300025233 | Bacteria | 56228 |
| 317 | Ga0209437_101914 | 3300025233 | Bacteria | 4358 |
| 318 | Ga0209437_104525 | 3300025233 | Bacteria | 2442 |
| 319 | Ga0209258_100027 | 3300025242 | Bacteria | 518449 |
| 320 | Ga0209258_100854 | 3300025242 | Bacteria | 16339 |
| 321 | Ga0209258_104471 | 3300025242 | Bacteria | 2638 |
| 322 | Ga0207425_1000311 | 3300025245 | Bacteria | 35119 |
| 323 | Ga0209646_1001638 | 3300025246 | Bacteria | 5757 |
| 324 | Ga0209646_1003535 | 3300025246 | Bacteria | 3061 |
| 325 | Ga0209646_1015697 | 3300025246 | Bacteria | 1128 |
| 326 | Ga0209026_1000018 | 3300025250 | Bacteria | 381351 |
| 327 | Ga0209026_1000084 | 3300025250 | Bacteria | 186997 |
| 328 | Ga0209026_1004876 | 3300025250 | Bacteria | 3804 |
| 329 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 330 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 331 | Ga0209148_1001074 | 3300025254 | Bacteria | 16668 |
| 332 | Ga0209759_1001248 | 3300025256 | Bacteria | 15421 |
| 333 | Ga0209759_1003313 | 3300025256 | Bacteria | 6481 |
| 334 | Ga0209759_1004487 | 3300025256 | Bacteria | 5191 |
| 335 | Ga0209129_1000011 | 3300025258 | Bacteria | 568657 |
| 336 | Ga0209129_1001119 | 3300025258 | Bacteria | 15581 |
| 337 | Ga0209129_1002671 | 3300025258 | Bacteria | 8436 |
| 338 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 339 | Ga0209233_1023974 | 3300025261 | Bacteria | 1534 |
| 340 | Ga0209565_1000274 | 3300025263 | Bacteria | 52312 |
| 341 | Ga0209455_1000019 | 3300025272 | Bacteria | 705658 |
| 342 | Ga0209455_1000266 | 3300025272 | Bacteria | 59221 |
| 343 | Ga0209455_1021749 | 3300025272 | Bacteria | 1238 |
| 344 | Ga0209673_1000032 | 3300025273 | Bacteria | 339956 |
| 345 | Ga0209130_1017459 | 3300025284 | Bacteria | 1708 |
| 346 | Ga0209675_1000233 | 3300025291 | Bacteria | 55562 |
| 347 | Ga0209676_1000131 | 3300025292 | Bacteria | 185298 |
| 348 | Ga0209676_1000594 | 3300025292 | Bacteria | 53972 |
| 349 | Ga0209676_1000813 | 3300025292 | Bacteria | 40787 |
| 350 | Ga0209025_1000002 | 3300025294 | Bacteria | 1393142 |
| 351 | Ga0209564_1000037 | 3300025295 | Bacteria | 414794 |
| 352 | Ga0209758_1000003 | 3300025297 | Bacteria | 1398533 |
| 353 | Ga0209758_1000647 | 3300025297 | Bacteria | 52818 |
| 354 | Ga0209758_1009551 | 3300025297 | Bacteria | 5998 |
| 355 | Ga0209758_1029390 | 3300025297 | Bacteria | 2300 |
| 356 | Ga0209050_1000147 | 3300025298 | Bacteria | 164512 |
| 357 | Ga0209050_1000328 | 3300025298 | Bacteria | 94963 |
| 358 | Ga0209050_1015059 | 3300025298 | Bacteria | 3280 |
| 359 | Ga0209050_1043390 | 3300025298 | Bacteria | 1216 |
| 360 | Ga0209256_1001837 | 3300025299 | Bacteria | 19742 |
| 361 | Ga0209256_1014050 | 3300025299 | Bacteria | 2916 |
| 362 | Ga0209256_1021875 | 3300025299 | Bacteria | 1950 |
| 363 | Ga0209051_1001685 | 3300025303 | Bacteria | 17778 |
| 364 | Ga0209051_1011441 | 3300025303 | Bacteria | 4379 |
| 365 | Ga0209051_1028146 | 3300025303 | Bacteria | 2225 |
| 366 | Ga0209257_1000086 | 3300025304 | Bacteria | 287437 |
| 367 | Ga0209257_1000655 | 3300025304 | Bacteria | 54777 |
| 368 | Ga0209257_1001357 | 3300025304 | Bacteria | 29616 |
| 369 | Ga0209257_1006199 | 3300025304 | Bacteria | 7848 |
| 370 | Ga0209257_1039636 | 3300025304 | Bacteria | 1414 |
| 371 | Ga0207656_10001353 | 3300025321 | Bacteria | 8083 |
| 372 | Ga0207656_10003323 | 3300025321 | Bacteria | 5511 |
| 373 | Ga0207713_1002689 | 3300025735 | Bacteria | 12711 |
| 374 | Ga0207713_1011905 | 3300025735 | Bacteria | 4693 |
| 375 | Ga0207692_10073959 | 3300025898 | Bacteria | 1804 |
| 376 | Ga0207710_10095650 | 3300025900 | Bacteria | 1396 |
| 377 | Ga0207680_10000001 | 3300025903 | Bacteria | 1091453 |
| 378 | Ga0207680_10001357 | 3300025903 | Bacteria | 11609 |
| 379 | Ga0207680_10020209 | 3300025903 | Bacteria | 3578 |
| 380 | Ga0207647_10000016 | 3300025904 | Bacteria | 130866 |
| 381 | Ga0207647_10000066 | 3300025904 | Bacteria | 81782 |
| 382 | Ga0207647_10001470 | 3300025904 | Bacteria | 18101 |
| 383 | Ga0207647_10005342 | 3300025904 | Bacteria | 9442 |
| 384 | Ga0207647_10022858 | 3300025904 | Bacteria | 4147 |
| 385 | Ga0207647_10044803 | 3300025904 | Bacteria | 2763 |
| 386 | Ga0207705_10000087 | 3300025909 | Bacteria | 114441 |
| 387 | Ga0207705_10000153 | 3300025909 | Bacteria | 74093 |
| 388 | Ga0207705_10005258 | 3300025909 | Bacteria | 9700 |
| 389 | Ga0207705_10013607 | 3300025909 | Bacteria | 5872 |
| 390 | Ga0207705_10225627 | 3300025909 | Bacteria | 1424 |
| 391 | Ga0207654_10005258 | 3300025911 | Bacteria | 6536 |
| 392 | Ga0207654_10019517 | 3300025911 | Bacteria | 3579 |
| 393 | Ga0207654_10052976 | 3300025911 | Bacteria | 2341 |
| 394 | Ga0207654_10100935 | 3300025911 | Bacteria | 1778 |
| 395 | Ga0207707_10001030 | 3300025912 | Bacteria | 26758 |
| 396 | Ga0207695_10000859 | 3300025913 | Bacteria | 55564 |
| 397 | Ga0207695_10001326 | 3300025913 | Bacteria | 41988 |
| 398 | Ga0207695_10001671 | 3300025913 | Bacteria | 35725 |
| 399 | Ga0207695_10002027 | 3300025913 | Bacteria | 31101 |
| 400 | Ga0207695_10005701 | 3300025913 | Bacteria | 16423 |
| 401 | Ga0207695_10005750 | 3300025913 | Bacteria | 16327 |
| 402 | Ga0207695_10006209 | 3300025913 | Bacteria | 15563 |
| 403 | Ga0207695_10020536 | 3300025913 | Bacteria | 7561 |
| 404 | Ga0207695_10051852 | 3300025913 | Bacteria | 4304 |
| 405 | Ga0207695_10056392 | 3300025913 | Bacteria | 4088 |
| 406 | Ga0207671_10000028 | 3300025914 | Bacteria | 263092 |
| 407 | Ga0207671_10001571 | 3300025914 | Bacteria | 26024 |
| 408 | Ga0207671_10001602 | 3300025914 | Bacteria | 25731 |
| 409 | Ga0207671_10005765 | 3300025914 | Bacteria | 11280 |
| 410 | Ga0207671_10008242 | 3300025914 | Bacteria | 8870 |
| 411 | Ga0207671_10284427 | 3300025914 | Bacteria | 1305 |
| 412 | Ga0207660_10000534 | 3300025917 | Bacteria | 25449 |
| 413 | Ga0207660_10023809 | 3300025917 | Bacteria | 4139 |
| 414 | Ga0207657_10002053 | 3300025919 | Bacteria | 21792 |
| 415 | Ga0207657_10007728 | 3300025919 | Bacteria | 10979 |
| 416 | Ga0207657_10012319 | 3300025919 | Bacteria | 8450 |
| 417 | Ga0207649_10000488 | 3300025920 | Bacteria | 28138 |
| 418 | Ga0207649_10004897 | 3300025920 | Bacteria | 7241 |
| 419 | Ga0207649_10023674 | 3300025920 | Bacteria | 3559 |
| 420 | Ga0207649_10047259 | 3300025920 | Bacteria | 2648 |
| 421 | Ga0207649_10084602 | 3300025920 | Bacteria | 2062 |
| 422 | Ga0207649_10458161 | 3300025920 | Bacteria | 964 |
| 423 | Ga0207652_10000418 | 3300025921 | Bacteria | 44135 |
| 424 | Ga0207681_10367080 | 3300025923 | Bacteria | 1156 |
| 425 | Ga0207681_10645391 | 3300025923 | Bacteria | 877 |
| 426 | Ga0207694_10000633 | 3300025924 | Bacteria | 31848 |
| 427 | Ga0207694_10000925 | 3300025924 | Bacteria | 25997 |
| 428 | Ga0207694_10001341 | 3300025924 | Bacteria | 21199 |
| 429 | Ga0207694_10003183 | 3300025924 | Bacteria | 13094 |
| 430 | Ga0207694_10014889 | 3300025924 | Bacteria | 5866 |
| 431 | Ga0207694_10037290 | 3300025924 | Bacteria | 3733 |
| 432 | Ga0207694_10041945 | 3300025924 | Bacteria | 3528 |
| 433 | Ga0207694_10177359 | 3300025924 | Bacteria | 1727 |
| 434 | Ga0207694_10311040 | 3300025924 | Bacteria | 1299 |
| 435 | Ga0207694_10327757 | 3300025924 | Bacteria | 1264 |
| 436 | Ga0207650_10012465 | 3300025925 | Bacteria | 5869 |
| 437 | Ga0207650_10040961 | 3300025925 | Bacteria | 3392 |
| 438 | Ga0207687_10241406 | 3300025927 | Bacteria | 1432 |
| 439 | Ga0207690_10001149 | 3300025932 | Bacteria | 16803 |
| 440 | Ga0207690_10003181 | 3300025932 | Bacteria | 9861 |
| 441 | Ga0207690_10174782 | 3300025932 | Bacteria | 1612 |
| 442 | Ga0207706_10029839 | 3300025933 | Bacteria | 4866 |
| 443 | Ga0207706_10129991 | 3300025933 | Bacteria | 2215 |
| 444 | Ga0207706_10173819 | 3300025933 | Bacteria | 1892 |
| 445 | Ga0207706_10363970 | 3300025933 | Bacteria | 1256 |
| 446 | Ga0207686_10012831 | 3300025934 | Bacteria | 4617 |
| 447 | Ga0207686_10178534 | 3300025934 | Bacteria | 1504 |
| 448 | Ga0207709_10002169 | 3300025935 | Bacteria | 12571 |
| 449 | Ga0207709_10004394 | 3300025935 | Bacteria | 8162 |
| 450 | Ga0207670_10008919 | 3300025936 | Bacteria | 5689 |
| 451 | Ga0207704_10040687 | 3300025938 | Bacteria | 2719 |
| 452 | Ga0207704_10073969 | 3300025938 | Bacteria | 2172 |
| 453 | Ga0207711_10084893 | 3300025941 | Bacteria | 2772 |
| 454 | Ga0207689_10331680 | 3300025942 | Bacteria | 1263 |
| 455 | Ga0207661_10001043 | 3300025944 | Bacteria | 18426 |
| 456 | Ga0207679_10003034 | 3300025945 | Bacteria | 10399 |
| 457 | Ga0207679_10890729 | 3300025945 | Bacteria | 814 |
| 458 | Ga0207667_10000080 | 3300025949 | Bacteria | 163287 |
| 459 | Ga0207667_10001299 | 3300025949 | Bacteria | 31318 |
| 460 | Ga0207667_10002701 | 3300025949 | Bacteria | 21961 |
| 461 | Ga0207667_10005890 | 3300025949 | Bacteria | 14928 |
| 462 | Ga0207667_10018316 | 3300025949 | Bacteria | 7858 |
| 463 | Ga0207667_10026775 | 3300025949 | Bacteria | 6291 |
| 464 | Ga0207667_10063691 | 3300025949 | Bacteria | 3852 |
| 465 | Ga0207667_10168872 | 3300025949 | Bacteria | 2249 |
| 466 | Ga0207712_10255447 | 3300025961 | Bacteria | 1419 |
| 467 | Ga0207668_10008349 | 3300025972 | Bacteria | 6168 |
| 468 | Ga0207668_10174987 | 3300025972 | Bacteria | 1687 |
| 469 | Ga0207640_10000313 | 3300025981 | Bacteria | 32457 |
| 470 | Ga0207640_10000318 | 3300025981 | Bacteria | 32231 |
| 471 | Ga0207640_10000713 | 3300025981 | Bacteria | 19283 |
| 472 | Ga0207640_10009737 | 3300025981 | Bacteria | 5387 |
| 473 | Ga0207640_10233252 | 3300025981 | Bacteria | 1417 |
| 474 | Ga0207640_10274259 | 3300025981 | Bacteria | 1321 |
| 475 | Ga0207658_10059804 | 3300025986 | Bacteria | 2840 |
| 476 | Ga0207658_10080940 | 3300025986 | Bacteria | 2489 |
| 477 | Ga0207658_10558032 | 3300025986 | Bacteria | 1025 |
| 478 | Ga0207703_10000793 | 3300026035 | Bacteria | 31116 |
| 479 | Ga0207703_10095330 | 3300026035 | Bacteria | 2510 |
| 480 | Ga0207703_10220771 | 3300026035 | Bacteria | 1694 |
| 481 | Ga0207639_10000479 | 3300026041 | Bacteria | 27677 |
| 482 | Ga0207639_10000702 | 3300026041 | Bacteria | 22962 |
| 483 | Ga0207639_10001975 | 3300026041 | Bacteria | 13794 |
| 484 | Ga0207639_10002304 | 3300026041 | Bacteria | 12819 |
| 485 | Ga0207639_10004444 | 3300026041 | Bacteria | 9462 |
| 486 | Ga0207639_10136498 | 3300026041 | Bacteria | 2038 |
| 487 | Ga0207639_10177668 | 3300026041 | Bacteria | 1808 |
| 488 | Ga0207639_10831694 | 3300026041 | Bacteria | 861 |
| 489 | Ga0207678_10002305 | 3300026067 | Bacteria | 17276 |
| 490 | Ga0207678_10002600 | 3300026067 | Bacteria | 16445 |
| 491 | Ga0207678_10023163 | 3300026067 | Bacteria | 5432 |
| 492 | Ga0207678_10038001 | 3300026067 | Bacteria | 4186 |
| 493 | Ga0207678_10039061 | 3300026067 | Bacteria | 4121 |
| 494 | Ga0207702_10002690 | 3300026078 | Bacteria | 16687 |
| 495 | Ga0207702_10007325 | 3300026078 | Bacteria | 9424 |
| 496 | Ga0207702_10034514 | 3300026078 | Bacteria | 4229 |
| 497 | Ga0207702_10195191 | 3300026078 | Bacteria | 1873 |
| 498 | Ga0207702_10197794 | 3300026078 | Bacteria | 1861 |
| 499 | Ga0207702_11089372 | 3300026078 | Bacteria | 793 |
| 500 | Ga0207641_10008256 | 3300026088 | Bacteria | 8605 |
| 501 | Ga0207641_10174328 | 3300026088 | Bacteria | 1966 |
| 502 | Ga0207641_11050102 | 3300026088 | Bacteria | 812 |
| 503 | Ga0207648_10056679 | 3300026089 | Bacteria | 3419 |
| 504 | Ga0207674_10000091 | 3300026116 | Bacteria | 99785 |
| 505 | Ga0207674_10004284 | 3300026116 | Bacteria | 17204 |
| 506 | Ga0207674_10015162 | 3300026116 | Bacteria | 8481 |
| 507 | Ga0207674_10067225 | 3300026116 | Bacteria | 3608 |
| 508 | Ga0207674_10248823 | 3300026116 | Bacteria | 1724 |
| 509 | Ga0207674_10678261 | 3300026116 | Bacteria | 995 |
| 510 | Ga0207683_10144341 | 3300026121 | Bacteria | 2146 |
| 511 | Ga0207698_10000056 | 3300026142 | Bacteria | 80605 |
| 512 | Ga0207698_10002003 | 3300026142 | Bacteria | 12007 |
| 513 | Ga0207698_10006507 | 3300026142 | Bacteria | 7296 |
| 514 | Ga0207698_10207331 | 3300026142 | Bacteria | 1760 |
| 515 | Ga0207698_10337917 | 3300026142 | Bacteria | 1417 |
| 516 | Ga0207698_10892241 | 3300026142 | Bacteria | 896 |
| 517 | Ga0209371_1000028 | 3300027312 | Bacteria | 429688 |
| 518 | Ga0209371_1000055 | 3300027312 | Bacteria | 257599 |
| 519 | Ga0268266_10000008 | 3300028379 | Bacteria | 1161875 |
| 520 | Ga0268266_10000075 | 3300028379 | Bacteria | 218045 |
| 521 | Ga0268266_10096618 | 3300028379 | Bacteria | 2597 |
| 522 | Ga0268266_10187785 | 3300028379 | Bacteria | 1886 |
| 523 | Ga0268265_10044018 | 3300028380 | Bacteria | 3322 |
| 524 | Ga0268264_10036823 | 3300028381 | Bacteria | 4032 |
| 525 | Ga0268264_10136173 | 3300028381 | Bacteria | 2184 |
| 526 | Ga0268264_10233901 | 3300028381 | Bacteria | 1698 |
| 527 | Ga0268264_10683465 | 3300028381 | Bacteria | 1018 |
| 528 | Ga0268256_1000030 | 3300030500 | Bacteria | 429688 |
| 529 | Ga0268256_1000054 | 3300030500 | Bacteria | 257599 |
| 530 | Ga0316183_1021347 | 3300030742 | Bacteria | 2127 |
| 531 | Ga0316181_1021237 | 3300030744 | Bacteria | 648 |
| 532 | Ga0307508_10019266 | 3300031616 | Bacteria | 6204 |
| 533 | Ga0307405_10168386 | 3300031731 | Bacteria | 1560 |
| 534 | Ga0307410_10377502 | 3300031852 | Bacteria | 1140 |
| 535 | Ga0307412_10000785 | 3300031911 | Bacteria | 18337 |
| 536 | Ga0307412_10049825 | 3300031911 | Bacteria | 2760 |
| 537 | Ga0307414_10682389 | 3300032004 | Bacteria | 928 |
| 538 | Ga0307510_10106560 | 3300033180 | Bacteria | 2565 |
| 539 | Ga0373923_0071225 | 3300035111 | Bacteria | 1493 |
| 540 | Ga0373936_0188150 | 3300035113 | Bacteria | 908 |
| 541 | Ga0373956_0257176 | 3300035119 | Bacteria | 830 |
| 542 | Ga0373937_0225913 | 3300036401 | Bacteria | 1762 |
| 543 | Ga0395899_0066922 | 3300037312 | Bacteria | 2637 |
| 544 | Ga0395900_0025171 | 3300037418 | Bacteria | 6093 |
| 545 | Ga0395901_0014437 | 3300038443 | Bacteria | 8038 |
| 546 | Ga0237819_00010 | 3300038705 | Bacteria | 65492 |
| 547 | Ga0237819_08767 | 3300038705 | Bacteria | 1385 |
| 548 | Ga0436365_0600206 | 3300039437 | Bacteria | 2172 |
| 549 | Ga0439436_0000029 | 3300041404 | Bacteria | 48668 |
| 550 | Ga0439465_0000540 | 3300041413 | Bacteria | 11344 |
| 551 | Ga0451789_0170969 | 3300041443 | Bacteria | 848 |
| 552 | Ga0451793_0929925 | 3300041452 | Bacteria | 1929 |
| 553 | Ga0451793_1709265 | 3300041452 | Bacteria | 1556 |
| 554 | Ga0451800_1097985 | 3300041459 | Bacteria | 3219 |
| 555 | Ga0451806_068305 | 3300041462 | Bacteria | 3175 |
| 556 | Ga0451804_0990427 | 3300041463 | Bacteria | 2440 |
| 557 | Ga0451807_1980282 | 3300041486 | Bacteria | 3124 |
| 558 | Ga0451839_0761720 | 3300041496 | Bacteria | 914 |
| 559 | Ga0451851_0523967 | 3300041507 | Bacteria | 1614 |
| 560 | Ga0451843_0754940 | 3300041509 | Bacteria | 922 |
| 561 | Ga0439432_021962 | 3300042006 | Bacteria | 2111 |
| 562 | Ga0439449_0027598 | 3300042007 | Bacteria | 2119 |
| 563 | Ga0439449_0034649 | 3300042007 | Bacteria | 1880 |
| 564 | Ga0450908_000009 | 3300042184 | Bacteria | 51894 |
| 565 | Ga0451577_0362394 | 3300042876 | Bacteria | 1315 |
| 566 | Ga0466969_0017514 | 3300044656 | Bacteria | 3738 |
| 567 | Ga0466972_0031717 | 3300044658 | Bacteria | 2597 |
| 568 | Ga0466982_0000007 | 3300044672 | Bacteria | 250854 |
| 569 | Ga0466966_0024524 | 3300044684 | Bacteria | 3944 |
| 570 | Ga0466964_0001643 | 3300044706 | Bacteria | 7724 |
| 571 | Ga0453684_0006590 | 3300044712 | Bacteria | 21964 |
| 572 | Ga0466971_0037384 | 3300044719 | Bacteria | 2175 |
| 573 | Ga0466968_0000774 | 3300044735 | Bacteria | 11100 |
| 574 | Ga0466968_0069988 | 3300044735 | Bacteria | 1525 |
| 575 | Ga0466970_0064485 | 3300044765 | Bacteria | 1964 |
| 576 | Ga0466957_0353535 | 3300044842 | Bacteria | 997 |
| 577 | Ga0466960_0024174 | 3300044901 | Bacteria | 2738 |
| 578 | Ga0451576_0000042 | 3300045051 | Bacteria | 342102 |
| 579 | Ga0495617_000100 | 3300046452 | Bacteria | 62279 |
| 580 | Ga0495617_000592 | 3300046452 | Bacteria | 18455 |
| 581 | Ga0495627_015083 | 3300046453 | Bacteria | 2675 |
| 582 | Ga0495638_0000019 | 3300046460 | Bacteria | 384671 |
| 583 | Ga0495638_0000082 | 3300046460 | Bacteria | 153986 |
| 584 | Ga0495638_0000104 | 3300046460 | Bacteria | 135059 |
| 585 | Ga0495638_0000176 | 3300046460 | Bacteria | 99164 |
| 586 | Ga0495638_0137470 | 3300046460 | Bacteria | 1429 |
| 587 | Ga0495650_0000443 | 3300046471 | Bacteria | 66631 |
| 588 | Ga0495650_0000527 | 3300046471 | Bacteria | 55856 |
| 589 | Ga0495650_0000985 | 3300046471 | Bacteria | 32518 |
| 590 | Ga0495650_0015004 | 3300046471 | Bacteria | 3997 |
| 591 | Ga0495584_0008985 | 3300046491 | Bacteria | 5163 |
| 592 | Ga0495585_0000095 | 3300046492 | Bacteria | 93661 |
| 593 | Ga0495585_0001216 | 3300046492 | Bacteria | 20858 |
| 594 | Ga0495585_0324732 | 3300046492 | Bacteria | 752 |
| 595 | Ga0495607_0000133 | 3300046501 | Bacteria | 78789 |
| 596 | Ga0495607_0000182 | 3300046501 | Bacteria | 67010 |
| 597 | Ga0495607_0005791 | 3300046501 | Bacteria | 8792 |
| 598 | Ga0495607_0042887 | 3300046501 | Bacteria | 2679 |
| 599 | Ga0495583_0013612 | 3300046506 | Bacteria | 4525 |
| 600 | Ga0495606_0000113 | 3300046507 | Bacteria | 136805 |
| 601 | Ga0495606_0000160 | 3300046507 | Bacteria | 118218 |
| 602 | Ga0495606_0028505 | 3300046507 | Bacteria | 3938 |
| 603 | Ga0495606_0187615 | 3300046507 | Bacteria | 1187 |
| 604 | Ga0495610_0001348 | 3300046512 | Bacteria | 21781 |
| 605 | Ga0495610_0006465 | 3300046512 | Bacteria | 8055 |
| 606 | Ga0495616_0000006 | 3300046513 | Bacteria | 234766 |
| 607 | Ga0495616_0018953 | 3300046513 | Bacteria | 3762 |
| 608 | Ga0495620_0001091 | 3300046515 | Bacteria | 16573 |
| 609 | Ga0495620_0016941 | 3300046515 | Bacteria | 3643 |
| 610 | Ga0495631_0000683 | 3300046518 | Bacteria | 21924 |
| 611 | Ga0495631_0001042 | 3300046518 | Bacteria | 17183 |
| 612 | Ga0495631_0001175 | 3300046518 | Bacteria | 16180 |
| 613 | Ga0495632_0000010 | 3300046519 | Bacteria | 272360 |
| 614 | Ga0495632_0004263 | 3300046519 | Bacteria | 9760 |
| 615 | Ga0495632_0072216 | 3300046519 | Bacteria | 1656 |
| 616 | Ga0495632_0141787 | 3300046519 | Bacteria | 1114 |
| 617 | Ga0495637_0005951 | 3300046520 | Bacteria | 6168 |
| 618 | Ga0495643_0035985 | 3300046522 | Bacteria | 2722 |
| 619 | Ga0495648_0001434 | 3300046524 | Bacteria | 23344 |
| 620 | Ga0495648_0002102 | 3300046524 | Bacteria | 18781 |
| 621 | Ga0495586_0062663 | 3300046535 | Bacteria | 2025 |
| 622 | Ga0495609_0002164 | 3300046538 | Bacteria | 12349 |
| 623 | Ga0495645_0354250 | 3300046543 | Bacteria | 945 |
| 624 | Ga0495622_0004252 | 3300046557 | Bacteria | 6669 |
| 625 | Ga0495633_0004565 | 3300046558 | Bacteria | 8738 |
| 626 | Ga0495633_0008257 | 3300046558 | Bacteria | 5891 |
| 627 | Ga0495668_0005320 | 3300046616 | Bacteria | 8791 |
| 628 | Ga0495611_0000003 | 3300046648 | Bacteria | 395679 |
| 629 | Ga0495611_0000028 | 3300046648 | Bacteria | 116155 |
| 630 | Ga0495625_0000193 | 3300046660 | Bacteria | 97042 |
| 631 | Ga0495625_0011967 | 3300046660 | Bacteria | 7043 |
| 632 | Ga0495625_0015081 | 3300046660 | Bacteria | 6135 |
| 633 | Ga0495625_0023101 | 3300046660 | Bacteria | 4755 |
| 634 | Ga0495661_0000911 | 3300046665 | Bacteria | 27128 |
| 635 | Ga0495658_0067432 | 3300046683 | Bacteria | 2069 |
| 636 | Ga0495670_0002135 | 3300046691 | Bacteria | 9774 |
| 637 | Ga0495670_0002542 | 3300046691 | Bacteria | 9011 |
| 638 | Ga0495670_0116220 | 3300046691 | Bacteria | 1387 |
| 639 | Ga0495671_0012816 | 3300046692 | Bacteria | 4564 |
| 640 | Ga0495649_0004395 | 3300046694 | Bacteria | 9218 |
| 641 | Ga0495649_0027192 | 3300046694 | Bacteria | 3175 |
| 642 | Ga0495589_0000042 | 3300046794 | Bacteria | 138627 |
| 643 | Ga0495660_0000165 | 3300046810 | Bacteria | 71308 |
| 644 | Ga0495660_0000193 | 3300046810 | Bacteria | 64080 |
| 645 | Ga0495660_0074410 | 3300046810 | Bacteria | 1794 |
| 646 | Ga0495672_0000564 | 3300047320 | Bacteria | 41848 |
| 647 | Ga0495672_0068553 | 3300047320 | Bacteria | 2016 |
| 648 | Ga0495683_0000148 | 3300047323 | Bacteria | 68795 |
| 649 | Ga0495679_000046 | 3300047446 | Bacteria | 132566 |
| 650 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 651 | Ga0495673_0000041 | 3300047469 | Bacteria | 296723 |
| 652 | Ga0495673_0004946 | 3300047469 | Bacteria | 8203 |
| 653 | Ga0495686_0000117 | 3300047472 | Bacteria | 166073 |
| 654 | Ga0495686_0000807 | 3300047472 | Bacteria | 40575 |
| 655 | Ga0495686_0012990 | 3300047472 | Bacteria | 5802 |
| 656 | Ga0495686_0020948 | 3300047472 | Bacteria | 4353 |
| 657 | Ga0495686_0022756 | 3300047472 | Bacteria | 4142 |
| 658 | Ga0495686_0031743 | 3300047472 | Bacteria | 3421 |
| 659 | Ga0495686_0054340 | 3300047472 | Bacteria | 2507 |
| 660 | Ga0495602_0582971 | 3300048088 | Bacteria | 771 |
| 661 | Ga0496101_0025211 | 3300048904 | Bacteria | 4123 |
| 662 | Ga0496103_0126380 | 3300048906 | Bacteria | 1631 |
| 663 | Ga0496104_0000365 | 3300048907 | Bacteria | 40128 |
| 664 | Ga0496104_0075712 | 3300048907 | Bacteria | 3205 |
| 665 | Ga0496105_0000048 | 3300048908 | Bacteria | 96832 |
| 666 | Ga0496106_0000680 | 3300048909 | Bacteria | 24345 |
| 667 | Ga0496106_0055159 | 3300048909 | Bacteria | 3003 |
| 668 | Ga0496113_0005765 | 3300048916 | Bacteria | 7763 |
| 669 | Ga0496114_0388354 | 3300048917 | Bacteria | 1236 |
| 670 | Ga0496115_0000114 | 3300048918 | Bacteria | 73307 |
| 671 | Ga0496115_0000487 | 3300048918 | Bacteria | 31378 |
| 672 | Ga0496115_0001663 | 3300048918 | Bacteria | 15992 |
| 673 | Ga0496115_0062612 | 3300048918 | Bacteria | 3001 |
| 674 | Ga0496115_0638972 | 3300048918 | Bacteria | 842 |
| 675 | Ga0496116_0002825 | 3300048919 | Bacteria | 17815 |
| 676 | Ga0496116_0104941 | 3300048919 | Bacteria | 1677 |
| 677 | Ga0496116_0149206 | 3300048919 | Bacteria | 1302 |
| 678 | Ga0496117_0002569 | 3300048920 | Bacteria | 22600 |
| 679 | Ga0496117_0003786 | 3300048920 | Bacteria | 17270 |
| 680 | Ga0496117_0005542 | 3300048920 | Bacteria | 13213 |
| 681 | Ga0496117_0014387 | 3300048920 | Bacteria | 6821 |
| 682 | Ga0496117_0070657 | 3300048920 | Bacteria | 2343 |
| 683 | Ga0496117_0072040 | 3300048920 | Bacteria | 2313 |
| 684 | Ga0496117_0109417 | 3300048920 | Bacteria | 1725 |
| 685 | Ga0496117_0336090 | 3300048920 | Bacteria | 785 |
| 686 | Ga0496118_0002703 | 3300048921 | Bacteria | 23369 |
| 687 | Ga0496118_0007099 | 3300048921 | Bacteria | 12022 |
| 688 | Ga0496118_0007291 | 3300048921 | Bacteria | 11772 |
| 689 | Ga0496118_0008786 | 3300048921 | Bacteria | 10360 |
| 690 | Ga0496118_0025437 | 3300048921 | Bacteria | 5076 |
| 691 | Ga0496118_0062279 | 3300048921 | Bacteria | 2755 |
| 692 | Ga0496118_0113851 | 3300048921 | Bacteria | 1785 |
| 693 | Ga0496118_0226165 | 3300048921 | Bacteria | 1084 |
| 694 | Ga0496119_0002512 | 3300048922 | Bacteria | 20037 |
| 695 | Ga0496119_0026178 | 3300048922 | Bacteria | 4051 |
| 696 | Ga0496119_0051029 | 3300048922 | Bacteria | 2545 |
| 697 | Ga0496120_0000988 | 3300048923 | Bacteria | 38579 |
| 698 | Ga0496120_0036381 | 3300048923 | Bacteria | 2931 |
| 699 | Ga0496121_0000251 | 3300048924 | Bacteria | 113931 |
| 700 | Ga0496121_0001805 | 3300048924 | Bacteria | 34588 |
| 701 | Ga0496121_0002210 | 3300048924 | Bacteria | 30380 |
| 702 | Ga0496121_0007673 | 3300048924 | Bacteria | 12959 |
| 703 | Ga0496121_0036416 | 3300048924 | Bacteria | 4385 |
| 704 | Ga0496121_0060106 | 3300048924 | Bacteria | 3128 |
| 705 | Ga0496121_0244370 | 3300048924 | Bacteria | 1248 |
| 706 | Ga0496122_0003606 | 3300048925 | Bacteria | 20169 |
| 707 | Ga0496122_0017822 | 3300048925 | Bacteria | 6604 |
| 708 | Ga0496122_0018410 | 3300048925 | Bacteria | 6455 |
| 709 | Ga0496122_0065031 | 3300048925 | Bacteria | 2648 |
| 710 | Ga0496122_0100725 | 3300048925 | Bacteria | 1932 |
| 711 | Ga0496122_0108683 | 3300048925 | Bacteria | 1828 |
| 712 | Ga0496122_0188124 | 3300048925 | Bacteria | 1222 |
| 713 | Ga0496123_0000417 | 3300048926 | Bacteria | 77334 |
| 714 | Ga0496123_0011389 | 3300048926 | Bacteria | 7713 |
| 715 | Ga0496123_0011561 | 3300048926 | Bacteria | 7636 |
| 716 | Ga0496123_0014546 | 3300048926 | Bacteria | 6513 |
| 717 | Ga0496123_0045007 | 3300048926 | Bacteria | 3011 |
| 718 | Ga0496123_0061949 | 3300048926 | Bacteria | 2400 |
| 719 | Ga0496123_0128003 | 3300048926 | Bacteria | 1413 |
| 720 | Ga0496123_0200423 | 3300048926 | Bacteria | 1023 |
| 721 | Ga0496124_0000866 | 3300048927 | Bacteria | 49473 |
| 722 | Ga0496124_0002325 | 3300048927 | Bacteria | 25085 |
| 723 | Ga0496124_0004662 | 3300048927 | Bacteria | 15858 |
| 724 | Ga0496124_0004701 | 3300048927 | Bacteria | 15761 |
| 725 | Ga0496124_0010018 | 3300048927 | Bacteria | 9672 |
| 726 | Ga0496124_0012323 | 3300048927 | Bacteria | 8444 |
| 727 | Ga0496124_0030890 | 3300048927 | Bacteria | 4746 |
| 728 | Ga0496124_0031804 | 3300048927 | Bacteria | 4666 |
| 729 | Ga0496124_0082741 | 3300048927 | Bacteria | 2634 |
| 730 | Ga0496125_0000590 | 3300048928 | Bacteria | 61941 |
| 731 | Ga0496125_0011413 | 3300048928 | Bacteria | 8887 |
| 732 | Ga0496125_0023735 | 3300048928 | Bacteria | 5655 |
| 733 | Ga0496125_0053628 | 3300048928 | Bacteria | 3303 |
| 734 | Ga0496125_0084041 | 3300048928 | Bacteria | 2419 |
| 735 | Ga0496125_0335283 | 3300048928 | Bacteria | 910 |
| 736 | Ga0496126_0000553 | 3300048929 | Bacteria | 72027 |
| 737 | Ga0496126_0040099 | 3300048929 | Bacteria | 4342 |
| 738 | Ga0496126_0051498 | 3300048929 | Bacteria | 3748 |
| 739 | Ga0496126_0054164 | 3300048929 | Bacteria | 3635 |
| 740 | Ga0496126_0065888 | 3300048929 | Bacteria | 3239 |
| 741 | Ga0496126_0097437 | 3300048929 | Bacteria | 2577 |
| 742 | Ga0496126_0286066 | 3300048929 | Bacteria | 1364 |
| 743 | Ga0496126_0331753 | 3300048929 | Bacteria | 1248 |
| 744 | Ga0495678_000261 | 3300049459 | Bacteria | 58678 |
| 745 | Ga0495678_049037 | 3300049459 | Bacteria | 1643 |
| 746 | Ga0495682_0011122 | 3300049460 | Bacteria | 3467 |
| 747 | Ga0501032_0035393 | 3300049569 | Bacteria | 3414 |
| 748 | Ga0501032_0155452 | 3300049569 | Bacteria | 1503 |
| 749 | Ga0501032_0212858 | 3300049569 | Bacteria | 1259 |
| 750 | Ga0501033_0046293 | 3300049570 | Bacteria | 3234 |
| 751 | Ga0501034_0001222 | 3300049571 | Bacteria | 35142 |
| 752 | Ga0501034_0001438 | 3300049571 | Bacteria | 31673 |
| 753 | Ga0501034_0075699 | 3300049571 | Bacteria | 3372 |
| 754 | Ga0501034_0296891 | 3300049571 | Bacteria | 1553 |
| 755 | Ga0501034_0711343 | 3300049571 | Bacteria | 902 |
| 756 | Ga0501036_0070279 | 3300049572 | Bacteria | 2960 |
| 757 | Ga0501037_0094182 | 3300049573 | Bacteria | 2166 |
| 758 | Ga0501037_0277160 | 3300049573 | Bacteria | 1169 |
| 759 | Ga0501038_0012654 | 3300049574 | Bacteria | 7712 |
| 760 | Ga0501038_0122708 | 3300049574 | Bacteria | 2141 |
| 761 | Ga0501038_0489850 | 3300049574 | Bacteria | 941 |
| 762 | Ga0501039_0094206 | 3300049575 | Bacteria | 2334 |
| 763 | Ga0501043_0004602 | 3300049579 | Bacteria | 11191 |
| 764 | Ga0501043_0063660 | 3300049579 | Bacteria | 2896 |
| 765 | Ga0501043_0066949 | 3300049579 | Bacteria | 2821 |
| 766 | Ga0501043_0111266 | 3300049579 | Bacteria | 2150 |
| 767 | Ga0501046_0027284 | 3300049580 | Bacteria | 4661 |
| 768 | Ga0501046_0289114 | 3300049580 | Bacteria | 1199 |
| 769 | Ga0501047_0000238 | 3300049581 | Bacteria | 65182 |
| 770 | Ga0501047_0008893 | 3300049581 | Bacteria | 9478 |
| 771 | Ga0501047_0052406 | 3300049581 | Bacteria | 3944 |
| 772 | Ga0501047_0080365 | 3300049581 | Bacteria | 3133 |
| 773 | Ga0501047_0089332 | 3300049581 | Bacteria | 2958 |
| 774 | Ga0501047_0202192 | 3300049581 | Bacteria | 1847 |
| 775 | Ga0501047_0300342 | 3300049581 | Bacteria | 1448 |
| 776 | Ga0501048_0082463 | 3300049582 | Bacteria | 2268 |
| 777 | Ga0501048_0881197 | 3300049582 | Bacteria | 643 |
| 778 | Ga0501067_0000055 | 3300049583 | Bacteria | 66700 |
| 779 | Ga0501067_0193602 | 3300049583 | Bacteria | 1133 |
| 780 | Ga0501068_0002629 | 3300049584 | Bacteria | 9514 |
| 781 | Ga0501069_0003118 | 3300049585 | Bacteria | 8496 |
| 782 | Ga0501069_0023477 | 3300049585 | Bacteria | 3363 |
| 783 | Ga0501070_0003358 | 3300049586 | Bacteria | 13883 |
| 784 | Ga0501070_0004834 | 3300049586 | Bacteria | 11512 |
| 785 | Ga0501070_0005863 | 3300049586 | Bacteria | 10473 |
| 786 | Ga0501070_0031475 | 3300049586 | Bacteria | 4445 |
| 787 | Ga0501070_0043594 | 3300049586 | Bacteria | 3733 |
| 788 | Ga0501070_0056010 | 3300049586 | Bacteria | 3268 |
| 789 | Ga0501070_0081937 | 3300049586 | Bacteria | 2670 |
| 790 | Ga0501070_0192834 | 3300049586 | Bacteria | 1674 |
| 791 | Ga0501070_0356934 | 3300049586 | Bacteria | 1186 |
| 792 | Ga0501070_0496694 | 3300049586 | Bacteria | 980 |
| 793 | Ga0501072_0012242 | 3300049588 | Bacteria | 6555 |
| 794 | Ga0501073_0000072 | 3300049589 | Bacteria | 62953 |
| 795 | Ga0501073_0270083 | 3300049589 | Bacteria | 1173 |
| 796 | Ga0501074_0003527 | 3300049590 | Bacteria | 11099 |
| 797 | Ga0501074_0082953 | 3300049590 | Bacteria | 2298 |
| 798 | Ga0501077_0029250 | 3300049593 | Bacteria | 3503 |
| 799 | Ga0501079_0026009 | 3300049741 | Bacteria | 4488 |
| 800 | Ga0501079_0090392 | 3300049741 | Bacteria | 2372 |
| 801 | Ga0501079_0497442 | 3300049741 | Bacteria | 958 |
| 802 | Ga0501080_0000097 | 3300049742 | Bacteria | 59356 |
| 803 | Ga0501080_0001262 | 3300049742 | Bacteria | 21046 |
| 804 | Ga0501080_0034314 | 3300049742 | Bacteria | 4735 |
| 805 | Ga0501080_0043760 | 3300049742 | Bacteria | 4169 |
| 806 | Ga0501080_0063683 | 3300049742 | Bacteria | 3431 |
| 807 | Ga0501080_0307674 | 3300049742 | Bacteria | 1436 |
| 808 | Ga0501080_0900314 | 3300049742 | Bacteria | 771 |
| 809 | Ga0501083_0000128 | 3300049744 | Bacteria | 51820 |
| 810 | Ga0501035_0006662 | 3300049822 | Bacteria | 10798 |
| 811 | Ga0501035_0081313 | 3300049822 | Bacteria | 2859 |
| 812 | Ga0501035_0100707 | 3300049822 | Bacteria | 2536 |
| 813 | Ga0501035_0618591 | 3300049822 | Bacteria | 881 |
| 814 | Ga0501035_0813817 | 3300049822 | Bacteria | 745 |
| 815 | Ga0501044_0005861 | 3300049823 | Bacteria | 13610 |
| 816 | Ga0501044_0006633 | 3300049823 | Bacteria | 12763 |
| 817 | Ga0501044_0014080 | 3300049823 | Bacteria | 8637 |
| 818 | Ga0501044_0047146 | 3300049823 | Bacteria | 4458 |
| 819 | Ga0501044_0284873 | 3300049823 | Bacteria | 1585 |
| 820 | Ga0501044_0317883 | 3300049823 | Bacteria | 1482 |
| 821 | nmdc:mga00v17_105745_c1 | 3300050491 | Bacteria | 1781 |
| 822 | nmdc:mga00v17_582_c2 | 3300050491 | Bacteria | 10150 |
| 823 | nmdc:mga06z11_142482_c1 | 3300050494 | Bacteria | 1356 |
| 824 | nmdc:mga0sz30_72482_c1 | 3300050516 | Bacteria | 1484 |
| 825 | Ga0500643_000036 | 3300053087 | Bacteria | 183253 |
| 826 | Ga0500646_0021800 | 3300053090 | Bacteria | 1709 |
| 827 | Ga0500555_000110 | 3300053103 | Bacteria | 38639 |
| 828 | Ga0500634_0000178 | 3300053161 | Bacteria | 21040 |
| 829 | Ga0500645_001177 | 3300053730 | Bacteria | 13958 |
| 830 | Ga0501084_1148177 | 3300054114 | Bacteria | 652 |
| 831 | Ga0466962_0001663 | 3300061719 | Bacteria | 10427 |
| 832 | 2572254494 | 2571042365 | Bacteria | 3289345 |
| 833 | 2595447897 | 2593339238 | Bacteria | 4182970 |
| 834 | 2643915149 | 2643221581 | Bacteria | 3893603 |
| 835 | 2644528369 | 2643221695 | Bacteria | 3441323 |
| 836 | 2687582041 | 2687453130 | Bacteria | 4227172 |
| 837 | 2721026033 | 2718218334 | Bacteria | 4765486 |
| 838 | 2735833999 | 2734482264 | Unclassified | 5014763 |
| 839 | 2739225408 | 2738543009 | Bacteria | 4944499 |
| 840 | 2739732404 | 2739367700 | Bacteria | 4747630 |
| 841 | 2747951165 | 2747842428 | Bacteria | 4689383 |
| 842 | 2816519485 | 2816332141 | Bacteria | 4436036 |
| 843 | 2819662696 | 2818991457 | Bacteria | 5323295 |
| 844 | 2842395643 | 2842391507 | Bacteria | 4486072 |
| 845 | 2842759669 | 2842757796 | Bacteria | 3981385 |
| 846 | 2842917746 | 2842914999 | Bacteria | 4419378 |
| 847 | 2842922092 | 2842918807 | Bacteria | 4289178 |
| 848 | 2852687563 | 2852684882 | Bacteria | 5463342 |
| 849 | 2874224568 | 2874220319 | Bacteria | 4594709 |
| 850 | 2884341987 | 2884338543 | Bacteria | 4610696 |
| 851 | 2884411633 | 2884411467 | Bacteria | 5246714 |
| 852 | 2919087268 | 2919085039 | Bacteria | 4532964 |
| 853 | 2919091582 | 2919089067 | Bacteria | 4560942 |
| 854 | 2919134254 | 2919130084 | Bacteria | 5301837 |
| 855 | 2919135008 | 2919134579 | Bacteria | 4480386 |
| 856 | 2919408197 | 2919404418 | Bacteria | 4232372 |
| 857 | 2923519311 | 2923516293 | Bacteria | 3716336 |
| 858 | 2928498913 | 2928496128 | Bacteria | 4631123 |
| 859 | 2928965082 | 2928963466 | Bacteria | 5165703 |
| 860 | 2929199000 | 2929195423 | Bacteria | 5325372 |
| 861 | 2931382031 | 2931380184 | Bacteria | 4455911 |
| 862 | 2937611209 | 2937610967 | Bacteria | 4618818 |
| 863 | 2939592601 | 2939589442 | Bacteria | 4214238 |
| 864 | 2939630148 | 2939626828 | Bacteria | 4695272 |
| 865 | 2941473990 | 2941471342 | Bacteria | 5018624 |
| 866 | 2953997202 | 2953994433 | Bacteria | 4303959 |
| 867 | 2961051332 | 2961047084 | Bacteria | 4594415 |
| 868 | 2961066414 | 2961064222 | Bacteria | 4749990 |
| 869 | 2974310043 | 2974307012 | Bacteria | 4172388 |
| 870 | 2977250777 | 2977247770 | Bacteria | 4160543 |
| 871 | 2984514737 | 2984514374 | Bacteria | 4172479 |
| 872 | 8021628188 | 8021626552 | Bacteria | 4665214 |
| 873 | 8021651400 | 8021648035 | Bacteria | 4772378 |
| 874 | Ga0070666_10017949 | |||
| 875 | SwRhRL2b_contig_437430 | |||
| 876 | JGI24741J21665_1001083 | |||
| 877 | JGI24741J21665_1001160 | |||
| 878 | JGI24741J21665_1019418 | |||
| 879 | JGI24740J21852_10000202 | |||
| 880 | JGI24739J22299_10000106 | |||
| 881 | JGI24739J22299_10009578 | |||
| 882 | JGI24737J22298_10003313 | |||
| 883 | JGI24737J22298_10012599 | |||
| 884 | JGI24738J21930_10000629 | |||
| 885 | JGI24744J21845_10011202 | |||
| 886 | JGI25156J39149_1004204 | |||
| 887 | JGI25156J39149_1004457 | |||
| 888 | JGI25162J39368_1000189 | |||
| 889 | JGI25162J39368_1001211 | |||
| 890 | JGI25154J39366_1005767 | |||
| 891 | JGI25154J39366_1007499 | |||
| 892 | JGI25157J39369_1000343 | |||
| 893 | JGI25157J39369_1001906 | |||
| 894 | JGI25163J39215_1000482 | |||
| 895 | JGI25164J39214_1000093 | |||
| 896 | JGI25164J39214_1007042 | |||
| 897 | JGI25152J39213_1000100 | |||
| 898 | JGI25152J39213_1021261 | |||
| 899 | JGI25150J39212_1001361 | |||
| 900 | JGI25151J46595_10000286 | |||
| 901 | JGI25406J46586_10043374 | |||
| 902 | JGI25165J46597_1000283 | |||
| 903 | JGI25153J46596_10000185 | |||
| 904 | rootH1_10026426 | |||
| 905 | rootH2_10067014 | |||
| 906 | rootH1_10095898 | |||
| 907 | Ga0006562J51391_1006439 | |||
| 908 | Ga0006562J51391_1006443 | |||
| 909 | Ga0006562J51391_1010698 | |||
| 910 | Ga0006562J51391_1010700 | |||
| 911 | Ga0055533_1000863 | |||
| 912 | Ga0055535_1000070 | |||
| 913 | Ga0055535_1000152 | |||
| 914 | Ga0055542_1000232 | |||
| 915 | Ga0055542_1000606 | |||
| 916 | Ga0055529_1000024 | |||
| 917 | Ga0055529_1000082 | |||
| 918 | Ga0055537_1001012 | |||
| 919 | Ga0055524_1016880 | |||
| 920 | Ga0055536_1002151 | |||
| 921 | Ga0055536_1002439 | |||
| 922 | Ga0055534_1000665 | |||
| 923 | Ga0055528_1000354 | |||
| 924 | Ga0055530_10001405 | |||
| 925 | Ga0055530_10002266 | |||
| 926 | Ga0055531_10004756 | |||
| 927 | Ga0055531_10004760 | |||
| 928 | Ga0055531_10017670 | |||
| 929 | Ga0055531_10026916 | |||
| 930 | Ga0058692_1000032 | |||
| 931 | Ga0058692_1000107 | |||
| 932 | Ga0065165_1003415 | |||
| 933 | Ga0065704_10086549 | |||
| 934 | Ga0070658_10010741 | |||
| 935 | Ga0070658_10548958 | |||
| 936 | Ga0070658_10964599 | |||
| 937 | Ga0070670_100005468 | |||
| 938 | Ga0070670_100151637 | |||
| 939 | Ga0070666_10000037 | |||
| 940 | Ga0070666_10000113 | |||
| 941 | Ga0070666_10364491 | |||
| 942 | Ga0070680_100005860 | |||
| 943 | Ga0070680_100836145 | |||
| 944 | Ga0070682_100004836 | |||
| 945 | Ga0068868_100209877 | |||
| 946 | Ga0070660_100444267 | |||
| 947 | Ga0070689_100110565 | |||
| 948 | Ga0070691_10001898 | |||
| 949 | Ga0070691_10022492 | |||
| 950 | Ga0070661_100008749 | |||
| 951 | Ga0070661_100008845 | |||
| 952 | Ga0070661_100029838 | |||
| 953 | Ga0070661_100251997 | |||
| 954 | Ga0070661_100577904 | |||
| 955 | Ga0070692_10002113 | |||
| 956 | Ga0070692_10007608 | |||
| 957 | Ga0070668_100048978 | |||
| 958 | Ga0070668_100191937 | |||
| 959 | Ga0070659_100221998 | |||
| 960 | Ga0070667_100011381 | |||
| 961 | Ga0070667_100307227 | |||
| 962 | Ga0070663_100029834 | |||
| 963 | Ga0070663_100030244 | |||
| 964 | Ga0070663_100039060 | |||
| 965 | Ga0070663_100157631 | |||
| 966 | Ga0070663_100166556 | |||
| 967 | Ga0070663_100310810 | |||
| 968 | Ga0070663_100556927 | |||
| 969 | Ga0070678_100035902 | |||
| 970 | Ga0070662_100007404 | |||
| 971 | Ga0070662_100023092 | |||
| 972 | Ga0070662_100276898 | |||
| 973 | Ga0070662_100453922 | |||
| 974 | Ga0068867_100218406 | |||
| 975 | Ga0070685_10034140 | |||
| 976 | Ga0070684_100034303 | |||
| 977 | Ga0068853_100020190 | |||
| 978 | Ga0068853_100037221 | |||
| 979 | Ga0068853_100037482 | |||
| 980 | Ga0068853_100490069 | |||
| 981 | Ga0068853_100510672 | |||
| 982 | Ga0070696_100026308 | |||
| 983 | Ga0070696_100108501 | |||
| 984 | Ga0070693_100057268 | |||
| 985 | Ga0070693_100102935 | |||
| 986 | Ga0070665_100001464 | |||
| 987 | Ga0070665_100017618 | |||
| 988 | Ga0070665_100055875 | |||
| 989 | Ga0070665_100066955 | |||
| 990 | Ga0068855_100014993 | |||
| 991 | Ga0068855_100025540 | |||
| 992 | Ga0068855_100137820 | |||
| 993 | Ga0068855_100147646 | |||
| 994 | Ga0068855_100214274 | |||
| 995 | Ga0068855_100649128 | |||
| 996 | Ga0068855_101050884 | |||
| 997 | Ga0070664_100037277 | |||
| 998 | Ga0068857_100050914 | |||
| 999 | Ga0068857_100065226 | |||
| 1000 | Ga0068857_100066638 | |||
| 1001 | Ga0068857_100476578 | |||
| 1002 | Ga0068857_100535088 | |||
| 1003 | Ga0068857_100563357 | |||
| 1004 | Ga0068854_100000327 | |||
| 1005 | Ga0068854_100017753 | |||
| 1006 | Ga0068854_100032577 | |||
| 1007 | Ga0068854_100042596 | |||
| 1008 | Ga0068854_100053732 | |||
| 1009 | Ga0068854_100069788 | |||
| 1010 | Ga0068856_100000465 | |||
| 1011 | Ga0068856_100015047 | |||
| 1012 | Ga0068856_100062516 | |||
| 1013 | Ga0068856_100210733 | |||
| 1014 | Ga0068856_101251107 | |||
| 1015 | Ga0068852_100005072 | |||
| 1016 | Ga0068852_100009214 | |||
| 1017 | Ga0068852_100021345 | |||
| 1018 | Ga0068852_100040858 | |||
| 1019 | Ga0068852_100082600 | |||
| 1020 | Ga0068852_100271558 | |||
| 1021 | Ga0068852_100974690 | |||
| 1022 | Ga0068851_10004227 | |||
| 1023 | Ga0068851_10111674 | |||
| 1024 | Ga0068863_100010577 | |||
| 1025 | Ga0068863_100302374 | |||
| 1026 | Ga0068863_100803708 | |||
| 1027 | Ga0068858_100001617 | |||
| 1028 | Ga0068858_100078878 | |||
| 1029 | Ga0068858_100156022 | |||
| 1030 | Ga0068858_100175553 | |||
| 1031 | Ga0068858_100762189 | |||
| 1032 | Ga0068860_100016312 | |||
| 1033 | Ga0068860_100021300 | |||
| 1034 | Ga0068860_100028649 | |||
| 1035 | Ga0068860_100088614 | |||
| 1036 | Ga0068860_100088656 | |||
| 1037 | Ga0068862_100134261 | |||
| 1038 | Ga0068862_100715261 | |||
| 1039 | Ga0081539_10102567 | |||
| 1040 | Ga0075364_10071742 | |||
| 1041 | Ga0075364_10103757 | |||
| 1042 | Ga0075367_10021354 | |||
| 1043 | Ga0075369_10041635 | |||
| 1044 | Ga0075369_10078466 | |||
| 1045 | Ga0097621_100034951 | |||
| 1046 | Ga0097621_100797273 | |||
| 1047 | Ga0068871_100209860 | |||
| 1048 | Ga0068865_100001874 | |||
| 1049 | Ga0105251_10001430 | |||
| 1050 | Ga0105251_10006046 | |||
| 1051 | Ga0105240_10002550 | |||
| 1052 | Ga0105240_10031555 | |||
| 1053 | Ga0105240_10068928 | |||
| 1054 | Ga0105240_10088182 | |||
| 1055 | Ga0105240_10120708 | |||
| 1056 | Ga0105240_10132563 | |||
| 1057 | Ga0105240_10172895 | |||
| 1058 | Ga0105240_10231302 | |||
| 1059 | Ga0105240_10241267 | |||
| 1060 | Ga0105245_10038052 | |||
| 1061 | Ga0105247_10000850 | |||
| 1062 | Ga0105243_10003698 | |||
| 1063 | Ga0105243_10192227 | |||
| 1064 | Ga0105241_10003077 | |||
| 1065 | Ga0105241_10016891 | |||
| 1066 | Ga0105241_10216749 | |||
| 1067 | Ga0105241_10235485 | |||
| 1068 | Ga0105241_10306209 | |||
| 1069 | Ga0105242_10007774 | |||
| 1070 | Ga0105242_10167833 | |||
| 1071 | Ga0105248_10106625 | |||
| 1072 | Ga0105248_10166189 | |||
| 1073 | Ga0105248_10253635 | |||
| 1074 | Ga0105237_10000145 | |||
| 1075 | Ga0105237_10000351 | |||
| 1076 | Ga0105237_10002004 | |||
| 1077 | Ga0105237_10021391 | |||
| 1078 | Ga0105237_10626920 | |||
| 1079 | Ga0105238_10000154 | |||
| 1080 | Ga0105238_10001816 | |||
| 1081 | Ga0105238_10003169 | |||
| 1082 | Ga0105238_10003482 | |||
| 1083 | Ga0105238_10004755 | |||
| 1084 | Ga0105238_10014221 | |||
| 1085 | Ga0105238_10098946 | |||
| 1086 | Ga0105238_10115874 | |||
| 1087 | Ga0105238_10240295 | |||
| 1088 | Ga0105249_10016822 | |||
| 1089 | Ga0105249_11158488 | |||
| 1090 | Ga0105147_114136 | |||
| 1091 | Ga0105239_10008021 | |||
| 1092 | Ga0105239_10009128 | |||
| 1093 | Ga0105239_10010310 | |||
| 1094 | Ga0105239_10010456 | |||
| 1095 | Ga0105239_10055563 | |||
| 1096 | Ga0105239_10098555 | |||
| 1097 | Ga0105239_10128279 | |||
| 1098 | Ga0105246_10111959 | |||
| 1099 | Ga0157314_1000050 | |||
| 1100 | Ga0157373_10026468 | |||
| 1101 | Ga0157373_10028498 | |||
| 1102 | Ga0157373_10143012 | |||
| 1103 | Ga0157373_10236918 | |||
| 1104 | Ga0157373_10686945 | |||
| 1105 | Ga0157371_10052237 | |||
| 1106 | Ga0157371_10093649 | |||
| 1107 | Ga0157371_10311578 | |||
| 1108 | Ga0157370_10002475 | |||
| 1109 | Ga0157370_10002903 | |||
| 1110 | Ga0157370_10020888 | |||
| 1111 | Ga0157370_10025503 | |||
| 1112 | Ga0157370_10051703 | |||
| 1113 | Ga0157370_10131718 | |||
| 1114 | Ga0157370_10198283 | |||
| 1115 | Ga0157370_10225923 | |||
| 1116 | Ga0157370_10750810 | |||
| 1117 | Ga0157369_10000030 | |||
| 1118 | Ga0157369_10001038 | |||
| 1119 | Ga0157369_10004259 | |||
| 1120 | Ga0157369_10021621 | |||
| 1121 | Ga0157369_10049276 | |||
| 1122 | Ga0157369_10069025 | |||
| 1123 | Ga0157369_10121709 | |||
| 1124 | Ga0157369_10171067 | |||
| 1125 | Ga0157369_10377154 | |||
| 1126 | Ga0157374_10005891 | |||
| 1127 | Ga0157374_10047351 | |||
| 1128 | Ga0157374_10422732 | |||
| 1129 | Ga0157378_10015806 | |||
| 1130 | Ga0163162_10000739 | |||
| 1131 | Ga0163162_10001975 | |||
| 1132 | Ga0163162_10108673 | |||
| 1133 | Ga0163162_10160052 | |||
| 1134 | Ga0157372_10001632 | |||
| 1135 | Ga0157372_10015710 | |||
| 1136 | Ga0157372_10174703 | |||
| 1137 | Ga0157372_10184716 | |||
| 1138 | Ga0157372_10224411 | |||
| 1139 | Ga0157372_10258002 | |||
| 1140 | Ga0157372_10773255 | |||
| 1141 | Ga0157372_11136813 | |||
| 1142 | Ga0163163_10000143 | |||
| 1143 | Ga0163163_10227563 | |||
| 1144 | Ga0182008_10003207 | |||
| 1145 | Ga0182008_10004013 | |||
| 1146 | Ga0182008_10006474 | |||
| 1147 | Ga0182008_10043509 | |||
| 1148 | Ga0157379_10005653 | |||
| 1149 | Ga0157376_10004843 | |||
| 1150 | Ga0157376_10018257 | |||
| 1151 | Ga0157376_10032656 | |||
| 1152 | Ga0182006_1000031 | |||
| 1153 | Ga0182006_1000362 | |||
| 1154 | Ga0182006_1009502 | |||
| 1155 | Ga0182006_1012885 | |||
| 1156 | Ga0182006_1013105 | |||
| 1157 | Ga0182007_10002222 | |||
| 1158 | Ga0182005_1000049 | |||
| 1159 | Ga0182005_1001834 | |||
| 1160 | Ga0182005_1001840 | |||
| 1161 | Ga0182005_1001908 | |||
| 1162 | Ga0182005_1046616 | |||
| 1163 | Ga0183369_1003 | |||
| 1164 | Ga0183368_1003 | |||
| 1165 | Ga0163161_10001105 | |||
| 1166 | Ga0163161_10017339 | |||
| 1167 | Ga0163161_10061666 | |||
| 1168 | Ga0163161_10114656 | |||
| 1169 | Ga0163161_10146788 | |||
| 1170 | Ga0163161_10363144 | |||
| 1171 | Ga0206356_11026814 | |||
| 1172 | Ga0206356_11707498 | |||
| 1173 | Ga0206354_10866433 | |||
| 1174 | Ga0206354_11324804 | |||
| 1175 | Ga0206353_11004208 | |||
| 1176 | Ga0206353_11518548 | |||
| 1177 | Ga0206353_11951358 | |||
| 1178 | Ga0154015_1130650 | |||
| 1179 | Ga0213876_10122365 | |||
| 1180 | Ga0209435_100965 | |||
| 1181 | Ga0209760_100330 | |||
| 1182 | Ga0209784_100011 | |||
| 1183 | Ga0209566_105487 | |||
| 1184 | Ga0209674_100012 | |||
| 1185 | Ga0209674_100389 | |||
| 1186 | Ga0207427_100026 | |||
| 1187 | Ga0207427_105025 | |||
| 1188 | Ga0209437_100241 | |||
| 1189 | Ga0209437_100340 | |||
| 1190 | Ga0209437_101914 | |||
| 1191 | Ga0209437_104525 | |||
| 1192 | Ga0209258_100027 | |||
| 1193 | Ga0209258_100854 | |||
| 1194 | Ga0209258_104471 | |||
| 1195 | Ga0207425_1000311 | |||
| 1196 | Ga0209646_1001638 | |||
| 1197 | Ga0209646_1003535 | |||
| 1198 | Ga0209646_1015697 | |||
| 1199 | Ga0209026_1000018 | |||
| 1200 | Ga0209026_1000084 | |||
| 1201 | Ga0209026_1004876 | |||
| 1202 | Ga0209148_1000001 | |||
| 1203 | Ga0209148_1000002 | |||
| 1204 | Ga0209148_1001074 | |||
| 1205 | Ga0209759_1001248 | |||
| 1206 | Ga0209759_1003313 | |||
| 1207 | Ga0209759_1004487 | |||
| 1208 | Ga0209129_1000011 | |||
| 1209 | Ga0209129_1001119 | |||
| 1210 | Ga0209129_1002671 | |||
| 1211 | Ga0209233_1000002 | |||
| 1212 | Ga0209233_1023974 | |||
| 1213 | Ga0209565_1000274 | |||
| 1214 | Ga0209455_1000019 | |||
| 1215 | Ga0209455_1000266 | |||
| 1216 | Ga0209455_1021749 | |||
| 1217 | Ga0209673_1000032 | |||
| 1218 | Ga0209130_1017459 | |||
| 1219 | Ga0209675_1000233 | |||
| 1220 | Ga0209676_1000131 | |||
| 1221 | Ga0209676_1000594 | |||
| 1222 | Ga0209676_1000813 | |||
| 1223 | Ga0209025_1000002 | |||
| 1224 | Ga0209564_1000037 | |||
| 1225 | Ga0209758_1000003 | |||
| 1226 | Ga0209758_1000647 | |||
| 1227 | Ga0209758_1009551 | |||
| 1228 | Ga0209758_1029390 | |||
| 1229 | Ga0209050_1000147 | |||
| 1230 | Ga0209050_1000328 | |||
| 1231 | Ga0209050_1015059 | |||
| 1232 | Ga0209050_1043390 | |||
| 1233 | Ga0209256_1001837 | |||
| 1234 | Ga0209256_1014050 | |||
| 1235 | Ga0209256_1021875 | |||
| 1236 | Ga0209051_1001685 | |||
| 1237 | Ga0209051_1011441 | |||
| 1238 | Ga0209051_1028146 | |||
| 1239 | Ga0209257_1000086 | |||
| 1240 | Ga0209257_1000655 | |||
| 1241 | Ga0209257_1001357 | |||
| 1242 | Ga0209257_1006199 | |||
| 1243 | Ga0209257_1039636 | |||
| 1244 | Ga0207656_10001353 | |||
| 1245 | Ga0207656_10003323 | |||
| 1246 | Ga0207713_1002689 | |||
| 1247 | Ga0207713_1011905 | |||
| 1248 | Ga0207692_10073959 | |||
| 1249 | Ga0207710_10095650 | |||
| 1250 | Ga0207680_10000001 | |||
| 1251 | Ga0207680_10001357 | |||
| 1252 | Ga0207680_10020209 | |||
| 1253 | Ga0207647_10000016 | |||
| 1254 | Ga0207647_10000066 | |||
| 1255 | Ga0207647_10001470 | |||
| 1256 | Ga0207647_10005342 | |||
| 1257 | Ga0207647_10022858 | |||
| 1258 | Ga0207647_10044803 | |||
| 1259 | Ga0207705_10000087 | |||
| 1260 | Ga0207705_10000153 | |||
| 1261 | Ga0207705_10005258 | |||
| 1262 | Ga0207705_10013607 | |||
| 1263 | Ga0207705_10225627 | |||
| 1264 | Ga0207654_10005258 | |||
| 1265 | Ga0207654_10019517 | |||
| 1266 | Ga0207654_10052976 | |||
| 1267 | Ga0207654_10100935 | |||
| 1268 | Ga0207707_10001030 | |||
| 1269 | Ga0207695_10000859 | |||
| 1270 | Ga0207695_10001326 | |||
| 1271 | Ga0207695_10001671 | |||
| 1272 | Ga0207695_10002027 | |||
| 1273 | Ga0207695_10005701 | |||
| 1274 | Ga0207695_10005750 | |||
| 1275 | Ga0207695_10006209 | |||
| 1276 | Ga0207695_10020536 | |||
| 1277 | Ga0207695_10051852 | |||
| 1278 | Ga0207695_10056392 | |||
| 1279 | Ga0207671_10000028 | |||
| 1280 | Ga0207671_10001571 | |||
| 1281 | Ga0207671_10001602 | |||
| 1282 | Ga0207671_10005765 | |||
| 1283 | Ga0207671_10008242 | |||
| 1284 | Ga0207671_10284427 | |||
| 1285 | Ga0207660_10000534 | |||
| 1286 | Ga0207660_10023809 | |||
| 1287 | Ga0207657_10002053 | |||
| 1288 | Ga0207657_10007728 | |||
| 1289 | Ga0207657_10012319 | |||
| 1290 | Ga0207649_10000488 | |||
| 1291 | Ga0207649_10004897 | |||
| 1292 | Ga0207649_10023674 | |||
| 1293 | Ga0207649_10047259 | |||
| 1294 | Ga0207649_10084602 | |||
| 1295 | Ga0207649_10458161 | |||
| 1296 | Ga0207652_10000418 | |||
| 1297 | Ga0207681_10367080 | |||
| 1298 | Ga0207681_10645391 | |||
| 1299 | Ga0207694_10000633 | |||
| 1300 | Ga0207694_10000925 | |||
| 1301 | Ga0207694_10001341 | |||
| 1302 | Ga0207694_10003183 | |||
| 1303 | Ga0207694_10014889 | |||
| 1304 | Ga0207694_10037290 | |||
| 1305 | Ga0207694_10041945 | |||
| 1306 | Ga0207694_10177359 | |||
| 1307 | Ga0207694_10311040 | |||
| 1308 | Ga0207694_10327757 | |||
| 1309 | Ga0207650_10012465 | |||
| 1310 | Ga0207650_10040961 | |||
| 1311 | Ga0207687_10241406 | |||
| 1312 | Ga0207690_10001149 | |||
| 1313 | Ga0207690_10003181 | |||
| 1314 | Ga0207690_10174782 | |||
| 1315 | Ga0207706_10029839 | |||
| 1316 | Ga0207706_10129991 | |||
| 1317 | Ga0207706_10173819 | |||
| 1318 | Ga0207706_10363970 | |||
| 1319 | Ga0207686_10012831 | |||
| 1320 | Ga0207686_10178534 | |||
| 1321 | Ga0207709_10002169 | |||
| 1322 | Ga0207709_10004394 | |||
| 1323 | Ga0207670_10008919 | |||
| 1324 | Ga0207704_10040687 | |||
| 1325 | Ga0207704_10073969 | |||
| 1326 | Ga0207711_10084893 | |||
| 1327 | Ga0207689_10331680 | |||
| 1328 | Ga0207661_10001043 | |||
| 1329 | Ga0207679_10003034 | |||
| 1330 | Ga0207679_10890729 | |||
| 1331 | Ga0207667_10000080 | |||
| 1332 | Ga0207667_10001299 | |||
| 1333 | Ga0207667_10002701 | |||
| 1334 | Ga0207667_10005890 | |||
| 1335 | Ga0207667_10018316 | |||
| 1336 | Ga0207667_10026775 | |||
| 1337 | Ga0207667_10063691 | |||
| 1338 | Ga0207667_10168872 | |||
| 1339 | Ga0207712_10255447 | |||
| 1340 | Ga0207668_10008349 | |||
| 1341 | Ga0207668_10174987 | |||
| 1342 | Ga0207640_10000313 | |||
| 1343 | Ga0207640_10000318 | |||
| 1344 | Ga0207640_10000713 | |||
| 1345 | Ga0207640_10009737 | |||
| 1346 | Ga0207640_10233252 | |||
| 1347 | Ga0207640_10274259 | |||
| 1348 | Ga0207658_10059804 | |||
| 1349 | Ga0207658_10080940 | |||
| 1350 | Ga0207658_10558032 | |||
| 1351 | Ga0207703_10000793 | |||
| 1352 | Ga0207703_10095330 | |||
| 1353 | Ga0207703_10220771 | |||
| 1354 | Ga0207639_10000479 | |||
| 1355 | Ga0207639_10000702 | |||
| 1356 | Ga0207639_10001975 | |||
| 1357 | Ga0207639_10002304 | |||
| 1358 | Ga0207639_10004444 | |||
| 1359 | Ga0207639_10136498 | |||
| 1360 | Ga0207639_10177668 | |||
| 1361 | Ga0207639_10831694 | |||
| 1362 | Ga0207678_10002305 | |||
| 1363 | Ga0207678_10002600 | |||
| 1364 | Ga0207678_10023163 | |||
| 1365 | Ga0207678_10038001 | |||
| 1366 | Ga0207678_10039061 | |||
| 1367 | Ga0207702_10002690 | |||
| 1368 | Ga0207702_10007325 | |||
| 1369 | Ga0207702_10034514 | |||
| 1370 | Ga0207702_10195191 | |||
| 1371 | Ga0207702_10197794 | |||
| 1372 | Ga0207702_11089372 | |||
| 1373 | Ga0207641_10008256 | |||
| 1374 | Ga0207641_10174328 | |||
| 1375 | Ga0207641_11050102 | |||
| 1376 | Ga0207648_10056679 | |||
| 1377 | Ga0207674_10000091 | |||
| 1378 | Ga0207674_10004284 | |||
| 1379 | Ga0207674_10015162 | |||
| 1380 | Ga0207674_10067225 | |||
| 1381 | Ga0207674_10248823 | |||
| 1382 | Ga0207674_10678261 | |||
| 1383 | Ga0207683_10144341 | |||
| 1384 | Ga0207698_10000056 | |||
| 1385 | Ga0207698_10002003 | |||
| 1386 | Ga0207698_10006507 | |||
| 1387 | Ga0207698_10207331 | |||
| 1388 | Ga0207698_10337917 | |||
| 1389 | Ga0207698_10892241 | |||
| 1390 | Ga0209371_1000028 | |||
| 1391 | Ga0209371_1000055 | |||
| 1392 | Ga0268266_10000008 | |||
| 1393 | Ga0268266_10000075 | |||
| 1394 | Ga0268266_10096618 | |||
| 1395 | Ga0268266_10187785 | |||
| 1396 | Ga0268265_10044018 | |||
| 1397 | Ga0268264_10036823 | |||
| 1398 | Ga0268264_10136173 | |||
| 1399 | Ga0268264_10233901 | |||
| 1400 | Ga0268264_10683465 | |||
| 1401 | Ga0268256_1000030 | |||
| 1402 | Ga0268256_1000054 | |||
| 1403 | Ga0316183_1021347 | |||
| 1404 | Ga0316181_1021237 | |||
| 1405 | Ga0307508_10019266 | |||
| 1406 | Ga0307405_10168386 | |||
| 1407 | Ga0307410_10377502 | |||
| 1408 | Ga0307412_10000785 | |||
| 1409 | Ga0307412_10049825 | |||
| 1410 | Ga0307414_10682389 | |||
| 1411 | Ga0307510_10106560 | |||
| 1412 | Ga0373923_0071225 | |||
| 1413 | Ga0373936_0188150 | |||
| 1414 | Ga0373956_0257176 | |||
| 1415 | Ga0373937_0225913 | |||
| 1416 | Ga0395899_0066922 | |||
| 1417 | Ga0395900_0025171 | |||
| 1418 | Ga0395901_0014437 | |||
| 1419 | Ga0237819_00010 | |||
| 1420 | Ga0237819_08767 | |||
| 1421 | Ga0436365_0600206 | |||
| 1422 | Ga0439436_0000029 | |||
| 1423 | Ga0439465_0000540 | |||
| 1424 | Ga0451789_0170969 | |||
| 1425 | Ga0451793_0929925 | |||
| 1426 | Ga0451793_1709265 | |||
| 1427 | Ga0451800_1097985 | |||
| 1428 | Ga0451806_068305 | |||
| 1429 | Ga0451804_0990427 | |||
| 1430 | Ga0451807_1980282 | |||
| 1431 | Ga0451839_0761720 | |||
| 1432 | Ga0451851_0523967 | |||
| 1433 | Ga0451843_0754940 | |||
| 1434 | Ga0439432_021962 | |||
| 1435 | Ga0439449_0027598 | |||
| 1436 | Ga0439449_0034649 | |||
| 1437 | Ga0450908_000009 | |||
| 1438 | Ga0451577_0362394 | |||
| 1439 | Ga0466969_0017514 | |||
| 1440 | Ga0466972_0031717 | |||
| 1441 | Ga0466982_0000007 | |||
| 1442 | Ga0466966_0024524 | |||
| 1443 | Ga0466964_0001643 | |||
| 1444 | Ga0453684_0006590 | |||
| 1445 | Ga0466971_0037384 | |||
| 1446 | Ga0466968_0000774 | |||
| 1447 | Ga0466968_0069988 | |||
| 1448 | Ga0466970_0064485 | |||
| 1449 | Ga0466957_0353535 | |||
| 1450 | Ga0466960_0024174 | |||
| 1451 | Ga0451576_0000042 | |||
| 1452 | Ga0495617_000100 | |||
| 1453 | Ga0495617_000592 | |||
| 1454 | Ga0495627_015083 | |||
| 1455 | Ga0495638_0000019 | |||
| 1456 | Ga0495638_0000082 | |||
| 1457 | Ga0495638_0000104 | |||
| 1458 | Ga0495638_0000176 | |||
| 1459 | Ga0495638_0137470 | |||
| 1460 | Ga0495650_0000443 | |||
| 1461 | Ga0495650_0000527 | |||
| 1462 | Ga0495650_0000985 | |||
| 1463 | Ga0495650_0015004 | |||
| 1464 | Ga0495584_0008985 | |||
| 1465 | Ga0495585_0000095 | |||
| 1466 | Ga0495585_0001216 | |||
| 1467 | Ga0495585_0324732 | |||
| 1468 | Ga0495607_0000133 | |||
| 1469 | Ga0495607_0000182 | |||
| 1470 | Ga0495607_0005791 | |||
| 1471 | Ga0495607_0042887 | |||
| 1472 | Ga0495583_0013612 | |||
| 1473 | Ga0495606_0000113 | |||
| 1474 | Ga0495606_0000160 | |||
| 1475 | Ga0495606_0028505 | |||
| 1476 | Ga0495606_0187615 | |||
| 1477 | Ga0495610_0001348 | |||
| 1478 | Ga0495610_0006465 | |||
| 1479 | Ga0495616_0000006 | |||
| 1480 | Ga0495616_0018953 | |||
| 1481 | Ga0495620_0001091 | |||
| 1482 | Ga0495620_0016941 | |||
| 1483 | Ga0495631_0000683 | |||
| 1484 | Ga0495631_0001042 | |||
| 1485 | Ga0495631_0001175 | |||
| 1486 | Ga0495632_0000010 | |||
| 1487 | Ga0495632_0004263 | |||
| 1488 | Ga0495632_0072216 | |||
| 1489 | Ga0495632_0141787 | |||
| 1490 | Ga0495637_0005951 | |||
| 1491 | Ga0495643_0035985 | |||
| 1492 | Ga0495648_0001434 | |||
| 1493 | Ga0495648_0002102 | |||
| 1494 | Ga0495586_0062663 | |||
| 1495 | Ga0495609_0002164 | |||
| 1496 | Ga0495645_0354250 | |||
| 1497 | Ga0495622_0004252 | |||
| 1498 | Ga0495633_0004565 | |||
| 1499 | Ga0495633_0008257 | |||
| 1500 | Ga0495668_0005320 | |||
| 1501 | Ga0495611_0000003 | |||
| 1502 | Ga0495611_0000028 | |||
| 1503 | Ga0495625_0000193 | |||
| 1504 | Ga0495625_0011967 | |||
| 1505 | Ga0495625_0015081 | |||
| 1506 | Ga0495625_0023101 | |||
| 1507 | Ga0495661_0000911 | |||
| 1508 | Ga0495658_0067432 | |||
| 1509 | Ga0495670_0002135 | |||
| 1510 | Ga0495670_0002542 | |||
| 1511 | Ga0495670_0116220 | |||
| 1512 | Ga0495671_0012816 | |||
| 1513 | Ga0495649_0004395 | |||
| 1514 | Ga0495649_0027192 | |||
| 1515 | Ga0495589_0000042 | |||
| 1516 | Ga0495660_0000165 | |||
| 1517 | Ga0495660_0000193 | |||
| 1518 | Ga0495660_0074410 | |||
| 1519 | Ga0495672_0000564 | |||
| 1520 | Ga0495672_0068553 | |||
| 1521 | Ga0495683_0000148 | |||
| 1522 | Ga0495679_000046 | |||
| 1523 | Ga0495673_0000004 | |||
| 1524 | Ga0495673_0000041 | |||
| 1525 | Ga0495673_0004946 | |||
| 1526 | Ga0495686_0000117 | |||
| 1527 | Ga0495686_0000807 | |||
| 1528 | Ga0495686_0012990 | |||
| 1529 | Ga0495686_0020948 | |||
| 1530 | Ga0495686_0022756 | |||
| 1531 | Ga0495686_0031743 | |||
| 1532 | Ga0495686_0054340 | |||
| 1533 | Ga0495602_0582971 | |||
| 1534 | Ga0496101_0025211 | |||
| 1535 | Ga0496103_0126380 | |||
| 1536 | Ga0496104_0000365 | |||
| 1537 | Ga0496104_0075712 | |||
| 1538 | Ga0496105_0000048 | |||
| 1539 | Ga0496106_0000680 | |||
| 1540 | Ga0496106_0055159 | |||
| 1541 | Ga0496113_0005765 | |||
| 1542 | Ga0496114_0388354 | |||
| 1543 | Ga0496115_0000114 | |||
| 1544 | Ga0496115_0000487 | |||
| 1545 | Ga0496115_0001663 | |||
| 1546 | Ga0496115_0062612 | |||
| 1547 | Ga0496115_0638972 | |||
| 1548 | Ga0496116_0002825 | |||
| 1549 | Ga0496116_0104941 | |||
| 1550 | Ga0496116_0149206 | |||
| 1551 | Ga0496117_0002569 | |||
| 1552 | Ga0496117_0003786 | |||
| 1553 | Ga0496117_0005542 | |||
| 1554 | Ga0496117_0014387 | |||
| 1555 | Ga0496117_0070657 | |||
| 1556 | Ga0496117_0072040 | |||
| 1557 | Ga0496117_0109417 | |||
| 1558 | Ga0496117_0336090 | |||
| 1559 | Ga0496118_0002703 | |||
| 1560 | Ga0496118_0007099 | |||
| 1561 | Ga0496118_0007291 | |||
| 1562 | Ga0496118_0008786 | |||
| 1563 | Ga0496118_0025437 | |||
| 1564 | Ga0496118_0062279 | |||
| 1565 | Ga0496118_0113851 | |||
| 1566 | Ga0496118_0226165 | |||
| 1567 | Ga0496119_0002512 | |||
| 1568 | Ga0496119_0026178 | |||
| 1569 | Ga0496119_0051029 | |||
| 1570 | Ga0496120_0000988 | |||
| 1571 | Ga0496120_0036381 | |||
| 1572 | Ga0496121_0000251 | |||
| 1573 | Ga0496121_0001805 | |||
| 1574 | Ga0496121_0002210 | |||
| 1575 | Ga0496121_0007673 | |||
| 1576 | Ga0496121_0036416 | |||
| 1577 | Ga0496121_0060106 | |||
| 1578 | Ga0496121_0244370 | |||
| 1579 | Ga0496122_0003606 | |||
| 1580 | Ga0496122_0017822 | |||
| 1581 | Ga0496122_0018410 | |||
| 1582 | Ga0496122_0065031 | |||
| 1583 | Ga0496122_0100725 | |||
| 1584 | Ga0496122_0108683 | |||
| 1585 | Ga0496122_0188124 | |||
| 1586 | Ga0496123_0000417 | |||
| 1587 | Ga0496123_0011389 | |||
| 1588 | Ga0496123_0011561 | |||
| 1589 | Ga0496123_0014546 | |||
| 1590 | Ga0496123_0045007 | |||
| 1591 | Ga0496123_0061949 | |||
| 1592 | Ga0496123_0128003 | |||
| 1593 | Ga0496123_0200423 | |||
| 1594 | Ga0496124_0000866 | |||
| 1595 | Ga0496124_0002325 | |||
| 1596 | Ga0496124_0004662 | |||
| 1597 | Ga0496124_0004701 | |||
| 1598 | Ga0496124_0010018 | |||
| 1599 | Ga0496124_0012323 | |||
| 1600 | Ga0496124_0030890 | |||
| 1601 | Ga0496124_0031804 | |||
| 1602 | Ga0496124_0082741 | |||
| 1603 | Ga0496125_0000590 | |||
| 1604 | Ga0496125_0011413 | |||
| 1605 | Ga0496125_0023735 | |||
| 1606 | Ga0496125_0053628 | |||
| 1607 | Ga0496125_0084041 | |||
| 1608 | Ga0496125_0335283 | |||
| 1609 | Ga0496126_0000553 | |||
| 1610 | Ga0496126_0040099 | |||
| 1611 | Ga0496126_0051498 | |||
| 1612 | Ga0496126_0054164 | |||
| 1613 | Ga0496126_0065888 | |||
| 1614 | Ga0496126_0097437 | |||
| 1615 | Ga0496126_0286066 | |||
| 1616 | Ga0496126_0331753 | |||
| 1617 | Ga0495678_000261 | |||
| 1618 | Ga0495678_049037 | |||
| 1619 | Ga0495682_0011122 | |||
| 1620 | Ga0501032_0035393 | |||
| 1621 | Ga0501032_0155452 | |||
| 1622 | Ga0501032_0212858 | |||
| 1623 | Ga0501033_0046293 | |||
| 1624 | Ga0501034_0001222 | |||
| 1625 | Ga0501034_0001438 | |||
| 1626 | Ga0501034_0075699 | |||
| 1627 | Ga0501034_0296891 | |||
| 1628 | Ga0501034_0711343 | |||
| 1629 | Ga0501036_0070279 | |||
| 1630 | Ga0501037_0094182 | |||
| 1631 | Ga0501037_0277160 | |||
| 1632 | Ga0501038_0012654 | |||
| 1633 | Ga0501038_0122708 | |||
| 1634 | Ga0501038_0489850 | |||
| 1635 | Ga0501039_0094206 | |||
| 1636 | Ga0501043_0004602 | |||
| 1637 | Ga0501043_0063660 | |||
| 1638 | Ga0501043_0066949 | |||
| 1639 | Ga0501043_0111266 | |||
| 1640 | Ga0501046_0027284 | |||
| 1641 | Ga0501046_0289114 | |||
| 1642 | Ga0501047_0000238 | |||
| 1643 | Ga0501047_0008893 | |||
| 1644 | Ga0501047_0052406 | |||
| 1645 | Ga0501047_0080365 | |||
| 1646 | Ga0501047_0089332 | |||
| 1647 | Ga0501047_0202192 | |||
| 1648 | Ga0501047_0300342 | |||
| 1649 | Ga0501048_0082463 | |||
| 1650 | Ga0501048_0881197 | |||
| 1651 | Ga0501067_0000055 | |||
| 1652 | Ga0501067_0193602 | |||
| 1653 | Ga0501068_0002629 | |||
| 1654 | Ga0501069_0003118 | |||
| 1655 | Ga0501069_0023477 | |||
| 1656 | Ga0501070_0003358 | |||
| 1657 | Ga0501070_0004834 | |||
| 1658 | Ga0501070_0005863 | |||
| 1659 | Ga0501070_0031475 | |||
| 1660 | Ga0501070_0043594 | |||
| 1661 | Ga0501070_0056010 | |||
| 1662 | Ga0501070_0081937 | |||
| 1663 | Ga0501070_0192834 | |||
| 1664 | Ga0501070_0356934 | |||
| 1665 | Ga0501070_0496694 | |||
| 1666 | Ga0501072_0012242 | |||
| 1667 | Ga0501073_0000072 | |||
| 1668 | Ga0501073_0270083 | |||
| 1669 | Ga0501074_0003527 | |||
| 1670 | Ga0501074_0082953 | |||
| 1671 | Ga0501077_0029250 | |||
| 1672 | Ga0501079_0026009 | |||
| 1673 | Ga0501079_0090392 | |||
| 1674 | Ga0501079_0497442 | |||
| 1675 | Ga0501080_0000097 | |||
| 1676 | Ga0501080_0001262 | |||
| 1677 | Ga0501080_0034314 | |||
| 1678 | Ga0501080_0043760 | |||
| 1679 | Ga0501080_0063683 | |||
| 1680 | Ga0501080_0307674 | |||
| 1681 | Ga0501080_0900314 | |||
| 1682 | Ga0501083_0000128 | |||
| 1683 | Ga0501035_0006662 | |||
| 1684 | Ga0501035_0081313 | |||
| 1685 | Ga0501035_0100707 | |||
| 1686 | Ga0501035_0618591 | |||
| 1687 | Ga0501035_0813817 | |||
| 1688 | Ga0501044_0005861 | |||
| 1689 | Ga0501044_0006633 | |||
| 1690 | Ga0501044_0014080 | |||
| 1691 | Ga0501044_0047146 | |||
| 1692 | Ga0501044_0284873 | |||
| 1693 | Ga0501044_0317883 | |||
| 1694 | nmdc:mga00v17_105745_c1 | |||
| 1695 | nmdc:mga00v17_582_c2 | |||
| 1696 | nmdc:mga06z11_142482_c1 | |||
| 1697 | nmdc:mga0sz30_72482_c1 | |||
| 1698 | Ga0500643_000036 | |||
| 1699 | Ga0500646_0021800 | |||
| 1700 | Ga0500555_000110 | |||
| 1701 | Ga0500634_0000178 | |||
| 1702 | Ga0500645_001177 | |||
| 1703 | Ga0501084_1148177 | |||
| 1704 | Ga0466962_0001663 | |||
| 1705 | 2572254494 | |||
| 1706 | 2595447897 | |||
| 1707 | 2643915149 | |||
| 1708 | 2644528369 | |||
| 1709 | 2687582041 | |||
| 1710 | 2721026033 | |||
| 1711 | 2735833999 | |||
| 1712 | 2739225408 | |||
| 1713 | 2739732404 | |||
| 1714 | 2747951165 | |||
| 1715 | 2816519485 | |||
| 1716 | 2819662696 | |||
| 1717 | 2842395643 | |||
| 1718 | 2842759669 | |||
| 1719 | 2842917746 | |||
| 1720 | 2842922092 | |||
| 1721 | 2852687563 | |||
| 1722 | 2874224568 | |||
| 1723 | 2884341987 | |||
| 1724 | 2884411633 | |||
| 1725 | 2919087268 | |||
| 1726 | 2919091582 | |||
| 1727 | 2919134254 | |||
| 1728 | 2919135008 | |||
| 1729 | 2919408197 | |||
| 1730 | 2923519311 | |||
| 1731 | 2928498913 | |||
| 1732 | 2928965082 | |||
| 1733 | 2929199000 | |||
| 1734 | 2931382031 | |||
| 1735 | 2937611209 | |||
| 1736 | 2939592601 | |||
| 1737 | 2939630148 | |||
| 1738 | 2941473990 | |||
| 1739 | 2953997202 | |||
| 1740 | 2961051332 | |||
| 1741 | 2961066414 | |||
| 1742 | 2974310043 | |||
| 1743 | 2977250777 | |||
| 1744 | 2984514737 | |||
| 1745 | 8021628188 | |||
| 1746 | 8021651400 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hrw-assembly1.cif.gz_B | identification of function and mechanistic insights of guanine deaminase from nitrosomonas europaea | 0.9455 | 5 | 181 |
| 4lcp-assembly1.cif.gz_A | crytsal structure of ne0047 in complex with 2,6-diaminopurine | 0.9334 | 7 | 186 |
| 7c3t-assembly1.cif.gz_B | crystal structure of ne0047 (n66q) mutant in complex with 8-azaguanine | 0.933 | 1 | 179 |
| 7c3s-assembly1.cif.gz_B | crystal structure of ne0047 (e143d) mutant in complex with 8-azaguanine | 0.9304 | 1 | 180 |
| 7c3u-assembly1.cif.gz_B | crystal structure of ne0047 (n66a) mutant in complex with 8-azaguanine | 0.9299 | 1 | 181 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4lc5A01 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.9487 | 10 | 179 | 3.40.140.10 |
| af_A0A1D6ELV0_114_227_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.9298 | 28 | 138 | 3.40.140.10 |
| 4lc5A01 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.9274 | 10 | 179 | 3.40.140.10 |
| af_F1QGS9_227_327_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.9122 | 50 | 64 | 2.60.40.10 |
| af_A0A0R0KFE2_25_145_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.9114 | 34 | 123 | 3.40.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q5GWE7-F1-model_v4 | Cytosine/adenosine deaminases | 0.993 | 1 | 180 |
GO:0003824
|
| AF-A0A6P0EP93-F1-model_v4 | deleted | 0.9899 | 46 | 157 |
|
| AF-A0A357NRB2-F1-model_v4 | deleted | 0.9868 | 55 | 186 |
|
| AF-A0A6P1SII9-F1-model_v4 | deleted | 0.9841 | 1 | 186 |
|
| AF-A0A4Z0DNF3-F1-model_v4 | Nucleoside deaminase | 0.9841 | 1 | 186 |
GO:0003824
|