F484248

General Info

Members Datasets Scaffolds Average Seq Length
873 289 873 259

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100122017|Ga0070682_1001220172
Length 292
Sequence MSSSAECERLLDLPGWIRPVEPQLDFTGGFPMTTATSTLLGRPVWYELMTGDVAAAETFYKNVIGWTSAPFRGAPDPYDVFKRSGDVQVAGVMHTPKGMNMPPFWSMYVAVPKLEEAVAHIKRLGGTELSGVIDVPTVGRMQMLKDPQGAAFYIIQPAPREERAETAPVVGEASWHELMTTDADAAMKFYSDVFGWQPSEAMDMGEMGKYQMFNRPSGMIGGMMNKPPQMADVPPYWAIYFLVPDINAAVERIKANGGQVLNGPMEVPGGDWIVNAMDPQGAMFSLHAKKAQ

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
162 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
183 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
195 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
196 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
197 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
198 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
199 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
200 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
201 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
228 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
251 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
252 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
253 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
257 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
258 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
259 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
263 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
266 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
269 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
277 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
278 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
279 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
284 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
285 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
286 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
287 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 1.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.29
Nodule 0
Rhizoplane 3.09
Rhizosphere 93.47
Stem 0
Stem Tuber 0
Unclassified 1.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_3199878 2162886011 Unclassified 949
2 Ga0058859_11229463 3300004798 Bacteria 1041
3 Ga0058863_11934526 3300004799 Bacteria 1226
4 Ga0058861_11748004 3300004800 Bacteria 1374
5 Ga0058861_12031893 3300004800 Bacteria 1094
6 Ga0058860_10064540 3300004801 Unclassified 1164
7 Ga0058860_10090918 3300004801 Bacteria 918
8 Ga0058860_11611968 3300004801 Bacteria 1142
9 Ga0058860_12028819 3300004801 Bacteria 1216
10 Ga0058862_12539343 3300004803 Bacteria 1186
11 Ga0058862_12758636 3300004803 Unclassified 943
12 Ga0058862_12783670 3300004803 Unclassified 989
13 Ga0065714_10071074 3300005288 Bacteria 3671
14 Ga0065704_10171588 3300005289 Unclassified 1288
15 Ga0065712_10003381 3300005290 Bacteria 5639
16 Ga0065712_10010152 3300005290 Bacteria 2758
17 Ga0065712_10074252 3300005290 Unclassified 4144
18 Ga0065715_10004219 3300005293 Bacteria 6834
19 Ga0065715_10094822 3300005293 Unclassified 4232
20 Ga0065715_10102412 3300005293 Bacteria 3117
21 Ga0065715_10126090 3300005293 Bacteria 2101
22 Ga0065715_10167934 3300005293 Bacteria 1571
23 Ga0065715_10169792 3300005293 Unclassified 1556
24 Ga0065707_10092277 3300005295 Bacteria 3794
25 Ga0065707_10194570 3300005295 Bacteria 1337
26 Ga0065707_10212626 3300005295 Unclassified 1256
27 Ga0070658_10013944 3300005327 Bacteria 6452
28 Ga0070676_10019726 3300005328 Unclassified 3756
29 Ga0070676_10140219 3300005328 Unclassified 1538
30 Ga0070683_100000260 3300005329 Bacteria 36410
31 Ga0070683_100707004 3300005329 Bacteria 965
32 Ga0070690_100011445 3300005330 Bacteria 5189
33 Ga0070690_100014027 3300005330 Unclassified 4750
34 Ga0070690_100023056 3300005330 Bacteria 3814
35 Ga0070670_100001340 3300005331 Bacteria 19679
36 Ga0070670_100005713 3300005331 Bacteria 10514
37 Ga0070670_100008280 3300005331 Bacteria 8852
38 Ga0070670_100013192 3300005331 Bacteria 7078
39 Ga0070670_100016091 3300005331 Bacteria 6420
40 Ga0070670_100068105 3300005331 Bacteria 3055
41 Ga0070670_100124633 3300005331 Bacteria 2224
42 Ga0070670_100156618 3300005331 Unclassified 1973
43 Ga0070670_100163332 3300005331 Bacteria 1930
44 Ga0070670_100540427 3300005331 Bacteria 1039
45 Ga0070677_10016722 3300005333 Bacteria 2615
46 Ga0070677_10058734 3300005333 Unclassified 1580
47 Ga0068869_100020689 3300005334 Unclassified 4517
48 Ga0068869_100025458 3300005334 Bacteria 4109
49 Ga0068869_100154420 3300005334 Unclassified 1782
50 Ga0070666_10012985 3300005335 Bacteria 5273
51 Ga0070666_10064586 3300005335 Bacteria 2482
52 Ga0070666_10159512 3300005335 Unclassified 1576
53 Ga0070666_10227019 3300005335 Bacteria 1318
54 Ga0070666_10322574 3300005335 Bacteria 1102
55 Ga0070680_100441545 3300005336 Bacteria 1111
56 Ga0070682_100122017 3300005337 Bacteria 1751
57 Ga0068868_100011659 3300005338 Bacteria 6404
58 Ga0070660_100275589 3300005339 Unclassified 1376
59 Ga0070689_100039410 3300005340 Unclassified 3617
60 Ga0070689_100245288 3300005340 Unclassified 1477
61 Ga0070689_100468948 3300005340 Bacteria 1074
62 Ga0070687_100006132 3300005343 Bacteria 4910
63 Ga0070687_100031838 3300005343 Unclassified 2590
64 Ga0070687_100050658 3300005343 Bacteria 2145
65 Ga0070661_100001252 3300005344 Bacteria 17814
66 Ga0070661_100020068 3300005344 Bacteria 4764
67 Ga0070668_100013056 3300005347 Bacteria 6187
68 Ga0070668_100136203 3300005347 Bacteria 1975
69 Ga0070668_100296484 3300005347 Bacteria 1355
70 Ga0070668_100320759 3300005347 Bacteria 1304
71 Ga0070668_100659752 3300005347 Bacteria 920
72 Ga0070669_100000399 3300005353 Bacteria 33282
73 Ga0070669_100002199 3300005353 Bacteria 14122
74 Ga0070669_100003613 3300005353 Bacteria 11161
75 Ga0070669_100017648 3300005353 Bacteria 5091
76 Ga0070669_100036098 3300005353 Bacteria 3581
77 Ga0070669_100073288 3300005353 Bacteria 2536
78 Ga0070669_100102331 3300005353 Bacteria 2163
79 Ga0070669_100307046 3300005353 Bacteria 1277
80 Ga0070675_100017161 3300005354 Bacteria 5753
81 Ga0070675_100047773 3300005354 Bacteria 3508
82 Ga0070675_100081052 3300005354 Unclassified 2706
83 Ga0070675_100124137 3300005354 Bacteria 2196
84 Ga0070675_100277332 3300005354 Unclassified 1472
85 Ga0070675_100631575 3300005354 Bacteria 973
86 Ga0070675_100647599 3300005354 Unclassified 960
87 Ga0070671_100171233 3300005355 Bacteria 1836
88 Ga0070671_100268190 3300005355 Unclassified 1451
89 Ga0070671_100462898 3300005355 Unclassified 1088
90 Ga0070674_100000133 3300005356 Bacteria 34091
91 Ga0070674_100038102 3300005356 Unclassified 3238
92 Ga0070674_100130461 3300005356 Unclassified 1873
93 Ga0070673_100007069 3300005364 Bacteria 7366
94 Ga0070673_100008782 3300005364 Bacteria 6745
95 Ga0070673_100032544 3300005364 Bacteria 3928
96 Ga0070673_100458554 3300005364 Unclassified 1147
97 Ga0070688_100087207 3300005365 Unclassified 2032
98 Ga0070688_100106534 3300005365 Unclassified 1857
99 Ga0070688_100117494 3300005365 Bacteria 1777
100 Ga0070688_100210667 3300005365 Unclassified 1364
101 Ga0070667_100004567 3300005367 Bacteria 11631
102 Ga0070703_10158118 3300005406 Unclassified 857
103 Ga0070701_10001279 3300005438 Bacteria 9244
104 Ga0070701_10043901 3300005438 Unclassified 2289
105 Ga0070701_10068895 3300005438 Bacteria 1886
106 Ga0070705_100053529 3300005440 Unclassified 2363
107 Ga0070705_100232308 3300005440 Bacteria 1284
108 Ga0070700_100015636 3300005441 Bacteria 4308
109 Ga0070700_100077549 3300005441 Unclassified 2137
110 Ga0070700_100155460 3300005441 Bacteria 1569
111 Ga0070700_100506285 3300005441 Bacteria 930
112 Ga0070694_100033846 3300005444 Unclassified 3367
113 Ga0070708_100346796 3300005445 Unclassified 1399
114 Ga0070663_100007791 3300005455 Bacteria 6545
115 Ga0070678_100026864 3300005456 Bacteria 3899
116 Ga0070678_100054028 3300005456 Bacteria 2924
117 Ga0070678_100130396 3300005456 Bacteria 1996
118 Ga0070678_100161441 3300005456 Bacteria 1816
119 Ga0070662_100011707 3300005457 Bacteria 5790
120 Ga0070662_100024347 3300005457 Unclassified 4170
121 Ga0068867_100004682 3300005459 Bacteria 9625
122 Ga0068867_100022711 3300005459 Bacteria 4487
123 Ga0068867_100058755 3300005459 Bacteria 2850
124 Ga0068867_100600452 3300005459 Bacteria 960
125 Ga0070685_10041862 3300005466 Unclassified 2611
126 Ga0070685_10260454 3300005466 Bacteria 1153
127 Ga0070698_100205261 3300005471 Bacteria 1906
128 Ga0070698_100740187 3300005471 Unclassified 926
129 Ga0070699_100000485 3300005518 Bacteria 37796
130 Ga0070699_100041522 3300005518 Bacteria 3982
131 Ga0070679_100116476 3300005530 Bacteria 2657
132 Ga0070684_100000898 3300005535 Bacteria 21069
133 Ga0070697_100165138 3300005536 Bacteria 1872
134 Ga0070672_100012392 3300005543 Bacteria 5984
135 Ga0070672_100015890 3300005543 Bacteria 5375
136 Ga0070672_100186409 3300005543 Unclassified 1731
137 Ga0070672_100412461 3300005543 Bacteria 1159
138 Ga0070686_100009424 3300005544 Bacteria 5489
139 Ga0070686_100051783 3300005544 Unclassified 2615
140 Ga0070686_100251732 3300005544 Bacteria 1290
141 Ga0070695_100417634 3300005545 Bacteria 1021
142 Ga0070696_100443868 3300005546 Unclassified 1023
143 Ga0070665_100028846 3300005548 Bacteria 5586
144 Ga0070665_100048324 3300005548 Unclassified 4272
145 Ga0070665_100444421 3300005548 Unclassified 1306
146 Ga0070704_100033061 3300005549 Unclassified 3495
147 Ga0070664_100002150 3300005564 Bacteria 15800
148 Ga0070664_100014148 3300005564 Bacteria 6508
149 Ga0070664_100312663 3300005564 Unclassified 1422
150 Ga0070664_100402932 3300005564 Unclassified 1251
151 Ga0070664_100554967 3300005564 Unclassified 1062
152 Ga0068857_100011022 3300005577 Bacteria 7870
153 Ga0068857_100013100 3300005577 Bacteria 7226
154 Ga0068857_100062811 3300005577 Bacteria 3302
155 Ga0068857_100628900 3300005577 Bacteria 1016
156 Ga0068854_100145624 3300005578 Unclassified 1822
157 Ga0070702_100091927 3300005615 Bacteria 1842
158 Ga0068852_100210251 3300005616 Bacteria 1845
159 Ga0068859_100005105 3300005617 Bacteria 13335
160 Ga0068859_100009922 3300005617 Bacteria 9611
161 Ga0068859_100012595 3300005617 Bacteria 8505
162 Ga0068859_100060387 3300005617 Bacteria 3820
163 Ga0068859_100079721 3300005617 Bacteria 3315
164 Ga0068859_100237905 3300005617 Unclassified 1910
165 Ga0068864_100039642 3300005618 Unclassified 4025
166 Ga0068864_100064648 3300005618 Bacteria 3173
167 Ga0068864_100427390 3300005618 Bacteria 1263
168 Ga0068864_100511997 3300005618 Unclassified 1156
169 Ga0068861_100006364 3300005719 Bacteria 8040
170 Ga0068861_100013596 3300005719 Bacteria 5698
171 Ga0068861_100172423 3300005719 Bacteria 1794
172 Ga0068870_10000968 3300005840 Bacteria 11294
173 Ga0068870_10014039 3300005840 Bacteria 3775
174 Ga0068870_10059758 3300005840 Bacteria 2044
175 Ga0068870_10066038 3300005840 Bacteria 1959
176 Ga0068863_100000005 3300005841 Bacteria 269757
177 Ga0068863_100000867 3300005841 Bacteria 30266
178 Ga0068863_100039399 3300005841 Bacteria 4496
179 Ga0068863_100083183 3300005841 Bacteria 3033
180 Ga0068863_100158225 3300005841 Unclassified 2169
181 Ga0068863_100834985 3300005841 Bacteria 920
182 Ga0068863_100865957 3300005841 Bacteria 903
183 Ga0068858_100007931 3300005842 Bacteria 10232
184 Ga0068858_100009898 3300005842 Bacteria 9058
185 Ga0068858_100012596 3300005842 Bacteria 7971
186 Ga0068858_100048972 3300005842 Bacteria 3914
187 Ga0068858_100083127 3300005842 Bacteria 2977
188 Ga0068858_100336378 3300005842 Bacteria 1444
189 Ga0068860_100000008 3300005843 Bacteria 427367
190 Ga0068860_100021964 3300005843 Bacteria 6176
191 Ga0068860_100053433 3300005843 Bacteria 3841
192 Ga0068860_100140178 3300005843 Bacteria 2324
193 Ga0068860_100194295 3300005843 Unclassified 1965
194 Ga0068862_100001221 3300005844 Bacteria 24241
195 Ga0068862_100012814 3300005844 Bacteria 6936
196 Ga0068862_100038425 3300005844 Bacteria 4059
197 Ga0068862_100051534 3300005844 Unclassified 3520
198 Ga0068862_100100586 3300005844 Bacteria 2528
199 Ga0068862_100137218 3300005844 Bacteria 2169
200 Ga0068862_100205237 3300005844 Bacteria 1778
201 Ga0068862_100280175 3300005844 Unclassified 1528
202 Ga0068862_100517777 3300005844 Bacteria 1135
203 Ga0081455_10034132 3300005937 Bacteria 4562
204 Ga0081455_10156505 3300005937 Bacteria 1751
205 Ga0081455_10191329 3300005937 Bacteria 1540
206 Ga0075368_10005612 3300006042 Bacteria 4329
207 Ga0075364_10130065 3300006051 Bacteria 1689
208 Ga0075367_10211582 3300006178 Unclassified 1212
209 Ga0075366_10027111 3300006195 Bacteria 3360
210 Ga0075366_10129648 3300006195 Bacteria 1522
211 Ga0097621_100049978 3300006237 Bacteria 3399
212 Ga0097621_100176404 3300006237 Bacteria 1845
213 Ga0075370_10013601 3300006353 Bacteria 4330
214 Ga0068871_100043752 3300006358 Bacteria 3598
215 Ga0068871_100095480 3300006358 Unclassified 2483
216 Ga0068871_100203448 3300006358 Unclassified 1710
217 Ga0075428_100004960 3300006844 Bacteria 14782
218 Ga0075428_100009217 3300006844 Bacteria 10949
219 Ga0075428_100014803 3300006844 Bacteria 8668
220 Ga0075428_100073348 3300006844 Bacteria 3738
221 Ga0075428_100074638 3300006844 Bacteria 3704
222 Ga0075428_100144399 3300006844 Bacteria 2587
223 Ga0075428_100152385 3300006844 Unclassified 2511
224 Ga0075428_100231389 3300006844 Bacteria 1994
225 Ga0075428_100314293 3300006844 Bacteria 1684
226 Ga0075428_100477156 3300006844 Bacteria 1335
227 Ga0075430_100000381 3300006846 Bacteria 32603
228 Ga0075430_100002731 3300006846 Bacteria 14733
229 Ga0075430_100003464 3300006846 Bacteria 13207
230 Ga0075430_100027201 3300006846 Bacteria 4862
231 Ga0075430_100029136 3300006846 Bacteria 4686
232 Ga0075430_100029161 3300006846 Bacteria 4684
233 Ga0075430_100097419 3300006846 Bacteria 2457
234 Ga0075430_100165560 3300006846 Bacteria 1840
235 Ga0075430_100326305 3300006846 Unclassified 1269
236 Ga0075431_100003416 3300006847 Bacteria 15405
237 Ga0075431_100004623 3300006847 Bacteria 13514
238 Ga0075431_100007678 3300006847 Bacteria 10741
239 Ga0075431_100014566 3300006847 Bacteria 7956
240 Ga0075431_100026322 3300006847 Bacteria 5967
241 Ga0075431_100030553 3300006847 Bacteria 5550
242 Ga0075431_100040167 3300006847 Bacteria 4821
243 Ga0075431_100080952 3300006847 Bacteria 3353
244 Ga0075431_100091222 3300006847 Bacteria 3145
245 Ga0075431_100134472 3300006847 Bacteria 2549
246 Ga0075431_100210863 3300006847 Bacteria 1984
247 Ga0075431_100359785 3300006847 Unclassified 1462
248 Ga0075431_100365266 3300006847 Unclassified 1449
249 Ga0075431_100379848 3300006847 Bacteria 1417
250 Ga0075431_100514590 3300006847 Unclassified 1187
251 Ga0075431_100626470 3300006847 Unclassified 1058
252 Ga0075433_10000202 3300006852 Bacteria 33478
253 Ga0075433_10001786 3300006852 Bacteria 16117
254 Ga0075433_10003482 3300006852 Bacteria 12158
255 Ga0075433_10042323 3300006852 Bacteria 3951
256 Ga0075433_10098939 3300006852 Bacteria 2582
257 Ga0075433_10146676 3300006852 Bacteria 2098
258 Ga0075433_10162575 3300006852 Bacteria 1987
259 Ga0075433_10333096 3300006852 Bacteria 1342
260 Ga0075434_100000875 3300006871 Bacteria 24088
261 Ga0075434_100016237 3300006871 Bacteria 7156
262 Ga0075434_100030656 3300006871 Bacteria 5297
263 Ga0075434_100082095 3300006871 Unclassified 3220
264 Ga0075434_100093703 3300006871 Bacteria 3007
265 Ga0075434_100120243 3300006871 Bacteria 2641
266 Ga0075434_100544748 3300006871 Unclassified 1180
267 Ga0075429_100003511 3300006880 Bacteria 13368
268 Ga0075429_100010406 3300006880 Bacteria 8049
269 Ga0075429_100061640 3300006880 Unclassified 3268
270 Ga0075429_100072231 3300006880 Unclassified 3005
271 Ga0075429_100074273 3300006880 Unclassified 2962
272 Ga0075429_100080109 3300006880 Unclassified 2846
273 Ga0075429_100091450 3300006880 Bacteria 2654
274 Ga0075429_100104488 3300006880 Bacteria 2474
275 Ga0075429_100109643 3300006880 Bacteria 2413
276 Ga0075429_100212024 3300006880 Unclassified 1697
277 Ga0075429_100219241 3300006880 Bacteria 1667
278 Ga0068865_100004621 3300006881 Bacteria 8315
279 Ga0075436_100027966 3300006914 Bacteria 3881
280 Ga0097620_100005105 3300006931 Bacteria 13335
281 Ga0097620_100009922 3300006931 Bacteria 9611
282 Ga0097620_100012593 3300006931 Bacteria 8505
283 Ga0097620_100060387 3300006931 Bacteria 3820
284 Ga0097620_100079721 3300006931 Bacteria 3315
285 Ga0097620_100237898 3300006931 Unclassified 1910
286 Ga0075435_100004350 3300007076 Bacteria 9734
287 Ga0075435_100032944 3300007076 Bacteria 4094
288 Ga0075435_100192506 3300007076 Bacteria 1726
289 Ga0111539_10005953 3300009094 Bacteria 15750
290 Ga0111539_10007864 3300009094 Bacteria 13616
291 Ga0111539_10009385 3300009094 Bacteria 12349
292 Ga0111539_10034066 3300009094 Bacteria 6179
293 Ga0111539_10059762 3300009094 Unclassified 4519
294 Ga0111539_10074765 3300009094 Unclassified 3993
295 Ga0111539_10094768 3300009094 Unclassified 3507
296 Ga0111539_10126120 3300009094 Bacteria 2999
297 Ga0111539_10132362 3300009094 Bacteria 2920
298 Ga0111539_10134852 3300009094 Bacteria 2891
299 Ga0111539_10232020 3300009094 Bacteria 2149
300 Ga0111539_10243421 3300009094 Bacteria 2094
301 Ga0105245_10249724 3300009098 Unclassified 1723
302 Ga0105245_10721333 3300009098 Bacteria 1031
303 Ga0105247_10009735 3300009101 Bacteria 5828
304 Ga0105247_10285540 3300009101 Unclassified 1140
305 Ga0114129_10000022 3300009147 Bacteria 119291
306 Ga0114129_10003016 3300009147 Bacteria 23605
307 Ga0114129_10003432 3300009147 Bacteria 22271
308 Ga0114129_10013890 3300009147 Bacteria 11474
309 Ga0114129_10017528 3300009147 Bacteria 10197
310 Ga0114129_10028685 3300009147 Bacteria 7885
311 Ga0114129_10046369 3300009147 Bacteria 6108
312 Ga0114129_10057192 3300009147 Bacteria 5460
313 Ga0114129_10067969 3300009147 Bacteria 4969
314 Ga0114129_10074127 3300009147 Bacteria 4741
315 Ga0114129_10093312 3300009147 Unclassified 4170
316 Ga0114129_10100099 3300009147 Bacteria 4011
317 Ga0114129_10106729 3300009147 Bacteria 3868
318 Ga0114129_10188764 3300009147 Bacteria 2800
319 Ga0114129_10228245 3300009147 Bacteria 2508
320 Ga0114129_10422479 3300009147 Bacteria 1753
321 Ga0114129_10428859 3300009147 Bacteria 1737
322 Ga0114129_10665167 3300009147 Bacteria 1343
323 Ga0114129_10696160 3300009147 Bacteria 1306
324 Ga0114129_10701113 3300009147 Bacteria 1301
325 Ga0114129_11075208 3300009147 Bacteria 1009
326 Ga0105248_10008525 3300009177 Bacteria 11255
327 Ga0105248_10011617 3300009177 Bacteria 9701
328 Ga0105248_10011763 3300009177 Bacteria 9653
329 Ga0105248_10026048 3300009177 Bacteria 6506
330 Ga0105248_10051068 3300009177 Bacteria 4640
331 Ga0105248_10083496 3300009177 Bacteria 3593
332 Ga0105248_10130990 3300009177 Bacteria 2830
333 Ga0105248_10264336 3300009177 Bacteria 1937
334 Ga0105248_10544546 3300009177 Bacteria 1309
335 Ga0105248_10633814 3300009177 Bacteria 1206
336 Ga0105248_10712024 3300009177 Bacteria 1133
337 Ga0105248_10775390 3300009177 Bacteria 1082
338 Ga0105237_10135419 3300009545 Unclassified 2458
339 Ga0105249_10002178 3300009553 Bacteria 16974
340 Ga0105249_10033902 3300009553 Unclassified 4624
341 Ga0105249_10086394 3300009553 Bacteria 2925
342 Ga0105249_10194900 3300009553 Unclassified 1979
343 Ga0105249_10328074 3300009553 Bacteria 1543
344 Ga0105249_10405995 3300009553 Bacteria 1394
345 Ga0105249_10460113 3300009553 Bacteria 1312
346 Ga0105239_10055042 3300010375 Bacteria 4364
347 Ga0105246_10151349 3300011119 Unclassified 1757
348 Ga0105246_10170480 3300011119 Unclassified 1666
349 Ga0157369_10393377 3300013105 Bacteria 1438
350 Ga0157374_10014200 3300013296 Bacteria 6964
351 Ga0163162_10057350 3300013306 Bacteria 3923
352 Ga0157372_10744242 3300013307 Bacteria 1140
353 Ga0157375_10004391 3300013308 Bacteria 12242
354 Ga0157375_10215352 3300013308 Bacteria 2078
355 Ga0157375_10459444 3300013308 Bacteria 1439
356 Ga0157375_10704525 3300013308 Unclassified 1163
357 Ga0163163_10012072 3300014325 Bacteria 7859
358 Ga0163163_10040189 3300014325 Unclassified 4567
359 Ga0163163_10153205 3300014325 Bacteria 2348
360 Ga0157380_10012655 3300014326 Bacteria 6124
361 Ga0157380_10053866 3300014326 Unclassified 3191
362 Ga0157380_10124633 3300014326 Unclassified 2188
363 Ga0157380_10129036 3300014326 Bacteria 2154
364 Ga0157380_10158026 3300014326 Bacteria 1967
365 Ga0157380_10210677 3300014326 Bacteria 1731
366 Ga0157380_10265621 3300014326 Bacteria 1561
367 Ga0157380_10360187 3300014326 Bacteria 1364
368 Ga0157377_10008902 3300014745 Bacteria 4911
369 Ga0157377_10031373 3300014745 Bacteria 2887
370 Ga0157379_10016566 3300014968 Bacteria 6481
371 Ga0157379_10017284 3300014968 Bacteria 6354
372 Ga0157379_10073242 3300014968 Unclassified 3065
373 Ga0157376_10028990 3300014969 Bacteria 4406
374 Ga0163161_10087470 3300017792 Unclassified 2302
375 Ga0163161_10116583 3300017792 Bacteria 2002
376 Ga0206356_10432168 3300020070 Unclassified 933
377 Ga0213872_10116995 3300021361 Bacteria 1180
378 Ga0224712_10197880 3300022467 Unclassified 912
379 Ga0207697_10001648 3300025315 Bacteria 12069
380 Ga0207697_10010073 3300025315 Unclassified 4059
381 Ga0207697_10015174 3300025315 Bacteria 3186
382 Ga0207697_10093832 3300025315 Bacteria 1273
383 Ga0207682_10008517 3300025893 Unclassified 4052
384 Ga0207682_10021451 3300025893 Bacteria 2541
385 Ga0207642_10154808 3300025899 Unclassified 1224
386 Ga0207710_10006846 3300025900 Bacteria 4851
387 Ga0207688_10013358 3300025901 Bacteria 4461
388 Ga0207688_10058421 3300025901 Unclassified 2170
389 Ga0207680_10021614 3300025903 Unclassified 3484
390 Ga0207680_10025785 3300025903 Bacteria 3247
391 Ga0207680_10118406 3300025903 Bacteria 1729
392 Ga0207680_10196220 3300025903 Bacteria 1373
393 Ga0207680_10265102 3300025903 Bacteria 1190
394 Ga0207647_10136441 3300025904 Bacteria 1440
395 Ga0207645_10003388 3300025907 Bacteria 12118
396 Ga0207645_10040789 3300025907 Bacteria 2973
397 Ga0207645_10137629 3300025907 Unclassified 1590
398 Ga0207643_10002413 3300025908 Bacteria 10115
399 Ga0207684_10178354 3300025910 Bacteria 1832
400 Ga0207707_10041639 3300025912 Bacteria 4011
401 Ga0207662_10011372 3300025918 Bacteria 4933
402 Ga0207662_10022232 3300025918 Bacteria 3633
403 Ga0207662_10215739 3300025918 Bacteria 1247
404 Ga0207657_10216614 3300025919 Bacteria 1535
405 Ga0207649_10004162 3300025920 Bacteria 7879
406 Ga0207652_10276834 3300025921 Bacteria 1514
407 Ga0207646_10112952 3300025922 Bacteria 2438
408 Ga0207681_10009018 3300025923 Bacteria 6094
409 Ga0207681_10024466 3300025923 Bacteria 3876
410 Ga0207681_10041155 3300025923 Bacteria 3079
411 Ga0207681_10041333 3300025923 Unclassified 3073
412 Ga0207681_10105521 3300025923 Unclassified 2040
413 Ga0207681_10228473 3300025923 Bacteria 1443
414 Ga0207650_10009691 3300025925 Bacteria 6585
415 Ga0207650_10025629 3300025925 Unclassified 4201
416 Ga0207650_10085355 3300025925 Unclassified 2402
417 Ga0207650_10120578 3300025925 Unclassified 2041
418 Ga0207650_10149901 3300025925 Bacteria 1840
419 Ga0207650_10170112 3300025925 Unclassified 1731
420 Ga0207650_10207765 3300025925 Bacteria 1571
421 Ga0207650_10464442 3300025925 Bacteria 1055
422 Ga0207659_10057797 3300025926 Unclassified 2783
423 Ga0207659_10255952 3300025926 Unclassified 1422
424 Ga0207659_10296426 3300025926 Bacteria 1327
425 Ga0207644_10030834 3300025931 Bacteria 3732
426 Ga0207644_10163895 3300025931 Unclassified 1730
427 Ga0207644_10180956 3300025931 Bacteria 1652
428 Ga0207690_10373539 3300025932 Bacteria 1132
429 Ga0207706_10006664 3300025933 Bacteria 10678
430 Ga0207706_10057575 3300025933 Bacteria 3424
431 Ga0207706_10084872 3300025933 Unclassified 2784
432 Ga0207706_10229777 3300025933 Bacteria 1623
433 Ga0207706_10428455 3300025933 Bacteria 1146
434 Ga0207706_10504749 3300025933 Bacteria 1044
435 Ga0207686_10033165 3300025934 Bacteria 3080
436 Ga0207670_10009343 3300025936 Bacteria 5593
437 Ga0207670_10021772 3300025936 Bacteria 3960
438 Ga0207670_10110882 3300025936 Bacteria 1977
439 Ga0207670_10149820 3300025936 Unclassified 1730
440 Ga0207670_10470744 3300025936 Unclassified 1016
441 Ga0207670_10717644 3300025936 Bacteria 829
442 Ga0207669_10004070 3300025937 Bacteria 6404
443 Ga0207669_10128460 3300025937 Unclassified 1736
444 Ga0207669_10230104 3300025937 Bacteria 1367
445 Ga0207669_10289904 3300025937 Unclassified 1239
446 Ga0207704_10039222 3300025938 Unclassified 2755
447 Ga0207704_10044350 3300025938 Bacteria 2634
448 Ga0207704_10106645 3300025938 Bacteria 1882
449 Ga0207691_10005619 3300025940 Bacteria 12118
450 Ga0207691_10027372 3300025940 Bacteria 5344
451 Ga0207691_10043702 3300025940 Bacteria 4128
452 Ga0207691_10090897 3300025940 Unclassified 2736
453 Ga0207691_10099066 3300025940 Bacteria 2603
454 Ga0207691_10292231 3300025940 Bacteria 1401
455 Ga0207691_10307917 3300025940 Unclassified 1360
456 Ga0207711_10027516 3300025941 Bacteria 4776
457 Ga0207711_10052589 3300025941 Bacteria 3491
458 Ga0207711_10074932 3300025941 Bacteria 2944
459 Ga0207711_10084800 3300025941 Bacteria 2774
460 Ga0207689_10003959 3300025942 Bacteria 13486
461 Ga0207689_10032589 3300025942 Bacteria 4333
462 Ga0207689_10057367 3300025942 Unclassified 3204
463 Ga0207689_10095679 3300025942 Bacteria 2439
464 Ga0207661_10002490 3300025944 Bacteria 12676
465 Ga0207679_10004135 3300025945 Bacteria 9014
466 Ga0207679_10027193 3300025945 Bacteria 3954
467 Ga0207679_10040304 3300025945 Bacteria 3342
468 Ga0207679_10511831 3300025945 Unclassified 1072
469 Ga0207679_10515363 3300025945 Unclassified 1069
470 Ga0207667_10194720 3300025949 Bacteria 2080
471 Ga0207651_10010174 3300025960 Bacteria 5198
472 Ga0207651_10013855 3300025960 Bacteria 4632
473 Ga0207651_10032756 3300025960 Bacteria 3343
474 Ga0207651_10077103 3300025960 Unclassified 2385
475 Ga0207651_10091539 3300025960 Bacteria 2227
476 Ga0207651_10419135 3300025960 Bacteria 1143
477 Ga0207712_10022462 3300025961 Unclassified 4154
478 Ga0207712_10041146 3300025961 Bacteria 3175
479 Ga0207712_10617526 3300025961 Bacteria 939
480 Ga0207668_10040164 3300025972 Bacteria 3155
481 Ga0207658_10009565 3300025986 Bacteria 6579
482 Ga0207658_10066652 3300025986 Bacteria 2709
483 Ga0207658_10373534 3300025986 Unclassified 1247
484 Ga0207677_10040009 3300026023 Bacteria 3087
485 Ga0207677_10628803 3300026023 Unclassified 945
486 Ga0207703_10006715 3300026035 Bacteria 9182
487 Ga0207703_10068704 3300026035 Bacteria 2920
488 Ga0207703_10070905 3300026035 Bacteria 2877
489 Ga0207703_10329503 3300026035 Bacteria 1400
490 Ga0207703_10480732 3300026035 Bacteria 1164
491 Ga0207678_10008867 3300026067 Bacteria 8856
492 Ga0207708_10006488 3300026075 Bacteria 8666
493 Ga0207708_10025427 3300026075 Bacteria 4478
494 Ga0207708_10034925 3300026075 Bacteria 3825
495 Ga0207708_10036468 3300026075 Bacteria 3743
496 Ga0207708_10193915 3300026075 Bacteria 1618
497 Ga0207702_10150743 3300026078 Bacteria 2115
498 Ga0207702_10614272 3300026078 Bacteria 1067
499 Ga0207702_11120401 3300026078 Bacteria 781
500 Ga0207641_10000198 3300026088 Bacteria 81646
501 Ga0207641_10000259 3300026088 Bacteria 67298
502 Ga0207641_10051564 3300026088 Bacteria 3485
503 Ga0207641_10058303 3300026088 Bacteria 3286
504 Ga0207641_10070828 3300026088 Bacteria 2997
505 Ga0207648_10000246 3300026089 Bacteria 58501
506 Ga0207648_10017826 3300026089 Bacteria 6443
507 Ga0207648_10165985 3300026089 Unclassified 1951
508 Ga0207648_10229136 3300026089 Bacteria 1652
509 Ga0207676_10010909 3300026095 Bacteria 6482
510 Ga0207676_10035502 3300026095 Bacteria 3784
511 Ga0207676_10434658 3300026095 Bacteria 1234
512 Ga0207674_10030346 3300026116 Bacteria 5684
513 Ga0207674_10093971 3300026116 Bacteria 2986
514 Ga0207674_10252094 3300026116 Bacteria 1712
515 Ga0207674_10536165 3300026116 Unclassified 1131
516 Ga0207675_100001075 3300026118 Bacteria 27143
517 Ga0207675_100027442 3300026118 Bacteria 5303
518 Ga0207675_100082957 3300026118 Bacteria 3006
519 Ga0207675_100132571 3300026118 Bacteria 2363
520 Ga0207675_100194483 3300026118 Unclassified 1947
521 Ga0207675_100241277 3300026118 Bacteria 1746
522 Ga0207675_100341765 3300026118 Bacteria 1465
523 Ga0207683_10003979 3300026121 Bacteria 12810
524 Ga0207683_10006075 3300026121 Bacteria 10341
525 Ga0207683_10027139 3300026121 Bacteria 4949
526 Ga0207683_10127770 3300026121 Bacteria 2285
527 Ga0207698_10040220 3300026142 Bacteria 3471
528 Ga0207698_10535965 3300026142 Bacteria 1145
529 Ga0210000_1017153 3300027462 Bacteria 1097
530 Ga0209971_1007621 3300027682 Bacteria 2568
531 Ga0209813_10019325 3300027866 Bacteria 1892
532 Ga0209974_10014860 3300027876 Bacteria 2585
533 Ga0209974_10015823 3300027876 Bacteria 2505
534 Ga0209974_10104232 3300027876 Bacteria 993
535 Ga0207428_10003486 3300027907 Bacteria 15254
536 Ga0207428_10005664 3300027907 Bacteria 11604
537 Ga0207428_10009483 3300027907 Bacteria 8717
538 Ga0207428_10024378 3300027907 Bacteria 5079
539 Ga0207428_10039646 3300027907 Unclassified 3825
540 Ga0207428_10092849 3300027907 Unclassified 2342
541 Ga0207428_10139122 3300027907 Bacteria 1854
542 Ga0207428_10276750 3300027907 Bacteria 1247
543 Ga0268266_10006015 3300028379 Bacteria 11195
544 Ga0268266_10696669 3300028379 Bacteria 979
545 Ga0268265_10001488 3300028380 Bacteria 19626
546 Ga0268265_10031270 3300028380 Bacteria 3843
547 Ga0268265_10079108 3300028380 Bacteria 2588
548 Ga0268265_10079933 3300028380 Bacteria 2577
549 Ga0268265_10115558 3300028380 Unclassified 2200
550 Ga0268265_10267468 3300028380 Bacteria 1523
551 Ga0268265_10513505 3300028380 Bacteria 1131
552 Ga0268264_10000588 3300028381 Bacteria 44134
553 Ga0268264_10026990 3300028381 Bacteria 4691
554 Ga0268264_10043169 3300028381 Bacteria 3735
555 Ga0268264_10118510 3300028381 Bacteria 2330
556 Ga0307513_10011871 3300031456 Bacteria 10792
557 Ga0307408_100008140 3300031548 Bacteria 6927
558 Ga0307408_100025388 3300031548 Bacteria 4059
559 Ga0307408_100057087 3300031548 Bacteria 2833
560 Ga0307408_100122298 3300031548 Bacteria 2018
561 Ga0307408_100356642 3300031548 Unclassified 1242
562 Ga0307405_10018703 3300031731 Unclassified 3829
563 Ga0307405_10019998 3300031731 Bacteria 3731
564 Ga0307405_10296649 3300031731 Unclassified 1224
565 Ga0307405_10613795 3300031731 Bacteria 889
566 Ga0307413_10012181 3300031824 Unclassified 4270
567 Ga0307410_10041729 3300031852 Bacteria 3027
568 Ga0307410_10321541 3300031852 Unclassified 1228
569 Ga0307410_10424445 3300031852 Bacteria 1079
570 Ga0307410_10518800 3300031852 Unclassified 983
571 Ga0307406_10146209 3300031901 Bacteria 1680
572 Ga0307407_10010767 3300031903 Bacteria 4326
573 Ga0307407_10012301 3300031903 Unclassified 4108
574 Ga0307412_10018836 3300031911 Bacteria 4165
575 Ga0307412_10137366 3300031911 Bacteria 1785
576 Ga0307412_10329362 3300031911 Bacteria 1218
577 Ga0307412_10333543 3300031911 Unclassified 1211
578 Ga0307412_10336223 3300031911 Bacteria 1207
579 Ga0307409_100022631 3300031995 Unclassified 4335
580 Ga0307409_100065980 3300031995 Bacteria 2851
581 Ga0307409_100289646 3300031995 Bacteria 1518
582 Ga0307416_100015969 3300032002 Bacteria 5203
583 Ga0307416_100021724 3300032002 Unclassified 4614
584 Ga0307416_100029729 3300032002 Bacteria 4087
585 Ga0307416_100055276 3300032002 Bacteria 3196
586 Ga0307416_100374730 3300032002 Bacteria 1451
587 Ga0307416_100392854 3300032002 Bacteria 1422
588 Ga0307416_100399580 3300032002 Bacteria 1411
589 Ga0307416_100563096 3300032002 Bacteria 1215
590 Ga0307414_10038982 3300032004 Unclassified 3196
591 Ga0307414_10123129 3300032004 Bacteria 1998
592 Ga0307414_10480891 3300032004 Unclassified 1095
593 Ga0307411_10031137 3300032005 Bacteria 3278
594 Ga0307411_10034924 3300032005 Unclassified 3133
595 Ga0307411_10041035 3300032005 Bacteria 2941
596 Ga0307411_10058672 3300032005 Bacteria 2548
597 Ga0307411_10068882 3300032005 Bacteria 2387
598 Ga0307415_100008598 3300032126 Bacteria 5669
599 Ga0307415_100011264 3300032126 Bacteria 5110
600 Ga0307415_100278900 3300032126 Bacteria 1373
601 Ga0373960_0017586 3300035121 Bacteria 1854
602 Ga0373955_0343741 3300035172 Unclassified 903
603 Ga0373961_0000297 3300035241 Bacteria 22207
604 Ga0373962_0061062 3300035242 Unclassified 1107
605 Ga0373931_0171100 3300035691 Bacteria 1280
606 Ga0373933_0335936 3300035724 Bacteria 980
607 Ga0373937_0051107 3300036401 Unclassified 3789
608 Ga0373925_0746146 3300037068 Bacteria 807
609 Ga0395899_0422937 3300037312 Bacteria 877
610 Ga0395900_0049548 3300037418 Bacteria 4328
611 Ga0395900_0340172 3300037418 Bacteria 1476
612 Ga0395898_0211834 3300037466 Bacteria 1848
613 Ga0395898_0621401 3300037466 Unclassified 1023
614 Ga0395905_0059052 3300037471 Bacteria 3586
615 Ga0395905_0084219 3300037471 Bacteria 2979
616 Ga0395901_0177997 3300038443 Bacteria 2230
617 Ga0395901_0400049 3300038443 Bacteria 1411
618 Ga0436365_1614654 3300039437 Bacteria 6289
619 Ga0436361_0942135 3300039447 Bacteria 2901
620 Ga0439433_0005167 3300041999 Bacteria 2805
621 Ga0439433_0031053 3300041999 Bacteria 1222
622 Ga0439450_016156 3300042008 Bacteria 1539
623 Ga0439451_035945 3300042009 Bacteria 996
624 Ga0439435_0003900 3300042436 Bacteria 3158
625 Ga0439435_0013465 3300042436 Bacteria 2000
626 Ga0439435_0051849 3300042436 Bacteria 1177
627 Ga0439435_0065028 3300042436 Bacteria 1069
628 Ga0439435_0066706 3300042436 Bacteria 1058
629 Ga0439435_0109146 3300042436 Bacteria 857
630 Ga0439444_0023359 3300042437 Bacteria 1109
631 Ga0439444_0045118 3300042437 Bacteria 879
632 Ga0439464_0002455 3300042439 Bacteria 4560
633 Ga0439464_0050234 3300042439 Bacteria 1204
634 Ga0439460_0009321 3300042461 Bacteria 2492
635 Ga0439460_0057246 3300042461 Bacteria 1182
636 Ga0439460_0077691 3300042461 Bacteria 1038
637 Ga0451577_0056963 3300042876 Bacteria 3485
638 Ga0451577_0076842 3300042876 Bacteria 2977
639 Ga0451577_0767595 3300042876 Bacteria 872
640 Ga0453684_0786377 3300044712 Bacteria 1027
641 Ga0451576_0043858 3300045051 Unclassified 4717
642 Ga0451576_0048477 3300045051 Unclassified 4461
643 Ga0451576_0146119 3300045051 Unclassified 2465
644 Ga0451576_0517300 3300045051 Unclassified 1254
645 Ga0495603_0269556 3300046455 Bacteria 979
646 Ga0495642_0014741 3300046528 Bacteria 3032
647 Ga0495598_0008216 3300046537 Unclassified 2422
648 Ga0495668_0124076 3300046616 Bacteria 1413
649 Ga0495625_0223882 3300046660 Bacteria 1231
650 Ga0495613_0005490 3300046689 Bacteria 9527
651 Ga0495636_0044302 3300047318 Bacteria 1852
652 Ga0495674_0101914 3300047319 Bacteria 2442
653 Ga0495672_0001520 3300047320 Bacteria 22733
654 Ga0495672_0249622 3300047320 Bacteria 862
655 Ga0496102_0137055 3300048905 Bacteria 2294
656 Ga0496103_0366014 3300048906 Bacteria 927
657 Ga0496104_0005034 3300048907 Bacteria 11527
658 Ga0496104_0013360 3300048907 Bacteria 7399
659 Ga0496104_0033034 3300048907 Bacteria 4817
660 Ga0496104_0264633 3300048907 Bacteria 1632
661 Ga0496104_0559162 3300048907 Bacteria 1055
662 Ga0496105_0022305 3300048908 Bacteria 5128
663 Ga0496105_0090782 3300048908 Bacteria 2523
664 Ga0496106_0035091 3300048909 Bacteria 3749
665 Ga0496108_0018786 3300048911 Bacteria 5666
666 Ga0496108_0827344 3300048911 Bacteria 798
667 Ga0496109_0001054 3300048912 Bacteria 22785
668 Ga0496109_0034897 3300048912 Bacteria 4534
669 Ga0496109_0252495 3300048912 Unclassified 1661
670 Ga0496109_0542849 3300048912 Unclassified 1097
671 Ga0496110_0002072 3300048913 Bacteria 14946
672 Ga0496110_0003883 3300048913 Bacteria 11500
673 Ga0496111_0064665 3300048914 Bacteria 2654
674 Ga0496111_0321780 3300048914 Unclassified 1145
675 Ga0496112_0003061 3300048915 Bacteria 13692
676 Ga0496112_0005221 3300048915 Bacteria 11180
677 Ga0496112_0058506 3300048915 Bacteria 3796
678 Ga0496113_0074500 3300048916 Unclassified 2588
679 Ga0496113_0094299 3300048916 Bacteria 2312
680 Ga0496114_0465612 3300048917 Unclassified 1119
681 Ga0496115_0122921 3300048918 Bacteria 2136
682 Ga0496117_0185733 3300048920 Bacteria 1190
683 Ga0496118_0016401 3300048921 Bacteria 6799
684 Ga0496121_0000243 3300048924 Bacteria 116698
685 Ga0501299_022347 3300049522 Unclassified 1166
686 Ga0501032_0278000 3300049569 Unclassified 1084
687 Ga0501032_0293391 3300049569 Bacteria 1052
688 Ga0501034_0039253 3300049571 Bacteria 4795
689 Ga0501036_0156950 3300049572 Unclassified 1919
690 Ga0501036_0218330 3300049572 Bacteria 1601
691 Ga0501036_0279380 3300049572 Bacteria 1398
692 Ga0501036_0351264 3300049572 Unclassified 1231
693 Ga0501038_0157232 3300049574 Bacteria 1850
694 Ga0501038_0424801 3300049574 Bacteria 1025
695 Ga0501040_0020560 3300049576 Bacteria 4401
696 Ga0501040_0155555 3300049576 Bacteria 1614
697 Ga0501041_0010636 3300049577 Bacteria 5426
698 Ga0501041_0011231 3300049577 Bacteria 5291
699 Ga0501041_0162503 3300049577 Bacteria 1396
700 Ga0501041_0289185 3300049577 Bacteria 1032
701 Ga0501042_0063830 3300049578 Bacteria 2632
702 Ga0501042_0085180 3300049578 Bacteria 2266
703 Ga0501042_0195223 3300049578 Bacteria 1460
704 Ga0501042_0212026 3300049578 Bacteria 1397
705 Ga0501043_0106457 3300049579 Bacteria 2203
706 Ga0501043_0343542 3300049579 Bacteria 1135
707 Ga0501046_0035947 3300049580 Bacteria 3989
708 Ga0501047_0052331 3300049581 Bacteria 3947
709 Ga0501048_0033566 3300049582 Bacteria 3707
710 Ga0501048_0224436 3300049582 Bacteria 1333
711 Ga0501068_0332508 3300049584 Bacteria 975
712 Ga0501069_0214318 3300049585 Bacteria 1118
713 Ga0501071_0013769 3300049587 Bacteria 5517
714 Ga0501071_0107076 3300049587 Unclassified 2064
715 Ga0501071_0119398 3300049587 Bacteria 1954
716 Ga0501071_0191228 3300049587 Bacteria 1535
717 Ga0501072_0032275 3300049588 Bacteria 4102
718 Ga0501072_0042098 3300049588 Bacteria 3588
719 Ga0501072_0091050 3300049588 Bacteria 2421
720 Ga0501072_0103309 3300049588 Bacteria 2265
721 Ga0501072_0335317 3300049588 Bacteria 1201
722 Ga0501074_0105851 3300049590 Unclassified 2014
723 Ga0501074_0270389 3300049590 Bacteria 1208
724 Ga0501075_0019019 3300049591 Bacteria 4981
725 Ga0501075_0081685 3300049591 Bacteria 2447
726 Ga0501075_0163142 3300049591 Bacteria 1700
727 Ga0501075_0427074 3300049591 Bacteria 1010
728 Ga0501075_0488749 3300049591 Bacteria 939
729 Ga0501076_0005097 3300049592 Bacteria 9406
730 Ga0501076_0047976 3300049592 Bacteria 3376
731 Ga0501076_0130401 3300049592 Bacteria 2039
732 Ga0501076_0165266 3300049592 Bacteria 1804
733 Ga0501076_0288425 3300049592 Bacteria 1345
734 Ga0501077_0393637 3300049593 Bacteria 885
735 Ga0501217_079764 3300049661 Unclassified 904
736 Ga0501235_031445 3300049669 Unclassified 1199
737 Ga0501247_011556 3300049677 Unclassified 1066
738 Ga0501245_011486 3300049708 Unclassified 1290
739 Ga0501079_0052049 3300049741 Bacteria 3162
740 Ga0501079_0202364 3300049741 Unclassified 1551
741 Ga0501079_0211818 3300049741 Unclassified 1514
742 Ga0501080_0212064 3300049742 Bacteria 1775
743 Ga0501080_0432865 3300049742 Bacteria 1181
744 Ga0501080_0856980 3300049742 Bacteria 794
745 Ga0501081_0209315 3300049743 Bacteria 1416
746 Ga0501081_0331772 3300049743 Unclassified 1119
747 Ga0501272_004728 3300049769 Bacteria 1421
748 Ga0501274_010984 3300049771 Unclassified 841
749 Ga0501283_025443 3300049779 Unclassified 969
750 Ga0501044_0027646 3300049823 Bacteria 5990
751 Ga0501045_0020019 3300049824 Bacteria 4777
752 Ga0501045_0024508 3300049824 Bacteria 4333
753 Ga0501045_0031413 3300049824 Bacteria 3847
754 Ga0501045_0061736 3300049824 Bacteria 2750
755 nmdc:mga03683_12926_c1 3300050489 Bacteria 3061
756 nmdc:mga03n38_133976_c1 3300050490 Bacteria 1231
757 nmdc:mga00v17_19639_c1 3300050491 Bacteria 3862
758 nmdc:mga0yw44_156896_c1 3300050492 Bacteria 1488
759 nmdc:mga0yw44_30218_c1 3300050492 Bacteria 3136
760 nmdc:mga0k408_320004_c1 3300050493 Bacteria 926
761 nmdc:mga0k408_76872_c1 3300050493 Unclassified 1952
762 nmdc:mga06z11_246932_c1 3300050494 Bacteria 1050
763 nmdc:mga06z11_32907_c1 3300050494 Bacteria 2532
764 nmdc:mga04h51_20370_c1 3300050495 Bacteria 1979
765 nmdc:mga07m45_49442_c1 3300050496 Bacteria 2008
766 nmdc:mga05p37_107342_c1 3300050507 Bacteria 3435
767 nmdc:mga05p37_1074_c1 3300050507 Bacteria 31305
768 nmdc:mga05p37_129618_c1 3300050507 Bacteria 3095
769 nmdc:mga05p37_161143_c1 3300050507 Bacteria 2740
770 nmdc:mga05p37_170381_c1 3300050507 Bacteria 2655
771 nmdc:mga05p37_191001_c1 3300050507 Bacteria 2486
772 nmdc:mga05p37_227632_c2 3300050507 Bacteria 1998
773 nmdc:mga05p37_232050_c1 3300050507 Unclassified 2223
774 nmdc:mga05p37_24240_c1 3300050507 Bacteria 7372
775 nmdc:mga05p37_254208_c1 3300050507 Bacteria 2106
776 nmdc:mga05p37_2653_c1 3300050507 Bacteria 20833
777 nmdc:mga05p37_27424_c1 3300050507 Bacteria 6933
778 nmdc:mga05p37_321996_c1 3300050507 Bacteria 1829
779 nmdc:mga05p37_403023_c1 3300050507 Bacteria 1597
780 nmdc:mga05p37_467662_c1 3300050507 Bacteria 1456
781 nmdc:mga05p37_483921_c1 3300050507 Bacteria 1425
782 nmdc:mga05p37_486290_c1 3300050507 Bacteria 1420
783 nmdc:mga05p37_4973_c1 3300050507 Bacteria 15580
784 nmdc:mga05p37_551536_c1 3300050507 Bacteria 1312
785 nmdc:mga05p37_82607_c1 3300050507 Bacteria 3959
786 nmdc:mga05p37_83_c1 3300050507 Bacteria 83944
787 nmdc:mga05p37_869737_c1 3300050507 Bacteria 976
788 nmdc:mga05p37_876_c1 3300050507 Bacteria 33908
789 nmdc:mga09592_101092_c1 3300050508 Bacteria 2470
790 nmdc:mga09592_13552_c1 3300050508 Bacteria 6658
791 nmdc:mga09592_15786_c1 3300050508 Bacteria 6170
792 nmdc:mga09592_242959_c1 3300050508 Bacteria 1560
793 nmdc:mga09592_36829_c1 3300050508 Bacteria 4100
794 nmdc:mga09592_41866_c1 3300050508 Bacteria 3853
795 nmdc:mga09592_42919_c1 3300050508 Bacteria 3804
796 nmdc:mga09592_46796_c1 3300050508 Unclassified 3644
797 nmdc:mga09592_58391_c1 3300050508 Bacteria 3262
798 nmdc:mga09592_7978_c1 3300050508 Bacteria 8604
799 nmdc:mga09592_90410_c1 3300050508 Bacteria 2615
800 nmdc:mga0qj67_10922_c1 3300050509 Bacteria 6795
801 nmdc:mga0qj67_116243_c1 3300050509 Bacteria 2161
802 nmdc:mga0qj67_16467_c1 3300050509 Bacteria 5608
803 nmdc:mga0qj67_17069_c1 3300050509 Bacteria 5515
804 nmdc:mga0qj67_203387_c1 3300050509 Bacteria 1609
805 nmdc:mga0qj67_230269_c1 3300050509 Bacteria 1504
806 nmdc:mga0qj67_35275_c1 3300050509 Bacteria 2159
807 nmdc:mga0qj67_56085_c1 3300050509 Unclassified 3123
808 nmdc:mga0qj67_57490_c1 3300050509 Bacteria 3083
809 nmdc:mga06r32_121634_c1 3300050510 Bacteria 2575
810 nmdc:mga06r32_160477_c1 3300050510 Unclassified 2230
811 nmdc:mga06r32_186599_c1 3300050510 Bacteria 2061
812 nmdc:mga06r32_20103_c1 3300050510 Bacteria 6141
813 nmdc:mga06r32_243033_c1 3300050510 Bacteria 1787
814 nmdc:mga06r32_279435_c1 3300050510 Bacteria 1657
815 nmdc:mga06r32_4267_c1 3300050510 Bacteria 12799
816 nmdc:mga06r32_4360_c1 3300050510 Bacteria 12657
817 nmdc:mga06r32_442461_c1 3300050510 Bacteria 1280
818 nmdc:mga06r32_52513_c1 3300050510 Unclassified 3904
819 nmdc:mga06r32_6742_c1 3300050510 Bacteria 10321
820 nmdc:mga06r32_785317_c1 3300050510 Bacteria 914
821 nmdc:mga08y16_100479_c1 3300050511 Bacteria 3012
822 nmdc:mga08y16_111173_c1 3300050511 Bacteria 2852
823 nmdc:mga08y16_1121_c1 3300050511 Bacteria 26404
824 nmdc:mga08y16_125171_c1 3300050511 Bacteria 2674
825 nmdc:mga08y16_206959_c1 3300050511 Unclassified 2032
826 nmdc:mga08y16_223798_c1 3300050511 Unclassified 1947
827 nmdc:mga08y16_2471_c1 3300050511 Bacteria 18972
828 nmdc:mga08y16_30792_c1 3300050511 Bacteria 5644
829 nmdc:mga08y16_7060_c1 3300050511 Bacteria 11789
830 nmdc:mga08y16_7865_c1 3300050511 Bacteria 11162
831 nmdc:mga0n895_251662_c1 3300050512 Unclassified 1793
832 nmdc:mga0n895_4356_c1 3300050512 Bacteria 11605
833 nmdc:mga0n895_48219_c1 3300050512 Bacteria 4168
834 nmdc:mga0n895_5029_c1 3300050512 Bacteria 10971
835 nmdc:mga0n895_5070_c1 3300050512 Bacteria 10936
836 nmdc:mga0n895_68276_c1 3300050512 Bacteria 3522
837 nmdc:mga0n895_768996_c1 3300050512 Bacteria 955
838 nmdc:mga0rr50_6819_c1 3300050513 Bacteria 6999
839 nmdc:mga08x19_73783_c1 3300050514 Bacteria 2228
840 nmdc:mga0a205_15411_c1 3300050515 Bacteria 7143
841 nmdc:mga0a205_16830_c1 3300050515 Bacteria 6847
842 nmdc:mga0a205_17912_c1 3300050515 Bacteria 6648
843 nmdc:mga0a205_29612_c1 3300050515 Bacteria 5240
844 nmdc:mga0a205_34306_c1 3300050515 Bacteria 4870
845 nmdc:mga0a205_43676_c1 3300050515 Bacteria 4320
846 nmdc:mga0a205_4439_c1 3300050515 Bacteria 12597
847 nmdc:mga0a205_50427_c2 3300050515 Bacteria 2602
848 nmdc:mga0a205_538788_c1 3300050515 Unclassified 1023
849 nmdc:mga0a205_606472_c1 3300050515 Unclassified 948
850 nmdc:mga0a205_76_c1 3300050515 Bacteria 54611
851 nmdc:mga0a205_96540_c1 3300050515 Unclassified 2854
852 nmdc:mga0sz30_29885_c1 3300050516 Bacteria 2248
853 Ga0495601_0075013 3300053077 Bacteria 2165
854 Ga0500588_0008931 3300053146 Bacteria 2362
855 Ga0501084_0067656 3300054114 Bacteria 2990
856 Ga0501084_0468328 3300054114 Unclassified 1065
857 Ga0501084_0580879 3300054114 Bacteria 947
858 Ga0590071_000030 3300059421 Bacteria 37230
859 Ga0590071_001388 3300059421 Bacteria 6417
860 Ga0590071_006653 3300059421 Bacteria 2745
861 Ga0590074_002044 3300059423 Unclassified 3306
862 Ga0590074_005177 3300059423 Unclassified 2156
863 Ga0590075_000351 3300059424 Bacteria 12827
864 Ga0590075_001856 3300059424 Bacteria 5132
865 Ga0590075_003200 3300059424 Bacteria 3895
866 Ga0590075_004308 3300059424 Unclassified 3367
867 Ga0590075_050806 3300059424 Bacteria 1064
868 Ga0590077_000390 3300059426 Bacteria 12365
869 Ga0590077_001322 3300059426 Bacteria 5851
870 Ga0587091_042773 3300059511 Bacteria 900
871 Ga0501082_0269423 3300060353 Bacteria 1482
872 Ga0530510_0006822 3300061734 Bacteria 7956
873 Ga0530510_0180631 3300061734 Bacteria 1565

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050515 nmdc:mga0a205_34306_c1 nmdc:mga0a205_34306_c1_4227_4859 209
2 3300026078 Ga0207702_11120401 Ga0207702_111204011 210
3 3300042876 Ga0451577_0767595 Ga0451577_0767595_16_654 210
4 3300050507 nmdc:mga05p37_486290_c1 nmdc:mga05p37_486290_c1_25_663 211
5 3300035724 Ga0373933_0335936 Ga0373933_0335936_24_680 212
6 3300048915 Ga0496112_0058506 Ga0496112_0058506_447_1235 218
7 3300005331 Ga0070670_100540427 Ga0070670_1005404272 219
8 3300005367 Ga0070667_100004567 Ga0070667_1000045676 219
9 3300005843 Ga0068860_100021964 Ga0068860_1000219644 219
10 3300009177 Ga0105248_10633814 Ga0105248_106338142 219
11 3300025925 Ga0207650_10464442 Ga0207650_104644421 219
12 3300026118 Ga0207675_100341765 Ga0207675_1003417652 219
13 3300028381 Ga0268264_10118510 Ga0268264_101185103 219
14 3300048921 Ga0496118_0016401 Ga0496118_0016401_1558_2355 220
15 3300048924 Ga0496121_0000243 Ga0496121_0000243_74640_75437 220
16 3300014326 Ga0157380_10360187 Ga0157380_103601872 227
17 3300032002 Ga0307416_100563096 Ga0307416_1005630962 228
18 3300053146 Ga0500588_0008931 Ga0500588_0008931_985_2127 228
19 3300005441 Ga0070700_100506285 Ga0070700_1005062851 230
20 3300005518 Ga0070699_100000485 Ga0070699_10000048532 230
21 3300021361 Ga0213872_10116995 Ga0213872_101169952 230
22 3300039447 Ga0436361_0942135 Ga0436361_0942135_192_980 230
23 3300005548 Ga0070665_100028846 Ga0070665_1000288468 231
24 3300005618 Ga0068864_100064648 Ga0068864_1000646483 231
25 3300005841 Ga0068863_100000005 Ga0068863_100000005221 231
26 3300005842 Ga0068858_100009898 Ga0068858_1000098989 231
27 3300005843 Ga0068860_100000008 Ga0068860_10000000854 231
28 3300005844 Ga0068862_100100586 Ga0068862_1001005862 231
29 3300025923 Ga0207681_10228473 Ga0207681_102284733 231
30 3300025986 Ga0207658_10009565 Ga0207658_100095656 231
31 3300026035 Ga0207703_10006715 Ga0207703_100067158 231
32 3300026088 Ga0207641_10000198 Ga0207641_1000019828 231
33 3300026095 Ga0207676_10035502 Ga0207676_100355021 231
34 3300028379 Ga0268266_10006015 Ga0268266_100060159 231
35 3300028380 Ga0268265_10031270 Ga0268265_100312702 231
36 3300028381 Ga0268264_10000588 Ga0268264_1000058853 231
37 3300048907 Ga0496104_0013360 Ga0496104_0013360_5644_6435 231
38 3300048908 Ga0496105_0022305 Ga0496105_0022305_1563_2354 231
39 3300005335 Ga0070666_10227019 Ga0070666_102270192 232
40 3300005843 Ga0068860_100053433 Ga0068860_1000534331 232
41 3300025903 Ga0207680_10265102 Ga0207680_102651021 232
42 3300028381 Ga0268264_10026990 Ga0268264_100269903 232
43 3300005329 Ga0070683_100707004 Ga0070683_1007070041 233
44 3300005577 Ga0068857_100628900 Ga0068857_1006289002 233
45 3300026078 Ga0207702_10614272 Ga0207702_106142722 233
46 3300032002 Ga0307416_100392854 Ga0307416_1003928542 233
47 3300048920 Ga0496117_0185733 Ga0496117_0185733_57_830 233
48 3300005327 Ga0070658_10013944 Ga0070658_100139446 234
49 3300013105 Ga0157369_10393377 Ga0157369_103933772 234
50 3300031911 Ga0307412_10137366 Ga0307412_101373662 234
51 3300005617 Ga0068859_100012595 Ga0068859_1000125953 235
52 3300006931 Ga0097620_100012593 Ga0097620_1000125933 235
53 3300005365 Ga0070688_100117494 Ga0070688_1001174941 236
54 3300005466 Ga0070685_10260454 Ga0070685_102604541 236
55 3300025940 Ga0207691_10292231 Ga0207691_102922312 236
56 3300037418 Ga0395900_0049548 Ga0395900_0049548_548_1312 236
57 3300037466 Ga0395898_0211834 Ga0395898_0211834_446_1210 236
58 3300037471 Ga0395905_0084219 Ga0395905_0084219_1585_2349 236
59 3300038443 Ga0395901_0177997 Ga0395901_0177997_549_1313 236
60 3300038443 Ga0395901_0400049 Ga0395901_0400049_586_1350 236
61 3300046689 Ga0495613_0005490 Ga0495613_0005490_3322_4086 236
62 3300047318 Ga0495636_0044302 Ga0495636_0044302_689_1429 236
63 3300047320 Ga0495672_0001520 Ga0495672_0001520_1796_2773 236
64 3300048918 Ga0496115_0122921 Ga0496115_0122921_1201_1965 236
65 3300035241 Ga0373961_0000297 Ga0373961_0000297_20170_20964 237
66 3300042008 Ga0439450_016156 Ga0439450_016156_17_733 237
67 3300045051 Ga0451576_0517300 Ga0451576_0517300_343_1062 237
68 3300050507 nmdc:mga05p37_129618_c1 nmdc:mga05p37_129618_c1_1167_1937 237
69 3300009147 Ga0114129_10100099 Ga0114129_101000992 238
70 3300009177 Ga0105248_10008525 Ga0105248_100085257 238
71 3300009545 Ga0105237_10135419 Ga0105237_101354193 238
72 3300025933 Ga0207706_10504749 Ga0207706_105047491 238
73 3300025949 Ga0207667_10194720 Ga0207667_101947202 238
74 3300026078 Ga0207702_10150743 Ga0207702_101507432 238
75 3300031456 Ga0307513_10011871 Ga0307513_1001187111 238
76 3300032002 Ga0307416_100015969 Ga0307416_1000159695 238
77 3300039437 Ga0436365_1614654 Ga0436365_1614654_572_1357 238
78 3300042439 Ga0439464_0050234 Ga0439464_0050234_269_988 238
79 3300046528 Ga0495642_0014741 Ga0495642_0014741_2173_2952 238
80 3300046616 Ga0495668_0124076 Ga0495668_0124076_66_842 238
81 3300047320 Ga0495672_0249622 Ga0495672_0249622_28_807 238
82 3300049592 Ga0501076_0165266 Ga0501076_0165266_808_1572 238
83 3300049769 Ga0501272_004728 Ga0501272_004728_621_1388 238
84 3300050507 nmdc:mga05p37_82607_c1 nmdc:mga05p37_82607_c1_2471_3235 238
85 3300005356 Ga0070674_100130461 Ga0070674_1001304611 239
86 3300005440 Ga0070705_100232308 Ga0070705_1002323081 239
87 3300006871 Ga0075434_100544748 Ga0075434_1005447481 239
88 3300009147 Ga0114129_10106729 Ga0114129_101067294 239
89 3300009553 Ga0105249_10405995 Ga0105249_104059952 239
90 3300025922 Ga0207646_10112952 Ga0207646_101129522 239
91 3300025936 Ga0207670_10470744 Ga0207670_104707441 239
92 3300025937 Ga0207669_10289904 Ga0207669_102899042 239
93 3300037312 Ga0395899_0422937 Ga0395899_0422937_53_847 239
94 3300037418 Ga0395900_0340172 Ga0395900_0340172_31_864 239
95 3300037466 Ga0395898_0621401 Ga0395898_0621401_59_892 239
96 3300037471 Ga0395905_0059052 Ga0395905_0059052_1591_2424 239
97 3300041999 Ga0439433_0005167 Ga0439433_0005167_1148_1912 239
98 3300042437 Ga0439444_0023359 Ga0439444_0023359_249_971 239
99 3300050508 nmdc:mga09592_36829_c1 nmdc:mga09592_36829_c1_1154_1876 239
100 3300050510 nmdc:mga06r32_4360_c1 nmdc:mga06r32_4360_c1_10198_10920 239
101 3300050516 nmdc:mga0sz30_29885_c1 nmdc:mga0sz30_29885_c1_127_906 239
102 3300006844 Ga0075428_100231389 Ga0075428_1002313892 240
103 3300006847 Ga0075431_100003416 Ga0075431_1000034169 240
104 3300006847 Ga0075431_100080952 Ga0075431_1000809522 240
105 3300006880 Ga0075429_100074273 Ga0075429_1000742732 240
106 3300006880 Ga0075429_100080109 Ga0075429_1000801094 240
107 3300027682 Ga0209971_1007621 Ga0209971_10076212 240
108 3300027876 Ga0209974_10014860 Ga0209974_100148602 240
109 3300027876 Ga0209974_10104232 Ga0209974_101042322 240
110 3300027907 Ga0207428_10139122 Ga0207428_101391222 240
111 3300042436 Ga0439435_0066706 Ga0439435_0066706_225_992 240
112 3300042437 Ga0439444_0045118 Ga0439444_0045118_91_858 240
113 3300046660 Ga0495625_0223882 Ga0495625_0223882_101_892 240
114 3300050507 nmdc:mga05p37_161143_c1 nmdc:mga05p37_161143_c1_751_1521 240
115 3300050507 nmdc:mga05p37_483921_c1 nmdc:mga05p37_483921_c1_530_1297 240
116 3300050508 nmdc:mga09592_13552_c1 nmdc:mga09592_13552_c1_5449_6222 240
117 3300050508 nmdc:mga09592_242959_c1 nmdc:mga09592_242959_c1_163_930 240
118 3300050509 nmdc:mga0qj67_57490_c1 nmdc:mga0qj67_57490_c1_1320_2087 240
119 3300050510 nmdc:mga06r32_4267_c1 nmdc:mga06r32_4267_c1_11138_11905 240
120 3300050510 nmdc:mga06r32_6742_c1 nmdc:mga06r32_6742_c1_3701_4474 240
121 3300054114 Ga0501084_0580879 Ga0501084_0580879_167_937 240
122 3300005293 Ga0065715_10167934 Ga0065715_101679341 241
123 3300005331 Ga0070670_100016091 Ga0070670_1000160916 241
124 3300005471 Ga0070698_100205261 Ga0070698_1002052611 241
125 3300005471 Ga0070698_100740187 Ga0070698_1007401871 241
126 3300006844 Ga0075428_100073348 Ga0075428_1000733482 241
127 3300006846 Ga0075430_100000381 Ga0075430_10000038112 241
128 3300006847 Ga0075431_100030553 Ga0075431_1000305534 241
129 3300006847 Ga0075431_100359785 Ga0075431_1003597852 241
130 3300006847 Ga0075431_100626470 Ga0075431_1006264702 241
131 3300006852 Ga0075433_10000202 Ga0075433_100002029 241
132 3300006871 Ga0075434_100093703 Ga0075434_1000937033 241
133 3300006880 Ga0075429_100091450 Ga0075429_1000914502 241
134 3300009094 Ga0111539_10132362 Ga0111539_101323623 241
135 3300009147 Ga0114129_10003016 Ga0114129_100030164 241
136 3300025925 Ga0207650_10170112 Ga0207650_101701122 241
137 3300027907 Ga0207428_10024378 Ga0207428_100243783 241
138 3300031548 Ga0307408_100122298 Ga0307408_1001222982 241
139 3300031548 Ga0307408_100356642 Ga0307408_1003566422 241
140 3300031852 Ga0307410_10321541 Ga0307410_103215411 241
141 3300031911 Ga0307412_10329362 Ga0307412_103293622 241
142 3300032002 Ga0307416_100399580 Ga0307416_1003995802 241
143 3300032005 Ga0307411_10058672 Ga0307411_100586723 241
144 3300042439 Ga0439464_0002455 Ga0439464_0002455_1726_2499 241
145 3300042461 Ga0439460_0077691 Ga0439460_0077691_219_995 241
146 3300042876 Ga0451577_0056963 Ga0451577_0056963_1754_2524 241
147 3300049522 Ga0501299_022347 Ga0501299_022347_62_835 241
148 3300049669 Ga0501235_031445 Ga0501235_031445_176_964 241
149 3300049677 Ga0501247_011556 Ga0501247_011556_188_961 241
150 3300049771 Ga0501274_010984 Ga0501274_010984_14_787 241
151 3300050507 nmdc:mga05p37_2653_c1 nmdc:mga05p37_2653_c1_15902_16675 241
152 3300050508 nmdc:mga09592_15786_c1 nmdc:mga09592_15786_c1_2950_3723 241
153 3300050508 nmdc:mga09592_41866_c1 nmdc:mga09592_41866_c1_2011_2802 241
154 3300050509 nmdc:mga0qj67_10922_c1 nmdc:mga0qj67_10922_c1_3588_4361 241
155 3300050510 nmdc:mga06r32_20103_c1 nmdc:mga06r32_20103_c1_1799_2572 241
156 3300050511 nmdc:mga08y16_100479_c1 nmdc:mga08y16_100479_c1_2007_2780 241
157 3300050512 nmdc:mga0n895_4356_c1 nmdc:mga0n895_4356_c1_6015_6746 241
158 3300050515 nmdc:mga0a205_76_c1 nmdc:mga0a205_76_c1_46641_47372 241
159 3300005331 Ga0070670_100124633 Ga0070670_1001246332 242
160 3300005340 Ga0070689_100468948 Ga0070689_1004689482 242
161 3300005347 Ga0070668_100296484 Ga0070668_1002964842 242
162 3300005445 Ga0070708_100346796 Ga0070708_1003467961 242
163 3300005456 Ga0070678_100026864 Ga0070678_1000268642 242
164 3300005842 Ga0068858_100012596 Ga0068858_1000125963 242
165 3300006844 Ga0075428_100144399 Ga0075428_1001443993 242
166 3300006846 Ga0075430_100326305 Ga0075430_1003263052 242
167 3300006847 Ga0075431_100026322 Ga0075431_1000263225 242
168 3300006852 Ga0075433_10001786 Ga0075433_100017861 242
169 3300006871 Ga0075434_100016237 Ga0075434_1000162373 242
170 3300007076 Ga0075435_100032944 Ga0075435_1000329442 242
171 3300009094 Ga0111539_10134852 Ga0111539_101348523 242
172 3300009147 Ga0114129_11075208 Ga0114129_110752081 242
173 3300009553 Ga0105249_10086394 Ga0105249_100863941 242
174 3300014325 Ga0163163_10012072 Ga0163163_100120727 242
175 3300025936 Ga0207670_10717644 Ga0207670_107176441 242
176 3300025986 Ga0207658_10066652 Ga0207658_100666523 242
177 3300026035 Ga0207703_10068704 Ga0207703_100687041 242
178 3300026121 Ga0207683_10127770 Ga0207683_101277703 242
179 3300042436 Ga0439435_0109146 Ga0439435_0109146_70_798 242
180 3300049578 Ga0501042_0212026 Ga0501042_0212026_130_948 242
181 3300049585 Ga0501069_0214318 Ga0501069_0214318_145_873 242
182 3300049742 Ga0501080_0856980 Ga0501080_0856980_34_762 242
183 3300050507 nmdc:mga05p37_869737_c1 nmdc:mga05p37_869737_c1_39_773 242
184 3300050510 nmdc:mga06r32_160477_c1 nmdc:mga06r32_160477_c1_1149_1931 242
185 3300050512 nmdc:mga0n895_5070_c1 nmdc:mga0n895_5070_c1_4696_5481 242
186 3300050515 nmdc:mga0a205_606472_c1 nmdc:mga0a205_606472_c1_114_899 242
187 3300059421 Ga0590071_000030 Ga0590071_000030_1482_2279 242
188 3300059423 Ga0590074_002044 Ga0590074_002044_2169_2966 242
189 3300059424 Ga0590075_001856 Ga0590075_001856_2607_3404 242
190 2162886011 MRS1b_contig_3199878 MRS1b_0698.00001390 243
191 3300004798 Ga0058859_11229463 Ga0058859_112294631 243
192 3300004799 Ga0058863_11934526 Ga0058863_119345261 243
193 3300004800 Ga0058861_11748004 Ga0058861_117480041 243
194 3300004800 Ga0058861_12031893 Ga0058861_120318931 243
195 3300004801 Ga0058860_10064540 Ga0058860_100645402 243
196 3300004801 Ga0058860_10090918 Ga0058860_100909181 243
197 3300004801 Ga0058860_11611968 Ga0058860_116119682 243
198 3300004801 Ga0058860_12028819 Ga0058860_120288192 243
199 3300004803 Ga0058862_12539343 Ga0058862_125393432 243
200 3300004803 Ga0058862_12758636 Ga0058862_127586361 243
201 3300004803 Ga0058862_12783670 Ga0058862_127836702 243
202 3300005288 Ga0065714_10071074 Ga0065714_100710742 243
203 3300005289 Ga0065704_10171588 Ga0065704_101715881 243
204 3300005290 Ga0065712_10003381 Ga0065712_100033812 243
205 3300005290 Ga0065712_10010152 Ga0065712_100101525 243
206 3300005290 Ga0065712_10074252 Ga0065712_100742523 243
207 3300005293 Ga0065715_10004219 Ga0065715_100042193 243
208 3300005293 Ga0065715_10094822 Ga0065715_100948224 243
209 3300005293 Ga0065715_10102412 Ga0065715_101024124 243
210 3300005293 Ga0065715_10126090 Ga0065715_101260903 243
211 3300005293 Ga0065715_10169792 Ga0065715_101697923 243
212 3300005295 Ga0065707_10092277 Ga0065707_100922771 243
213 3300005295 Ga0065707_10194570 Ga0065707_101945702 243
214 3300005295 Ga0065707_10212626 Ga0065707_102126262 243
215 3300005328 Ga0070676_10019726 Ga0070676_100197262 243
216 3300005328 Ga0070676_10140219 Ga0070676_101402191 243
217 3300005329 Ga0070683_100000260 Ga0070683_1000002604 243
218 3300005330 Ga0070690_100011445 Ga0070690_1000114452 243
219 3300005330 Ga0070690_100014027 Ga0070690_1000140273 243
220 3300005330 Ga0070690_100023056 Ga0070690_1000230564 243
221 3300005331 Ga0070670_100001340 Ga0070670_10000134016 243
222 3300005331 Ga0070670_100005713 Ga0070670_1000057138 243
223 3300005331 Ga0070670_100008280 Ga0070670_1000082806 243
224 3300005331 Ga0070670_100013192 Ga0070670_1000131922 243
225 3300005331 Ga0070670_100068105 Ga0070670_1000681052 243
226 3300005331 Ga0070670_100156618 Ga0070670_1001566183 243
227 3300005331 Ga0070670_100163332 Ga0070670_1001633322 243
228 3300005333 Ga0070677_10016722 Ga0070677_100167221 243
229 3300005333 Ga0070677_10058734 Ga0070677_100587343 243
230 3300005334 Ga0068869_100020689 Ga0068869_1000206897 243
231 3300005334 Ga0068869_100025458 Ga0068869_1000254585 243
232 3300005334 Ga0068869_100154420 Ga0068869_1001544201 243
233 3300005335 Ga0070666_10012985 Ga0070666_100129852 243
234 3300005335 Ga0070666_10064586 Ga0070666_100645863 243
235 3300005335 Ga0070666_10159512 Ga0070666_101595121 243
236 3300005335 Ga0070666_10322574 Ga0070666_103225741 243
237 3300005336 Ga0070680_100441545 Ga0070680_1004415451 243
238 3300005337 Ga0070682_100122017 Ga0070682_1001220172 243
239 3300005338 Ga0068868_100011659 Ga0068868_1000116594 243
240 3300005339 Ga0070660_100275589 Ga0070660_1002755892 243
241 3300005340 Ga0070689_100039410 Ga0070689_1000394102 243
242 3300005340 Ga0070689_100245288 Ga0070689_1002452882 243
243 3300005343 Ga0070687_100006132 Ga0070687_1000061322 243
244 3300005343 Ga0070687_100031838 Ga0070687_1000318383 243
245 3300005343 Ga0070687_100050658 Ga0070687_1000506582 243
246 3300005344 Ga0070661_100001252 Ga0070661_1000012522 243
247 3300005344 Ga0070661_100020068 Ga0070661_1000200681 243
248 3300005347 Ga0070668_100013056 Ga0070668_1000130564 243
249 3300005347 Ga0070668_100136203 Ga0070668_1001362031 243
250 3300005347 Ga0070668_100320759 Ga0070668_1003207591 243
251 3300005347 Ga0070668_100659752 Ga0070668_1006597521 243
252 3300005353 Ga0070669_100000399 Ga0070669_10000039921 243
253 3300005353 Ga0070669_100002199 Ga0070669_1000021993 243
254 3300005353 Ga0070669_100003613 Ga0070669_1000036138 243
255 3300005353 Ga0070669_100017648 Ga0070669_1000176482 243
256 3300005353 Ga0070669_100036098 Ga0070669_1000360983 243
257 3300005353 Ga0070669_100073288 Ga0070669_1000732882 243
258 3300005353 Ga0070669_100102331 Ga0070669_1001023312 243
259 3300005353 Ga0070669_100307046 Ga0070669_1003070462 243
260 3300005354 Ga0070675_100017161 Ga0070675_1000171618 243
261 3300005354 Ga0070675_100047773 Ga0070675_1000477734 243
262 3300005354 Ga0070675_100081052 Ga0070675_1000810521 243
263 3300005354 Ga0070675_100124137 Ga0070675_1001241371 243
264 3300005354 Ga0070675_100277332 Ga0070675_1002773322 243
265 3300005354 Ga0070675_100631575 Ga0070675_1006315751 243
266 3300005354 Ga0070675_100647599 Ga0070675_1006475991 243
267 3300005355 Ga0070671_100171233 Ga0070671_1001712332 243
268 3300005355 Ga0070671_100268190 Ga0070671_1002681901 243
269 3300005355 Ga0070671_100462898 Ga0070671_1004628981 243
270 3300005356 Ga0070674_100000133 Ga0070674_10000013315 243
271 3300005356 Ga0070674_100038102 Ga0070674_1000381026 243
272 3300005364 Ga0070673_100007069 Ga0070673_1000070696 243
273 3300005364 Ga0070673_100008782 Ga0070673_10000878210 243
274 3300005364 Ga0070673_100032544 Ga0070673_1000325442 243
275 3300005364 Ga0070673_100458554 Ga0070673_1004585541 243
276 3300005365 Ga0070688_100087207 Ga0070688_1000872071 243
277 3300005365 Ga0070688_100106534 Ga0070688_1001065342 243
278 3300005365 Ga0070688_100210667 Ga0070688_1002106671 243
279 3300005406 Ga0070703_10158118 Ga0070703_101581181 243
280 3300005438 Ga0070701_10001279 Ga0070701_100012793 243
281 3300005438 Ga0070701_10043901 Ga0070701_100439011 243
282 3300005438 Ga0070701_10068895 Ga0070701_100688952 243
283 3300005440 Ga0070705_100053529 Ga0070705_1000535292 243
284 3300005441 Ga0070700_100015636 Ga0070700_1000156364 243
285 3300005441 Ga0070700_100077549 Ga0070700_1000775492 243
286 3300005441 Ga0070700_100155460 Ga0070700_1001554602 243
287 3300005444 Ga0070694_100033846 Ga0070694_1000338462 243
288 3300005455 Ga0070663_100007791 Ga0070663_1000077914 243
289 3300005456 Ga0070678_100054028 Ga0070678_1000540283 243
290 3300005456 Ga0070678_100130396 Ga0070678_1001303962 243
291 3300005456 Ga0070678_100161441 Ga0070678_1001614412 243
292 3300005457 Ga0070662_100011707 Ga0070662_1000117076 243
293 3300005457 Ga0070662_100024347 Ga0070662_1000243473 243
294 3300005459 Ga0068867_100004682 Ga0068867_1000046829 243
295 3300005459 Ga0068867_100022711 Ga0068867_1000227113 243
296 3300005459 Ga0068867_100058755 Ga0068867_1000587553 243
297 3300005459 Ga0068867_100600452 Ga0068867_1006004521 243
298 3300005466 Ga0070685_10041862 Ga0070685_100418624 243
299 3300005518 Ga0070699_100041522 Ga0070699_1000415223 243
300 3300005530 Ga0070679_100116476 Ga0070679_1001164762 243
301 3300005535 Ga0070684_100000898 Ga0070684_1000008987 243
302 3300005536 Ga0070697_100165138 Ga0070697_1001651382 243
303 3300005543 Ga0070672_100012392 Ga0070672_1000123922 243
304 3300005543 Ga0070672_100015890 Ga0070672_1000158904 243
305 3300005543 Ga0070672_100186409 Ga0070672_1001864091 243
306 3300005543 Ga0070672_100412461 Ga0070672_1004124612 243
307 3300005544 Ga0070686_100009424 Ga0070686_1000094243 243
308 3300005544 Ga0070686_100051783 Ga0070686_1000517832 243
309 3300005544 Ga0070686_100251732 Ga0070686_1002517321 243
310 3300005545 Ga0070695_100417634 Ga0070695_1004176341 243
311 3300005546 Ga0070696_100443868 Ga0070696_1004438681 243
312 3300005548 Ga0070665_100048324 Ga0070665_1000483247 243
313 3300005548 Ga0070665_100444421 Ga0070665_1004444212 243
314 3300005549 Ga0070704_100033061 Ga0070704_1000330613 243
315 3300005564 Ga0070664_100002150 Ga0070664_1000021504 243
316 3300005564 Ga0070664_100014148 Ga0070664_1000141482 243
317 3300005564 Ga0070664_100312663 Ga0070664_1003126631 243
318 3300005564 Ga0070664_100402932 Ga0070664_1004029322 243
319 3300005564 Ga0070664_100554967 Ga0070664_1005549671 243
320 3300005577 Ga0068857_100011022 Ga0068857_1000110225 243
321 3300005577 Ga0068857_100013100 Ga0068857_1000131005 243
322 3300005577 Ga0068857_100062811 Ga0068857_1000628115 243
323 3300005578 Ga0068854_100145624 Ga0068854_1001456242 243
324 3300005615 Ga0070702_100091927 Ga0070702_1000919272 243
325 3300005616 Ga0068852_100210251 Ga0068852_1002102513 243
326 3300005617 Ga0068859_100005105 Ga0068859_10000510515 243
327 3300005617 Ga0068859_100009922 Ga0068859_1000099229 243
328 3300005617 Ga0068859_100060387 Ga0068859_1000603874 243
329 3300005617 Ga0068859_100079721 Ga0068859_1000797213 243
330 3300005617 Ga0068859_100237905 Ga0068859_1002379052 243
331 3300005618 Ga0068864_100039642 Ga0068864_1000396423 243
332 3300005618 Ga0068864_100427390 Ga0068864_1004273902 243
333 3300005618 Ga0068864_100511997 Ga0068864_1005119971 243
334 3300005719 Ga0068861_100006364 Ga0068861_1000063647 243
335 3300005719 Ga0068861_100013596 Ga0068861_1000135964 243
336 3300005719 Ga0068861_100172423 Ga0068861_1001724232 243
337 3300005840 Ga0068870_10000968 Ga0068870_100009685 243
338 3300005840 Ga0068870_10014039 Ga0068870_100140392 243
339 3300005840 Ga0068870_10059758 Ga0068870_100597582 243
340 3300005840 Ga0068870_10066038 Ga0068870_100660381 243
341 3300005841 Ga0068863_100000867 Ga0068863_1000008675 243
342 3300005841 Ga0068863_100039399 Ga0068863_1000393992 243
343 3300005841 Ga0068863_100083183 Ga0068863_1000831834 243
344 3300005841 Ga0068863_100158225 Ga0068863_1001582251 243
345 3300005841 Ga0068863_100834985 Ga0068863_1008349851 243
346 3300005841 Ga0068863_100865957 Ga0068863_1008659571 243
347 3300005842 Ga0068858_100007931 Ga0068858_1000079314 243
348 3300005842 Ga0068858_100048972 Ga0068858_1000489723 243
349 3300005842 Ga0068858_100083127 Ga0068858_1000831273 243
350 3300005842 Ga0068858_100336378 Ga0068858_1003363782 243
351 3300005843 Ga0068860_100140178 Ga0068860_1001401782 243
352 3300005843 Ga0068860_100194295 Ga0068860_1001942953 243
353 3300005844 Ga0068862_100001221 Ga0068862_1000012219 243
354 3300005844 Ga0068862_100012814 Ga0068862_1000128147 243
355 3300005844 Ga0068862_100038425 Ga0068862_1000384251 243
356 3300005844 Ga0068862_100051534 Ga0068862_1000515343 243
357 3300005844 Ga0068862_100137218 Ga0068862_1001372183 243
358 3300005844 Ga0068862_100205237 Ga0068862_1002052373 243
359 3300005844 Ga0068862_100280175 Ga0068862_1002801752 243
360 3300005844 Ga0068862_100517777 Ga0068862_1005177772 243
361 3300005937 Ga0081455_10034132 Ga0081455_100341323 243
362 3300005937 Ga0081455_10156505 Ga0081455_101565052 243
363 3300005937 Ga0081455_10191329 Ga0081455_101913292 243
364 3300006042 Ga0075368_10005612 Ga0075368_100056122 243
365 3300006051 Ga0075364_10130065 Ga0075364_101300652 243
366 3300006178 Ga0075367_10211582 Ga0075367_102115821 243
367 3300006195 Ga0075366_10027111 Ga0075366_100271112 243
368 3300006195 Ga0075366_10129648 Ga0075366_101296481 243
369 3300006237 Ga0097621_100049978 Ga0097621_1000499783 243
370 3300006237 Ga0097621_100176404 Ga0097621_1001764042 243
371 3300006353 Ga0075370_10013601 Ga0075370_100136012 243
372 3300006358 Ga0068871_100043752 Ga0068871_1000437522 243
373 3300006358 Ga0068871_100095480 Ga0068871_1000954801 243
374 3300006358 Ga0068871_100203448 Ga0068871_1002034483 243
375 3300006844 Ga0075428_100004960 Ga0075428_1000049602 243
376 3300006844 Ga0075428_100009217 Ga0075428_1000092174 243
377 3300006844 Ga0075428_100014803 Ga0075428_1000148033 243
378 3300006844 Ga0075428_100074638 Ga0075428_1000746384 243
379 3300006844 Ga0075428_100152385 Ga0075428_1001523854 243
380 3300006844 Ga0075428_100314293 Ga0075428_1003142931 243
381 3300006844 Ga0075428_100477156 Ga0075428_1004771562 243
382 3300006846 Ga0075430_100002731 Ga0075430_1000027316 243
383 3300006846 Ga0075430_100003464 Ga0075430_10000346411 243
384 3300006846 Ga0075430_100027201 Ga0075430_1000272012 243
385 3300006846 Ga0075430_100029136 Ga0075430_1000291362 243
386 3300006846 Ga0075430_100029161 Ga0075430_1000291613 243
387 3300006846 Ga0075430_100097419 Ga0075430_1000974192 243
388 3300006846 Ga0075430_100165560 Ga0075430_1001655601 243
389 3300006847 Ga0075431_100004623 Ga0075431_10000462311 243
390 3300006847 Ga0075431_100007678 Ga0075431_1000076786 243
391 3300006847 Ga0075431_100014566 Ga0075431_1000145666 243
392 3300006847 Ga0075431_100040167 Ga0075431_1000401672 243
393 3300006847 Ga0075431_100091222 Ga0075431_1000912223 243
394 3300006847 Ga0075431_100134472 Ga0075431_1001344722 243
395 3300006847 Ga0075431_100210863 Ga0075431_1002108632 243
396 3300006847 Ga0075431_100365266 Ga0075431_1003652662 243
397 3300006847 Ga0075431_100379848 Ga0075431_1003798481 243
398 3300006847 Ga0075431_100514590 Ga0075431_1005145901 243
399 3300006852 Ga0075433_10003482 Ga0075433_100034824 243
400 3300006852 Ga0075433_10042323 Ga0075433_100423232 243
401 3300006852 Ga0075433_10098939 Ga0075433_100989393 243
402 3300006852 Ga0075433_10146676 Ga0075433_101466763 243
403 3300006852 Ga0075433_10162575 Ga0075433_101625754 243
404 3300006852 Ga0075433_10333096 Ga0075433_103330961 243
405 3300006871 Ga0075434_100000875 Ga0075434_1000008757 243
406 3300006871 Ga0075434_100030656 Ga0075434_1000306564 243
407 3300006871 Ga0075434_100082095 Ga0075434_1000820954 243
408 3300006871 Ga0075434_100120243 Ga0075434_1001202432 243
409 3300006880 Ga0075429_100003511 Ga0075429_1000035113 243
410 3300006880 Ga0075429_100010406 Ga0075429_1000104063 243
411 3300006880 Ga0075429_100061640 Ga0075429_1000616402 243
412 3300006880 Ga0075429_100072231 Ga0075429_1000722313 243
413 3300006880 Ga0075429_100104488 Ga0075429_1001044882 243
414 3300006880 Ga0075429_100109643 Ga0075429_1001096432 243
415 3300006880 Ga0075429_100212024 Ga0075429_1002120242 243
416 3300006880 Ga0075429_100219241 Ga0075429_1002192412 243
417 3300006881 Ga0068865_100004621 Ga0068865_1000046218 243
418 3300006914 Ga0075436_100027966 Ga0075436_1000279663 243
419 3300006931 Ga0097620_100005105 Ga0097620_1000051052 243
420 3300006931 Ga0097620_100009922 Ga0097620_1000099229 243
421 3300006931 Ga0097620_100060387 Ga0097620_1000603874 243
422 3300006931 Ga0097620_100079721 Ga0097620_1000797213 243
423 3300006931 Ga0097620_100237898 Ga0097620_1002378982 243
424 3300007076 Ga0075435_100004350 Ga0075435_1000043504 243
425 3300007076 Ga0075435_100192506 Ga0075435_1001925062 243
426 3300009094 Ga0111539_10005953 Ga0111539_1000595311 243
427 3300009094 Ga0111539_10007864 Ga0111539_100078643 243
428 3300009094 Ga0111539_10009385 Ga0111539_100093855 243
429 3300009094 Ga0111539_10034066 Ga0111539_100340666 243
430 3300009094 Ga0111539_10059762 Ga0111539_100597622 243
431 3300009094 Ga0111539_10074765 Ga0111539_100747654 243
432 3300009094 Ga0111539_10094768 Ga0111539_100947684 243
433 3300009094 Ga0111539_10126120 Ga0111539_101261205 243
434 3300009094 Ga0111539_10232020 Ga0111539_102320201 243
435 3300009094 Ga0111539_10243421 Ga0111539_102434213 243
436 3300009098 Ga0105245_10249724 Ga0105245_102497241 243
437 3300009098 Ga0105245_10721333 Ga0105245_107213331 243
438 3300009101 Ga0105247_10009735 Ga0105247_100097353 243
439 3300009101 Ga0105247_10285540 Ga0105247_102855401 243
440 3300009147 Ga0114129_10000022 Ga0114129_100000229 243
441 3300009147 Ga0114129_10003432 Ga0114129_100034327 243
442 3300009147 Ga0114129_10013890 Ga0114129_100138909 243
443 3300009147 Ga0114129_10017528 Ga0114129_1001752812 243
444 3300009147 Ga0114129_10028685 Ga0114129_100286853 243
445 3300009147 Ga0114129_10046369 Ga0114129_100463691 243
446 3300009147 Ga0114129_10057192 Ga0114129_100571922 243
447 3300009147 Ga0114129_10067969 Ga0114129_100679692 243
448 3300009147 Ga0114129_10074127 Ga0114129_100741274 243
449 3300009147 Ga0114129_10093312 Ga0114129_100933126 243
450 3300009147 Ga0114129_10188764 Ga0114129_101887642 243
451 3300009147 Ga0114129_10228245 Ga0114129_102282452 243
452 3300009147 Ga0114129_10422479 Ga0114129_104224792 243
453 3300009147 Ga0114129_10428859 Ga0114129_104288592 243
454 3300009147 Ga0114129_10665167 Ga0114129_106651671 243
455 3300009147 Ga0114129_10696160 Ga0114129_106961601 243
456 3300009147 Ga0114129_10701113 Ga0114129_107011132 243
457 3300009177 Ga0105248_10011617 Ga0105248_100116178 243
458 3300009177 Ga0105248_10011763 Ga0105248_100117635 243
459 3300009177 Ga0105248_10026048 Ga0105248_100260485 243
460 3300009177 Ga0105248_10051068 Ga0105248_100510682 243
461 3300009177 Ga0105248_10083496 Ga0105248_100834963 243
462 3300009177 Ga0105248_10130990 Ga0105248_101309903 243
463 3300009177 Ga0105248_10264336 Ga0105248_102643362 243
464 3300009177 Ga0105248_10544546 Ga0105248_105445462 243
465 3300009177 Ga0105248_10712024 Ga0105248_107120241 243
466 3300009177 Ga0105248_10775390 Ga0105248_107753901 243
467 3300009553 Ga0105249_10002178 Ga0105249_100021789 243
468 3300009553 Ga0105249_10033902 Ga0105249_100339023 243
469 3300009553 Ga0105249_10194900 Ga0105249_101949002 243
470 3300009553 Ga0105249_10328074 Ga0105249_103280742 243
471 3300009553 Ga0105249_10460113 Ga0105249_104601132 243
472 3300010375 Ga0105239_10055042 Ga0105239_100550424 243
473 3300011119 Ga0105246_10151349 Ga0105246_101513492 243
474 3300011119 Ga0105246_10170480 Ga0105246_101704802 243
475 3300013296 Ga0157374_10014200 Ga0157374_100142003 243
476 3300013306 Ga0163162_10057350 Ga0163162_100573504 243
477 3300013307 Ga0157372_10744242 Ga0157372_107442422 243
478 3300013308 Ga0157375_10004391 Ga0157375_1000439110 243
479 3300013308 Ga0157375_10215352 Ga0157375_102153523 243
480 3300013308 Ga0157375_10459444 Ga0157375_104594441 243
481 3300013308 Ga0157375_10704525 Ga0157375_107045252 243
482 3300014325 Ga0163163_10040189 Ga0163163_100401892 243
483 3300014325 Ga0163163_10153205 Ga0163163_101532053 243
484 3300014326 Ga0157380_10012655 Ga0157380_100126554 243
485 3300014326 Ga0157380_10053866 Ga0157380_100538663 243
486 3300014326 Ga0157380_10124633 Ga0157380_101246332 243
487 3300014326 Ga0157380_10129036 Ga0157380_101290362 243
488 3300014326 Ga0157380_10158026 Ga0157380_101580261 243
489 3300014326 Ga0157380_10210677 Ga0157380_102106771 243
490 3300014326 Ga0157380_10265621 Ga0157380_102656212 243
491 3300014745 Ga0157377_10008902 Ga0157377_100089022 243
492 3300014745 Ga0157377_10031373 Ga0157377_100313732 243
493 3300014968 Ga0157379_10016566 Ga0157379_100165663 243
494 3300014968 Ga0157379_10017284 Ga0157379_100172843 243
495 3300014968 Ga0157379_10073242 Ga0157379_100732422 243
496 3300014969 Ga0157376_10028990 Ga0157376_100289905 243
497 3300017792 Ga0163161_10087470 Ga0163161_100874702 243
498 3300017792 Ga0163161_10116583 Ga0163161_101165832 243
499 3300020070 Ga0206356_10432168 Ga0206356_104321681 243
500 3300022467 Ga0224712_10197880 Ga0224712_101978801 243
501 3300025315 Ga0207697_10001648 Ga0207697_100016489 243
502 3300025315 Ga0207697_10010073 Ga0207697_100100734 243
503 3300025315 Ga0207697_10015174 Ga0207697_100151744 243
504 3300025315 Ga0207697_10093832 Ga0207697_100938321 243
505 3300025893 Ga0207682_10008517 Ga0207682_100085172 243
506 3300025893 Ga0207682_10021451 Ga0207682_100214513 243
507 3300025899 Ga0207642_10154808 Ga0207642_101548082 243
508 3300025900 Ga0207710_10006846 Ga0207710_100068463 243
509 3300025901 Ga0207688_10013358 Ga0207688_100133585 243
510 3300025901 Ga0207688_10058421 Ga0207688_100584212 243
511 3300025903 Ga0207680_10021614 Ga0207680_100216143 243
512 3300025903 Ga0207680_10025785 Ga0207680_100257853 243
513 3300025903 Ga0207680_10118406 Ga0207680_101184063 243
514 3300025903 Ga0207680_10196220 Ga0207680_101962202 243
515 3300025904 Ga0207647_10136441 Ga0207647_101364412 243
516 3300025907 Ga0207645_10003388 Ga0207645_100033888 243
517 3300025907 Ga0207645_10040789 Ga0207645_100407894 243
518 3300025907 Ga0207645_10137629 Ga0207645_101376291 243
519 3300025908 Ga0207643_10002413 Ga0207643_1000241310 243
520 3300025910 Ga0207684_10178354 Ga0207684_101783542 243
521 3300025912 Ga0207707_10041639 Ga0207707_100416393 243
522 3300025918 Ga0207662_10011372 Ga0207662_100113724 243
523 3300025918 Ga0207662_10022232 Ga0207662_100222322 243
524 3300025918 Ga0207662_10215739 Ga0207662_102157392 243
525 3300025919 Ga0207657_10216614 Ga0207657_102166142 243
526 3300025920 Ga0207649_10004162 Ga0207649_100041622 243
527 3300025921 Ga0207652_10276834 Ga0207652_102768342 243
528 3300025923 Ga0207681_10009018 Ga0207681_100090182 243
529 3300025923 Ga0207681_10024466 Ga0207681_100244662 243
530 3300025923 Ga0207681_10041155 Ga0207681_100411551 243
531 3300025923 Ga0207681_10041333 Ga0207681_100413332 243
532 3300025923 Ga0207681_10105521 Ga0207681_101055212 243
533 3300025925 Ga0207650_10009691 Ga0207650_100096916 243
534 3300025925 Ga0207650_10025629 Ga0207650_100256293 243
535 3300025925 Ga0207650_10085355 Ga0207650_100853552 243
536 3300025925 Ga0207650_10120578 Ga0207650_101205783 243
537 3300025925 Ga0207650_10149901 Ga0207650_101499012 243
538 3300025925 Ga0207650_10207765 Ga0207650_102077652 243
539 3300025926 Ga0207659_10057797 Ga0207659_100577971 243
540 3300025926 Ga0207659_10255952 Ga0207659_102559521 243
541 3300025926 Ga0207659_10296426 Ga0207659_102964262 243
542 3300025931 Ga0207644_10030834 Ga0207644_100308342 243
543 3300025931 Ga0207644_10163895 Ga0207644_101638951 243
544 3300025931 Ga0207644_10180956 Ga0207644_101809561 243
545 3300025932 Ga0207690_10373539 Ga0207690_103735391 243
546 3300025933 Ga0207706_10006664 Ga0207706_100066645 243
547 3300025933 Ga0207706_10057575 Ga0207706_100575751 243
548 3300025933 Ga0207706_10084872 Ga0207706_100848722 243
549 3300025933 Ga0207706_10229777 Ga0207706_102297772 243
550 3300025933 Ga0207706_10428455 Ga0207706_104284552 243
551 3300025934 Ga0207686_10033165 Ga0207686_100331654 243
552 3300025936 Ga0207670_10009343 Ga0207670_100093434 243
553 3300025936 Ga0207670_10021772 Ga0207670_100217722 243
554 3300025936 Ga0207670_10110882 Ga0207670_101108821 243
555 3300025936 Ga0207670_10149820 Ga0207670_101498202 243
556 3300025937 Ga0207669_10004070 Ga0207669_100040708 243
557 3300025937 Ga0207669_10128460 Ga0207669_101284603 243
558 3300025937 Ga0207669_10230104 Ga0207669_102301042 243
559 3300025938 Ga0207704_10039222 Ga0207704_100392223 243
560 3300025938 Ga0207704_10044350 Ga0207704_100443503 243
561 3300025938 Ga0207704_10106645 Ga0207704_101066451 243
562 3300025940 Ga0207691_10005619 Ga0207691_1000561910 243
563 3300025940 Ga0207691_10027372 Ga0207691_100273724 243
564 3300025940 Ga0207691_10043702 Ga0207691_100437023 243
565 3300025940 Ga0207691_10090897 Ga0207691_100908972 243
566 3300025940 Ga0207691_10099066 Ga0207691_100990662 243
567 3300025940 Ga0207691_10307917 Ga0207691_103079172 243
568 3300025941 Ga0207711_10027516 Ga0207711_100275165 243
569 3300025941 Ga0207711_10052589 Ga0207711_100525892 243
570 3300025941 Ga0207711_10074932 Ga0207711_100749322 243
571 3300025941 Ga0207711_10084800 Ga0207711_100848001 243
572 3300025942 Ga0207689_10003959 Ga0207689_1000395911 243
573 3300025942 Ga0207689_10032589 Ga0207689_100325895 243
574 3300025942 Ga0207689_10057367 Ga0207689_100573675 243
575 3300025942 Ga0207689_10095679 Ga0207689_100956793 243
576 3300025944 Ga0207661_10002490 Ga0207661_100024902 243
577 3300025945 Ga0207679_10004135 Ga0207679_100041352 243
578 3300025945 Ga0207679_10027193 Ga0207679_100271934 243
579 3300025945 Ga0207679_10040304 Ga0207679_100403043 243
580 3300025945 Ga0207679_10511831 Ga0207679_105118311 243
581 3300025945 Ga0207679_10515363 Ga0207679_105153631 243
582 3300025960 Ga0207651_10010174 Ga0207651_100101743 243
583 3300025960 Ga0207651_10013855 Ga0207651_100138555 243
584 3300025960 Ga0207651_10032756 Ga0207651_100327564 243
585 3300025960 Ga0207651_10077103 Ga0207651_100771031 243
586 3300025960 Ga0207651_10091539 Ga0207651_100915391 243
587 3300025960 Ga0207651_10419135 Ga0207651_104191351 243
588 3300025961 Ga0207712_10022462 Ga0207712_100224622 243
589 3300025961 Ga0207712_10041146 Ga0207712_100411461 243
590 3300025961 Ga0207712_10617526 Ga0207712_106175261 243
591 3300025972 Ga0207668_10040164 Ga0207668_100401642 243
592 3300025986 Ga0207658_10373534 Ga0207658_103735342 243
593 3300026023 Ga0207677_10040009 Ga0207677_100400094 243
594 3300026023 Ga0207677_10628803 Ga0207677_106288031 243
595 3300026035 Ga0207703_10070905 Ga0207703_100709052 243
596 3300026035 Ga0207703_10329503 Ga0207703_103295031 243
597 3300026035 Ga0207703_10480732 Ga0207703_104807321 243
598 3300026067 Ga0207678_10008867 Ga0207678_100088673 243
599 3300026075 Ga0207708_10006488 Ga0207708_100064888 243
600 3300026075 Ga0207708_10025427 Ga0207708_100254274 243
601 3300026075 Ga0207708_10034925 Ga0207708_100349252 243
602 3300026075 Ga0207708_10036468 Ga0207708_100364684 243
603 3300026075 Ga0207708_10193915 Ga0207708_101939152 243
604 3300026088 Ga0207641_10000259 Ga0207641_1000025932 243
605 3300026088 Ga0207641_10051564 Ga0207641_100515643 243
606 3300026088 Ga0207641_10058303 Ga0207641_100583033 243
607 3300026088 Ga0207641_10070828 Ga0207641_100708283 243
608 3300026089 Ga0207648_10000246 Ga0207648_1000024631 243
609 3300026089 Ga0207648_10017826 Ga0207648_100178263 243
610 3300026089 Ga0207648_10165985 Ga0207648_101659853 243
611 3300026089 Ga0207648_10229136 Ga0207648_102291362 243
612 3300026095 Ga0207676_10010909 Ga0207676_100109095 243
613 3300026095 Ga0207676_10434658 Ga0207676_104346582 243
614 3300026116 Ga0207674_10030346 Ga0207674_100303463 243
615 3300026116 Ga0207674_10093971 Ga0207674_100939715 243
616 3300026116 Ga0207674_10252094 Ga0207674_102520943 243
617 3300026116 Ga0207674_10536165 Ga0207674_105361651 243
618 3300026118 Ga0207675_100001075 Ga0207675_10000107510 243
619 3300026118 Ga0207675_100027442 Ga0207675_1000274424 243
620 3300026118 Ga0207675_100082957 Ga0207675_1000829574 243
621 3300026118 Ga0207675_100132571 Ga0207675_1001325711 243
622 3300026118 Ga0207675_100194483 Ga0207675_1001944831 243
623 3300026118 Ga0207675_100241277 Ga0207675_1002412772 243
624 3300026121 Ga0207683_10003979 Ga0207683_1000397910 243
625 3300026121 Ga0207683_10006075 Ga0207683_100060756 243
626 3300026121 Ga0207683_10027139 Ga0207683_100271393 243
627 3300026142 Ga0207698_10040220 Ga0207698_100402204 243
628 3300026142 Ga0207698_10535965 Ga0207698_105359651 243
629 3300027462 Ga0210000_1017153 Ga0210000_10171532 243
630 3300027866 Ga0209813_10019325 Ga0209813_100193251 243
631 3300027876 Ga0209974_10015823 Ga0209974_100158233 243
632 3300027907 Ga0207428_10003486 Ga0207428_1000348612 243
633 3300027907 Ga0207428_10005664 Ga0207428_100056644 243
634 3300027907 Ga0207428_10009483 Ga0207428_1000948310 243
635 3300027907 Ga0207428_10039646 Ga0207428_100396463 243
636 3300027907 Ga0207428_10092849 Ga0207428_100928491 243
637 3300027907 Ga0207428_10276750 Ga0207428_102767501 243
638 3300028379 Ga0268266_10696669 Ga0268266_106966692 243
639 3300028380 Ga0268265_10001488 Ga0268265_100014887 243
640 3300028380 Ga0268265_10079108 Ga0268265_100791082 243
641 3300028380 Ga0268265_10079933 Ga0268265_100799332 243
642 3300028380 Ga0268265_10115558 Ga0268265_101155582 243
643 3300028380 Ga0268265_10267468 Ga0268265_102674681 243
644 3300028380 Ga0268265_10513505 Ga0268265_105135051 243
645 3300028381 Ga0268264_10043169 Ga0268264_100431692 243
646 3300031548 Ga0307408_100008140 Ga0307408_1000081403 243
647 3300031548 Ga0307408_100025388 Ga0307408_1000253882 243
648 3300031548 Ga0307408_100057087 Ga0307408_1000570873 243
649 3300031731 Ga0307405_10018703 Ga0307405_100187036 243
650 3300031731 Ga0307405_10019998 Ga0307405_100199983 243
651 3300031731 Ga0307405_10296649 Ga0307405_102966492 243
652 3300031731 Ga0307405_10613795 Ga0307405_106137951 243
653 3300031824 Ga0307413_10012181 Ga0307413_100121812 243
654 3300031852 Ga0307410_10041729 Ga0307410_100417292 243
655 3300031852 Ga0307410_10424445 Ga0307410_104244451 243
656 3300031852 Ga0307410_10518800 Ga0307410_105188001 243
657 3300031901 Ga0307406_10146209 Ga0307406_101462092 243
658 3300031903 Ga0307407_10010767 Ga0307407_100107673 243
659 3300031903 Ga0307407_10012301 Ga0307407_100123012 243
660 3300031911 Ga0307412_10018836 Ga0307412_100188362 243
661 3300031911 Ga0307412_10333543 Ga0307412_103335431 243
662 3300031911 Ga0307412_10336223 Ga0307412_103362231 243
663 3300031995 Ga0307409_100022631 Ga0307409_1000226312 243
664 3300031995 Ga0307409_100065980 Ga0307409_1000659801 243
665 3300031995 Ga0307409_100289646 Ga0307409_1002896461 243
666 3300032002 Ga0307416_100021724 Ga0307416_1000217246 243
667 3300032002 Ga0307416_100029729 Ga0307416_1000297291 243
668 3300032002 Ga0307416_100055276 Ga0307416_1000552763 243
669 3300032002 Ga0307416_100374730 Ga0307416_1003747302 243
670 3300032004 Ga0307414_10038982 Ga0307414_100389822 243
671 3300032004 Ga0307414_10123129 Ga0307414_101231292 243
672 3300032004 Ga0307414_10480891 Ga0307414_104808911 243
673 3300032005 Ga0307411_10031137 Ga0307411_100311372 243
674 3300032005 Ga0307411_10034924 Ga0307411_100349242 243
675 3300032005 Ga0307411_10041035 Ga0307411_100410353 243
676 3300032005 Ga0307411_10068882 Ga0307411_100688821 243
677 3300032126 Ga0307415_100008598 Ga0307415_1000085983 243
678 3300032126 Ga0307415_100011264 Ga0307415_1000112648 243
679 3300032126 Ga0307415_100278900 Ga0307415_1002789002 243
680 3300035121 Ga0373960_0017586 Ga0373960_0017586_115_900 243
681 3300035172 Ga0373955_0343741 Ga0373955_0343741_54_839 243
682 3300035242 Ga0373962_0061062 Ga0373962_0061062_314_1045 243
683 3300035691 Ga0373931_0171100 Ga0373931_0171100_38_820 243
684 3300036401 Ga0373937_0051107 Ga0373937_0051107_1813_2598 243
685 3300037068 Ga0373925_0746146 Ga0373925_0746146_39_770 243
686 3300041999 Ga0439433_0031053 Ga0439433_0031053_41_826 243
687 3300042009 Ga0439451_035945 Ga0439451_035945_39_824 243
688 3300042436 Ga0439435_0003900 Ga0439435_0003900_384_1169 243
689 3300042436 Ga0439435_0013465 Ga0439435_0013465_1136_1921 243
690 3300042436 Ga0439435_0051849 Ga0439435_0051849_230_1015 243
691 3300042436 Ga0439435_0065028 Ga0439435_0065028_292_1023 243
692 3300042461 Ga0439460_0009321 Ga0439460_0009321_775_1560 243
693 3300042461 Ga0439460_0057246 Ga0439460_0057246_27_812 243
694 3300042876 Ga0451577_0076842 Ga0451577_0076842_2043_2828 243
695 3300044712 Ga0453684_0786377 Ga0453684_0786377_171_956 243
696 3300045051 Ga0451576_0043858 Ga0451576_0043858_3234_4106 243
697 3300045051 Ga0451576_0048477 Ga0451576_0048477_191_925 243
698 3300045051 Ga0451576_0146119 Ga0451576_0146119_181_966 243
699 3300046455 Ga0495603_0269556 Ga0495603_0269556_137_919 243
700 3300046537 Ga0495598_0008216 Ga0495598_0008216_123_908 243
701 3300047319 Ga0495674_0101914 Ga0495674_0101914_1179_1916 243
702 3300048905 Ga0496102_0137055 Ga0496102_0137055_470_1288 243
703 3300048906 Ga0496103_0366014 Ga0496103_0366014_128_910 243
704 3300048907 Ga0496104_0005034 Ga0496104_0005034_7289_8020 243
705 3300048907 Ga0496104_0033034 Ga0496104_0033034_3264_4082 243
706 3300048907 Ga0496104_0264633 Ga0496104_0264633_647_1438 243
707 3300048907 Ga0496104_0559162 Ga0496104_0559162_15_749 243
708 3300048908 Ga0496105_0090782 Ga0496105_0090782_1581_2372 243
709 3300048909 Ga0496106_0035091 Ga0496106_0035091_2674_3492 243
710 3300048911 Ga0496108_0018786 Ga0496108_0018786_3458_4276 243
711 3300048911 Ga0496108_0827344 Ga0496108_0827344_30_767 243
712 3300048912 Ga0496109_0001054 Ga0496109_0001054_11892_12623 243
713 3300048912 Ga0496109_0034897 Ga0496109_0034897_1017_1835 243
714 3300048912 Ga0496109_0252495 Ga0496109_0252495_309_1043 243
715 3300048912 Ga0496109_0542849 Ga0496109_0542849_135_923 243
716 3300048913 Ga0496110_0002072 Ga0496110_0002072_2696_3427 243
717 3300048913 Ga0496110_0003883 Ga0496110_0003883_1230_2048 243
718 3300048914 Ga0496111_0064665 Ga0496111_0064665_1036_1854 243
719 3300048914 Ga0496111_0321780 Ga0496111_0321780_114_845 243
720 3300048915 Ga0496112_0003061 Ga0496112_0003061_5526_6257 243
721 3300048915 Ga0496112_0005221 Ga0496112_0005221_473_1291 243
722 3300048916 Ga0496113_0074500 Ga0496113_0074500_854_1585 243
723 3300048916 Ga0496113_0094299 Ga0496113_0094299_1103_1921 243
724 3300048917 Ga0496114_0465612 Ga0496114_0465612_311_1042 243
725 3300049569 Ga0501032_0278000 Ga0501032_0278000_231_1016 243
726 3300049569 Ga0501032_0293391 Ga0501032_0293391_54_839 243
727 3300049571 Ga0501034_0039253 Ga0501034_0039253_4037_4768 243
728 3300049572 Ga0501036_0156950 Ga0501036_0156950_143_928 243
729 3300049572 Ga0501036_0218330 Ga0501036_0218330_172_957 243
730 3300049572 Ga0501036_0279380 Ga0501036_0279380_76_861 243
731 3300049572 Ga0501036_0351264 Ga0501036_0351264_128_913 243
732 3300049574 Ga0501038_0157232 Ga0501038_0157232_917_1702 243
733 3300049574 Ga0501038_0424801 Ga0501038_0424801_185_970 243
734 3300049576 Ga0501040_0020560 Ga0501040_0020560_19_804 243
735 3300049576 Ga0501040_0155555 Ga0501040_0155555_149_934 243
736 3300049577 Ga0501041_0010636 Ga0501041_0010636_342_1127 243
737 3300049577 Ga0501041_0011231 Ga0501041_0011231_3531_4316 243
738 3300049577 Ga0501041_0162503 Ga0501041_0162503_371_1156 243
739 3300049577 Ga0501041_0289185 Ga0501041_0289185_104_889 243
740 3300049578 Ga0501042_0063830 Ga0501042_0063830_280_1065 243
741 3300049578 Ga0501042_0085180 Ga0501042_0085180_1273_2058 243
742 3300049578 Ga0501042_0195223 Ga0501042_0195223_321_1106 243
743 3300049579 Ga0501043_0106457 Ga0501043_0106457_967_1749 243
744 3300049579 Ga0501043_0343542 Ga0501043_0343542_325_1110 243
745 3300049580 Ga0501046_0035947 Ga0501046_0035947_3007_3792 243
746 3300049581 Ga0501047_0052331 Ga0501047_0052331_1323_2105 243
747 3300049582 Ga0501048_0033566 Ga0501048_0033566_2217_3002 243
748 3300049582 Ga0501048_0224436 Ga0501048_0224436_236_1021 243
749 3300049584 Ga0501068_0332508 Ga0501068_0332508_114_899 243
750 3300049587 Ga0501071_0013769 Ga0501071_0013769_2825_3610 243
751 3300049587 Ga0501071_0107076 Ga0501071_0107076_517_1302 243
752 3300049587 Ga0501071_0119398 Ga0501071_0119398_852_1637 243
753 3300049587 Ga0501071_0191228 Ga0501071_0191228_67_852 243
754 3300049588 Ga0501072_0032275 Ga0501072_0032275_115_900 243
755 3300049588 Ga0501072_0042098 Ga0501072_0042098_282_1067 243
756 3300049588 Ga0501072_0091050 Ga0501072_0091050_1419_2204 243
757 3300049588 Ga0501072_0103309 Ga0501072_0103309_159_944 243
758 3300049588 Ga0501072_0335317 Ga0501072_0335317_299_1084 243
759 3300049590 Ga0501074_0105851 Ga0501074_0105851_105_890 243
760 3300049590 Ga0501074_0270389 Ga0501074_0270389_67_852 243
761 3300049591 Ga0501075_0019019 Ga0501075_0019019_459_1244 243
762 3300049591 Ga0501075_0081685 Ga0501075_0081685_953_1738 243
763 3300049591 Ga0501075_0163142 Ga0501075_0163142_23_808 243
764 3300049591 Ga0501075_0427074 Ga0501075_0427074_209_994 243
765 3300049591 Ga0501075_0488749 Ga0501075_0488749_86_874 243
766 3300049592 Ga0501076_0005097 Ga0501076_0005097_8445_9230 243
767 3300049592 Ga0501076_0047976 Ga0501076_0047976_1196_1981 243
768 3300049592 Ga0501076_0130401 Ga0501076_0130401_1141_1926 243
769 3300049592 Ga0501076_0288425 Ga0501076_0288425_19_753 243
770 3300049593 Ga0501077_0393637 Ga0501077_0393637_50_835 243
771 3300049661 Ga0501217_079764 Ga0501217_079764_16_798 243
772 3300049708 Ga0501245_011486 Ga0501245_011486_351_1133 243
773 3300049741 Ga0501079_0052049 Ga0501079_0052049_2202_2987 243
774 3300049741 Ga0501079_0202364 Ga0501079_0202364_753_1538 243
775 3300049741 Ga0501079_0211818 Ga0501079_0211818_174_908 243
776 3300049742 Ga0501080_0212064 Ga0501080_0212064_340_1125 243
777 3300049742 Ga0501080_0432865 Ga0501080_0432865_272_1057 243
778 3300049743 Ga0501081_0209315 Ga0501081_0209315_333_1118 243
779 3300049743 Ga0501081_0331772 Ga0501081_0331772_202_987 243
780 3300049779 Ga0501283_025443 Ga0501283_025443_93_875 243
781 3300049823 Ga0501044_0027646 Ga0501044_0027646_3489_4271 243
782 3300049824 Ga0501045_0020019 Ga0501045_0020019_359_1144 243
783 3300049824 Ga0501045_0024508 Ga0501045_0024508_2605_3390 243
784 3300049824 Ga0501045_0031413 Ga0501045_0031413_203_988 243
785 3300049824 Ga0501045_0061736 Ga0501045_0061736_1938_2723 243
786 3300050489 nmdc:mga03683_12926_c1 nmdc:mga03683_12926_c1_1296_2027 243
787 3300050490 nmdc:mga03n38_133976_c1 nmdc:mga03n38_133976_c1_450_1184 243
788 3300050491 nmdc:mga00v17_19639_c1 nmdc:mga00v17_19639_c1_1514_2245 243
789 3300050492 nmdc:mga0yw44_156896_c1 nmdc:mga0yw44_156896_c1_251_1033 243
790 3300050492 nmdc:mga0yw44_30218_c1 nmdc:mga0yw44_30218_c1_1105_1839 243
791 3300050493 nmdc:mga0k408_320004_c1 nmdc:mga0k408_320004_c1_173_904 243
792 3300050493 nmdc:mga0k408_76872_c1 nmdc:mga0k408_76872_c1_1078_1809 243
793 3300050494 nmdc:mga06z11_246932_c1 nmdc:mga06z11_246932_c1_95_826 243
794 3300050494 nmdc:mga06z11_32907_c1 nmdc:mga06z11_32907_c1_12_746 243
795 3300050495 nmdc:mga04h51_20370_c1 nmdc:mga04h51_20370_c1_1093_1827 243
796 3300050496 nmdc:mga07m45_49442_c1 nmdc:mga07m45_49442_c1_558_1292 243
797 3300050507 nmdc:mga05p37_107342_c1 nmdc:mga05p37_107342_c1_2474_3259 243
798 3300050507 nmdc:mga05p37_1074_c1 nmdc:mga05p37_1074_c1_2218_3003 243
799 3300050507 nmdc:mga05p37_170381_c1 nmdc:mga05p37_170381_c1_1743_2528 243
800 3300050507 nmdc:mga05p37_191001_c1 nmdc:mga05p37_191001_c1_877_1662 243
801 3300050507 nmdc:mga05p37_227632_c2 nmdc:mga05p37_227632_c2_265_1047 243
802 3300050507 nmdc:mga05p37_232050_c1 nmdc:mga05p37_232050_c1_776_1561 243
803 3300050507 nmdc:mga05p37_24240_c1 nmdc:mga05p37_24240_c1_40_825 243
804 3300050507 nmdc:mga05p37_254208_c1 nmdc:mga05p37_254208_c1_131_916 243
805 3300050507 nmdc:mga05p37_27424_c1 nmdc:mga05p37_27424_c1_1260_2045 243
806 3300050507 nmdc:mga05p37_321996_c1 nmdc:mga05p37_321996_c1_913_1698 243
807 3300050507 nmdc:mga05p37_403023_c1 nmdc:mga05p37_403023_c1_383_1174 243
808 3300050507 nmdc:mga05p37_467662_c1 nmdc:mga05p37_467662_c1_424_1155 243
809 3300050507 nmdc:mga05p37_4973_c1 nmdc:mga05p37_4973_c1_1711_2496 243
810 3300050507 nmdc:mga05p37_551536_c1 nmdc:mga05p37_551536_c1_486_1268 243
811 3300050507 nmdc:mga05p37_83_c1 nmdc:mga05p37_83_c1_70216_70947 243
812 3300050507 nmdc:mga05p37_876_c1 nmdc:mga05p37_876_c1_28711_29445 243
813 3300050508 nmdc:mga09592_101092_c1 nmdc:mga09592_101092_c1_1195_1977 243
814 3300050508 nmdc:mga09592_42919_c1 nmdc:mga09592_42919_c1_2779_3564 243
815 3300050508 nmdc:mga09592_46796_c1 nmdc:mga09592_46796_c1_689_1474 243
816 3300050508 nmdc:mga09592_58391_c1 nmdc:mga09592_58391_c1_1167_1952 243
817 3300050508 nmdc:mga09592_7978_c1 nmdc:mga09592_7978_c1_4261_5046 243
818 3300050508 nmdc:mga09592_90410_c1 nmdc:mga09592_90410_c1_1220_1954 243
819 3300050509 nmdc:mga0qj67_116243_c1 nmdc:mga0qj67_116243_c1_389_1174 243
820 3300050509 nmdc:mga0qj67_16467_c1 nmdc:mga0qj67_16467_c1_4264_5049 243
821 3300050509 nmdc:mga0qj67_17069_c1 nmdc:mga0qj67_17069_c1_2540_3325 243
822 3300050509 nmdc:mga0qj67_203387_c1 nmdc:mga0qj67_203387_c1_159_941 243
823 3300050509 nmdc:mga0qj67_230269_c1 nmdc:mga0qj67_230269_c1_122_907 243
824 3300050509 nmdc:mga0qj67_35275_c1 nmdc:mga0qj67_35275_c1_206_988 243
825 3300050509 nmdc:mga0qj67_56085_c1 nmdc:mga0qj67_56085_c1_1150_1935 243
826 3300050510 nmdc:mga06r32_121634_c1 nmdc:mga06r32_121634_c1_1172_1957 243
827 3300050510 nmdc:mga06r32_186599_c1 nmdc:mga06r32_186599_c1_888_1622 243
828 3300050510 nmdc:mga06r32_243033_c1 nmdc:mga06r32_243033_c1_788_1573 243
829 3300050510 nmdc:mga06r32_279435_c1 nmdc:mga06r32_279435_c1_126_911 243
830 3300050510 nmdc:mga06r32_442461_c1 nmdc:mga06r32_442461_c1_135_920 243
831 3300050510 nmdc:mga06r32_52513_c1 nmdc:mga06r32_52513_c1_2323_3108 243
832 3300050510 nmdc:mga06r32_785317_c1 nmdc:mga06r32_785317_c1_26_760 243
833 3300050511 nmdc:mga08y16_111173_c1 nmdc:mga08y16_111173_c1_1877_2662 243
834 3300050511 nmdc:mga08y16_1121_c1 nmdc:mga08y16_1121_c1_24031_24816 243
835 3300050511 nmdc:mga08y16_125171_c1 nmdc:mga08y16_125171_c1_1840_2622 243
836 3300050511 nmdc:mga08y16_206959_c1 nmdc:mga08y16_206959_c1_1086_1877 243
837 3300050511 nmdc:mga08y16_223798_c1 nmdc:mga08y16_223798_c1_805_1590 243
838 3300050511 nmdc:mga08y16_2471_c1 nmdc:mga08y16_2471_c1_5851_6636 243
839 3300050511 nmdc:mga08y16_30792_c1 nmdc:mga08y16_30792_c1_3312_4046 243
840 3300050511 nmdc:mga08y16_7060_c1 nmdc:mga08y16_7060_c1_4573_5361 243
841 3300050511 nmdc:mga08y16_7865_c1 nmdc:mga08y16_7865_c1_8804_9586 243
842 3300050512 nmdc:mga0n895_251662_c1 nmdc:mga0n895_251662_c1_759_1493 243
843 3300050512 nmdc:mga0n895_48219_c1 nmdc:mga0n895_48219_c1_1146_1931 243
844 3300050512 nmdc:mga0n895_5029_c1 nmdc:mga0n895_5029_c1_496_1278 243
845 3300050512 nmdc:mga0n895_68276_c1 nmdc:mga0n895_68276_c1_376_1161 243
846 3300050512 nmdc:mga0n895_768996_c1 nmdc:mga0n895_768996_c1_81_863 243
847 3300050513 nmdc:mga0rr50_6819_c1 nmdc:mga0rr50_6819_c1_1119_1904 243
848 3300050514 nmdc:mga08x19_73783_c1 nmdc:mga08x19_73783_c1_197_982 243
849 3300050515 nmdc:mga0a205_15411_c1 nmdc:mga0a205_15411_c1_5143_5925 243
850 3300050515 nmdc:mga0a205_16830_c1 nmdc:mga0a205_16830_c1_2724_3509 243
851 3300050515 nmdc:mga0a205_17912_c1 nmdc:mga0a205_17912_c1_5395_6183 243
852 3300050515 nmdc:mga0a205_29612_c1 nmdc:mga0a205_29612_c1_3701_4486 243
853 3300050515 nmdc:mga0a205_43676_c1 nmdc:mga0a205_43676_c1_2631_3416 243
854 3300050515 nmdc:mga0a205_4439_c1 nmdc:mga0a205_4439_c1_5677_6411 243
855 3300050515 nmdc:mga0a205_50427_c2 nmdc:mga0a205_50427_c2_1369_2151 243
856 3300050515 nmdc:mga0a205_538788_c1 nmdc:mga0a205_538788_c1_47_835 243
857 3300050515 nmdc:mga0a205_96540_c1 nmdc:mga0a205_96540_c1_364_1149 243
858 3300053077 Ga0495601_0075013 Ga0495601_0075013_219_1004 243
859 3300054114 Ga0501084_0067656 Ga0501084_0067656_1930_2715 243
860 3300054114 Ga0501084_0468328 Ga0501084_0468328_86_871 243
861 3300059421 Ga0590071_001388 Ga0590071_001388_2723_3508 243
862 3300059421 Ga0590071_006653 Ga0590071_006653_317_1105 243
863 3300059423 Ga0590074_005177 Ga0590074_005177_511_1296 243
864 3300059424 Ga0590075_000351 Ga0590075_000351_9588_10373 243
865 3300059424 Ga0590075_003200 Ga0590075_003200_779_1567 243
866 3300059424 Ga0590075_004308 Ga0590075_004308_92_874 243
867 3300059424 Ga0590075_050806 Ga0590075_050806_164_949 243
868 3300059426 Ga0590077_000390 Ga0590077_000390_9429_10211 243
869 3300059426 Ga0590077_001322 Ga0590077_001322_3361_4146 243
870 3300059511 Ga0587091_042773 Ga0587091_042773_45_833 243
871 3300060353 Ga0501082_0269423 Ga0501082_0269423_312_1097 243
872 3300061734 Ga0530510_0006822 Ga0530510_0006822_2296_3081 243
873 3300061734 Ga0530510_0180631 Ga0530510_0180631_164_949 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

174

211

0.94

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

42

154

0.89

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

173

286

0.85

PF18029

Glyoxalase_6

Glyoxalase-like domain

46

155

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.9082 2 243
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.8376 2 243
3oa4-assembly1.cif.gz_A-2 crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 0.7883 121 243
6xbs-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (e43q) in complex with 2-nitronate-propionyl-coa 0.7714 125 243
2r6u-assembly2.cif.gz_B crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.7667 123 243
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8951 190 243 3.30.720.110
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8674 123 242 3.10.180.10
3oxhA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8645 113 242 3.10.180.10
af_I6XA34_134_256_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8579 121 240 3.10.180.10
3oxhA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.852 121 243 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2V8IG39-F1-model_v4 Glyoxalase 0.9882 1 243
AF-A0A7Y4VZB3-F1-model_v4 VOC family protein 0.9846 1 241
AF-A0A2V8IG39-F1-model_v4 Glyoxalase 0.9842 1 243
AF-A0A7Y4VZB3-F1-model_v4 VOC family protein 0.9647 1 241
AF-A0A6B1FMV3-F1-model_v4 VOC family protein 0.9579 1 243

Feature Viewer

pLDDT pTM Quality
93.77 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map