F484248
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 873 | 289 | 873 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300005337|Ga0070682_100122017|Ga0070682_1001220172 |
| Length | 292 |
| Sequence | MSSSAECERLLDLPGWIRPVEPQLDFTGGFPMTTATSTLLGRPVWYELMTGDVAAAETFYKNVIGWTSAPFRGAPDPYDVFKRSGDVQVAGVMHTPKGMNMPPFWSMYVAVPKLEEAVAHIKRLGGTELSGVIDVPTVGRMQMLKDPQGAAFYIIQPAPREERAETAPVVGEASWHELMTTDADAAMKFYSDVFGWQPSEAMDMGEMGKYQMFNRPSGMIGGMMNKPPQMADVPPYWAIYFLVPDINAAVERIKANGGQVLNGPMEVPGGDWIVNAMDPQGAMFSLHAKKAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 3 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 6 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 110 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 168 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 169 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 170 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 171 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 172 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 173 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 180 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 186 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 189 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 190 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 191 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 192 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 193 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 194 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 195 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 196 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 197 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 198 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 199 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 200 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 201 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 202 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 203 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 204 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 205 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 215 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 216 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 217 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 218 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 219 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 222 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 223 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 224 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 225 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 226 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 227 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 228 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 229 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 230 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 231 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 251 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 252 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 253 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 254 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 258 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 259 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 260 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 263 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 264 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 265 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 266 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 267 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 268 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 269 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 270 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 280 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 282 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 284 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 285 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 286 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 287 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.4 |
| Metatranscriptomes | 1.6 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.29 |
| Nodule | 0 |
| Rhizoplane | 3.09 |
| Rhizosphere | 93.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_3199878 | 2162886011 | Unclassified | 949 |
| 2 | Ga0058859_11229463 | 3300004798 | Bacteria | 1041 |
| 3 | Ga0058863_11934526 | 3300004799 | Bacteria | 1226 |
| 4 | Ga0058861_11748004 | 3300004800 | Bacteria | 1374 |
| 5 | Ga0058861_12031893 | 3300004800 | Bacteria | 1094 |
| 6 | Ga0058860_10064540 | 3300004801 | Unclassified | 1164 |
| 7 | Ga0058860_10090918 | 3300004801 | Bacteria | 918 |
| 8 | Ga0058860_11611968 | 3300004801 | Bacteria | 1142 |
| 9 | Ga0058860_12028819 | 3300004801 | Bacteria | 1216 |
| 10 | Ga0058862_12539343 | 3300004803 | Bacteria | 1186 |
| 11 | Ga0058862_12758636 | 3300004803 | Unclassified | 943 |
| 12 | Ga0058862_12783670 | 3300004803 | Unclassified | 989 |
| 13 | Ga0065714_10071074 | 3300005288 | Bacteria | 3671 |
| 14 | Ga0065704_10171588 | 3300005289 | Unclassified | 1288 |
| 15 | Ga0065712_10003381 | 3300005290 | Bacteria | 5639 |
| 16 | Ga0065712_10010152 | 3300005290 | Bacteria | 2758 |
| 17 | Ga0065712_10074252 | 3300005290 | Unclassified | 4144 |
| 18 | Ga0065715_10004219 | 3300005293 | Bacteria | 6834 |
| 19 | Ga0065715_10094822 | 3300005293 | Unclassified | 4232 |
| 20 | Ga0065715_10102412 | 3300005293 | Bacteria | 3117 |
| 21 | Ga0065715_10126090 | 3300005293 | Bacteria | 2101 |
| 22 | Ga0065715_10167934 | 3300005293 | Bacteria | 1571 |
| 23 | Ga0065715_10169792 | 3300005293 | Unclassified | 1556 |
| 24 | Ga0065707_10092277 | 3300005295 | Bacteria | 3794 |
| 25 | Ga0065707_10194570 | 3300005295 | Bacteria | 1337 |
| 26 | Ga0065707_10212626 | 3300005295 | Unclassified | 1256 |
| 27 | Ga0070658_10013944 | 3300005327 | Bacteria | 6452 |
| 28 | Ga0070676_10019726 | 3300005328 | Unclassified | 3756 |
| 29 | Ga0070676_10140219 | 3300005328 | Unclassified | 1538 |
| 30 | Ga0070683_100000260 | 3300005329 | Bacteria | 36410 |
| 31 | Ga0070683_100707004 | 3300005329 | Bacteria | 965 |
| 32 | Ga0070690_100011445 | 3300005330 | Bacteria | 5189 |
| 33 | Ga0070690_100014027 | 3300005330 | Unclassified | 4750 |
| 34 | Ga0070690_100023056 | 3300005330 | Bacteria | 3814 |
| 35 | Ga0070670_100001340 | 3300005331 | Bacteria | 19679 |
| 36 | Ga0070670_100005713 | 3300005331 | Bacteria | 10514 |
| 37 | Ga0070670_100008280 | 3300005331 | Bacteria | 8852 |
| 38 | Ga0070670_100013192 | 3300005331 | Bacteria | 7078 |
| 39 | Ga0070670_100016091 | 3300005331 | Bacteria | 6420 |
| 40 | Ga0070670_100068105 | 3300005331 | Bacteria | 3055 |
| 41 | Ga0070670_100124633 | 3300005331 | Bacteria | 2224 |
| 42 | Ga0070670_100156618 | 3300005331 | Unclassified | 1973 |
| 43 | Ga0070670_100163332 | 3300005331 | Bacteria | 1930 |
| 44 | Ga0070670_100540427 | 3300005331 | Bacteria | 1039 |
| 45 | Ga0070677_10016722 | 3300005333 | Bacteria | 2615 |
| 46 | Ga0070677_10058734 | 3300005333 | Unclassified | 1580 |
| 47 | Ga0068869_100020689 | 3300005334 | Unclassified | 4517 |
| 48 | Ga0068869_100025458 | 3300005334 | Bacteria | 4109 |
| 49 | Ga0068869_100154420 | 3300005334 | Unclassified | 1782 |
| 50 | Ga0070666_10012985 | 3300005335 | Bacteria | 5273 |
| 51 | Ga0070666_10064586 | 3300005335 | Bacteria | 2482 |
| 52 | Ga0070666_10159512 | 3300005335 | Unclassified | 1576 |
| 53 | Ga0070666_10227019 | 3300005335 | Bacteria | 1318 |
| 54 | Ga0070666_10322574 | 3300005335 | Bacteria | 1102 |
| 55 | Ga0070680_100441545 | 3300005336 | Bacteria | 1111 |
| 56 | Ga0070682_100122017 | 3300005337 | Bacteria | 1751 |
| 57 | Ga0068868_100011659 | 3300005338 | Bacteria | 6404 |
| 58 | Ga0070660_100275589 | 3300005339 | Unclassified | 1376 |
| 59 | Ga0070689_100039410 | 3300005340 | Unclassified | 3617 |
| 60 | Ga0070689_100245288 | 3300005340 | Unclassified | 1477 |
| 61 | Ga0070689_100468948 | 3300005340 | Bacteria | 1074 |
| 62 | Ga0070687_100006132 | 3300005343 | Bacteria | 4910 |
| 63 | Ga0070687_100031838 | 3300005343 | Unclassified | 2590 |
| 64 | Ga0070687_100050658 | 3300005343 | Bacteria | 2145 |
| 65 | Ga0070661_100001252 | 3300005344 | Bacteria | 17814 |
| 66 | Ga0070661_100020068 | 3300005344 | Bacteria | 4764 |
| 67 | Ga0070668_100013056 | 3300005347 | Bacteria | 6187 |
| 68 | Ga0070668_100136203 | 3300005347 | Bacteria | 1975 |
| 69 | Ga0070668_100296484 | 3300005347 | Bacteria | 1355 |
| 70 | Ga0070668_100320759 | 3300005347 | Bacteria | 1304 |
| 71 | Ga0070668_100659752 | 3300005347 | Bacteria | 920 |
| 72 | Ga0070669_100000399 | 3300005353 | Bacteria | 33282 |
| 73 | Ga0070669_100002199 | 3300005353 | Bacteria | 14122 |
| 74 | Ga0070669_100003613 | 3300005353 | Bacteria | 11161 |
| 75 | Ga0070669_100017648 | 3300005353 | Bacteria | 5091 |
| 76 | Ga0070669_100036098 | 3300005353 | Bacteria | 3581 |
| 77 | Ga0070669_100073288 | 3300005353 | Bacteria | 2536 |
| 78 | Ga0070669_100102331 | 3300005353 | Bacteria | 2163 |
| 79 | Ga0070669_100307046 | 3300005353 | Bacteria | 1277 |
| 80 | Ga0070675_100017161 | 3300005354 | Bacteria | 5753 |
| 81 | Ga0070675_100047773 | 3300005354 | Bacteria | 3508 |
| 82 | Ga0070675_100081052 | 3300005354 | Unclassified | 2706 |
| 83 | Ga0070675_100124137 | 3300005354 | Bacteria | 2196 |
| 84 | Ga0070675_100277332 | 3300005354 | Unclassified | 1472 |
| 85 | Ga0070675_100631575 | 3300005354 | Bacteria | 973 |
| 86 | Ga0070675_100647599 | 3300005354 | Unclassified | 960 |
| 87 | Ga0070671_100171233 | 3300005355 | Bacteria | 1836 |
| 88 | Ga0070671_100268190 | 3300005355 | Unclassified | 1451 |
| 89 | Ga0070671_100462898 | 3300005355 | Unclassified | 1088 |
| 90 | Ga0070674_100000133 | 3300005356 | Bacteria | 34091 |
| 91 | Ga0070674_100038102 | 3300005356 | Unclassified | 3238 |
| 92 | Ga0070674_100130461 | 3300005356 | Unclassified | 1873 |
| 93 | Ga0070673_100007069 | 3300005364 | Bacteria | 7366 |
| 94 | Ga0070673_100008782 | 3300005364 | Bacteria | 6745 |
| 95 | Ga0070673_100032544 | 3300005364 | Bacteria | 3928 |
| 96 | Ga0070673_100458554 | 3300005364 | Unclassified | 1147 |
| 97 | Ga0070688_100087207 | 3300005365 | Unclassified | 2032 |
| 98 | Ga0070688_100106534 | 3300005365 | Unclassified | 1857 |
| 99 | Ga0070688_100117494 | 3300005365 | Bacteria | 1777 |
| 100 | Ga0070688_100210667 | 3300005365 | Unclassified | 1364 |
| 101 | Ga0070667_100004567 | 3300005367 | Bacteria | 11631 |
| 102 | Ga0070703_10158118 | 3300005406 | Unclassified | 857 |
| 103 | Ga0070701_10001279 | 3300005438 | Bacteria | 9244 |
| 104 | Ga0070701_10043901 | 3300005438 | Unclassified | 2289 |
| 105 | Ga0070701_10068895 | 3300005438 | Bacteria | 1886 |
| 106 | Ga0070705_100053529 | 3300005440 | Unclassified | 2363 |
| 107 | Ga0070705_100232308 | 3300005440 | Bacteria | 1284 |
| 108 | Ga0070700_100015636 | 3300005441 | Bacteria | 4308 |
| 109 | Ga0070700_100077549 | 3300005441 | Unclassified | 2137 |
| 110 | Ga0070700_100155460 | 3300005441 | Bacteria | 1569 |
| 111 | Ga0070700_100506285 | 3300005441 | Bacteria | 930 |
| 112 | Ga0070694_100033846 | 3300005444 | Unclassified | 3367 |
| 113 | Ga0070708_100346796 | 3300005445 | Unclassified | 1399 |
| 114 | Ga0070663_100007791 | 3300005455 | Bacteria | 6545 |
| 115 | Ga0070678_100026864 | 3300005456 | Bacteria | 3899 |
| 116 | Ga0070678_100054028 | 3300005456 | Bacteria | 2924 |
| 117 | Ga0070678_100130396 | 3300005456 | Bacteria | 1996 |
| 118 | Ga0070678_100161441 | 3300005456 | Bacteria | 1816 |
| 119 | Ga0070662_100011707 | 3300005457 | Bacteria | 5790 |
| 120 | Ga0070662_100024347 | 3300005457 | Unclassified | 4170 |
| 121 | Ga0068867_100004682 | 3300005459 | Bacteria | 9625 |
| 122 | Ga0068867_100022711 | 3300005459 | Bacteria | 4487 |
| 123 | Ga0068867_100058755 | 3300005459 | Bacteria | 2850 |
| 124 | Ga0068867_100600452 | 3300005459 | Bacteria | 960 |
| 125 | Ga0070685_10041862 | 3300005466 | Unclassified | 2611 |
| 126 | Ga0070685_10260454 | 3300005466 | Bacteria | 1153 |
| 127 | Ga0070698_100205261 | 3300005471 | Bacteria | 1906 |
| 128 | Ga0070698_100740187 | 3300005471 | Unclassified | 926 |
| 129 | Ga0070699_100000485 | 3300005518 | Bacteria | 37796 |
| 130 | Ga0070699_100041522 | 3300005518 | Bacteria | 3982 |
| 131 | Ga0070679_100116476 | 3300005530 | Bacteria | 2657 |
| 132 | Ga0070684_100000898 | 3300005535 | Bacteria | 21069 |
| 133 | Ga0070697_100165138 | 3300005536 | Bacteria | 1872 |
| 134 | Ga0070672_100012392 | 3300005543 | Bacteria | 5984 |
| 135 | Ga0070672_100015890 | 3300005543 | Bacteria | 5375 |
| 136 | Ga0070672_100186409 | 3300005543 | Unclassified | 1731 |
| 137 | Ga0070672_100412461 | 3300005543 | Bacteria | 1159 |
| 138 | Ga0070686_100009424 | 3300005544 | Bacteria | 5489 |
| 139 | Ga0070686_100051783 | 3300005544 | Unclassified | 2615 |
| 140 | Ga0070686_100251732 | 3300005544 | Bacteria | 1290 |
| 141 | Ga0070695_100417634 | 3300005545 | Bacteria | 1021 |
| 142 | Ga0070696_100443868 | 3300005546 | Unclassified | 1023 |
| 143 | Ga0070665_100028846 | 3300005548 | Bacteria | 5586 |
| 144 | Ga0070665_100048324 | 3300005548 | Unclassified | 4272 |
| 145 | Ga0070665_100444421 | 3300005548 | Unclassified | 1306 |
| 146 | Ga0070704_100033061 | 3300005549 | Unclassified | 3495 |
| 147 | Ga0070664_100002150 | 3300005564 | Bacteria | 15800 |
| 148 | Ga0070664_100014148 | 3300005564 | Bacteria | 6508 |
| 149 | Ga0070664_100312663 | 3300005564 | Unclassified | 1422 |
| 150 | Ga0070664_100402932 | 3300005564 | Unclassified | 1251 |
| 151 | Ga0070664_100554967 | 3300005564 | Unclassified | 1062 |
| 152 | Ga0068857_100011022 | 3300005577 | Bacteria | 7870 |
| 153 | Ga0068857_100013100 | 3300005577 | Bacteria | 7226 |
| 154 | Ga0068857_100062811 | 3300005577 | Bacteria | 3302 |
| 155 | Ga0068857_100628900 | 3300005577 | Bacteria | 1016 |
| 156 | Ga0068854_100145624 | 3300005578 | Unclassified | 1822 |
| 157 | Ga0070702_100091927 | 3300005615 | Bacteria | 1842 |
| 158 | Ga0068852_100210251 | 3300005616 | Bacteria | 1845 |
| 159 | Ga0068859_100005105 | 3300005617 | Bacteria | 13335 |
| 160 | Ga0068859_100009922 | 3300005617 | Bacteria | 9611 |
| 161 | Ga0068859_100012595 | 3300005617 | Bacteria | 8505 |
| 162 | Ga0068859_100060387 | 3300005617 | Bacteria | 3820 |
| 163 | Ga0068859_100079721 | 3300005617 | Bacteria | 3315 |
| 164 | Ga0068859_100237905 | 3300005617 | Unclassified | 1910 |
| 165 | Ga0068864_100039642 | 3300005618 | Unclassified | 4025 |
| 166 | Ga0068864_100064648 | 3300005618 | Bacteria | 3173 |
| 167 | Ga0068864_100427390 | 3300005618 | Bacteria | 1263 |
| 168 | Ga0068864_100511997 | 3300005618 | Unclassified | 1156 |
| 169 | Ga0068861_100006364 | 3300005719 | Bacteria | 8040 |
| 170 | Ga0068861_100013596 | 3300005719 | Bacteria | 5698 |
| 171 | Ga0068861_100172423 | 3300005719 | Bacteria | 1794 |
| 172 | Ga0068870_10000968 | 3300005840 | Bacteria | 11294 |
| 173 | Ga0068870_10014039 | 3300005840 | Bacteria | 3775 |
| 174 | Ga0068870_10059758 | 3300005840 | Bacteria | 2044 |
| 175 | Ga0068870_10066038 | 3300005840 | Bacteria | 1959 |
| 176 | Ga0068863_100000005 | 3300005841 | Bacteria | 269757 |
| 177 | Ga0068863_100000867 | 3300005841 | Bacteria | 30266 |
| 178 | Ga0068863_100039399 | 3300005841 | Bacteria | 4496 |
| 179 | Ga0068863_100083183 | 3300005841 | Bacteria | 3033 |
| 180 | Ga0068863_100158225 | 3300005841 | Unclassified | 2169 |
| 181 | Ga0068863_100834985 | 3300005841 | Bacteria | 920 |
| 182 | Ga0068863_100865957 | 3300005841 | Bacteria | 903 |
| 183 | Ga0068858_100007931 | 3300005842 | Bacteria | 10232 |
| 184 | Ga0068858_100009898 | 3300005842 | Bacteria | 9058 |
| 185 | Ga0068858_100012596 | 3300005842 | Bacteria | 7971 |
| 186 | Ga0068858_100048972 | 3300005842 | Bacteria | 3914 |
| 187 | Ga0068858_100083127 | 3300005842 | Bacteria | 2977 |
| 188 | Ga0068858_100336378 | 3300005842 | Bacteria | 1444 |
| 189 | Ga0068860_100000008 | 3300005843 | Bacteria | 427367 |
| 190 | Ga0068860_100021964 | 3300005843 | Bacteria | 6176 |
| 191 | Ga0068860_100053433 | 3300005843 | Bacteria | 3841 |
| 192 | Ga0068860_100140178 | 3300005843 | Bacteria | 2324 |
| 193 | Ga0068860_100194295 | 3300005843 | Unclassified | 1965 |
| 194 | Ga0068862_100001221 | 3300005844 | Bacteria | 24241 |
| 195 | Ga0068862_100012814 | 3300005844 | Bacteria | 6936 |
| 196 | Ga0068862_100038425 | 3300005844 | Bacteria | 4059 |
| 197 | Ga0068862_100051534 | 3300005844 | Unclassified | 3520 |
| 198 | Ga0068862_100100586 | 3300005844 | Bacteria | 2528 |
| 199 | Ga0068862_100137218 | 3300005844 | Bacteria | 2169 |
| 200 | Ga0068862_100205237 | 3300005844 | Bacteria | 1778 |
| 201 | Ga0068862_100280175 | 3300005844 | Unclassified | 1528 |
| 202 | Ga0068862_100517777 | 3300005844 | Bacteria | 1135 |
| 203 | Ga0081455_10034132 | 3300005937 | Bacteria | 4562 |
| 204 | Ga0081455_10156505 | 3300005937 | Bacteria | 1751 |
| 205 | Ga0081455_10191329 | 3300005937 | Bacteria | 1540 |
| 206 | Ga0075368_10005612 | 3300006042 | Bacteria | 4329 |
| 207 | Ga0075364_10130065 | 3300006051 | Bacteria | 1689 |
| 208 | Ga0075367_10211582 | 3300006178 | Unclassified | 1212 |
| 209 | Ga0075366_10027111 | 3300006195 | Bacteria | 3360 |
| 210 | Ga0075366_10129648 | 3300006195 | Bacteria | 1522 |
| 211 | Ga0097621_100049978 | 3300006237 | Bacteria | 3399 |
| 212 | Ga0097621_100176404 | 3300006237 | Bacteria | 1845 |
| 213 | Ga0075370_10013601 | 3300006353 | Bacteria | 4330 |
| 214 | Ga0068871_100043752 | 3300006358 | Bacteria | 3598 |
| 215 | Ga0068871_100095480 | 3300006358 | Unclassified | 2483 |
| 216 | Ga0068871_100203448 | 3300006358 | Unclassified | 1710 |
| 217 | Ga0075428_100004960 | 3300006844 | Bacteria | 14782 |
| 218 | Ga0075428_100009217 | 3300006844 | Bacteria | 10949 |
| 219 | Ga0075428_100014803 | 3300006844 | Bacteria | 8668 |
| 220 | Ga0075428_100073348 | 3300006844 | Bacteria | 3738 |
| 221 | Ga0075428_100074638 | 3300006844 | Bacteria | 3704 |
| 222 | Ga0075428_100144399 | 3300006844 | Bacteria | 2587 |
| 223 | Ga0075428_100152385 | 3300006844 | Unclassified | 2511 |
| 224 | Ga0075428_100231389 | 3300006844 | Bacteria | 1994 |
| 225 | Ga0075428_100314293 | 3300006844 | Bacteria | 1684 |
| 226 | Ga0075428_100477156 | 3300006844 | Bacteria | 1335 |
| 227 | Ga0075430_100000381 | 3300006846 | Bacteria | 32603 |
| 228 | Ga0075430_100002731 | 3300006846 | Bacteria | 14733 |
| 229 | Ga0075430_100003464 | 3300006846 | Bacteria | 13207 |
| 230 | Ga0075430_100027201 | 3300006846 | Bacteria | 4862 |
| 231 | Ga0075430_100029136 | 3300006846 | Bacteria | 4686 |
| 232 | Ga0075430_100029161 | 3300006846 | Bacteria | 4684 |
| 233 | Ga0075430_100097419 | 3300006846 | Bacteria | 2457 |
| 234 | Ga0075430_100165560 | 3300006846 | Bacteria | 1840 |
| 235 | Ga0075430_100326305 | 3300006846 | Unclassified | 1269 |
| 236 | Ga0075431_100003416 | 3300006847 | Bacteria | 15405 |
| 237 | Ga0075431_100004623 | 3300006847 | Bacteria | 13514 |
| 238 | Ga0075431_100007678 | 3300006847 | Bacteria | 10741 |
| 239 | Ga0075431_100014566 | 3300006847 | Bacteria | 7956 |
| 240 | Ga0075431_100026322 | 3300006847 | Bacteria | 5967 |
| 241 | Ga0075431_100030553 | 3300006847 | Bacteria | 5550 |
| 242 | Ga0075431_100040167 | 3300006847 | Bacteria | 4821 |
| 243 | Ga0075431_100080952 | 3300006847 | Bacteria | 3353 |
| 244 | Ga0075431_100091222 | 3300006847 | Bacteria | 3145 |
| 245 | Ga0075431_100134472 | 3300006847 | Bacteria | 2549 |
| 246 | Ga0075431_100210863 | 3300006847 | Bacteria | 1984 |
| 247 | Ga0075431_100359785 | 3300006847 | Unclassified | 1462 |
| 248 | Ga0075431_100365266 | 3300006847 | Unclassified | 1449 |
| 249 | Ga0075431_100379848 | 3300006847 | Bacteria | 1417 |
| 250 | Ga0075431_100514590 | 3300006847 | Unclassified | 1187 |
| 251 | Ga0075431_100626470 | 3300006847 | Unclassified | 1058 |
| 252 | Ga0075433_10000202 | 3300006852 | Bacteria | 33478 |
| 253 | Ga0075433_10001786 | 3300006852 | Bacteria | 16117 |
| 254 | Ga0075433_10003482 | 3300006852 | Bacteria | 12158 |
| 255 | Ga0075433_10042323 | 3300006852 | Bacteria | 3951 |
| 256 | Ga0075433_10098939 | 3300006852 | Bacteria | 2582 |
| 257 | Ga0075433_10146676 | 3300006852 | Bacteria | 2098 |
| 258 | Ga0075433_10162575 | 3300006852 | Bacteria | 1987 |
| 259 | Ga0075433_10333096 | 3300006852 | Bacteria | 1342 |
| 260 | Ga0075434_100000875 | 3300006871 | Bacteria | 24088 |
| 261 | Ga0075434_100016237 | 3300006871 | Bacteria | 7156 |
| 262 | Ga0075434_100030656 | 3300006871 | Bacteria | 5297 |
| 263 | Ga0075434_100082095 | 3300006871 | Unclassified | 3220 |
| 264 | Ga0075434_100093703 | 3300006871 | Bacteria | 3007 |
| 265 | Ga0075434_100120243 | 3300006871 | Bacteria | 2641 |
| 266 | Ga0075434_100544748 | 3300006871 | Unclassified | 1180 |
| 267 | Ga0075429_100003511 | 3300006880 | Bacteria | 13368 |
| 268 | Ga0075429_100010406 | 3300006880 | Bacteria | 8049 |
| 269 | Ga0075429_100061640 | 3300006880 | Unclassified | 3268 |
| 270 | Ga0075429_100072231 | 3300006880 | Unclassified | 3005 |
| 271 | Ga0075429_100074273 | 3300006880 | Unclassified | 2962 |
| 272 | Ga0075429_100080109 | 3300006880 | Unclassified | 2846 |
| 273 | Ga0075429_100091450 | 3300006880 | Bacteria | 2654 |
| 274 | Ga0075429_100104488 | 3300006880 | Bacteria | 2474 |
| 275 | Ga0075429_100109643 | 3300006880 | Bacteria | 2413 |
| 276 | Ga0075429_100212024 | 3300006880 | Unclassified | 1697 |
| 277 | Ga0075429_100219241 | 3300006880 | Bacteria | 1667 |
| 278 | Ga0068865_100004621 | 3300006881 | Bacteria | 8315 |
| 279 | Ga0075436_100027966 | 3300006914 | Bacteria | 3881 |
| 280 | Ga0097620_100005105 | 3300006931 | Bacteria | 13335 |
| 281 | Ga0097620_100009922 | 3300006931 | Bacteria | 9611 |
| 282 | Ga0097620_100012593 | 3300006931 | Bacteria | 8505 |
| 283 | Ga0097620_100060387 | 3300006931 | Bacteria | 3820 |
| 284 | Ga0097620_100079721 | 3300006931 | Bacteria | 3315 |
| 285 | Ga0097620_100237898 | 3300006931 | Unclassified | 1910 |
| 286 | Ga0075435_100004350 | 3300007076 | Bacteria | 9734 |
| 287 | Ga0075435_100032944 | 3300007076 | Bacteria | 4094 |
| 288 | Ga0075435_100192506 | 3300007076 | Bacteria | 1726 |
| 289 | Ga0111539_10005953 | 3300009094 | Bacteria | 15750 |
| 290 | Ga0111539_10007864 | 3300009094 | Bacteria | 13616 |
| 291 | Ga0111539_10009385 | 3300009094 | Bacteria | 12349 |
| 292 | Ga0111539_10034066 | 3300009094 | Bacteria | 6179 |
| 293 | Ga0111539_10059762 | 3300009094 | Unclassified | 4519 |
| 294 | Ga0111539_10074765 | 3300009094 | Unclassified | 3993 |
| 295 | Ga0111539_10094768 | 3300009094 | Unclassified | 3507 |
| 296 | Ga0111539_10126120 | 3300009094 | Bacteria | 2999 |
| 297 | Ga0111539_10132362 | 3300009094 | Bacteria | 2920 |
| 298 | Ga0111539_10134852 | 3300009094 | Bacteria | 2891 |
| 299 | Ga0111539_10232020 | 3300009094 | Bacteria | 2149 |
| 300 | Ga0111539_10243421 | 3300009094 | Bacteria | 2094 |
| 301 | Ga0105245_10249724 | 3300009098 | Unclassified | 1723 |
| 302 | Ga0105245_10721333 | 3300009098 | Bacteria | 1031 |
| 303 | Ga0105247_10009735 | 3300009101 | Bacteria | 5828 |
| 304 | Ga0105247_10285540 | 3300009101 | Unclassified | 1140 |
| 305 | Ga0114129_10000022 | 3300009147 | Bacteria | 119291 |
| 306 | Ga0114129_10003016 | 3300009147 | Bacteria | 23605 |
| 307 | Ga0114129_10003432 | 3300009147 | Bacteria | 22271 |
| 308 | Ga0114129_10013890 | 3300009147 | Bacteria | 11474 |
| 309 | Ga0114129_10017528 | 3300009147 | Bacteria | 10197 |
| 310 | Ga0114129_10028685 | 3300009147 | Bacteria | 7885 |
| 311 | Ga0114129_10046369 | 3300009147 | Bacteria | 6108 |
| 312 | Ga0114129_10057192 | 3300009147 | Bacteria | 5460 |
| 313 | Ga0114129_10067969 | 3300009147 | Bacteria | 4969 |
| 314 | Ga0114129_10074127 | 3300009147 | Bacteria | 4741 |
| 315 | Ga0114129_10093312 | 3300009147 | Unclassified | 4170 |
| 316 | Ga0114129_10100099 | 3300009147 | Bacteria | 4011 |
| 317 | Ga0114129_10106729 | 3300009147 | Bacteria | 3868 |
| 318 | Ga0114129_10188764 | 3300009147 | Bacteria | 2800 |
| 319 | Ga0114129_10228245 | 3300009147 | Bacteria | 2508 |
| 320 | Ga0114129_10422479 | 3300009147 | Bacteria | 1753 |
| 321 | Ga0114129_10428859 | 3300009147 | Bacteria | 1737 |
| 322 | Ga0114129_10665167 | 3300009147 | Bacteria | 1343 |
| 323 | Ga0114129_10696160 | 3300009147 | Bacteria | 1306 |
| 324 | Ga0114129_10701113 | 3300009147 | Bacteria | 1301 |
| 325 | Ga0114129_11075208 | 3300009147 | Bacteria | 1009 |
| 326 | Ga0105248_10008525 | 3300009177 | Bacteria | 11255 |
| 327 | Ga0105248_10011617 | 3300009177 | Bacteria | 9701 |
| 328 | Ga0105248_10011763 | 3300009177 | Bacteria | 9653 |
| 329 | Ga0105248_10026048 | 3300009177 | Bacteria | 6506 |
| 330 | Ga0105248_10051068 | 3300009177 | Bacteria | 4640 |
| 331 | Ga0105248_10083496 | 3300009177 | Bacteria | 3593 |
| 332 | Ga0105248_10130990 | 3300009177 | Bacteria | 2830 |
| 333 | Ga0105248_10264336 | 3300009177 | Bacteria | 1937 |
| 334 | Ga0105248_10544546 | 3300009177 | Bacteria | 1309 |
| 335 | Ga0105248_10633814 | 3300009177 | Bacteria | 1206 |
| 336 | Ga0105248_10712024 | 3300009177 | Bacteria | 1133 |
| 337 | Ga0105248_10775390 | 3300009177 | Bacteria | 1082 |
| 338 | Ga0105237_10135419 | 3300009545 | Unclassified | 2458 |
| 339 | Ga0105249_10002178 | 3300009553 | Bacteria | 16974 |
| 340 | Ga0105249_10033902 | 3300009553 | Unclassified | 4624 |
| 341 | Ga0105249_10086394 | 3300009553 | Bacteria | 2925 |
| 342 | Ga0105249_10194900 | 3300009553 | Unclassified | 1979 |
| 343 | Ga0105249_10328074 | 3300009553 | Bacteria | 1543 |
| 344 | Ga0105249_10405995 | 3300009553 | Bacteria | 1394 |
| 345 | Ga0105249_10460113 | 3300009553 | Bacteria | 1312 |
| 346 | Ga0105239_10055042 | 3300010375 | Bacteria | 4364 |
| 347 | Ga0105246_10151349 | 3300011119 | Unclassified | 1757 |
| 348 | Ga0105246_10170480 | 3300011119 | Unclassified | 1666 |
| 349 | Ga0157369_10393377 | 3300013105 | Bacteria | 1438 |
| 350 | Ga0157374_10014200 | 3300013296 | Bacteria | 6964 |
| 351 | Ga0163162_10057350 | 3300013306 | Bacteria | 3923 |
| 352 | Ga0157372_10744242 | 3300013307 | Bacteria | 1140 |
| 353 | Ga0157375_10004391 | 3300013308 | Bacteria | 12242 |
| 354 | Ga0157375_10215352 | 3300013308 | Bacteria | 2078 |
| 355 | Ga0157375_10459444 | 3300013308 | Bacteria | 1439 |
| 356 | Ga0157375_10704525 | 3300013308 | Unclassified | 1163 |
| 357 | Ga0163163_10012072 | 3300014325 | Bacteria | 7859 |
| 358 | Ga0163163_10040189 | 3300014325 | Unclassified | 4567 |
| 359 | Ga0163163_10153205 | 3300014325 | Bacteria | 2348 |
| 360 | Ga0157380_10012655 | 3300014326 | Bacteria | 6124 |
| 361 | Ga0157380_10053866 | 3300014326 | Unclassified | 3191 |
| 362 | Ga0157380_10124633 | 3300014326 | Unclassified | 2188 |
| 363 | Ga0157380_10129036 | 3300014326 | Bacteria | 2154 |
| 364 | Ga0157380_10158026 | 3300014326 | Bacteria | 1967 |
| 365 | Ga0157380_10210677 | 3300014326 | Bacteria | 1731 |
| 366 | Ga0157380_10265621 | 3300014326 | Bacteria | 1561 |
| 367 | Ga0157380_10360187 | 3300014326 | Bacteria | 1364 |
| 368 | Ga0157377_10008902 | 3300014745 | Bacteria | 4911 |
| 369 | Ga0157377_10031373 | 3300014745 | Bacteria | 2887 |
| 370 | Ga0157379_10016566 | 3300014968 | Bacteria | 6481 |
| 371 | Ga0157379_10017284 | 3300014968 | Bacteria | 6354 |
| 372 | Ga0157379_10073242 | 3300014968 | Unclassified | 3065 |
| 373 | Ga0157376_10028990 | 3300014969 | Bacteria | 4406 |
| 374 | Ga0163161_10087470 | 3300017792 | Unclassified | 2302 |
| 375 | Ga0163161_10116583 | 3300017792 | Bacteria | 2002 |
| 376 | Ga0206356_10432168 | 3300020070 | Unclassified | 933 |
| 377 | Ga0213872_10116995 | 3300021361 | Bacteria | 1180 |
| 378 | Ga0224712_10197880 | 3300022467 | Unclassified | 912 |
| 379 | Ga0207697_10001648 | 3300025315 | Bacteria | 12069 |
| 380 | Ga0207697_10010073 | 3300025315 | Unclassified | 4059 |
| 381 | Ga0207697_10015174 | 3300025315 | Bacteria | 3186 |
| 382 | Ga0207697_10093832 | 3300025315 | Bacteria | 1273 |
| 383 | Ga0207682_10008517 | 3300025893 | Unclassified | 4052 |
| 384 | Ga0207682_10021451 | 3300025893 | Bacteria | 2541 |
| 385 | Ga0207642_10154808 | 3300025899 | Unclassified | 1224 |
| 386 | Ga0207710_10006846 | 3300025900 | Bacteria | 4851 |
| 387 | Ga0207688_10013358 | 3300025901 | Bacteria | 4461 |
| 388 | Ga0207688_10058421 | 3300025901 | Unclassified | 2170 |
| 389 | Ga0207680_10021614 | 3300025903 | Unclassified | 3484 |
| 390 | Ga0207680_10025785 | 3300025903 | Bacteria | 3247 |
| 391 | Ga0207680_10118406 | 3300025903 | Bacteria | 1729 |
| 392 | Ga0207680_10196220 | 3300025903 | Bacteria | 1373 |
| 393 | Ga0207680_10265102 | 3300025903 | Bacteria | 1190 |
| 394 | Ga0207647_10136441 | 3300025904 | Bacteria | 1440 |
| 395 | Ga0207645_10003388 | 3300025907 | Bacteria | 12118 |
| 396 | Ga0207645_10040789 | 3300025907 | Bacteria | 2973 |
| 397 | Ga0207645_10137629 | 3300025907 | Unclassified | 1590 |
| 398 | Ga0207643_10002413 | 3300025908 | Bacteria | 10115 |
| 399 | Ga0207684_10178354 | 3300025910 | Bacteria | 1832 |
| 400 | Ga0207707_10041639 | 3300025912 | Bacteria | 4011 |
| 401 | Ga0207662_10011372 | 3300025918 | Bacteria | 4933 |
| 402 | Ga0207662_10022232 | 3300025918 | Bacteria | 3633 |
| 403 | Ga0207662_10215739 | 3300025918 | Bacteria | 1247 |
| 404 | Ga0207657_10216614 | 3300025919 | Bacteria | 1535 |
| 405 | Ga0207649_10004162 | 3300025920 | Bacteria | 7879 |
| 406 | Ga0207652_10276834 | 3300025921 | Bacteria | 1514 |
| 407 | Ga0207646_10112952 | 3300025922 | Bacteria | 2438 |
| 408 | Ga0207681_10009018 | 3300025923 | Bacteria | 6094 |
| 409 | Ga0207681_10024466 | 3300025923 | Bacteria | 3876 |
| 410 | Ga0207681_10041155 | 3300025923 | Bacteria | 3079 |
| 411 | Ga0207681_10041333 | 3300025923 | Unclassified | 3073 |
| 412 | Ga0207681_10105521 | 3300025923 | Unclassified | 2040 |
| 413 | Ga0207681_10228473 | 3300025923 | Bacteria | 1443 |
| 414 | Ga0207650_10009691 | 3300025925 | Bacteria | 6585 |
| 415 | Ga0207650_10025629 | 3300025925 | Unclassified | 4201 |
| 416 | Ga0207650_10085355 | 3300025925 | Unclassified | 2402 |
| 417 | Ga0207650_10120578 | 3300025925 | Unclassified | 2041 |
| 418 | Ga0207650_10149901 | 3300025925 | Bacteria | 1840 |
| 419 | Ga0207650_10170112 | 3300025925 | Unclassified | 1731 |
| 420 | Ga0207650_10207765 | 3300025925 | Bacteria | 1571 |
| 421 | Ga0207650_10464442 | 3300025925 | Bacteria | 1055 |
| 422 | Ga0207659_10057797 | 3300025926 | Unclassified | 2783 |
| 423 | Ga0207659_10255952 | 3300025926 | Unclassified | 1422 |
| 424 | Ga0207659_10296426 | 3300025926 | Bacteria | 1327 |
| 425 | Ga0207644_10030834 | 3300025931 | Bacteria | 3732 |
| 426 | Ga0207644_10163895 | 3300025931 | Unclassified | 1730 |
| 427 | Ga0207644_10180956 | 3300025931 | Bacteria | 1652 |
| 428 | Ga0207690_10373539 | 3300025932 | Bacteria | 1132 |
| 429 | Ga0207706_10006664 | 3300025933 | Bacteria | 10678 |
| 430 | Ga0207706_10057575 | 3300025933 | Bacteria | 3424 |
| 431 | Ga0207706_10084872 | 3300025933 | Unclassified | 2784 |
| 432 | Ga0207706_10229777 | 3300025933 | Bacteria | 1623 |
| 433 | Ga0207706_10428455 | 3300025933 | Bacteria | 1146 |
| 434 | Ga0207706_10504749 | 3300025933 | Bacteria | 1044 |
| 435 | Ga0207686_10033165 | 3300025934 | Bacteria | 3080 |
| 436 | Ga0207670_10009343 | 3300025936 | Bacteria | 5593 |
| 437 | Ga0207670_10021772 | 3300025936 | Bacteria | 3960 |
| 438 | Ga0207670_10110882 | 3300025936 | Bacteria | 1977 |
| 439 | Ga0207670_10149820 | 3300025936 | Unclassified | 1730 |
| 440 | Ga0207670_10470744 | 3300025936 | Unclassified | 1016 |
| 441 | Ga0207670_10717644 | 3300025936 | Bacteria | 829 |
| 442 | Ga0207669_10004070 | 3300025937 | Bacteria | 6404 |
| 443 | Ga0207669_10128460 | 3300025937 | Unclassified | 1736 |
| 444 | Ga0207669_10230104 | 3300025937 | Bacteria | 1367 |
| 445 | Ga0207669_10289904 | 3300025937 | Unclassified | 1239 |
| 446 | Ga0207704_10039222 | 3300025938 | Unclassified | 2755 |
| 447 | Ga0207704_10044350 | 3300025938 | Bacteria | 2634 |
| 448 | Ga0207704_10106645 | 3300025938 | Bacteria | 1882 |
| 449 | Ga0207691_10005619 | 3300025940 | Bacteria | 12118 |
| 450 | Ga0207691_10027372 | 3300025940 | Bacteria | 5344 |
| 451 | Ga0207691_10043702 | 3300025940 | Bacteria | 4128 |
| 452 | Ga0207691_10090897 | 3300025940 | Unclassified | 2736 |
| 453 | Ga0207691_10099066 | 3300025940 | Bacteria | 2603 |
| 454 | Ga0207691_10292231 | 3300025940 | Bacteria | 1401 |
| 455 | Ga0207691_10307917 | 3300025940 | Unclassified | 1360 |
| 456 | Ga0207711_10027516 | 3300025941 | Bacteria | 4776 |
| 457 | Ga0207711_10052589 | 3300025941 | Bacteria | 3491 |
| 458 | Ga0207711_10074932 | 3300025941 | Bacteria | 2944 |
| 459 | Ga0207711_10084800 | 3300025941 | Bacteria | 2774 |
| 460 | Ga0207689_10003959 | 3300025942 | Bacteria | 13486 |
| 461 | Ga0207689_10032589 | 3300025942 | Bacteria | 4333 |
| 462 | Ga0207689_10057367 | 3300025942 | Unclassified | 3204 |
| 463 | Ga0207689_10095679 | 3300025942 | Bacteria | 2439 |
| 464 | Ga0207661_10002490 | 3300025944 | Bacteria | 12676 |
| 465 | Ga0207679_10004135 | 3300025945 | Bacteria | 9014 |
| 466 | Ga0207679_10027193 | 3300025945 | Bacteria | 3954 |
| 467 | Ga0207679_10040304 | 3300025945 | Bacteria | 3342 |
| 468 | Ga0207679_10511831 | 3300025945 | Unclassified | 1072 |
| 469 | Ga0207679_10515363 | 3300025945 | Unclassified | 1069 |
| 470 | Ga0207667_10194720 | 3300025949 | Bacteria | 2080 |
| 471 | Ga0207651_10010174 | 3300025960 | Bacteria | 5198 |
| 472 | Ga0207651_10013855 | 3300025960 | Bacteria | 4632 |
| 473 | Ga0207651_10032756 | 3300025960 | Bacteria | 3343 |
| 474 | Ga0207651_10077103 | 3300025960 | Unclassified | 2385 |
| 475 | Ga0207651_10091539 | 3300025960 | Bacteria | 2227 |
| 476 | Ga0207651_10419135 | 3300025960 | Bacteria | 1143 |
| 477 | Ga0207712_10022462 | 3300025961 | Unclassified | 4154 |
| 478 | Ga0207712_10041146 | 3300025961 | Bacteria | 3175 |
| 479 | Ga0207712_10617526 | 3300025961 | Bacteria | 939 |
| 480 | Ga0207668_10040164 | 3300025972 | Bacteria | 3155 |
| 481 | Ga0207658_10009565 | 3300025986 | Bacteria | 6579 |
| 482 | Ga0207658_10066652 | 3300025986 | Bacteria | 2709 |
| 483 | Ga0207658_10373534 | 3300025986 | Unclassified | 1247 |
| 484 | Ga0207677_10040009 | 3300026023 | Bacteria | 3087 |
| 485 | Ga0207677_10628803 | 3300026023 | Unclassified | 945 |
| 486 | Ga0207703_10006715 | 3300026035 | Bacteria | 9182 |
| 487 | Ga0207703_10068704 | 3300026035 | Bacteria | 2920 |
| 488 | Ga0207703_10070905 | 3300026035 | Bacteria | 2877 |
| 489 | Ga0207703_10329503 | 3300026035 | Bacteria | 1400 |
| 490 | Ga0207703_10480732 | 3300026035 | Bacteria | 1164 |
| 491 | Ga0207678_10008867 | 3300026067 | Bacteria | 8856 |
| 492 | Ga0207708_10006488 | 3300026075 | Bacteria | 8666 |
| 493 | Ga0207708_10025427 | 3300026075 | Bacteria | 4478 |
| 494 | Ga0207708_10034925 | 3300026075 | Bacteria | 3825 |
| 495 | Ga0207708_10036468 | 3300026075 | Bacteria | 3743 |
| 496 | Ga0207708_10193915 | 3300026075 | Bacteria | 1618 |
| 497 | Ga0207702_10150743 | 3300026078 | Bacteria | 2115 |
| 498 | Ga0207702_10614272 | 3300026078 | Bacteria | 1067 |
| 499 | Ga0207702_11120401 | 3300026078 | Bacteria | 781 |
| 500 | Ga0207641_10000198 | 3300026088 | Bacteria | 81646 |
| 501 | Ga0207641_10000259 | 3300026088 | Bacteria | 67298 |
| 502 | Ga0207641_10051564 | 3300026088 | Bacteria | 3485 |
| 503 | Ga0207641_10058303 | 3300026088 | Bacteria | 3286 |
| 504 | Ga0207641_10070828 | 3300026088 | Bacteria | 2997 |
| 505 | Ga0207648_10000246 | 3300026089 | Bacteria | 58501 |
| 506 | Ga0207648_10017826 | 3300026089 | Bacteria | 6443 |
| 507 | Ga0207648_10165985 | 3300026089 | Unclassified | 1951 |
| 508 | Ga0207648_10229136 | 3300026089 | Bacteria | 1652 |
| 509 | Ga0207676_10010909 | 3300026095 | Bacteria | 6482 |
| 510 | Ga0207676_10035502 | 3300026095 | Bacteria | 3784 |
| 511 | Ga0207676_10434658 | 3300026095 | Bacteria | 1234 |
| 512 | Ga0207674_10030346 | 3300026116 | Bacteria | 5684 |
| 513 | Ga0207674_10093971 | 3300026116 | Bacteria | 2986 |
| 514 | Ga0207674_10252094 | 3300026116 | Bacteria | 1712 |
| 515 | Ga0207674_10536165 | 3300026116 | Unclassified | 1131 |
| 516 | Ga0207675_100001075 | 3300026118 | Bacteria | 27143 |
| 517 | Ga0207675_100027442 | 3300026118 | Bacteria | 5303 |
| 518 | Ga0207675_100082957 | 3300026118 | Bacteria | 3006 |
| 519 | Ga0207675_100132571 | 3300026118 | Bacteria | 2363 |
| 520 | Ga0207675_100194483 | 3300026118 | Unclassified | 1947 |
| 521 | Ga0207675_100241277 | 3300026118 | Bacteria | 1746 |
| 522 | Ga0207675_100341765 | 3300026118 | Bacteria | 1465 |
| 523 | Ga0207683_10003979 | 3300026121 | Bacteria | 12810 |
| 524 | Ga0207683_10006075 | 3300026121 | Bacteria | 10341 |
| 525 | Ga0207683_10027139 | 3300026121 | Bacteria | 4949 |
| 526 | Ga0207683_10127770 | 3300026121 | Bacteria | 2285 |
| 527 | Ga0207698_10040220 | 3300026142 | Bacteria | 3471 |
| 528 | Ga0207698_10535965 | 3300026142 | Bacteria | 1145 |
| 529 | Ga0210000_1017153 | 3300027462 | Bacteria | 1097 |
| 530 | Ga0209971_1007621 | 3300027682 | Bacteria | 2568 |
| 531 | Ga0209813_10019325 | 3300027866 | Bacteria | 1892 |
| 532 | Ga0209974_10014860 | 3300027876 | Bacteria | 2585 |
| 533 | Ga0209974_10015823 | 3300027876 | Bacteria | 2505 |
| 534 | Ga0209974_10104232 | 3300027876 | Bacteria | 993 |
| 535 | Ga0207428_10003486 | 3300027907 | Bacteria | 15254 |
| 536 | Ga0207428_10005664 | 3300027907 | Bacteria | 11604 |
| 537 | Ga0207428_10009483 | 3300027907 | Bacteria | 8717 |
| 538 | Ga0207428_10024378 | 3300027907 | Bacteria | 5079 |
| 539 | Ga0207428_10039646 | 3300027907 | Unclassified | 3825 |
| 540 | Ga0207428_10092849 | 3300027907 | Unclassified | 2342 |
| 541 | Ga0207428_10139122 | 3300027907 | Bacteria | 1854 |
| 542 | Ga0207428_10276750 | 3300027907 | Bacteria | 1247 |
| 543 | Ga0268266_10006015 | 3300028379 | Bacteria | 11195 |
| 544 | Ga0268266_10696669 | 3300028379 | Bacteria | 979 |
| 545 | Ga0268265_10001488 | 3300028380 | Bacteria | 19626 |
| 546 | Ga0268265_10031270 | 3300028380 | Bacteria | 3843 |
| 547 | Ga0268265_10079108 | 3300028380 | Bacteria | 2588 |
| 548 | Ga0268265_10079933 | 3300028380 | Bacteria | 2577 |
| 549 | Ga0268265_10115558 | 3300028380 | Unclassified | 2200 |
| 550 | Ga0268265_10267468 | 3300028380 | Bacteria | 1523 |
| 551 | Ga0268265_10513505 | 3300028380 | Bacteria | 1131 |
| 552 | Ga0268264_10000588 | 3300028381 | Bacteria | 44134 |
| 553 | Ga0268264_10026990 | 3300028381 | Bacteria | 4691 |
| 554 | Ga0268264_10043169 | 3300028381 | Bacteria | 3735 |
| 555 | Ga0268264_10118510 | 3300028381 | Bacteria | 2330 |
| 556 | Ga0307513_10011871 | 3300031456 | Bacteria | 10792 |
| 557 | Ga0307408_100008140 | 3300031548 | Bacteria | 6927 |
| 558 | Ga0307408_100025388 | 3300031548 | Bacteria | 4059 |
| 559 | Ga0307408_100057087 | 3300031548 | Bacteria | 2833 |
| 560 | Ga0307408_100122298 | 3300031548 | Bacteria | 2018 |
| 561 | Ga0307408_100356642 | 3300031548 | Unclassified | 1242 |
| 562 | Ga0307405_10018703 | 3300031731 | Unclassified | 3829 |
| 563 | Ga0307405_10019998 | 3300031731 | Bacteria | 3731 |
| 564 | Ga0307405_10296649 | 3300031731 | Unclassified | 1224 |
| 565 | Ga0307405_10613795 | 3300031731 | Bacteria | 889 |
| 566 | Ga0307413_10012181 | 3300031824 | Unclassified | 4270 |
| 567 | Ga0307410_10041729 | 3300031852 | Bacteria | 3027 |
| 568 | Ga0307410_10321541 | 3300031852 | Unclassified | 1228 |
| 569 | Ga0307410_10424445 | 3300031852 | Bacteria | 1079 |
| 570 | Ga0307410_10518800 | 3300031852 | Unclassified | 983 |
| 571 | Ga0307406_10146209 | 3300031901 | Bacteria | 1680 |
| 572 | Ga0307407_10010767 | 3300031903 | Bacteria | 4326 |
| 573 | Ga0307407_10012301 | 3300031903 | Unclassified | 4108 |
| 574 | Ga0307412_10018836 | 3300031911 | Bacteria | 4165 |
| 575 | Ga0307412_10137366 | 3300031911 | Bacteria | 1785 |
| 576 | Ga0307412_10329362 | 3300031911 | Bacteria | 1218 |
| 577 | Ga0307412_10333543 | 3300031911 | Unclassified | 1211 |
| 578 | Ga0307412_10336223 | 3300031911 | Bacteria | 1207 |
| 579 | Ga0307409_100022631 | 3300031995 | Unclassified | 4335 |
| 580 | Ga0307409_100065980 | 3300031995 | Bacteria | 2851 |
| 581 | Ga0307409_100289646 | 3300031995 | Bacteria | 1518 |
| 582 | Ga0307416_100015969 | 3300032002 | Bacteria | 5203 |
| 583 | Ga0307416_100021724 | 3300032002 | Unclassified | 4614 |
| 584 | Ga0307416_100029729 | 3300032002 | Bacteria | 4087 |
| 585 | Ga0307416_100055276 | 3300032002 | Bacteria | 3196 |
| 586 | Ga0307416_100374730 | 3300032002 | Bacteria | 1451 |
| 587 | Ga0307416_100392854 | 3300032002 | Bacteria | 1422 |
| 588 | Ga0307416_100399580 | 3300032002 | Bacteria | 1411 |
| 589 | Ga0307416_100563096 | 3300032002 | Bacteria | 1215 |
| 590 | Ga0307414_10038982 | 3300032004 | Unclassified | 3196 |
| 591 | Ga0307414_10123129 | 3300032004 | Bacteria | 1998 |
| 592 | Ga0307414_10480891 | 3300032004 | Unclassified | 1095 |
| 593 | Ga0307411_10031137 | 3300032005 | Bacteria | 3278 |
| 594 | Ga0307411_10034924 | 3300032005 | Unclassified | 3133 |
| 595 | Ga0307411_10041035 | 3300032005 | Bacteria | 2941 |
| 596 | Ga0307411_10058672 | 3300032005 | Bacteria | 2548 |
| 597 | Ga0307411_10068882 | 3300032005 | Bacteria | 2387 |
| 598 | Ga0307415_100008598 | 3300032126 | Bacteria | 5669 |
| 599 | Ga0307415_100011264 | 3300032126 | Bacteria | 5110 |
| 600 | Ga0307415_100278900 | 3300032126 | Bacteria | 1373 |
| 601 | Ga0373960_0017586 | 3300035121 | Bacteria | 1854 |
| 602 | Ga0373955_0343741 | 3300035172 | Unclassified | 903 |
| 603 | Ga0373961_0000297 | 3300035241 | Bacteria | 22207 |
| 604 | Ga0373962_0061062 | 3300035242 | Unclassified | 1107 |
| 605 | Ga0373931_0171100 | 3300035691 | Bacteria | 1280 |
| 606 | Ga0373933_0335936 | 3300035724 | Bacteria | 980 |
| 607 | Ga0373937_0051107 | 3300036401 | Unclassified | 3789 |
| 608 | Ga0373925_0746146 | 3300037068 | Bacteria | 807 |
| 609 | Ga0395899_0422937 | 3300037312 | Bacteria | 877 |
| 610 | Ga0395900_0049548 | 3300037418 | Bacteria | 4328 |
| 611 | Ga0395900_0340172 | 3300037418 | Bacteria | 1476 |
| 612 | Ga0395898_0211834 | 3300037466 | Bacteria | 1848 |
| 613 | Ga0395898_0621401 | 3300037466 | Unclassified | 1023 |
| 614 | Ga0395905_0059052 | 3300037471 | Bacteria | 3586 |
| 615 | Ga0395905_0084219 | 3300037471 | Bacteria | 2979 |
| 616 | Ga0395901_0177997 | 3300038443 | Bacteria | 2230 |
| 617 | Ga0395901_0400049 | 3300038443 | Bacteria | 1411 |
| 618 | Ga0436365_1614654 | 3300039437 | Bacteria | 6289 |
| 619 | Ga0436361_0942135 | 3300039447 | Bacteria | 2901 |
| 620 | Ga0439433_0005167 | 3300041999 | Bacteria | 2805 |
| 621 | Ga0439433_0031053 | 3300041999 | Bacteria | 1222 |
| 622 | Ga0439450_016156 | 3300042008 | Bacteria | 1539 |
| 623 | Ga0439451_035945 | 3300042009 | Bacteria | 996 |
| 624 | Ga0439435_0003900 | 3300042436 | Bacteria | 3158 |
| 625 | Ga0439435_0013465 | 3300042436 | Bacteria | 2000 |
| 626 | Ga0439435_0051849 | 3300042436 | Bacteria | 1177 |
| 627 | Ga0439435_0065028 | 3300042436 | Bacteria | 1069 |
| 628 | Ga0439435_0066706 | 3300042436 | Bacteria | 1058 |
| 629 | Ga0439435_0109146 | 3300042436 | Bacteria | 857 |
| 630 | Ga0439444_0023359 | 3300042437 | Bacteria | 1109 |
| 631 | Ga0439444_0045118 | 3300042437 | Bacteria | 879 |
| 632 | Ga0439464_0002455 | 3300042439 | Bacteria | 4560 |
| 633 | Ga0439464_0050234 | 3300042439 | Bacteria | 1204 |
| 634 | Ga0439460_0009321 | 3300042461 | Bacteria | 2492 |
| 635 | Ga0439460_0057246 | 3300042461 | Bacteria | 1182 |
| 636 | Ga0439460_0077691 | 3300042461 | Bacteria | 1038 |
| 637 | Ga0451577_0056963 | 3300042876 | Bacteria | 3485 |
| 638 | Ga0451577_0076842 | 3300042876 | Bacteria | 2977 |
| 639 | Ga0451577_0767595 | 3300042876 | Bacteria | 872 |
| 640 | Ga0453684_0786377 | 3300044712 | Bacteria | 1027 |
| 641 | Ga0451576_0043858 | 3300045051 | Unclassified | 4717 |
| 642 | Ga0451576_0048477 | 3300045051 | Unclassified | 4461 |
| 643 | Ga0451576_0146119 | 3300045051 | Unclassified | 2465 |
| 644 | Ga0451576_0517300 | 3300045051 | Unclassified | 1254 |
| 645 | Ga0495603_0269556 | 3300046455 | Bacteria | 979 |
| 646 | Ga0495642_0014741 | 3300046528 | Bacteria | 3032 |
| 647 | Ga0495598_0008216 | 3300046537 | Unclassified | 2422 |
| 648 | Ga0495668_0124076 | 3300046616 | Bacteria | 1413 |
| 649 | Ga0495625_0223882 | 3300046660 | Bacteria | 1231 |
| 650 | Ga0495613_0005490 | 3300046689 | Bacteria | 9527 |
| 651 | Ga0495636_0044302 | 3300047318 | Bacteria | 1852 |
| 652 | Ga0495674_0101914 | 3300047319 | Bacteria | 2442 |
| 653 | Ga0495672_0001520 | 3300047320 | Bacteria | 22733 |
| 654 | Ga0495672_0249622 | 3300047320 | Bacteria | 862 |
| 655 | Ga0496102_0137055 | 3300048905 | Bacteria | 2294 |
| 656 | Ga0496103_0366014 | 3300048906 | Bacteria | 927 |
| 657 | Ga0496104_0005034 | 3300048907 | Bacteria | 11527 |
| 658 | Ga0496104_0013360 | 3300048907 | Bacteria | 7399 |
| 659 | Ga0496104_0033034 | 3300048907 | Bacteria | 4817 |
| 660 | Ga0496104_0264633 | 3300048907 | Bacteria | 1632 |
| 661 | Ga0496104_0559162 | 3300048907 | Bacteria | 1055 |
| 662 | Ga0496105_0022305 | 3300048908 | Bacteria | 5128 |
| 663 | Ga0496105_0090782 | 3300048908 | Bacteria | 2523 |
| 664 | Ga0496106_0035091 | 3300048909 | Bacteria | 3749 |
| 665 | Ga0496108_0018786 | 3300048911 | Bacteria | 5666 |
| 666 | Ga0496108_0827344 | 3300048911 | Bacteria | 798 |
| 667 | Ga0496109_0001054 | 3300048912 | Bacteria | 22785 |
| 668 | Ga0496109_0034897 | 3300048912 | Bacteria | 4534 |
| 669 | Ga0496109_0252495 | 3300048912 | Unclassified | 1661 |
| 670 | Ga0496109_0542849 | 3300048912 | Unclassified | 1097 |
| 671 | Ga0496110_0002072 | 3300048913 | Bacteria | 14946 |
| 672 | Ga0496110_0003883 | 3300048913 | Bacteria | 11500 |
| 673 | Ga0496111_0064665 | 3300048914 | Bacteria | 2654 |
| 674 | Ga0496111_0321780 | 3300048914 | Unclassified | 1145 |
| 675 | Ga0496112_0003061 | 3300048915 | Bacteria | 13692 |
| 676 | Ga0496112_0005221 | 3300048915 | Bacteria | 11180 |
| 677 | Ga0496112_0058506 | 3300048915 | Bacteria | 3796 |
| 678 | Ga0496113_0074500 | 3300048916 | Unclassified | 2588 |
| 679 | Ga0496113_0094299 | 3300048916 | Bacteria | 2312 |
| 680 | Ga0496114_0465612 | 3300048917 | Unclassified | 1119 |
| 681 | Ga0496115_0122921 | 3300048918 | Bacteria | 2136 |
| 682 | Ga0496117_0185733 | 3300048920 | Bacteria | 1190 |
| 683 | Ga0496118_0016401 | 3300048921 | Bacteria | 6799 |
| 684 | Ga0496121_0000243 | 3300048924 | Bacteria | 116698 |
| 685 | Ga0501299_022347 | 3300049522 | Unclassified | 1166 |
| 686 | Ga0501032_0278000 | 3300049569 | Unclassified | 1084 |
| 687 | Ga0501032_0293391 | 3300049569 | Bacteria | 1052 |
| 688 | Ga0501034_0039253 | 3300049571 | Bacteria | 4795 |
| 689 | Ga0501036_0156950 | 3300049572 | Unclassified | 1919 |
| 690 | Ga0501036_0218330 | 3300049572 | Bacteria | 1601 |
| 691 | Ga0501036_0279380 | 3300049572 | Bacteria | 1398 |
| 692 | Ga0501036_0351264 | 3300049572 | Unclassified | 1231 |
| 693 | Ga0501038_0157232 | 3300049574 | Bacteria | 1850 |
| 694 | Ga0501038_0424801 | 3300049574 | Bacteria | 1025 |
| 695 | Ga0501040_0020560 | 3300049576 | Bacteria | 4401 |
| 696 | Ga0501040_0155555 | 3300049576 | Bacteria | 1614 |
| 697 | Ga0501041_0010636 | 3300049577 | Bacteria | 5426 |
| 698 | Ga0501041_0011231 | 3300049577 | Bacteria | 5291 |
| 699 | Ga0501041_0162503 | 3300049577 | Bacteria | 1396 |
| 700 | Ga0501041_0289185 | 3300049577 | Bacteria | 1032 |
| 701 | Ga0501042_0063830 | 3300049578 | Bacteria | 2632 |
| 702 | Ga0501042_0085180 | 3300049578 | Bacteria | 2266 |
| 703 | Ga0501042_0195223 | 3300049578 | Bacteria | 1460 |
| 704 | Ga0501042_0212026 | 3300049578 | Bacteria | 1397 |
| 705 | Ga0501043_0106457 | 3300049579 | Bacteria | 2203 |
| 706 | Ga0501043_0343542 | 3300049579 | Bacteria | 1135 |
| 707 | Ga0501046_0035947 | 3300049580 | Bacteria | 3989 |
| 708 | Ga0501047_0052331 | 3300049581 | Bacteria | 3947 |
| 709 | Ga0501048_0033566 | 3300049582 | Bacteria | 3707 |
| 710 | Ga0501048_0224436 | 3300049582 | Bacteria | 1333 |
| 711 | Ga0501068_0332508 | 3300049584 | Bacteria | 975 |
| 712 | Ga0501069_0214318 | 3300049585 | Bacteria | 1118 |
| 713 | Ga0501071_0013769 | 3300049587 | Bacteria | 5517 |
| 714 | Ga0501071_0107076 | 3300049587 | Unclassified | 2064 |
| 715 | Ga0501071_0119398 | 3300049587 | Bacteria | 1954 |
| 716 | Ga0501071_0191228 | 3300049587 | Bacteria | 1535 |
| 717 | Ga0501072_0032275 | 3300049588 | Bacteria | 4102 |
| 718 | Ga0501072_0042098 | 3300049588 | Bacteria | 3588 |
| 719 | Ga0501072_0091050 | 3300049588 | Bacteria | 2421 |
| 720 | Ga0501072_0103309 | 3300049588 | Bacteria | 2265 |
| 721 | Ga0501072_0335317 | 3300049588 | Bacteria | 1201 |
| 722 | Ga0501074_0105851 | 3300049590 | Unclassified | 2014 |
| 723 | Ga0501074_0270389 | 3300049590 | Bacteria | 1208 |
| 724 | Ga0501075_0019019 | 3300049591 | Bacteria | 4981 |
| 725 | Ga0501075_0081685 | 3300049591 | Bacteria | 2447 |
| 726 | Ga0501075_0163142 | 3300049591 | Bacteria | 1700 |
| 727 | Ga0501075_0427074 | 3300049591 | Bacteria | 1010 |
| 728 | Ga0501075_0488749 | 3300049591 | Bacteria | 939 |
| 729 | Ga0501076_0005097 | 3300049592 | Bacteria | 9406 |
| 730 | Ga0501076_0047976 | 3300049592 | Bacteria | 3376 |
| 731 | Ga0501076_0130401 | 3300049592 | Bacteria | 2039 |
| 732 | Ga0501076_0165266 | 3300049592 | Bacteria | 1804 |
| 733 | Ga0501076_0288425 | 3300049592 | Bacteria | 1345 |
| 734 | Ga0501077_0393637 | 3300049593 | Bacteria | 885 |
| 735 | Ga0501217_079764 | 3300049661 | Unclassified | 904 |
| 736 | Ga0501235_031445 | 3300049669 | Unclassified | 1199 |
| 737 | Ga0501247_011556 | 3300049677 | Unclassified | 1066 |
| 738 | Ga0501245_011486 | 3300049708 | Unclassified | 1290 |
| 739 | Ga0501079_0052049 | 3300049741 | Bacteria | 3162 |
| 740 | Ga0501079_0202364 | 3300049741 | Unclassified | 1551 |
| 741 | Ga0501079_0211818 | 3300049741 | Unclassified | 1514 |
| 742 | Ga0501080_0212064 | 3300049742 | Bacteria | 1775 |
| 743 | Ga0501080_0432865 | 3300049742 | Bacteria | 1181 |
| 744 | Ga0501080_0856980 | 3300049742 | Bacteria | 794 |
| 745 | Ga0501081_0209315 | 3300049743 | Bacteria | 1416 |
| 746 | Ga0501081_0331772 | 3300049743 | Unclassified | 1119 |
| 747 | Ga0501272_004728 | 3300049769 | Bacteria | 1421 |
| 748 | Ga0501274_010984 | 3300049771 | Unclassified | 841 |
| 749 | Ga0501283_025443 | 3300049779 | Unclassified | 969 |
| 750 | Ga0501044_0027646 | 3300049823 | Bacteria | 5990 |
| 751 | Ga0501045_0020019 | 3300049824 | Bacteria | 4777 |
| 752 | Ga0501045_0024508 | 3300049824 | Bacteria | 4333 |
| 753 | Ga0501045_0031413 | 3300049824 | Bacteria | 3847 |
| 754 | Ga0501045_0061736 | 3300049824 | Bacteria | 2750 |
| 755 | nmdc:mga03683_12926_c1 | 3300050489 | Bacteria | 3061 |
| 756 | nmdc:mga03n38_133976_c1 | 3300050490 | Bacteria | 1231 |
| 757 | nmdc:mga00v17_19639_c1 | 3300050491 | Bacteria | 3862 |
| 758 | nmdc:mga0yw44_156896_c1 | 3300050492 | Bacteria | 1488 |
| 759 | nmdc:mga0yw44_30218_c1 | 3300050492 | Bacteria | 3136 |
| 760 | nmdc:mga0k408_320004_c1 | 3300050493 | Bacteria | 926 |
| 761 | nmdc:mga0k408_76872_c1 | 3300050493 | Unclassified | 1952 |
| 762 | nmdc:mga06z11_246932_c1 | 3300050494 | Bacteria | 1050 |
| 763 | nmdc:mga06z11_32907_c1 | 3300050494 | Bacteria | 2532 |
| 764 | nmdc:mga04h51_20370_c1 | 3300050495 | Bacteria | 1979 |
| 765 | nmdc:mga07m45_49442_c1 | 3300050496 | Bacteria | 2008 |
| 766 | nmdc:mga05p37_107342_c1 | 3300050507 | Bacteria | 3435 |
| 767 | nmdc:mga05p37_1074_c1 | 3300050507 | Bacteria | 31305 |
| 768 | nmdc:mga05p37_129618_c1 | 3300050507 | Bacteria | 3095 |
| 769 | nmdc:mga05p37_161143_c1 | 3300050507 | Bacteria | 2740 |
| 770 | nmdc:mga05p37_170381_c1 | 3300050507 | Bacteria | 2655 |
| 771 | nmdc:mga05p37_191001_c1 | 3300050507 | Bacteria | 2486 |
| 772 | nmdc:mga05p37_227632_c2 | 3300050507 | Bacteria | 1998 |
| 773 | nmdc:mga05p37_232050_c1 | 3300050507 | Unclassified | 2223 |
| 774 | nmdc:mga05p37_24240_c1 | 3300050507 | Bacteria | 7372 |
| 775 | nmdc:mga05p37_254208_c1 | 3300050507 | Bacteria | 2106 |
| 776 | nmdc:mga05p37_2653_c1 | 3300050507 | Bacteria | 20833 |
| 777 | nmdc:mga05p37_27424_c1 | 3300050507 | Bacteria | 6933 |
| 778 | nmdc:mga05p37_321996_c1 | 3300050507 | Bacteria | 1829 |
| 779 | nmdc:mga05p37_403023_c1 | 3300050507 | Bacteria | 1597 |
| 780 | nmdc:mga05p37_467662_c1 | 3300050507 | Bacteria | 1456 |
| 781 | nmdc:mga05p37_483921_c1 | 3300050507 | Bacteria | 1425 |
| 782 | nmdc:mga05p37_486290_c1 | 3300050507 | Bacteria | 1420 |
| 783 | nmdc:mga05p37_4973_c1 | 3300050507 | Bacteria | 15580 |
| 784 | nmdc:mga05p37_551536_c1 | 3300050507 | Bacteria | 1312 |
| 785 | nmdc:mga05p37_82607_c1 | 3300050507 | Bacteria | 3959 |
| 786 | nmdc:mga05p37_83_c1 | 3300050507 | Bacteria | 83944 |
| 787 | nmdc:mga05p37_869737_c1 | 3300050507 | Bacteria | 976 |
| 788 | nmdc:mga05p37_876_c1 | 3300050507 | Bacteria | 33908 |
| 789 | nmdc:mga09592_101092_c1 | 3300050508 | Bacteria | 2470 |
| 790 | nmdc:mga09592_13552_c1 | 3300050508 | Bacteria | 6658 |
| 791 | nmdc:mga09592_15786_c1 | 3300050508 | Bacteria | 6170 |
| 792 | nmdc:mga09592_242959_c1 | 3300050508 | Bacteria | 1560 |
| 793 | nmdc:mga09592_36829_c1 | 3300050508 | Bacteria | 4100 |
| 794 | nmdc:mga09592_41866_c1 | 3300050508 | Bacteria | 3853 |
| 795 | nmdc:mga09592_42919_c1 | 3300050508 | Bacteria | 3804 |
| 796 | nmdc:mga09592_46796_c1 | 3300050508 | Unclassified | 3644 |
| 797 | nmdc:mga09592_58391_c1 | 3300050508 | Bacteria | 3262 |
| 798 | nmdc:mga09592_7978_c1 | 3300050508 | Bacteria | 8604 |
| 799 | nmdc:mga09592_90410_c1 | 3300050508 | Bacteria | 2615 |
| 800 | nmdc:mga0qj67_10922_c1 | 3300050509 | Bacteria | 6795 |
| 801 | nmdc:mga0qj67_116243_c1 | 3300050509 | Bacteria | 2161 |
| 802 | nmdc:mga0qj67_16467_c1 | 3300050509 | Bacteria | 5608 |
| 803 | nmdc:mga0qj67_17069_c1 | 3300050509 | Bacteria | 5515 |
| 804 | nmdc:mga0qj67_203387_c1 | 3300050509 | Bacteria | 1609 |
| 805 | nmdc:mga0qj67_230269_c1 | 3300050509 | Bacteria | 1504 |
| 806 | nmdc:mga0qj67_35275_c1 | 3300050509 | Bacteria | 2159 |
| 807 | nmdc:mga0qj67_56085_c1 | 3300050509 | Unclassified | 3123 |
| 808 | nmdc:mga0qj67_57490_c1 | 3300050509 | Bacteria | 3083 |
| 809 | nmdc:mga06r32_121634_c1 | 3300050510 | Bacteria | 2575 |
| 810 | nmdc:mga06r32_160477_c1 | 3300050510 | Unclassified | 2230 |
| 811 | nmdc:mga06r32_186599_c1 | 3300050510 | Bacteria | 2061 |
| 812 | nmdc:mga06r32_20103_c1 | 3300050510 | Bacteria | 6141 |
| 813 | nmdc:mga06r32_243033_c1 | 3300050510 | Bacteria | 1787 |
| 814 | nmdc:mga06r32_279435_c1 | 3300050510 | Bacteria | 1657 |
| 815 | nmdc:mga06r32_4267_c1 | 3300050510 | Bacteria | 12799 |
| 816 | nmdc:mga06r32_4360_c1 | 3300050510 | Bacteria | 12657 |
| 817 | nmdc:mga06r32_442461_c1 | 3300050510 | Bacteria | 1280 |
| 818 | nmdc:mga06r32_52513_c1 | 3300050510 | Unclassified | 3904 |
| 819 | nmdc:mga06r32_6742_c1 | 3300050510 | Bacteria | 10321 |
| 820 | nmdc:mga06r32_785317_c1 | 3300050510 | Bacteria | 914 |
| 821 | nmdc:mga08y16_100479_c1 | 3300050511 | Bacteria | 3012 |
| 822 | nmdc:mga08y16_111173_c1 | 3300050511 | Bacteria | 2852 |
| 823 | nmdc:mga08y16_1121_c1 | 3300050511 | Bacteria | 26404 |
| 824 | nmdc:mga08y16_125171_c1 | 3300050511 | Bacteria | 2674 |
| 825 | nmdc:mga08y16_206959_c1 | 3300050511 | Unclassified | 2032 |
| 826 | nmdc:mga08y16_223798_c1 | 3300050511 | Unclassified | 1947 |
| 827 | nmdc:mga08y16_2471_c1 | 3300050511 | Bacteria | 18972 |
| 828 | nmdc:mga08y16_30792_c1 | 3300050511 | Bacteria | 5644 |
| 829 | nmdc:mga08y16_7060_c1 | 3300050511 | Bacteria | 11789 |
| 830 | nmdc:mga08y16_7865_c1 | 3300050511 | Bacteria | 11162 |
| 831 | nmdc:mga0n895_251662_c1 | 3300050512 | Unclassified | 1793 |
| 832 | nmdc:mga0n895_4356_c1 | 3300050512 | Bacteria | 11605 |
| 833 | nmdc:mga0n895_48219_c1 | 3300050512 | Bacteria | 4168 |
| 834 | nmdc:mga0n895_5029_c1 | 3300050512 | Bacteria | 10971 |
| 835 | nmdc:mga0n895_5070_c1 | 3300050512 | Bacteria | 10936 |
| 836 | nmdc:mga0n895_68276_c1 | 3300050512 | Bacteria | 3522 |
| 837 | nmdc:mga0n895_768996_c1 | 3300050512 | Bacteria | 955 |
| 838 | nmdc:mga0rr50_6819_c1 | 3300050513 | Bacteria | 6999 |
| 839 | nmdc:mga08x19_73783_c1 | 3300050514 | Bacteria | 2228 |
| 840 | nmdc:mga0a205_15411_c1 | 3300050515 | Bacteria | 7143 |
| 841 | nmdc:mga0a205_16830_c1 | 3300050515 | Bacteria | 6847 |
| 842 | nmdc:mga0a205_17912_c1 | 3300050515 | Bacteria | 6648 |
| 843 | nmdc:mga0a205_29612_c1 | 3300050515 | Bacteria | 5240 |
| 844 | nmdc:mga0a205_34306_c1 | 3300050515 | Bacteria | 4870 |
| 845 | nmdc:mga0a205_43676_c1 | 3300050515 | Bacteria | 4320 |
| 846 | nmdc:mga0a205_4439_c1 | 3300050515 | Bacteria | 12597 |
| 847 | nmdc:mga0a205_50427_c2 | 3300050515 | Bacteria | 2602 |
| 848 | nmdc:mga0a205_538788_c1 | 3300050515 | Unclassified | 1023 |
| 849 | nmdc:mga0a205_606472_c1 | 3300050515 | Unclassified | 948 |
| 850 | nmdc:mga0a205_76_c1 | 3300050515 | Bacteria | 54611 |
| 851 | nmdc:mga0a205_96540_c1 | 3300050515 | Unclassified | 2854 |
| 852 | nmdc:mga0sz30_29885_c1 | 3300050516 | Bacteria | 2248 |
| 853 | Ga0495601_0075013 | 3300053077 | Bacteria | 2165 |
| 854 | Ga0500588_0008931 | 3300053146 | Bacteria | 2362 |
| 855 | Ga0501084_0067656 | 3300054114 | Bacteria | 2990 |
| 856 | Ga0501084_0468328 | 3300054114 | Unclassified | 1065 |
| 857 | Ga0501084_0580879 | 3300054114 | Bacteria | 947 |
| 858 | Ga0590071_000030 | 3300059421 | Bacteria | 37230 |
| 859 | Ga0590071_001388 | 3300059421 | Bacteria | 6417 |
| 860 | Ga0590071_006653 | 3300059421 | Bacteria | 2745 |
| 861 | Ga0590074_002044 | 3300059423 | Unclassified | 3306 |
| 862 | Ga0590074_005177 | 3300059423 | Unclassified | 2156 |
| 863 | Ga0590075_000351 | 3300059424 | Bacteria | 12827 |
| 864 | Ga0590075_001856 | 3300059424 | Bacteria | 5132 |
| 865 | Ga0590075_003200 | 3300059424 | Bacteria | 3895 |
| 866 | Ga0590075_004308 | 3300059424 | Unclassified | 3367 |
| 867 | Ga0590075_050806 | 3300059424 | Bacteria | 1064 |
| 868 | Ga0590077_000390 | 3300059426 | Bacteria | 12365 |
| 869 | Ga0590077_001322 | 3300059426 | Bacteria | 5851 |
| 870 | Ga0587091_042773 | 3300059511 | Bacteria | 900 |
| 871 | Ga0501082_0269423 | 3300060353 | Bacteria | 1482 |
| 872 | Ga0530510_0006822 | 3300061734 | Bacteria | 7956 |
| 873 | Ga0530510_0180631 | 3300061734 | Bacteria | 1565 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050515 | nmdc:mga0a205_34306_c1 | nmdc:mga0a205_34306_c1_4227_4859 | 209 |
| 2 | 3300026078 | Ga0207702_11120401 | Ga0207702_111204011 | 210 |
| 3 | 3300042876 | Ga0451577_0767595 | Ga0451577_0767595_16_654 | 210 |
| 4 | 3300050507 | nmdc:mga05p37_486290_c1 | nmdc:mga05p37_486290_c1_25_663 | 211 |
| 5 | 3300035724 | Ga0373933_0335936 | Ga0373933_0335936_24_680 | 212 |
| 6 | 3300048915 | Ga0496112_0058506 | Ga0496112_0058506_447_1235 | 218 |
| 7 | 3300005331 | Ga0070670_100540427 | Ga0070670_1005404272 | 219 |
| 8 | 3300005367 | Ga0070667_100004567 | Ga0070667_1000045676 | 219 |
| 9 | 3300005843 | Ga0068860_100021964 | Ga0068860_1000219644 | 219 |
| 10 | 3300009177 | Ga0105248_10633814 | Ga0105248_106338142 | 219 |
| 11 | 3300025925 | Ga0207650_10464442 | Ga0207650_104644421 | 219 |
| 12 | 3300026118 | Ga0207675_100341765 | Ga0207675_1003417652 | 219 |
| 13 | 3300028381 | Ga0268264_10118510 | Ga0268264_101185103 | 219 |
| 14 | 3300048921 | Ga0496118_0016401 | Ga0496118_0016401_1558_2355 | 220 |
| 15 | 3300048924 | Ga0496121_0000243 | Ga0496121_0000243_74640_75437 | 220 |
| 16 | 3300014326 | Ga0157380_10360187 | Ga0157380_103601872 | 227 |
| 17 | 3300032002 | Ga0307416_100563096 | Ga0307416_1005630962 | 228 |
| 18 | 3300053146 | Ga0500588_0008931 | Ga0500588_0008931_985_2127 | 228 |
| 19 | 3300005441 | Ga0070700_100506285 | Ga0070700_1005062851 | 230 |
| 20 | 3300005518 | Ga0070699_100000485 | Ga0070699_10000048532 | 230 |
| 21 | 3300021361 | Ga0213872_10116995 | Ga0213872_101169952 | 230 |
| 22 | 3300039447 | Ga0436361_0942135 | Ga0436361_0942135_192_980 | 230 |
| 23 | 3300005548 | Ga0070665_100028846 | Ga0070665_1000288468 | 231 |
| 24 | 3300005618 | Ga0068864_100064648 | Ga0068864_1000646483 | 231 |
| 25 | 3300005841 | Ga0068863_100000005 | Ga0068863_100000005221 | 231 |
| 26 | 3300005842 | Ga0068858_100009898 | Ga0068858_1000098989 | 231 |
| 27 | 3300005843 | Ga0068860_100000008 | Ga0068860_10000000854 | 231 |
| 28 | 3300005844 | Ga0068862_100100586 | Ga0068862_1001005862 | 231 |
| 29 | 3300025923 | Ga0207681_10228473 | Ga0207681_102284733 | 231 |
| 30 | 3300025986 | Ga0207658_10009565 | Ga0207658_100095656 | 231 |
| 31 | 3300026035 | Ga0207703_10006715 | Ga0207703_100067158 | 231 |
| 32 | 3300026088 | Ga0207641_10000198 | Ga0207641_1000019828 | 231 |
| 33 | 3300026095 | Ga0207676_10035502 | Ga0207676_100355021 | 231 |
| 34 | 3300028379 | Ga0268266_10006015 | Ga0268266_100060159 | 231 |
| 35 | 3300028380 | Ga0268265_10031270 | Ga0268265_100312702 | 231 |
| 36 | 3300028381 | Ga0268264_10000588 | Ga0268264_1000058853 | 231 |
| 37 | 3300048907 | Ga0496104_0013360 | Ga0496104_0013360_5644_6435 | 231 |
| 38 | 3300048908 | Ga0496105_0022305 | Ga0496105_0022305_1563_2354 | 231 |
| 39 | 3300005335 | Ga0070666_10227019 | Ga0070666_102270192 | 232 |
| 40 | 3300005843 | Ga0068860_100053433 | Ga0068860_1000534331 | 232 |
| 41 | 3300025903 | Ga0207680_10265102 | Ga0207680_102651021 | 232 |
| 42 | 3300028381 | Ga0268264_10026990 | Ga0268264_100269903 | 232 |
| 43 | 3300005329 | Ga0070683_100707004 | Ga0070683_1007070041 | 233 |
| 44 | 3300005577 | Ga0068857_100628900 | Ga0068857_1006289002 | 233 |
| 45 | 3300026078 | Ga0207702_10614272 | Ga0207702_106142722 | 233 |
| 46 | 3300032002 | Ga0307416_100392854 | Ga0307416_1003928542 | 233 |
| 47 | 3300048920 | Ga0496117_0185733 | Ga0496117_0185733_57_830 | 233 |
| 48 | 3300005327 | Ga0070658_10013944 | Ga0070658_100139446 | 234 |
| 49 | 3300013105 | Ga0157369_10393377 | Ga0157369_103933772 | 234 |
| 50 | 3300031911 | Ga0307412_10137366 | Ga0307412_101373662 | 234 |
| 51 | 3300005617 | Ga0068859_100012595 | Ga0068859_1000125953 | 235 |
| 52 | 3300006931 | Ga0097620_100012593 | Ga0097620_1000125933 | 235 |
| 53 | 3300005365 | Ga0070688_100117494 | Ga0070688_1001174941 | 236 |
| 54 | 3300005466 | Ga0070685_10260454 | Ga0070685_102604541 | 236 |
| 55 | 3300025940 | Ga0207691_10292231 | Ga0207691_102922312 | 236 |
| 56 | 3300037418 | Ga0395900_0049548 | Ga0395900_0049548_548_1312 | 236 |
| 57 | 3300037466 | Ga0395898_0211834 | Ga0395898_0211834_446_1210 | 236 |
| 58 | 3300037471 | Ga0395905_0084219 | Ga0395905_0084219_1585_2349 | 236 |
| 59 | 3300038443 | Ga0395901_0177997 | Ga0395901_0177997_549_1313 | 236 |
| 60 | 3300038443 | Ga0395901_0400049 | Ga0395901_0400049_586_1350 | 236 |
| 61 | 3300046689 | Ga0495613_0005490 | Ga0495613_0005490_3322_4086 | 236 |
| 62 | 3300047318 | Ga0495636_0044302 | Ga0495636_0044302_689_1429 | 236 |
| 63 | 3300047320 | Ga0495672_0001520 | Ga0495672_0001520_1796_2773 | 236 |
| 64 | 3300048918 | Ga0496115_0122921 | Ga0496115_0122921_1201_1965 | 236 |
| 65 | 3300035241 | Ga0373961_0000297 | Ga0373961_0000297_20170_20964 | 237 |
| 66 | 3300042008 | Ga0439450_016156 | Ga0439450_016156_17_733 | 237 |
| 67 | 3300045051 | Ga0451576_0517300 | Ga0451576_0517300_343_1062 | 237 |
| 68 | 3300050507 | nmdc:mga05p37_129618_c1 | nmdc:mga05p37_129618_c1_1167_1937 | 237 |
| 69 | 3300009147 | Ga0114129_10100099 | Ga0114129_101000992 | 238 |
| 70 | 3300009177 | Ga0105248_10008525 | Ga0105248_100085257 | 238 |
| 71 | 3300009545 | Ga0105237_10135419 | Ga0105237_101354193 | 238 |
| 72 | 3300025933 | Ga0207706_10504749 | Ga0207706_105047491 | 238 |
| 73 | 3300025949 | Ga0207667_10194720 | Ga0207667_101947202 | 238 |
| 74 | 3300026078 | Ga0207702_10150743 | Ga0207702_101507432 | 238 |
| 75 | 3300031456 | Ga0307513_10011871 | Ga0307513_1001187111 | 238 |
| 76 | 3300032002 | Ga0307416_100015969 | Ga0307416_1000159695 | 238 |
| 77 | 3300039437 | Ga0436365_1614654 | Ga0436365_1614654_572_1357 | 238 |
| 78 | 3300042439 | Ga0439464_0050234 | Ga0439464_0050234_269_988 | 238 |
| 79 | 3300046528 | Ga0495642_0014741 | Ga0495642_0014741_2173_2952 | 238 |
| 80 | 3300046616 | Ga0495668_0124076 | Ga0495668_0124076_66_842 | 238 |
| 81 | 3300047320 | Ga0495672_0249622 | Ga0495672_0249622_28_807 | 238 |
| 82 | 3300049592 | Ga0501076_0165266 | Ga0501076_0165266_808_1572 | 238 |
| 83 | 3300049769 | Ga0501272_004728 | Ga0501272_004728_621_1388 | 238 |
| 84 | 3300050507 | nmdc:mga05p37_82607_c1 | nmdc:mga05p37_82607_c1_2471_3235 | 238 |
| 85 | 3300005356 | Ga0070674_100130461 | Ga0070674_1001304611 | 239 |
| 86 | 3300005440 | Ga0070705_100232308 | Ga0070705_1002323081 | 239 |
| 87 | 3300006871 | Ga0075434_100544748 | Ga0075434_1005447481 | 239 |
| 88 | 3300009147 | Ga0114129_10106729 | Ga0114129_101067294 | 239 |
| 89 | 3300009553 | Ga0105249_10405995 | Ga0105249_104059952 | 239 |
| 90 | 3300025922 | Ga0207646_10112952 | Ga0207646_101129522 | 239 |
| 91 | 3300025936 | Ga0207670_10470744 | Ga0207670_104707441 | 239 |
| 92 | 3300025937 | Ga0207669_10289904 | Ga0207669_102899042 | 239 |
| 93 | 3300037312 | Ga0395899_0422937 | Ga0395899_0422937_53_847 | 239 |
| 94 | 3300037418 | Ga0395900_0340172 | Ga0395900_0340172_31_864 | 239 |
| 95 | 3300037466 | Ga0395898_0621401 | Ga0395898_0621401_59_892 | 239 |
| 96 | 3300037471 | Ga0395905_0059052 | Ga0395905_0059052_1591_2424 | 239 |
| 97 | 3300041999 | Ga0439433_0005167 | Ga0439433_0005167_1148_1912 | 239 |
| 98 | 3300042437 | Ga0439444_0023359 | Ga0439444_0023359_249_971 | 239 |
| 99 | 3300050508 | nmdc:mga09592_36829_c1 | nmdc:mga09592_36829_c1_1154_1876 | 239 |
| 100 | 3300050510 | nmdc:mga06r32_4360_c1 | nmdc:mga06r32_4360_c1_10198_10920 | 239 |
| 101 | 3300050516 | nmdc:mga0sz30_29885_c1 | nmdc:mga0sz30_29885_c1_127_906 | 239 |
| 102 | 3300006844 | Ga0075428_100231389 | Ga0075428_1002313892 | 240 |
| 103 | 3300006847 | Ga0075431_100003416 | Ga0075431_1000034169 | 240 |
| 104 | 3300006847 | Ga0075431_100080952 | Ga0075431_1000809522 | 240 |
| 105 | 3300006880 | Ga0075429_100074273 | Ga0075429_1000742732 | 240 |
| 106 | 3300006880 | Ga0075429_100080109 | Ga0075429_1000801094 | 240 |
| 107 | 3300027682 | Ga0209971_1007621 | Ga0209971_10076212 | 240 |
| 108 | 3300027876 | Ga0209974_10014860 | Ga0209974_100148602 | 240 |
| 109 | 3300027876 | Ga0209974_10104232 | Ga0209974_101042322 | 240 |
| 110 | 3300027907 | Ga0207428_10139122 | Ga0207428_101391222 | 240 |
| 111 | 3300042436 | Ga0439435_0066706 | Ga0439435_0066706_225_992 | 240 |
| 112 | 3300042437 | Ga0439444_0045118 | Ga0439444_0045118_91_858 | 240 |
| 113 | 3300046660 | Ga0495625_0223882 | Ga0495625_0223882_101_892 | 240 |
| 114 | 3300050507 | nmdc:mga05p37_161143_c1 | nmdc:mga05p37_161143_c1_751_1521 | 240 |
| 115 | 3300050507 | nmdc:mga05p37_483921_c1 | nmdc:mga05p37_483921_c1_530_1297 | 240 |
| 116 | 3300050508 | nmdc:mga09592_13552_c1 | nmdc:mga09592_13552_c1_5449_6222 | 240 |
| 117 | 3300050508 | nmdc:mga09592_242959_c1 | nmdc:mga09592_242959_c1_163_930 | 240 |
| 118 | 3300050509 | nmdc:mga0qj67_57490_c1 | nmdc:mga0qj67_57490_c1_1320_2087 | 240 |
| 119 | 3300050510 | nmdc:mga06r32_4267_c1 | nmdc:mga06r32_4267_c1_11138_11905 | 240 |
| 120 | 3300050510 | nmdc:mga06r32_6742_c1 | nmdc:mga06r32_6742_c1_3701_4474 | 240 |
| 121 | 3300054114 | Ga0501084_0580879 | Ga0501084_0580879_167_937 | 240 |
| 122 | 3300005293 | Ga0065715_10167934 | Ga0065715_101679341 | 241 |
| 123 | 3300005331 | Ga0070670_100016091 | Ga0070670_1000160916 | 241 |
| 124 | 3300005471 | Ga0070698_100205261 | Ga0070698_1002052611 | 241 |
| 125 | 3300005471 | Ga0070698_100740187 | Ga0070698_1007401871 | 241 |
| 126 | 3300006844 | Ga0075428_100073348 | Ga0075428_1000733482 | 241 |
| 127 | 3300006846 | Ga0075430_100000381 | Ga0075430_10000038112 | 241 |
| 128 | 3300006847 | Ga0075431_100030553 | Ga0075431_1000305534 | 241 |
| 129 | 3300006847 | Ga0075431_100359785 | Ga0075431_1003597852 | 241 |
| 130 | 3300006847 | Ga0075431_100626470 | Ga0075431_1006264702 | 241 |
| 131 | 3300006852 | Ga0075433_10000202 | Ga0075433_100002029 | 241 |
| 132 | 3300006871 | Ga0075434_100093703 | Ga0075434_1000937033 | 241 |
| 133 | 3300006880 | Ga0075429_100091450 | Ga0075429_1000914502 | 241 |
| 134 | 3300009094 | Ga0111539_10132362 | Ga0111539_101323623 | 241 |
| 135 | 3300009147 | Ga0114129_10003016 | Ga0114129_100030164 | 241 |
| 136 | 3300025925 | Ga0207650_10170112 | Ga0207650_101701122 | 241 |
| 137 | 3300027907 | Ga0207428_10024378 | Ga0207428_100243783 | 241 |
| 138 | 3300031548 | Ga0307408_100122298 | Ga0307408_1001222982 | 241 |
| 139 | 3300031548 | Ga0307408_100356642 | Ga0307408_1003566422 | 241 |
| 140 | 3300031852 | Ga0307410_10321541 | Ga0307410_103215411 | 241 |
| 141 | 3300031911 | Ga0307412_10329362 | Ga0307412_103293622 | 241 |
| 142 | 3300032002 | Ga0307416_100399580 | Ga0307416_1003995802 | 241 |
| 143 | 3300032005 | Ga0307411_10058672 | Ga0307411_100586723 | 241 |
| 144 | 3300042439 | Ga0439464_0002455 | Ga0439464_0002455_1726_2499 | 241 |
| 145 | 3300042461 | Ga0439460_0077691 | Ga0439460_0077691_219_995 | 241 |
| 146 | 3300042876 | Ga0451577_0056963 | Ga0451577_0056963_1754_2524 | 241 |
| 147 | 3300049522 | Ga0501299_022347 | Ga0501299_022347_62_835 | 241 |
| 148 | 3300049669 | Ga0501235_031445 | Ga0501235_031445_176_964 | 241 |
| 149 | 3300049677 | Ga0501247_011556 | Ga0501247_011556_188_961 | 241 |
| 150 | 3300049771 | Ga0501274_010984 | Ga0501274_010984_14_787 | 241 |
| 151 | 3300050507 | nmdc:mga05p37_2653_c1 | nmdc:mga05p37_2653_c1_15902_16675 | 241 |
| 152 | 3300050508 | nmdc:mga09592_15786_c1 | nmdc:mga09592_15786_c1_2950_3723 | 241 |
| 153 | 3300050508 | nmdc:mga09592_41866_c1 | nmdc:mga09592_41866_c1_2011_2802 | 241 |
| 154 | 3300050509 | nmdc:mga0qj67_10922_c1 | nmdc:mga0qj67_10922_c1_3588_4361 | 241 |
| 155 | 3300050510 | nmdc:mga06r32_20103_c1 | nmdc:mga06r32_20103_c1_1799_2572 | 241 |
| 156 | 3300050511 | nmdc:mga08y16_100479_c1 | nmdc:mga08y16_100479_c1_2007_2780 | 241 |
| 157 | 3300050512 | nmdc:mga0n895_4356_c1 | nmdc:mga0n895_4356_c1_6015_6746 | 241 |
| 158 | 3300050515 | nmdc:mga0a205_76_c1 | nmdc:mga0a205_76_c1_46641_47372 | 241 |
| 159 | 3300005331 | Ga0070670_100124633 | Ga0070670_1001246332 | 242 |
| 160 | 3300005340 | Ga0070689_100468948 | Ga0070689_1004689482 | 242 |
| 161 | 3300005347 | Ga0070668_100296484 | Ga0070668_1002964842 | 242 |
| 162 | 3300005445 | Ga0070708_100346796 | Ga0070708_1003467961 | 242 |
| 163 | 3300005456 | Ga0070678_100026864 | Ga0070678_1000268642 | 242 |
| 164 | 3300005842 | Ga0068858_100012596 | Ga0068858_1000125963 | 242 |
| 165 | 3300006844 | Ga0075428_100144399 | Ga0075428_1001443993 | 242 |
| 166 | 3300006846 | Ga0075430_100326305 | Ga0075430_1003263052 | 242 |
| 167 | 3300006847 | Ga0075431_100026322 | Ga0075431_1000263225 | 242 |
| 168 | 3300006852 | Ga0075433_10001786 | Ga0075433_100017861 | 242 |
| 169 | 3300006871 | Ga0075434_100016237 | Ga0075434_1000162373 | 242 |
| 170 | 3300007076 | Ga0075435_100032944 | Ga0075435_1000329442 | 242 |
| 171 | 3300009094 | Ga0111539_10134852 | Ga0111539_101348523 | 242 |
| 172 | 3300009147 | Ga0114129_11075208 | Ga0114129_110752081 | 242 |
| 173 | 3300009553 | Ga0105249_10086394 | Ga0105249_100863941 | 242 |
| 174 | 3300014325 | Ga0163163_10012072 | Ga0163163_100120727 | 242 |
| 175 | 3300025936 | Ga0207670_10717644 | Ga0207670_107176441 | 242 |
| 176 | 3300025986 | Ga0207658_10066652 | Ga0207658_100666523 | 242 |
| 177 | 3300026035 | Ga0207703_10068704 | Ga0207703_100687041 | 242 |
| 178 | 3300026121 | Ga0207683_10127770 | Ga0207683_101277703 | 242 |
| 179 | 3300042436 | Ga0439435_0109146 | Ga0439435_0109146_70_798 | 242 |
| 180 | 3300049578 | Ga0501042_0212026 | Ga0501042_0212026_130_948 | 242 |
| 181 | 3300049585 | Ga0501069_0214318 | Ga0501069_0214318_145_873 | 242 |
| 182 | 3300049742 | Ga0501080_0856980 | Ga0501080_0856980_34_762 | 242 |
| 183 | 3300050507 | nmdc:mga05p37_869737_c1 | nmdc:mga05p37_869737_c1_39_773 | 242 |
| 184 | 3300050510 | nmdc:mga06r32_160477_c1 | nmdc:mga06r32_160477_c1_1149_1931 | 242 |
| 185 | 3300050512 | nmdc:mga0n895_5070_c1 | nmdc:mga0n895_5070_c1_4696_5481 | 242 |
| 186 | 3300050515 | nmdc:mga0a205_606472_c1 | nmdc:mga0a205_606472_c1_114_899 | 242 |
| 187 | 3300059421 | Ga0590071_000030 | Ga0590071_000030_1482_2279 | 242 |
| 188 | 3300059423 | Ga0590074_002044 | Ga0590074_002044_2169_2966 | 242 |
| 189 | 3300059424 | Ga0590075_001856 | Ga0590075_001856_2607_3404 | 242 |
| 190 | 2162886011 | MRS1b_contig_3199878 | MRS1b_0698.00001390 | 243 |
| 191 | 3300004798 | Ga0058859_11229463 | Ga0058859_112294631 | 243 |
| 192 | 3300004799 | Ga0058863_11934526 | Ga0058863_119345261 | 243 |
| 193 | 3300004800 | Ga0058861_11748004 | Ga0058861_117480041 | 243 |
| 194 | 3300004800 | Ga0058861_12031893 | Ga0058861_120318931 | 243 |
| 195 | 3300004801 | Ga0058860_10064540 | Ga0058860_100645402 | 243 |
| 196 | 3300004801 | Ga0058860_10090918 | Ga0058860_100909181 | 243 |
| 197 | 3300004801 | Ga0058860_11611968 | Ga0058860_116119682 | 243 |
| 198 | 3300004801 | Ga0058860_12028819 | Ga0058860_120288192 | 243 |
| 199 | 3300004803 | Ga0058862_12539343 | Ga0058862_125393432 | 243 |
| 200 | 3300004803 | Ga0058862_12758636 | Ga0058862_127586361 | 243 |
| 201 | 3300004803 | Ga0058862_12783670 | Ga0058862_127836702 | 243 |
| 202 | 3300005288 | Ga0065714_10071074 | Ga0065714_100710742 | 243 |
| 203 | 3300005289 | Ga0065704_10171588 | Ga0065704_101715881 | 243 |
| 204 | 3300005290 | Ga0065712_10003381 | Ga0065712_100033812 | 243 |
| 205 | 3300005290 | Ga0065712_10010152 | Ga0065712_100101525 | 243 |
| 206 | 3300005290 | Ga0065712_10074252 | Ga0065712_100742523 | 243 |
| 207 | 3300005293 | Ga0065715_10004219 | Ga0065715_100042193 | 243 |
| 208 | 3300005293 | Ga0065715_10094822 | Ga0065715_100948224 | 243 |
| 209 | 3300005293 | Ga0065715_10102412 | Ga0065715_101024124 | 243 |
| 210 | 3300005293 | Ga0065715_10126090 | Ga0065715_101260903 | 243 |
| 211 | 3300005293 | Ga0065715_10169792 | Ga0065715_101697923 | 243 |
| 212 | 3300005295 | Ga0065707_10092277 | Ga0065707_100922771 | 243 |
| 213 | 3300005295 | Ga0065707_10194570 | Ga0065707_101945702 | 243 |
| 214 | 3300005295 | Ga0065707_10212626 | Ga0065707_102126262 | 243 |
| 215 | 3300005328 | Ga0070676_10019726 | Ga0070676_100197262 | 243 |
| 216 | 3300005328 | Ga0070676_10140219 | Ga0070676_101402191 | 243 |
| 217 | 3300005329 | Ga0070683_100000260 | Ga0070683_1000002604 | 243 |
| 218 | 3300005330 | Ga0070690_100011445 | Ga0070690_1000114452 | 243 |
| 219 | 3300005330 | Ga0070690_100014027 | Ga0070690_1000140273 | 243 |
| 220 | 3300005330 | Ga0070690_100023056 | Ga0070690_1000230564 | 243 |
| 221 | 3300005331 | Ga0070670_100001340 | Ga0070670_10000134016 | 243 |
| 222 | 3300005331 | Ga0070670_100005713 | Ga0070670_1000057138 | 243 |
| 223 | 3300005331 | Ga0070670_100008280 | Ga0070670_1000082806 | 243 |
| 224 | 3300005331 | Ga0070670_100013192 | Ga0070670_1000131922 | 243 |
| 225 | 3300005331 | Ga0070670_100068105 | Ga0070670_1000681052 | 243 |
| 226 | 3300005331 | Ga0070670_100156618 | Ga0070670_1001566183 | 243 |
| 227 | 3300005331 | Ga0070670_100163332 | Ga0070670_1001633322 | 243 |
| 228 | 3300005333 | Ga0070677_10016722 | Ga0070677_100167221 | 243 |
| 229 | 3300005333 | Ga0070677_10058734 | Ga0070677_100587343 | 243 |
| 230 | 3300005334 | Ga0068869_100020689 | Ga0068869_1000206897 | 243 |
| 231 | 3300005334 | Ga0068869_100025458 | Ga0068869_1000254585 | 243 |
| 232 | 3300005334 | Ga0068869_100154420 | Ga0068869_1001544201 | 243 |
| 233 | 3300005335 | Ga0070666_10012985 | Ga0070666_100129852 | 243 |
| 234 | 3300005335 | Ga0070666_10064586 | Ga0070666_100645863 | 243 |
| 235 | 3300005335 | Ga0070666_10159512 | Ga0070666_101595121 | 243 |
| 236 | 3300005335 | Ga0070666_10322574 | Ga0070666_103225741 | 243 |
| 237 | 3300005336 | Ga0070680_100441545 | Ga0070680_1004415451 | 243 |
| 238 | 3300005337 | Ga0070682_100122017 | Ga0070682_1001220172 | 243 |
| 239 | 3300005338 | Ga0068868_100011659 | Ga0068868_1000116594 | 243 |
| 240 | 3300005339 | Ga0070660_100275589 | Ga0070660_1002755892 | 243 |
| 241 | 3300005340 | Ga0070689_100039410 | Ga0070689_1000394102 | 243 |
| 242 | 3300005340 | Ga0070689_100245288 | Ga0070689_1002452882 | 243 |
| 243 | 3300005343 | Ga0070687_100006132 | Ga0070687_1000061322 | 243 |
| 244 | 3300005343 | Ga0070687_100031838 | Ga0070687_1000318383 | 243 |
| 245 | 3300005343 | Ga0070687_100050658 | Ga0070687_1000506582 | 243 |
| 246 | 3300005344 | Ga0070661_100001252 | Ga0070661_1000012522 | 243 |
| 247 | 3300005344 | Ga0070661_100020068 | Ga0070661_1000200681 | 243 |
| 248 | 3300005347 | Ga0070668_100013056 | Ga0070668_1000130564 | 243 |
| 249 | 3300005347 | Ga0070668_100136203 | Ga0070668_1001362031 | 243 |
| 250 | 3300005347 | Ga0070668_100320759 | Ga0070668_1003207591 | 243 |
| 251 | 3300005347 | Ga0070668_100659752 | Ga0070668_1006597521 | 243 |
| 252 | 3300005353 | Ga0070669_100000399 | Ga0070669_10000039921 | 243 |
| 253 | 3300005353 | Ga0070669_100002199 | Ga0070669_1000021993 | 243 |
| 254 | 3300005353 | Ga0070669_100003613 | Ga0070669_1000036138 | 243 |
| 255 | 3300005353 | Ga0070669_100017648 | Ga0070669_1000176482 | 243 |
| 256 | 3300005353 | Ga0070669_100036098 | Ga0070669_1000360983 | 243 |
| 257 | 3300005353 | Ga0070669_100073288 | Ga0070669_1000732882 | 243 |
| 258 | 3300005353 | Ga0070669_100102331 | Ga0070669_1001023312 | 243 |
| 259 | 3300005353 | Ga0070669_100307046 | Ga0070669_1003070462 | 243 |
| 260 | 3300005354 | Ga0070675_100017161 | Ga0070675_1000171618 | 243 |
| 261 | 3300005354 | Ga0070675_100047773 | Ga0070675_1000477734 | 243 |
| 262 | 3300005354 | Ga0070675_100081052 | Ga0070675_1000810521 | 243 |
| 263 | 3300005354 | Ga0070675_100124137 | Ga0070675_1001241371 | 243 |
| 264 | 3300005354 | Ga0070675_100277332 | Ga0070675_1002773322 | 243 |
| 265 | 3300005354 | Ga0070675_100631575 | Ga0070675_1006315751 | 243 |
| 266 | 3300005354 | Ga0070675_100647599 | Ga0070675_1006475991 | 243 |
| 267 | 3300005355 | Ga0070671_100171233 | Ga0070671_1001712332 | 243 |
| 268 | 3300005355 | Ga0070671_100268190 | Ga0070671_1002681901 | 243 |
| 269 | 3300005355 | Ga0070671_100462898 | Ga0070671_1004628981 | 243 |
| 270 | 3300005356 | Ga0070674_100000133 | Ga0070674_10000013315 | 243 |
| 271 | 3300005356 | Ga0070674_100038102 | Ga0070674_1000381026 | 243 |
| 272 | 3300005364 | Ga0070673_100007069 | Ga0070673_1000070696 | 243 |
| 273 | 3300005364 | Ga0070673_100008782 | Ga0070673_10000878210 | 243 |
| 274 | 3300005364 | Ga0070673_100032544 | Ga0070673_1000325442 | 243 |
| 275 | 3300005364 | Ga0070673_100458554 | Ga0070673_1004585541 | 243 |
| 276 | 3300005365 | Ga0070688_100087207 | Ga0070688_1000872071 | 243 |
| 277 | 3300005365 | Ga0070688_100106534 | Ga0070688_1001065342 | 243 |
| 278 | 3300005365 | Ga0070688_100210667 | Ga0070688_1002106671 | 243 |
| 279 | 3300005406 | Ga0070703_10158118 | Ga0070703_101581181 | 243 |
| 280 | 3300005438 | Ga0070701_10001279 | Ga0070701_100012793 | 243 |
| 281 | 3300005438 | Ga0070701_10043901 | Ga0070701_100439011 | 243 |
| 282 | 3300005438 | Ga0070701_10068895 | Ga0070701_100688952 | 243 |
| 283 | 3300005440 | Ga0070705_100053529 | Ga0070705_1000535292 | 243 |
| 284 | 3300005441 | Ga0070700_100015636 | Ga0070700_1000156364 | 243 |
| 285 | 3300005441 | Ga0070700_100077549 | Ga0070700_1000775492 | 243 |
| 286 | 3300005441 | Ga0070700_100155460 | Ga0070700_1001554602 | 243 |
| 287 | 3300005444 | Ga0070694_100033846 | Ga0070694_1000338462 | 243 |
| 288 | 3300005455 | Ga0070663_100007791 | Ga0070663_1000077914 | 243 |
| 289 | 3300005456 | Ga0070678_100054028 | Ga0070678_1000540283 | 243 |
| 290 | 3300005456 | Ga0070678_100130396 | Ga0070678_1001303962 | 243 |
| 291 | 3300005456 | Ga0070678_100161441 | Ga0070678_1001614412 | 243 |
| 292 | 3300005457 | Ga0070662_100011707 | Ga0070662_1000117076 | 243 |
| 293 | 3300005457 | Ga0070662_100024347 | Ga0070662_1000243473 | 243 |
| 294 | 3300005459 | Ga0068867_100004682 | Ga0068867_1000046829 | 243 |
| 295 | 3300005459 | Ga0068867_100022711 | Ga0068867_1000227113 | 243 |
| 296 | 3300005459 | Ga0068867_100058755 | Ga0068867_1000587553 | 243 |
| 297 | 3300005459 | Ga0068867_100600452 | Ga0068867_1006004521 | 243 |
| 298 | 3300005466 | Ga0070685_10041862 | Ga0070685_100418624 | 243 |
| 299 | 3300005518 | Ga0070699_100041522 | Ga0070699_1000415223 | 243 |
| 300 | 3300005530 | Ga0070679_100116476 | Ga0070679_1001164762 | 243 |
| 301 | 3300005535 | Ga0070684_100000898 | Ga0070684_1000008987 | 243 |
| 302 | 3300005536 | Ga0070697_100165138 | Ga0070697_1001651382 | 243 |
| 303 | 3300005543 | Ga0070672_100012392 | Ga0070672_1000123922 | 243 |
| 304 | 3300005543 | Ga0070672_100015890 | Ga0070672_1000158904 | 243 |
| 305 | 3300005543 | Ga0070672_100186409 | Ga0070672_1001864091 | 243 |
| 306 | 3300005543 | Ga0070672_100412461 | Ga0070672_1004124612 | 243 |
| 307 | 3300005544 | Ga0070686_100009424 | Ga0070686_1000094243 | 243 |
| 308 | 3300005544 | Ga0070686_100051783 | Ga0070686_1000517832 | 243 |
| 309 | 3300005544 | Ga0070686_100251732 | Ga0070686_1002517321 | 243 |
| 310 | 3300005545 | Ga0070695_100417634 | Ga0070695_1004176341 | 243 |
| 311 | 3300005546 | Ga0070696_100443868 | Ga0070696_1004438681 | 243 |
| 312 | 3300005548 | Ga0070665_100048324 | Ga0070665_1000483247 | 243 |
| 313 | 3300005548 | Ga0070665_100444421 | Ga0070665_1004444212 | 243 |
| 314 | 3300005549 | Ga0070704_100033061 | Ga0070704_1000330613 | 243 |
| 315 | 3300005564 | Ga0070664_100002150 | Ga0070664_1000021504 | 243 |
| 316 | 3300005564 | Ga0070664_100014148 | Ga0070664_1000141482 | 243 |
| 317 | 3300005564 | Ga0070664_100312663 | Ga0070664_1003126631 | 243 |
| 318 | 3300005564 | Ga0070664_100402932 | Ga0070664_1004029322 | 243 |
| 319 | 3300005564 | Ga0070664_100554967 | Ga0070664_1005549671 | 243 |
| 320 | 3300005577 | Ga0068857_100011022 | Ga0068857_1000110225 | 243 |
| 321 | 3300005577 | Ga0068857_100013100 | Ga0068857_1000131005 | 243 |
| 322 | 3300005577 | Ga0068857_100062811 | Ga0068857_1000628115 | 243 |
| 323 | 3300005578 | Ga0068854_100145624 | Ga0068854_1001456242 | 243 |
| 324 | 3300005615 | Ga0070702_100091927 | Ga0070702_1000919272 | 243 |
| 325 | 3300005616 | Ga0068852_100210251 | Ga0068852_1002102513 | 243 |
| 326 | 3300005617 | Ga0068859_100005105 | Ga0068859_10000510515 | 243 |
| 327 | 3300005617 | Ga0068859_100009922 | Ga0068859_1000099229 | 243 |
| 328 | 3300005617 | Ga0068859_100060387 | Ga0068859_1000603874 | 243 |
| 329 | 3300005617 | Ga0068859_100079721 | Ga0068859_1000797213 | 243 |
| 330 | 3300005617 | Ga0068859_100237905 | Ga0068859_1002379052 | 243 |
| 331 | 3300005618 | Ga0068864_100039642 | Ga0068864_1000396423 | 243 |
| 332 | 3300005618 | Ga0068864_100427390 | Ga0068864_1004273902 | 243 |
| 333 | 3300005618 | Ga0068864_100511997 | Ga0068864_1005119971 | 243 |
| 334 | 3300005719 | Ga0068861_100006364 | Ga0068861_1000063647 | 243 |
| 335 | 3300005719 | Ga0068861_100013596 | Ga0068861_1000135964 | 243 |
| 336 | 3300005719 | Ga0068861_100172423 | Ga0068861_1001724232 | 243 |
| 337 | 3300005840 | Ga0068870_10000968 | Ga0068870_100009685 | 243 |
| 338 | 3300005840 | Ga0068870_10014039 | Ga0068870_100140392 | 243 |
| 339 | 3300005840 | Ga0068870_10059758 | Ga0068870_100597582 | 243 |
| 340 | 3300005840 | Ga0068870_10066038 | Ga0068870_100660381 | 243 |
| 341 | 3300005841 | Ga0068863_100000867 | Ga0068863_1000008675 | 243 |
| 342 | 3300005841 | Ga0068863_100039399 | Ga0068863_1000393992 | 243 |
| 343 | 3300005841 | Ga0068863_100083183 | Ga0068863_1000831834 | 243 |
| 344 | 3300005841 | Ga0068863_100158225 | Ga0068863_1001582251 | 243 |
| 345 | 3300005841 | Ga0068863_100834985 | Ga0068863_1008349851 | 243 |
| 346 | 3300005841 | Ga0068863_100865957 | Ga0068863_1008659571 | 243 |
| 347 | 3300005842 | Ga0068858_100007931 | Ga0068858_1000079314 | 243 |
| 348 | 3300005842 | Ga0068858_100048972 | Ga0068858_1000489723 | 243 |
| 349 | 3300005842 | Ga0068858_100083127 | Ga0068858_1000831273 | 243 |
| 350 | 3300005842 | Ga0068858_100336378 | Ga0068858_1003363782 | 243 |
| 351 | 3300005843 | Ga0068860_100140178 | Ga0068860_1001401782 | 243 |
| 352 | 3300005843 | Ga0068860_100194295 | Ga0068860_1001942953 | 243 |
| 353 | 3300005844 | Ga0068862_100001221 | Ga0068862_1000012219 | 243 |
| 354 | 3300005844 | Ga0068862_100012814 | Ga0068862_1000128147 | 243 |
| 355 | 3300005844 | Ga0068862_100038425 | Ga0068862_1000384251 | 243 |
| 356 | 3300005844 | Ga0068862_100051534 | Ga0068862_1000515343 | 243 |
| 357 | 3300005844 | Ga0068862_100137218 | Ga0068862_1001372183 | 243 |
| 358 | 3300005844 | Ga0068862_100205237 | Ga0068862_1002052373 | 243 |
| 359 | 3300005844 | Ga0068862_100280175 | Ga0068862_1002801752 | 243 |
| 360 | 3300005844 | Ga0068862_100517777 | Ga0068862_1005177772 | 243 |
| 361 | 3300005937 | Ga0081455_10034132 | Ga0081455_100341323 | 243 |
| 362 | 3300005937 | Ga0081455_10156505 | Ga0081455_101565052 | 243 |
| 363 | 3300005937 | Ga0081455_10191329 | Ga0081455_101913292 | 243 |
| 364 | 3300006042 | Ga0075368_10005612 | Ga0075368_100056122 | 243 |
| 365 | 3300006051 | Ga0075364_10130065 | Ga0075364_101300652 | 243 |
| 366 | 3300006178 | Ga0075367_10211582 | Ga0075367_102115821 | 243 |
| 367 | 3300006195 | Ga0075366_10027111 | Ga0075366_100271112 | 243 |
| 368 | 3300006195 | Ga0075366_10129648 | Ga0075366_101296481 | 243 |
| 369 | 3300006237 | Ga0097621_100049978 | Ga0097621_1000499783 | 243 |
| 370 | 3300006237 | Ga0097621_100176404 | Ga0097621_1001764042 | 243 |
| 371 | 3300006353 | Ga0075370_10013601 | Ga0075370_100136012 | 243 |
| 372 | 3300006358 | Ga0068871_100043752 | Ga0068871_1000437522 | 243 |
| 373 | 3300006358 | Ga0068871_100095480 | Ga0068871_1000954801 | 243 |
| 374 | 3300006358 | Ga0068871_100203448 | Ga0068871_1002034483 | 243 |
| 375 | 3300006844 | Ga0075428_100004960 | Ga0075428_1000049602 | 243 |
| 376 | 3300006844 | Ga0075428_100009217 | Ga0075428_1000092174 | 243 |
| 377 | 3300006844 | Ga0075428_100014803 | Ga0075428_1000148033 | 243 |
| 378 | 3300006844 | Ga0075428_100074638 | Ga0075428_1000746384 | 243 |
| 379 | 3300006844 | Ga0075428_100152385 | Ga0075428_1001523854 | 243 |
| 380 | 3300006844 | Ga0075428_100314293 | Ga0075428_1003142931 | 243 |
| 381 | 3300006844 | Ga0075428_100477156 | Ga0075428_1004771562 | 243 |
| 382 | 3300006846 | Ga0075430_100002731 | Ga0075430_1000027316 | 243 |
| 383 | 3300006846 | Ga0075430_100003464 | Ga0075430_10000346411 | 243 |
| 384 | 3300006846 | Ga0075430_100027201 | Ga0075430_1000272012 | 243 |
| 385 | 3300006846 | Ga0075430_100029136 | Ga0075430_1000291362 | 243 |
| 386 | 3300006846 | Ga0075430_100029161 | Ga0075430_1000291613 | 243 |
| 387 | 3300006846 | Ga0075430_100097419 | Ga0075430_1000974192 | 243 |
| 388 | 3300006846 | Ga0075430_100165560 | Ga0075430_1001655601 | 243 |
| 389 | 3300006847 | Ga0075431_100004623 | Ga0075431_10000462311 | 243 |
| 390 | 3300006847 | Ga0075431_100007678 | Ga0075431_1000076786 | 243 |
| 391 | 3300006847 | Ga0075431_100014566 | Ga0075431_1000145666 | 243 |
| 392 | 3300006847 | Ga0075431_100040167 | Ga0075431_1000401672 | 243 |
| 393 | 3300006847 | Ga0075431_100091222 | Ga0075431_1000912223 | 243 |
| 394 | 3300006847 | Ga0075431_100134472 | Ga0075431_1001344722 | 243 |
| 395 | 3300006847 | Ga0075431_100210863 | Ga0075431_1002108632 | 243 |
| 396 | 3300006847 | Ga0075431_100365266 | Ga0075431_1003652662 | 243 |
| 397 | 3300006847 | Ga0075431_100379848 | Ga0075431_1003798481 | 243 |
| 398 | 3300006847 | Ga0075431_100514590 | Ga0075431_1005145901 | 243 |
| 399 | 3300006852 | Ga0075433_10003482 | Ga0075433_100034824 | 243 |
| 400 | 3300006852 | Ga0075433_10042323 | Ga0075433_100423232 | 243 |
| 401 | 3300006852 | Ga0075433_10098939 | Ga0075433_100989393 | 243 |
| 402 | 3300006852 | Ga0075433_10146676 | Ga0075433_101466763 | 243 |
| 403 | 3300006852 | Ga0075433_10162575 | Ga0075433_101625754 | 243 |
| 404 | 3300006852 | Ga0075433_10333096 | Ga0075433_103330961 | 243 |
| 405 | 3300006871 | Ga0075434_100000875 | Ga0075434_1000008757 | 243 |
| 406 | 3300006871 | Ga0075434_100030656 | Ga0075434_1000306564 | 243 |
| 407 | 3300006871 | Ga0075434_100082095 | Ga0075434_1000820954 | 243 |
| 408 | 3300006871 | Ga0075434_100120243 | Ga0075434_1001202432 | 243 |
| 409 | 3300006880 | Ga0075429_100003511 | Ga0075429_1000035113 | 243 |
| 410 | 3300006880 | Ga0075429_100010406 | Ga0075429_1000104063 | 243 |
| 411 | 3300006880 | Ga0075429_100061640 | Ga0075429_1000616402 | 243 |
| 412 | 3300006880 | Ga0075429_100072231 | Ga0075429_1000722313 | 243 |
| 413 | 3300006880 | Ga0075429_100104488 | Ga0075429_1001044882 | 243 |
| 414 | 3300006880 | Ga0075429_100109643 | Ga0075429_1001096432 | 243 |
| 415 | 3300006880 | Ga0075429_100212024 | Ga0075429_1002120242 | 243 |
| 416 | 3300006880 | Ga0075429_100219241 | Ga0075429_1002192412 | 243 |
| 417 | 3300006881 | Ga0068865_100004621 | Ga0068865_1000046218 | 243 |
| 418 | 3300006914 | Ga0075436_100027966 | Ga0075436_1000279663 | 243 |
| 419 | 3300006931 | Ga0097620_100005105 | Ga0097620_1000051052 | 243 |
| 420 | 3300006931 | Ga0097620_100009922 | Ga0097620_1000099229 | 243 |
| 421 | 3300006931 | Ga0097620_100060387 | Ga0097620_1000603874 | 243 |
| 422 | 3300006931 | Ga0097620_100079721 | Ga0097620_1000797213 | 243 |
| 423 | 3300006931 | Ga0097620_100237898 | Ga0097620_1002378982 | 243 |
| 424 | 3300007076 | Ga0075435_100004350 | Ga0075435_1000043504 | 243 |
| 425 | 3300007076 | Ga0075435_100192506 | Ga0075435_1001925062 | 243 |
| 426 | 3300009094 | Ga0111539_10005953 | Ga0111539_1000595311 | 243 |
| 427 | 3300009094 | Ga0111539_10007864 | Ga0111539_100078643 | 243 |
| 428 | 3300009094 | Ga0111539_10009385 | Ga0111539_100093855 | 243 |
| 429 | 3300009094 | Ga0111539_10034066 | Ga0111539_100340666 | 243 |
| 430 | 3300009094 | Ga0111539_10059762 | Ga0111539_100597622 | 243 |
| 431 | 3300009094 | Ga0111539_10074765 | Ga0111539_100747654 | 243 |
| 432 | 3300009094 | Ga0111539_10094768 | Ga0111539_100947684 | 243 |
| 433 | 3300009094 | Ga0111539_10126120 | Ga0111539_101261205 | 243 |
| 434 | 3300009094 | Ga0111539_10232020 | Ga0111539_102320201 | 243 |
| 435 | 3300009094 | Ga0111539_10243421 | Ga0111539_102434213 | 243 |
| 436 | 3300009098 | Ga0105245_10249724 | Ga0105245_102497241 | 243 |
| 437 | 3300009098 | Ga0105245_10721333 | Ga0105245_107213331 | 243 |
| 438 | 3300009101 | Ga0105247_10009735 | Ga0105247_100097353 | 243 |
| 439 | 3300009101 | Ga0105247_10285540 | Ga0105247_102855401 | 243 |
| 440 | 3300009147 | Ga0114129_10000022 | Ga0114129_100000229 | 243 |
| 441 | 3300009147 | Ga0114129_10003432 | Ga0114129_100034327 | 243 |
| 442 | 3300009147 | Ga0114129_10013890 | Ga0114129_100138909 | 243 |
| 443 | 3300009147 | Ga0114129_10017528 | Ga0114129_1001752812 | 243 |
| 444 | 3300009147 | Ga0114129_10028685 | Ga0114129_100286853 | 243 |
| 445 | 3300009147 | Ga0114129_10046369 | Ga0114129_100463691 | 243 |
| 446 | 3300009147 | Ga0114129_10057192 | Ga0114129_100571922 | 243 |
| 447 | 3300009147 | Ga0114129_10067969 | Ga0114129_100679692 | 243 |
| 448 | 3300009147 | Ga0114129_10074127 | Ga0114129_100741274 | 243 |
| 449 | 3300009147 | Ga0114129_10093312 | Ga0114129_100933126 | 243 |
| 450 | 3300009147 | Ga0114129_10188764 | Ga0114129_101887642 | 243 |
| 451 | 3300009147 | Ga0114129_10228245 | Ga0114129_102282452 | 243 |
| 452 | 3300009147 | Ga0114129_10422479 | Ga0114129_104224792 | 243 |
| 453 | 3300009147 | Ga0114129_10428859 | Ga0114129_104288592 | 243 |
| 454 | 3300009147 | Ga0114129_10665167 | Ga0114129_106651671 | 243 |
| 455 | 3300009147 | Ga0114129_10696160 | Ga0114129_106961601 | 243 |
| 456 | 3300009147 | Ga0114129_10701113 | Ga0114129_107011132 | 243 |
| 457 | 3300009177 | Ga0105248_10011617 | Ga0105248_100116178 | 243 |
| 458 | 3300009177 | Ga0105248_10011763 | Ga0105248_100117635 | 243 |
| 459 | 3300009177 | Ga0105248_10026048 | Ga0105248_100260485 | 243 |
| 460 | 3300009177 | Ga0105248_10051068 | Ga0105248_100510682 | 243 |
| 461 | 3300009177 | Ga0105248_10083496 | Ga0105248_100834963 | 243 |
| 462 | 3300009177 | Ga0105248_10130990 | Ga0105248_101309903 | 243 |
| 463 | 3300009177 | Ga0105248_10264336 | Ga0105248_102643362 | 243 |
| 464 | 3300009177 | Ga0105248_10544546 | Ga0105248_105445462 | 243 |
| 465 | 3300009177 | Ga0105248_10712024 | Ga0105248_107120241 | 243 |
| 466 | 3300009177 | Ga0105248_10775390 | Ga0105248_107753901 | 243 |
| 467 | 3300009553 | Ga0105249_10002178 | Ga0105249_100021789 | 243 |
| 468 | 3300009553 | Ga0105249_10033902 | Ga0105249_100339023 | 243 |
| 469 | 3300009553 | Ga0105249_10194900 | Ga0105249_101949002 | 243 |
| 470 | 3300009553 | Ga0105249_10328074 | Ga0105249_103280742 | 243 |
| 471 | 3300009553 | Ga0105249_10460113 | Ga0105249_104601132 | 243 |
| 472 | 3300010375 | Ga0105239_10055042 | Ga0105239_100550424 | 243 |
| 473 | 3300011119 | Ga0105246_10151349 | Ga0105246_101513492 | 243 |
| 474 | 3300011119 | Ga0105246_10170480 | Ga0105246_101704802 | 243 |
| 475 | 3300013296 | Ga0157374_10014200 | Ga0157374_100142003 | 243 |
| 476 | 3300013306 | Ga0163162_10057350 | Ga0163162_100573504 | 243 |
| 477 | 3300013307 | Ga0157372_10744242 | Ga0157372_107442422 | 243 |
| 478 | 3300013308 | Ga0157375_10004391 | Ga0157375_1000439110 | 243 |
| 479 | 3300013308 | Ga0157375_10215352 | Ga0157375_102153523 | 243 |
| 480 | 3300013308 | Ga0157375_10459444 | Ga0157375_104594441 | 243 |
| 481 | 3300013308 | Ga0157375_10704525 | Ga0157375_107045252 | 243 |
| 482 | 3300014325 | Ga0163163_10040189 | Ga0163163_100401892 | 243 |
| 483 | 3300014325 | Ga0163163_10153205 | Ga0163163_101532053 | 243 |
| 484 | 3300014326 | Ga0157380_10012655 | Ga0157380_100126554 | 243 |
| 485 | 3300014326 | Ga0157380_10053866 | Ga0157380_100538663 | 243 |
| 486 | 3300014326 | Ga0157380_10124633 | Ga0157380_101246332 | 243 |
| 487 | 3300014326 | Ga0157380_10129036 | Ga0157380_101290362 | 243 |
| 488 | 3300014326 | Ga0157380_10158026 | Ga0157380_101580261 | 243 |
| 489 | 3300014326 | Ga0157380_10210677 | Ga0157380_102106771 | 243 |
| 490 | 3300014326 | Ga0157380_10265621 | Ga0157380_102656212 | 243 |
| 491 | 3300014745 | Ga0157377_10008902 | Ga0157377_100089022 | 243 |
| 492 | 3300014745 | Ga0157377_10031373 | Ga0157377_100313732 | 243 |
| 493 | 3300014968 | Ga0157379_10016566 | Ga0157379_100165663 | 243 |
| 494 | 3300014968 | Ga0157379_10017284 | Ga0157379_100172843 | 243 |
| 495 | 3300014968 | Ga0157379_10073242 | Ga0157379_100732422 | 243 |
| 496 | 3300014969 | Ga0157376_10028990 | Ga0157376_100289905 | 243 |
| 497 | 3300017792 | Ga0163161_10087470 | Ga0163161_100874702 | 243 |
| 498 | 3300017792 | Ga0163161_10116583 | Ga0163161_101165832 | 243 |
| 499 | 3300020070 | Ga0206356_10432168 | Ga0206356_104321681 | 243 |
| 500 | 3300022467 | Ga0224712_10197880 | Ga0224712_101978801 | 243 |
| 501 | 3300025315 | Ga0207697_10001648 | Ga0207697_100016489 | 243 |
| 502 | 3300025315 | Ga0207697_10010073 | Ga0207697_100100734 | 243 |
| 503 | 3300025315 | Ga0207697_10015174 | Ga0207697_100151744 | 243 |
| 504 | 3300025315 | Ga0207697_10093832 | Ga0207697_100938321 | 243 |
| 505 | 3300025893 | Ga0207682_10008517 | Ga0207682_100085172 | 243 |
| 506 | 3300025893 | Ga0207682_10021451 | Ga0207682_100214513 | 243 |
| 507 | 3300025899 | Ga0207642_10154808 | Ga0207642_101548082 | 243 |
| 508 | 3300025900 | Ga0207710_10006846 | Ga0207710_100068463 | 243 |
| 509 | 3300025901 | Ga0207688_10013358 | Ga0207688_100133585 | 243 |
| 510 | 3300025901 | Ga0207688_10058421 | Ga0207688_100584212 | 243 |
| 511 | 3300025903 | Ga0207680_10021614 | Ga0207680_100216143 | 243 |
| 512 | 3300025903 | Ga0207680_10025785 | Ga0207680_100257853 | 243 |
| 513 | 3300025903 | Ga0207680_10118406 | Ga0207680_101184063 | 243 |
| 514 | 3300025903 | Ga0207680_10196220 | Ga0207680_101962202 | 243 |
| 515 | 3300025904 | Ga0207647_10136441 | Ga0207647_101364412 | 243 |
| 516 | 3300025907 | Ga0207645_10003388 | Ga0207645_100033888 | 243 |
| 517 | 3300025907 | Ga0207645_10040789 | Ga0207645_100407894 | 243 |
| 518 | 3300025907 | Ga0207645_10137629 | Ga0207645_101376291 | 243 |
| 519 | 3300025908 | Ga0207643_10002413 | Ga0207643_1000241310 | 243 |
| 520 | 3300025910 | Ga0207684_10178354 | Ga0207684_101783542 | 243 |
| 521 | 3300025912 | Ga0207707_10041639 | Ga0207707_100416393 | 243 |
| 522 | 3300025918 | Ga0207662_10011372 | Ga0207662_100113724 | 243 |
| 523 | 3300025918 | Ga0207662_10022232 | Ga0207662_100222322 | 243 |
| 524 | 3300025918 | Ga0207662_10215739 | Ga0207662_102157392 | 243 |
| 525 | 3300025919 | Ga0207657_10216614 | Ga0207657_102166142 | 243 |
| 526 | 3300025920 | Ga0207649_10004162 | Ga0207649_100041622 | 243 |
| 527 | 3300025921 | Ga0207652_10276834 | Ga0207652_102768342 | 243 |
| 528 | 3300025923 | Ga0207681_10009018 | Ga0207681_100090182 | 243 |
| 529 | 3300025923 | Ga0207681_10024466 | Ga0207681_100244662 | 243 |
| 530 | 3300025923 | Ga0207681_10041155 | Ga0207681_100411551 | 243 |
| 531 | 3300025923 | Ga0207681_10041333 | Ga0207681_100413332 | 243 |
| 532 | 3300025923 | Ga0207681_10105521 | Ga0207681_101055212 | 243 |
| 533 | 3300025925 | Ga0207650_10009691 | Ga0207650_100096916 | 243 |
| 534 | 3300025925 | Ga0207650_10025629 | Ga0207650_100256293 | 243 |
| 535 | 3300025925 | Ga0207650_10085355 | Ga0207650_100853552 | 243 |
| 536 | 3300025925 | Ga0207650_10120578 | Ga0207650_101205783 | 243 |
| 537 | 3300025925 | Ga0207650_10149901 | Ga0207650_101499012 | 243 |
| 538 | 3300025925 | Ga0207650_10207765 | Ga0207650_102077652 | 243 |
| 539 | 3300025926 | Ga0207659_10057797 | Ga0207659_100577971 | 243 |
| 540 | 3300025926 | Ga0207659_10255952 | Ga0207659_102559521 | 243 |
| 541 | 3300025926 | Ga0207659_10296426 | Ga0207659_102964262 | 243 |
| 542 | 3300025931 | Ga0207644_10030834 | Ga0207644_100308342 | 243 |
| 543 | 3300025931 | Ga0207644_10163895 | Ga0207644_101638951 | 243 |
| 544 | 3300025931 | Ga0207644_10180956 | Ga0207644_101809561 | 243 |
| 545 | 3300025932 | Ga0207690_10373539 | Ga0207690_103735391 | 243 |
| 546 | 3300025933 | Ga0207706_10006664 | Ga0207706_100066645 | 243 |
| 547 | 3300025933 | Ga0207706_10057575 | Ga0207706_100575751 | 243 |
| 548 | 3300025933 | Ga0207706_10084872 | Ga0207706_100848722 | 243 |
| 549 | 3300025933 | Ga0207706_10229777 | Ga0207706_102297772 | 243 |
| 550 | 3300025933 | Ga0207706_10428455 | Ga0207706_104284552 | 243 |
| 551 | 3300025934 | Ga0207686_10033165 | Ga0207686_100331654 | 243 |
| 552 | 3300025936 | Ga0207670_10009343 | Ga0207670_100093434 | 243 |
| 553 | 3300025936 | Ga0207670_10021772 | Ga0207670_100217722 | 243 |
| 554 | 3300025936 | Ga0207670_10110882 | Ga0207670_101108821 | 243 |
| 555 | 3300025936 | Ga0207670_10149820 | Ga0207670_101498202 | 243 |
| 556 | 3300025937 | Ga0207669_10004070 | Ga0207669_100040708 | 243 |
| 557 | 3300025937 | Ga0207669_10128460 | Ga0207669_101284603 | 243 |
| 558 | 3300025937 | Ga0207669_10230104 | Ga0207669_102301042 | 243 |
| 559 | 3300025938 | Ga0207704_10039222 | Ga0207704_100392223 | 243 |
| 560 | 3300025938 | Ga0207704_10044350 | Ga0207704_100443503 | 243 |
| 561 | 3300025938 | Ga0207704_10106645 | Ga0207704_101066451 | 243 |
| 562 | 3300025940 | Ga0207691_10005619 | Ga0207691_1000561910 | 243 |
| 563 | 3300025940 | Ga0207691_10027372 | Ga0207691_100273724 | 243 |
| 564 | 3300025940 | Ga0207691_10043702 | Ga0207691_100437023 | 243 |
| 565 | 3300025940 | Ga0207691_10090897 | Ga0207691_100908972 | 243 |
| 566 | 3300025940 | Ga0207691_10099066 | Ga0207691_100990662 | 243 |
| 567 | 3300025940 | Ga0207691_10307917 | Ga0207691_103079172 | 243 |
| 568 | 3300025941 | Ga0207711_10027516 | Ga0207711_100275165 | 243 |
| 569 | 3300025941 | Ga0207711_10052589 | Ga0207711_100525892 | 243 |
| 570 | 3300025941 | Ga0207711_10074932 | Ga0207711_100749322 | 243 |
| 571 | 3300025941 | Ga0207711_10084800 | Ga0207711_100848001 | 243 |
| 572 | 3300025942 | Ga0207689_10003959 | Ga0207689_1000395911 | 243 |
| 573 | 3300025942 | Ga0207689_10032589 | Ga0207689_100325895 | 243 |
| 574 | 3300025942 | Ga0207689_10057367 | Ga0207689_100573675 | 243 |
| 575 | 3300025942 | Ga0207689_10095679 | Ga0207689_100956793 | 243 |
| 576 | 3300025944 | Ga0207661_10002490 | Ga0207661_100024902 | 243 |
| 577 | 3300025945 | Ga0207679_10004135 | Ga0207679_100041352 | 243 |
| 578 | 3300025945 | Ga0207679_10027193 | Ga0207679_100271934 | 243 |
| 579 | 3300025945 | Ga0207679_10040304 | Ga0207679_100403043 | 243 |
| 580 | 3300025945 | Ga0207679_10511831 | Ga0207679_105118311 | 243 |
| 581 | 3300025945 | Ga0207679_10515363 | Ga0207679_105153631 | 243 |
| 582 | 3300025960 | Ga0207651_10010174 | Ga0207651_100101743 | 243 |
| 583 | 3300025960 | Ga0207651_10013855 | Ga0207651_100138555 | 243 |
| 584 | 3300025960 | Ga0207651_10032756 | Ga0207651_100327564 | 243 |
| 585 | 3300025960 | Ga0207651_10077103 | Ga0207651_100771031 | 243 |
| 586 | 3300025960 | Ga0207651_10091539 | Ga0207651_100915391 | 243 |
| 587 | 3300025960 | Ga0207651_10419135 | Ga0207651_104191351 | 243 |
| 588 | 3300025961 | Ga0207712_10022462 | Ga0207712_100224622 | 243 |
| 589 | 3300025961 | Ga0207712_10041146 | Ga0207712_100411461 | 243 |
| 590 | 3300025961 | Ga0207712_10617526 | Ga0207712_106175261 | 243 |
| 591 | 3300025972 | Ga0207668_10040164 | Ga0207668_100401642 | 243 |
| 592 | 3300025986 | Ga0207658_10373534 | Ga0207658_103735342 | 243 |
| 593 | 3300026023 | Ga0207677_10040009 | Ga0207677_100400094 | 243 |
| 594 | 3300026023 | Ga0207677_10628803 | Ga0207677_106288031 | 243 |
| 595 | 3300026035 | Ga0207703_10070905 | Ga0207703_100709052 | 243 |
| 596 | 3300026035 | Ga0207703_10329503 | Ga0207703_103295031 | 243 |
| 597 | 3300026035 | Ga0207703_10480732 | Ga0207703_104807321 | 243 |
| 598 | 3300026067 | Ga0207678_10008867 | Ga0207678_100088673 | 243 |
| 599 | 3300026075 | Ga0207708_10006488 | Ga0207708_100064888 | 243 |
| 600 | 3300026075 | Ga0207708_10025427 | Ga0207708_100254274 | 243 |
| 601 | 3300026075 | Ga0207708_10034925 | Ga0207708_100349252 | 243 |
| 602 | 3300026075 | Ga0207708_10036468 | Ga0207708_100364684 | 243 |
| 603 | 3300026075 | Ga0207708_10193915 | Ga0207708_101939152 | 243 |
| 604 | 3300026088 | Ga0207641_10000259 | Ga0207641_1000025932 | 243 |
| 605 | 3300026088 | Ga0207641_10051564 | Ga0207641_100515643 | 243 |
| 606 | 3300026088 | Ga0207641_10058303 | Ga0207641_100583033 | 243 |
| 607 | 3300026088 | Ga0207641_10070828 | Ga0207641_100708283 | 243 |
| 608 | 3300026089 | Ga0207648_10000246 | Ga0207648_1000024631 | 243 |
| 609 | 3300026089 | Ga0207648_10017826 | Ga0207648_100178263 | 243 |
| 610 | 3300026089 | Ga0207648_10165985 | Ga0207648_101659853 | 243 |
| 611 | 3300026089 | Ga0207648_10229136 | Ga0207648_102291362 | 243 |
| 612 | 3300026095 | Ga0207676_10010909 | Ga0207676_100109095 | 243 |
| 613 | 3300026095 | Ga0207676_10434658 | Ga0207676_104346582 | 243 |
| 614 | 3300026116 | Ga0207674_10030346 | Ga0207674_100303463 | 243 |
| 615 | 3300026116 | Ga0207674_10093971 | Ga0207674_100939715 | 243 |
| 616 | 3300026116 | Ga0207674_10252094 | Ga0207674_102520943 | 243 |
| 617 | 3300026116 | Ga0207674_10536165 | Ga0207674_105361651 | 243 |
| 618 | 3300026118 | Ga0207675_100001075 | Ga0207675_10000107510 | 243 |
| 619 | 3300026118 | Ga0207675_100027442 | Ga0207675_1000274424 | 243 |
| 620 | 3300026118 | Ga0207675_100082957 | Ga0207675_1000829574 | 243 |
| 621 | 3300026118 | Ga0207675_100132571 | Ga0207675_1001325711 | 243 |
| 622 | 3300026118 | Ga0207675_100194483 | Ga0207675_1001944831 | 243 |
| 623 | 3300026118 | Ga0207675_100241277 | Ga0207675_1002412772 | 243 |
| 624 | 3300026121 | Ga0207683_10003979 | Ga0207683_1000397910 | 243 |
| 625 | 3300026121 | Ga0207683_10006075 | Ga0207683_100060756 | 243 |
| 626 | 3300026121 | Ga0207683_10027139 | Ga0207683_100271393 | 243 |
| 627 | 3300026142 | Ga0207698_10040220 | Ga0207698_100402204 | 243 |
| 628 | 3300026142 | Ga0207698_10535965 | Ga0207698_105359651 | 243 |
| 629 | 3300027462 | Ga0210000_1017153 | Ga0210000_10171532 | 243 |
| 630 | 3300027866 | Ga0209813_10019325 | Ga0209813_100193251 | 243 |
| 631 | 3300027876 | Ga0209974_10015823 | Ga0209974_100158233 | 243 |
| 632 | 3300027907 | Ga0207428_10003486 | Ga0207428_1000348612 | 243 |
| 633 | 3300027907 | Ga0207428_10005664 | Ga0207428_100056644 | 243 |
| 634 | 3300027907 | Ga0207428_10009483 | Ga0207428_1000948310 | 243 |
| 635 | 3300027907 | Ga0207428_10039646 | Ga0207428_100396463 | 243 |
| 636 | 3300027907 | Ga0207428_10092849 | Ga0207428_100928491 | 243 |
| 637 | 3300027907 | Ga0207428_10276750 | Ga0207428_102767501 | 243 |
| 638 | 3300028379 | Ga0268266_10696669 | Ga0268266_106966692 | 243 |
| 639 | 3300028380 | Ga0268265_10001488 | Ga0268265_100014887 | 243 |
| 640 | 3300028380 | Ga0268265_10079108 | Ga0268265_100791082 | 243 |
| 641 | 3300028380 | Ga0268265_10079933 | Ga0268265_100799332 | 243 |
| 642 | 3300028380 | Ga0268265_10115558 | Ga0268265_101155582 | 243 |
| 643 | 3300028380 | Ga0268265_10267468 | Ga0268265_102674681 | 243 |
| 644 | 3300028380 | Ga0268265_10513505 | Ga0268265_105135051 | 243 |
| 645 | 3300028381 | Ga0268264_10043169 | Ga0268264_100431692 | 243 |
| 646 | 3300031548 | Ga0307408_100008140 | Ga0307408_1000081403 | 243 |
| 647 | 3300031548 | Ga0307408_100025388 | Ga0307408_1000253882 | 243 |
| 648 | 3300031548 | Ga0307408_100057087 | Ga0307408_1000570873 | 243 |
| 649 | 3300031731 | Ga0307405_10018703 | Ga0307405_100187036 | 243 |
| 650 | 3300031731 | Ga0307405_10019998 | Ga0307405_100199983 | 243 |
| 651 | 3300031731 | Ga0307405_10296649 | Ga0307405_102966492 | 243 |
| 652 | 3300031731 | Ga0307405_10613795 | Ga0307405_106137951 | 243 |
| 653 | 3300031824 | Ga0307413_10012181 | Ga0307413_100121812 | 243 |
| 654 | 3300031852 | Ga0307410_10041729 | Ga0307410_100417292 | 243 |
| 655 | 3300031852 | Ga0307410_10424445 | Ga0307410_104244451 | 243 |
| 656 | 3300031852 | Ga0307410_10518800 | Ga0307410_105188001 | 243 |
| 657 | 3300031901 | Ga0307406_10146209 | Ga0307406_101462092 | 243 |
| 658 | 3300031903 | Ga0307407_10010767 | Ga0307407_100107673 | 243 |
| 659 | 3300031903 | Ga0307407_10012301 | Ga0307407_100123012 | 243 |
| 660 | 3300031911 | Ga0307412_10018836 | Ga0307412_100188362 | 243 |
| 661 | 3300031911 | Ga0307412_10333543 | Ga0307412_103335431 | 243 |
| 662 | 3300031911 | Ga0307412_10336223 | Ga0307412_103362231 | 243 |
| 663 | 3300031995 | Ga0307409_100022631 | Ga0307409_1000226312 | 243 |
| 664 | 3300031995 | Ga0307409_100065980 | Ga0307409_1000659801 | 243 |
| 665 | 3300031995 | Ga0307409_100289646 | Ga0307409_1002896461 | 243 |
| 666 | 3300032002 | Ga0307416_100021724 | Ga0307416_1000217246 | 243 |
| 667 | 3300032002 | Ga0307416_100029729 | Ga0307416_1000297291 | 243 |
| 668 | 3300032002 | Ga0307416_100055276 | Ga0307416_1000552763 | 243 |
| 669 | 3300032002 | Ga0307416_100374730 | Ga0307416_1003747302 | 243 |
| 670 | 3300032004 | Ga0307414_10038982 | Ga0307414_100389822 | 243 |
| 671 | 3300032004 | Ga0307414_10123129 | Ga0307414_101231292 | 243 |
| 672 | 3300032004 | Ga0307414_10480891 | Ga0307414_104808911 | 243 |
| 673 | 3300032005 | Ga0307411_10031137 | Ga0307411_100311372 | 243 |
| 674 | 3300032005 | Ga0307411_10034924 | Ga0307411_100349242 | 243 |
| 675 | 3300032005 | Ga0307411_10041035 | Ga0307411_100410353 | 243 |
| 676 | 3300032005 | Ga0307411_10068882 | Ga0307411_100688821 | 243 |
| 677 | 3300032126 | Ga0307415_100008598 | Ga0307415_1000085983 | 243 |
| 678 | 3300032126 | Ga0307415_100011264 | Ga0307415_1000112648 | 243 |
| 679 | 3300032126 | Ga0307415_100278900 | Ga0307415_1002789002 | 243 |
| 680 | 3300035121 | Ga0373960_0017586 | Ga0373960_0017586_115_900 | 243 |
| 681 | 3300035172 | Ga0373955_0343741 | Ga0373955_0343741_54_839 | 243 |
| 682 | 3300035242 | Ga0373962_0061062 | Ga0373962_0061062_314_1045 | 243 |
| 683 | 3300035691 | Ga0373931_0171100 | Ga0373931_0171100_38_820 | 243 |
| 684 | 3300036401 | Ga0373937_0051107 | Ga0373937_0051107_1813_2598 | 243 |
| 685 | 3300037068 | Ga0373925_0746146 | Ga0373925_0746146_39_770 | 243 |
| 686 | 3300041999 | Ga0439433_0031053 | Ga0439433_0031053_41_826 | 243 |
| 687 | 3300042009 | Ga0439451_035945 | Ga0439451_035945_39_824 | 243 |
| 688 | 3300042436 | Ga0439435_0003900 | Ga0439435_0003900_384_1169 | 243 |
| 689 | 3300042436 | Ga0439435_0013465 | Ga0439435_0013465_1136_1921 | 243 |
| 690 | 3300042436 | Ga0439435_0051849 | Ga0439435_0051849_230_1015 | 243 |
| 691 | 3300042436 | Ga0439435_0065028 | Ga0439435_0065028_292_1023 | 243 |
| 692 | 3300042461 | Ga0439460_0009321 | Ga0439460_0009321_775_1560 | 243 |
| 693 | 3300042461 | Ga0439460_0057246 | Ga0439460_0057246_27_812 | 243 |
| 694 | 3300042876 | Ga0451577_0076842 | Ga0451577_0076842_2043_2828 | 243 |
| 695 | 3300044712 | Ga0453684_0786377 | Ga0453684_0786377_171_956 | 243 |
| 696 | 3300045051 | Ga0451576_0043858 | Ga0451576_0043858_3234_4106 | 243 |
| 697 | 3300045051 | Ga0451576_0048477 | Ga0451576_0048477_191_925 | 243 |
| 698 | 3300045051 | Ga0451576_0146119 | Ga0451576_0146119_181_966 | 243 |
| 699 | 3300046455 | Ga0495603_0269556 | Ga0495603_0269556_137_919 | 243 |
| 700 | 3300046537 | Ga0495598_0008216 | Ga0495598_0008216_123_908 | 243 |
| 701 | 3300047319 | Ga0495674_0101914 | Ga0495674_0101914_1179_1916 | 243 |
| 702 | 3300048905 | Ga0496102_0137055 | Ga0496102_0137055_470_1288 | 243 |
| 703 | 3300048906 | Ga0496103_0366014 | Ga0496103_0366014_128_910 | 243 |
| 704 | 3300048907 | Ga0496104_0005034 | Ga0496104_0005034_7289_8020 | 243 |
| 705 | 3300048907 | Ga0496104_0033034 | Ga0496104_0033034_3264_4082 | 243 |
| 706 | 3300048907 | Ga0496104_0264633 | Ga0496104_0264633_647_1438 | 243 |
| 707 | 3300048907 | Ga0496104_0559162 | Ga0496104_0559162_15_749 | 243 |
| 708 | 3300048908 | Ga0496105_0090782 | Ga0496105_0090782_1581_2372 | 243 |
| 709 | 3300048909 | Ga0496106_0035091 | Ga0496106_0035091_2674_3492 | 243 |
| 710 | 3300048911 | Ga0496108_0018786 | Ga0496108_0018786_3458_4276 | 243 |
| 711 | 3300048911 | Ga0496108_0827344 | Ga0496108_0827344_30_767 | 243 |
| 712 | 3300048912 | Ga0496109_0001054 | Ga0496109_0001054_11892_12623 | 243 |
| 713 | 3300048912 | Ga0496109_0034897 | Ga0496109_0034897_1017_1835 | 243 |
| 714 | 3300048912 | Ga0496109_0252495 | Ga0496109_0252495_309_1043 | 243 |
| 715 | 3300048912 | Ga0496109_0542849 | Ga0496109_0542849_135_923 | 243 |
| 716 | 3300048913 | Ga0496110_0002072 | Ga0496110_0002072_2696_3427 | 243 |
| 717 | 3300048913 | Ga0496110_0003883 | Ga0496110_0003883_1230_2048 | 243 |
| 718 | 3300048914 | Ga0496111_0064665 | Ga0496111_0064665_1036_1854 | 243 |
| 719 | 3300048914 | Ga0496111_0321780 | Ga0496111_0321780_114_845 | 243 |
| 720 | 3300048915 | Ga0496112_0003061 | Ga0496112_0003061_5526_6257 | 243 |
| 721 | 3300048915 | Ga0496112_0005221 | Ga0496112_0005221_473_1291 | 243 |
| 722 | 3300048916 | Ga0496113_0074500 | Ga0496113_0074500_854_1585 | 243 |
| 723 | 3300048916 | Ga0496113_0094299 | Ga0496113_0094299_1103_1921 | 243 |
| 724 | 3300048917 | Ga0496114_0465612 | Ga0496114_0465612_311_1042 | 243 |
| 725 | 3300049569 | Ga0501032_0278000 | Ga0501032_0278000_231_1016 | 243 |
| 726 | 3300049569 | Ga0501032_0293391 | Ga0501032_0293391_54_839 | 243 |
| 727 | 3300049571 | Ga0501034_0039253 | Ga0501034_0039253_4037_4768 | 243 |
| 728 | 3300049572 | Ga0501036_0156950 | Ga0501036_0156950_143_928 | 243 |
| 729 | 3300049572 | Ga0501036_0218330 | Ga0501036_0218330_172_957 | 243 |
| 730 | 3300049572 | Ga0501036_0279380 | Ga0501036_0279380_76_861 | 243 |
| 731 | 3300049572 | Ga0501036_0351264 | Ga0501036_0351264_128_913 | 243 |
| 732 | 3300049574 | Ga0501038_0157232 | Ga0501038_0157232_917_1702 | 243 |
| 733 | 3300049574 | Ga0501038_0424801 | Ga0501038_0424801_185_970 | 243 |
| 734 | 3300049576 | Ga0501040_0020560 | Ga0501040_0020560_19_804 | 243 |
| 735 | 3300049576 | Ga0501040_0155555 | Ga0501040_0155555_149_934 | 243 |
| 736 | 3300049577 | Ga0501041_0010636 | Ga0501041_0010636_342_1127 | 243 |
| 737 | 3300049577 | Ga0501041_0011231 | Ga0501041_0011231_3531_4316 | 243 |
| 738 | 3300049577 | Ga0501041_0162503 | Ga0501041_0162503_371_1156 | 243 |
| 739 | 3300049577 | Ga0501041_0289185 | Ga0501041_0289185_104_889 | 243 |
| 740 | 3300049578 | Ga0501042_0063830 | Ga0501042_0063830_280_1065 | 243 |
| 741 | 3300049578 | Ga0501042_0085180 | Ga0501042_0085180_1273_2058 | 243 |
| 742 | 3300049578 | Ga0501042_0195223 | Ga0501042_0195223_321_1106 | 243 |
| 743 | 3300049579 | Ga0501043_0106457 | Ga0501043_0106457_967_1749 | 243 |
| 744 | 3300049579 | Ga0501043_0343542 | Ga0501043_0343542_325_1110 | 243 |
| 745 | 3300049580 | Ga0501046_0035947 | Ga0501046_0035947_3007_3792 | 243 |
| 746 | 3300049581 | Ga0501047_0052331 | Ga0501047_0052331_1323_2105 | 243 |
| 747 | 3300049582 | Ga0501048_0033566 | Ga0501048_0033566_2217_3002 | 243 |
| 748 | 3300049582 | Ga0501048_0224436 | Ga0501048_0224436_236_1021 | 243 |
| 749 | 3300049584 | Ga0501068_0332508 | Ga0501068_0332508_114_899 | 243 |
| 750 | 3300049587 | Ga0501071_0013769 | Ga0501071_0013769_2825_3610 | 243 |
| 751 | 3300049587 | Ga0501071_0107076 | Ga0501071_0107076_517_1302 | 243 |
| 752 | 3300049587 | Ga0501071_0119398 | Ga0501071_0119398_852_1637 | 243 |
| 753 | 3300049587 | Ga0501071_0191228 | Ga0501071_0191228_67_852 | 243 |
| 754 | 3300049588 | Ga0501072_0032275 | Ga0501072_0032275_115_900 | 243 |
| 755 | 3300049588 | Ga0501072_0042098 | Ga0501072_0042098_282_1067 | 243 |
| 756 | 3300049588 | Ga0501072_0091050 | Ga0501072_0091050_1419_2204 | 243 |
| 757 | 3300049588 | Ga0501072_0103309 | Ga0501072_0103309_159_944 | 243 |
| 758 | 3300049588 | Ga0501072_0335317 | Ga0501072_0335317_299_1084 | 243 |
| 759 | 3300049590 | Ga0501074_0105851 | Ga0501074_0105851_105_890 | 243 |
| 760 | 3300049590 | Ga0501074_0270389 | Ga0501074_0270389_67_852 | 243 |
| 761 | 3300049591 | Ga0501075_0019019 | Ga0501075_0019019_459_1244 | 243 |
| 762 | 3300049591 | Ga0501075_0081685 | Ga0501075_0081685_953_1738 | 243 |
| 763 | 3300049591 | Ga0501075_0163142 | Ga0501075_0163142_23_808 | 243 |
| 764 | 3300049591 | Ga0501075_0427074 | Ga0501075_0427074_209_994 | 243 |
| 765 | 3300049591 | Ga0501075_0488749 | Ga0501075_0488749_86_874 | 243 |
| 766 | 3300049592 | Ga0501076_0005097 | Ga0501076_0005097_8445_9230 | 243 |
| 767 | 3300049592 | Ga0501076_0047976 | Ga0501076_0047976_1196_1981 | 243 |
| 768 | 3300049592 | Ga0501076_0130401 | Ga0501076_0130401_1141_1926 | 243 |
| 769 | 3300049592 | Ga0501076_0288425 | Ga0501076_0288425_19_753 | 243 |
| 770 | 3300049593 | Ga0501077_0393637 | Ga0501077_0393637_50_835 | 243 |
| 771 | 3300049661 | Ga0501217_079764 | Ga0501217_079764_16_798 | 243 |
| 772 | 3300049708 | Ga0501245_011486 | Ga0501245_011486_351_1133 | 243 |
| 773 | 3300049741 | Ga0501079_0052049 | Ga0501079_0052049_2202_2987 | 243 |
| 774 | 3300049741 | Ga0501079_0202364 | Ga0501079_0202364_753_1538 | 243 |
| 775 | 3300049741 | Ga0501079_0211818 | Ga0501079_0211818_174_908 | 243 |
| 776 | 3300049742 | Ga0501080_0212064 | Ga0501080_0212064_340_1125 | 243 |
| 777 | 3300049742 | Ga0501080_0432865 | Ga0501080_0432865_272_1057 | 243 |
| 778 | 3300049743 | Ga0501081_0209315 | Ga0501081_0209315_333_1118 | 243 |
| 779 | 3300049743 | Ga0501081_0331772 | Ga0501081_0331772_202_987 | 243 |
| 780 | 3300049779 | Ga0501283_025443 | Ga0501283_025443_93_875 | 243 |
| 781 | 3300049823 | Ga0501044_0027646 | Ga0501044_0027646_3489_4271 | 243 |
| 782 | 3300049824 | Ga0501045_0020019 | Ga0501045_0020019_359_1144 | 243 |
| 783 | 3300049824 | Ga0501045_0024508 | Ga0501045_0024508_2605_3390 | 243 |
| 784 | 3300049824 | Ga0501045_0031413 | Ga0501045_0031413_203_988 | 243 |
| 785 | 3300049824 | Ga0501045_0061736 | Ga0501045_0061736_1938_2723 | 243 |
| 786 | 3300050489 | nmdc:mga03683_12926_c1 | nmdc:mga03683_12926_c1_1296_2027 | 243 |
| 787 | 3300050490 | nmdc:mga03n38_133976_c1 | nmdc:mga03n38_133976_c1_450_1184 | 243 |
| 788 | 3300050491 | nmdc:mga00v17_19639_c1 | nmdc:mga00v17_19639_c1_1514_2245 | 243 |
| 789 | 3300050492 | nmdc:mga0yw44_156896_c1 | nmdc:mga0yw44_156896_c1_251_1033 | 243 |
| 790 | 3300050492 | nmdc:mga0yw44_30218_c1 | nmdc:mga0yw44_30218_c1_1105_1839 | 243 |
| 791 | 3300050493 | nmdc:mga0k408_320004_c1 | nmdc:mga0k408_320004_c1_173_904 | 243 |
| 792 | 3300050493 | nmdc:mga0k408_76872_c1 | nmdc:mga0k408_76872_c1_1078_1809 | 243 |
| 793 | 3300050494 | nmdc:mga06z11_246932_c1 | nmdc:mga06z11_246932_c1_95_826 | 243 |
| 794 | 3300050494 | nmdc:mga06z11_32907_c1 | nmdc:mga06z11_32907_c1_12_746 | 243 |
| 795 | 3300050495 | nmdc:mga04h51_20370_c1 | nmdc:mga04h51_20370_c1_1093_1827 | 243 |
| 796 | 3300050496 | nmdc:mga07m45_49442_c1 | nmdc:mga07m45_49442_c1_558_1292 | 243 |
| 797 | 3300050507 | nmdc:mga05p37_107342_c1 | nmdc:mga05p37_107342_c1_2474_3259 | 243 |
| 798 | 3300050507 | nmdc:mga05p37_1074_c1 | nmdc:mga05p37_1074_c1_2218_3003 | 243 |
| 799 | 3300050507 | nmdc:mga05p37_170381_c1 | nmdc:mga05p37_170381_c1_1743_2528 | 243 |
| 800 | 3300050507 | nmdc:mga05p37_191001_c1 | nmdc:mga05p37_191001_c1_877_1662 | 243 |
| 801 | 3300050507 | nmdc:mga05p37_227632_c2 | nmdc:mga05p37_227632_c2_265_1047 | 243 |
| 802 | 3300050507 | nmdc:mga05p37_232050_c1 | nmdc:mga05p37_232050_c1_776_1561 | 243 |
| 803 | 3300050507 | nmdc:mga05p37_24240_c1 | nmdc:mga05p37_24240_c1_40_825 | 243 |
| 804 | 3300050507 | nmdc:mga05p37_254208_c1 | nmdc:mga05p37_254208_c1_131_916 | 243 |
| 805 | 3300050507 | nmdc:mga05p37_27424_c1 | nmdc:mga05p37_27424_c1_1260_2045 | 243 |
| 806 | 3300050507 | nmdc:mga05p37_321996_c1 | nmdc:mga05p37_321996_c1_913_1698 | 243 |
| 807 | 3300050507 | nmdc:mga05p37_403023_c1 | nmdc:mga05p37_403023_c1_383_1174 | 243 |
| 808 | 3300050507 | nmdc:mga05p37_467662_c1 | nmdc:mga05p37_467662_c1_424_1155 | 243 |
| 809 | 3300050507 | nmdc:mga05p37_4973_c1 | nmdc:mga05p37_4973_c1_1711_2496 | 243 |
| 810 | 3300050507 | nmdc:mga05p37_551536_c1 | nmdc:mga05p37_551536_c1_486_1268 | 243 |
| 811 | 3300050507 | nmdc:mga05p37_83_c1 | nmdc:mga05p37_83_c1_70216_70947 | 243 |
| 812 | 3300050507 | nmdc:mga05p37_876_c1 | nmdc:mga05p37_876_c1_28711_29445 | 243 |
| 813 | 3300050508 | nmdc:mga09592_101092_c1 | nmdc:mga09592_101092_c1_1195_1977 | 243 |
| 814 | 3300050508 | nmdc:mga09592_42919_c1 | nmdc:mga09592_42919_c1_2779_3564 | 243 |
| 815 | 3300050508 | nmdc:mga09592_46796_c1 | nmdc:mga09592_46796_c1_689_1474 | 243 |
| 816 | 3300050508 | nmdc:mga09592_58391_c1 | nmdc:mga09592_58391_c1_1167_1952 | 243 |
| 817 | 3300050508 | nmdc:mga09592_7978_c1 | nmdc:mga09592_7978_c1_4261_5046 | 243 |
| 818 | 3300050508 | nmdc:mga09592_90410_c1 | nmdc:mga09592_90410_c1_1220_1954 | 243 |
| 819 | 3300050509 | nmdc:mga0qj67_116243_c1 | nmdc:mga0qj67_116243_c1_389_1174 | 243 |
| 820 | 3300050509 | nmdc:mga0qj67_16467_c1 | nmdc:mga0qj67_16467_c1_4264_5049 | 243 |
| 821 | 3300050509 | nmdc:mga0qj67_17069_c1 | nmdc:mga0qj67_17069_c1_2540_3325 | 243 |
| 822 | 3300050509 | nmdc:mga0qj67_203387_c1 | nmdc:mga0qj67_203387_c1_159_941 | 243 |
| 823 | 3300050509 | nmdc:mga0qj67_230269_c1 | nmdc:mga0qj67_230269_c1_122_907 | 243 |
| 824 | 3300050509 | nmdc:mga0qj67_35275_c1 | nmdc:mga0qj67_35275_c1_206_988 | 243 |
| 825 | 3300050509 | nmdc:mga0qj67_56085_c1 | nmdc:mga0qj67_56085_c1_1150_1935 | 243 |
| 826 | 3300050510 | nmdc:mga06r32_121634_c1 | nmdc:mga06r32_121634_c1_1172_1957 | 243 |
| 827 | 3300050510 | nmdc:mga06r32_186599_c1 | nmdc:mga06r32_186599_c1_888_1622 | 243 |
| 828 | 3300050510 | nmdc:mga06r32_243033_c1 | nmdc:mga06r32_243033_c1_788_1573 | 243 |
| 829 | 3300050510 | nmdc:mga06r32_279435_c1 | nmdc:mga06r32_279435_c1_126_911 | 243 |
| 830 | 3300050510 | nmdc:mga06r32_442461_c1 | nmdc:mga06r32_442461_c1_135_920 | 243 |
| 831 | 3300050510 | nmdc:mga06r32_52513_c1 | nmdc:mga06r32_52513_c1_2323_3108 | 243 |
| 832 | 3300050510 | nmdc:mga06r32_785317_c1 | nmdc:mga06r32_785317_c1_26_760 | 243 |
| 833 | 3300050511 | nmdc:mga08y16_111173_c1 | nmdc:mga08y16_111173_c1_1877_2662 | 243 |
| 834 | 3300050511 | nmdc:mga08y16_1121_c1 | nmdc:mga08y16_1121_c1_24031_24816 | 243 |
| 835 | 3300050511 | nmdc:mga08y16_125171_c1 | nmdc:mga08y16_125171_c1_1840_2622 | 243 |
| 836 | 3300050511 | nmdc:mga08y16_206959_c1 | nmdc:mga08y16_206959_c1_1086_1877 | 243 |
| 837 | 3300050511 | nmdc:mga08y16_223798_c1 | nmdc:mga08y16_223798_c1_805_1590 | 243 |
| 838 | 3300050511 | nmdc:mga08y16_2471_c1 | nmdc:mga08y16_2471_c1_5851_6636 | 243 |
| 839 | 3300050511 | nmdc:mga08y16_30792_c1 | nmdc:mga08y16_30792_c1_3312_4046 | 243 |
| 840 | 3300050511 | nmdc:mga08y16_7060_c1 | nmdc:mga08y16_7060_c1_4573_5361 | 243 |
| 841 | 3300050511 | nmdc:mga08y16_7865_c1 | nmdc:mga08y16_7865_c1_8804_9586 | 243 |
| 842 | 3300050512 | nmdc:mga0n895_251662_c1 | nmdc:mga0n895_251662_c1_759_1493 | 243 |
| 843 | 3300050512 | nmdc:mga0n895_48219_c1 | nmdc:mga0n895_48219_c1_1146_1931 | 243 |
| 844 | 3300050512 | nmdc:mga0n895_5029_c1 | nmdc:mga0n895_5029_c1_496_1278 | 243 |
| 845 | 3300050512 | nmdc:mga0n895_68276_c1 | nmdc:mga0n895_68276_c1_376_1161 | 243 |
| 846 | 3300050512 | nmdc:mga0n895_768996_c1 | nmdc:mga0n895_768996_c1_81_863 | 243 |
| 847 | 3300050513 | nmdc:mga0rr50_6819_c1 | nmdc:mga0rr50_6819_c1_1119_1904 | 243 |
| 848 | 3300050514 | nmdc:mga08x19_73783_c1 | nmdc:mga08x19_73783_c1_197_982 | 243 |
| 849 | 3300050515 | nmdc:mga0a205_15411_c1 | nmdc:mga0a205_15411_c1_5143_5925 | 243 |
| 850 | 3300050515 | nmdc:mga0a205_16830_c1 | nmdc:mga0a205_16830_c1_2724_3509 | 243 |
| 851 | 3300050515 | nmdc:mga0a205_17912_c1 | nmdc:mga0a205_17912_c1_5395_6183 | 243 |
| 852 | 3300050515 | nmdc:mga0a205_29612_c1 | nmdc:mga0a205_29612_c1_3701_4486 | 243 |
| 853 | 3300050515 | nmdc:mga0a205_43676_c1 | nmdc:mga0a205_43676_c1_2631_3416 | 243 |
| 854 | 3300050515 | nmdc:mga0a205_4439_c1 | nmdc:mga0a205_4439_c1_5677_6411 | 243 |
| 855 | 3300050515 | nmdc:mga0a205_50427_c2 | nmdc:mga0a205_50427_c2_1369_2151 | 243 |
| 856 | 3300050515 | nmdc:mga0a205_538788_c1 | nmdc:mga0a205_538788_c1_47_835 | 243 |
| 857 | 3300050515 | nmdc:mga0a205_96540_c1 | nmdc:mga0a205_96540_c1_364_1149 | 243 |
| 858 | 3300053077 | Ga0495601_0075013 | Ga0495601_0075013_219_1004 | 243 |
| 859 | 3300054114 | Ga0501084_0067656 | Ga0501084_0067656_1930_2715 | 243 |
| 860 | 3300054114 | Ga0501084_0468328 | Ga0501084_0468328_86_871 | 243 |
| 861 | 3300059421 | Ga0590071_001388 | Ga0590071_001388_2723_3508 | 243 |
| 862 | 3300059421 | Ga0590071_006653 | Ga0590071_006653_317_1105 | 243 |
| 863 | 3300059423 | Ga0590074_005177 | Ga0590074_005177_511_1296 | 243 |
| 864 | 3300059424 | Ga0590075_000351 | Ga0590075_000351_9588_10373 | 243 |
| 865 | 3300059424 | Ga0590075_003200 | Ga0590075_003200_779_1567 | 243 |
| 866 | 3300059424 | Ga0590075_004308 | Ga0590075_004308_92_874 | 243 |
| 867 | 3300059424 | Ga0590075_050806 | Ga0590075_050806_164_949 | 243 |
| 868 | 3300059426 | Ga0590077_000390 | Ga0590077_000390_9429_10211 | 243 |
| 869 | 3300059426 | Ga0590077_001322 | Ga0590077_001322_3361_4146 | 243 |
| 870 | 3300059511 | Ga0587091_042773 | Ga0587091_042773_45_833 | 243 |
| 871 | 3300060353 | Ga0501082_0269423 | Ga0501082_0269423_312_1097 | 243 |
| 872 | 3300061734 | Ga0530510_0006822 | Ga0530510_0006822_2296_3081 | 243 |
| 873 | 3300061734 | Ga0530510_0180631 | Ga0530510_0180631_164_949 | 243 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3oxh-assembly1.cif.gz_A | mycobacterium tuberculosis kinase inhibitor homolog rv0577 | 0.9082 | 2 | 243 |
| 3oxh-assembly1.cif.gz_A | mycobacterium tuberculosis kinase inhibitor homolog rv0577 | 0.8376 | 2 | 243 |
| 3oa4-assembly1.cif.gz_A-2 | crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 | 0.7883 | 121 | 243 |
| 6xbs-assembly1.cif.gz_A-2 | streptomyces coelicolor methylmalonyl-coa epimerase (e43q) in complex with 2-nitronate-propionyl-coa | 0.7714 | 125 | 243 |
| 2r6u-assembly2.cif.gz_B | crystal structure of gene product rha04853 from rhodococcus sp. rha1 | 0.7667 | 123 | 243 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WKQ3_98_165_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8951 | 190 | 243 | 3.30.720.110 |
| af_I6XA34_8_128_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8674 | 123 | 242 | 3.10.180.10 |
| 3oxhA01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8645 | 113 | 242 | 3.10.180.10 |
| af_I6XA34_134_256_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8579 | 121 | 240 | 3.10.180.10 |
| 3oxhA02 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.852 | 121 | 243 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8IG39-F1-model_v4 | Glyoxalase | 0.9882 | 1 | 243 |
|
| AF-A0A7Y4VZB3-F1-model_v4 | VOC family protein | 0.9846 | 1 | 241 |
|
| AF-A0A2V8IG39-F1-model_v4 | Glyoxalase | 0.9842 | 1 | 243 |
|
| AF-A0A7Y4VZB3-F1-model_v4 | VOC family protein | 0.9647 | 1 | 241 |
|
| AF-A0A6B1FMV3-F1-model_v4 | VOC family protein | 0.9579 | 1 | 243 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar