F484258

General Info

Members Datasets Scaffolds Average Seq Length
873 405 1746 258

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0115664|Ga0395899_0115664_640_1530
Length 296
Sequence LALQERFITKEDKNFVVKLHKIFIEDLMQFQLNSRIKFVMKIATYNVNGVNGRLPVLLRWLNETSPDVVCLQELKAPQEKFPEEAIKDAGYNAIWHGQKSWNGVAILARNGMPEEICRVLPGDPEDSHSRYIEAIVNGVIIGCLYLPNGNPLPGPKFDYKLRWFERLTAHASQLLASDKPVLLTGDFNVMPTEIDVYKPERWVNDALFRPEVRAAFKTLVSQGWTDAIRKLYPDEVIYTFWDYFRNAYGRNAGLRIDHFLLSSHLDKRLVGAGVDRNVRGWEKTSDHAPVWIELSD

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
122 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
123 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
127 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
128 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
129 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
130 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
193 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
194 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
195 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
220 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
221 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
224 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
225 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
226 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
227 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
228 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
229 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
230 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
231 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
232 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
233 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
234 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
235 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
236 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
239 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
240 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
241 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
242 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
243 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
244 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
245 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
246 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
247 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
248 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
249 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
253 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
254 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
255 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
258 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
259 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
260 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
261 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
262 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
263 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
264 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
265 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
266 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
267 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
278 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
279 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
280 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
281 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
282 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
283 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
284 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
285 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
286 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
287 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
290 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
291 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
292 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
293 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
294 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
295 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
296 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
297 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
298 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
299 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
300 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
301 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
302 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
303 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
304 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
305 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
306 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
307 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
308 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
309 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
310 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
311 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
312 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
313 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
314 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
315 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
316 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
318 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
319 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
320 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
321 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
322 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
323 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
324 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
325 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
326 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
327 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
328 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
329 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
330 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
331 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
332 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
333 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
334 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
335 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
336 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
337 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
338 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
339 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
340 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
341 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
342 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
343 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
344 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
345 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
346 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
347 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
348 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
349 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
350 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
351 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
352 2739367651 Pedobacter sp. OK291 Isolate Unclassified
353 2739367656 Pedobacter sp. CF523 Isolate Unclassified
354 2739367663 Pedobacter sp. YR510 Isolate Unclassified
355 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
356 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
357 2791355261 Rhizobium sp. J15 Isolate Nodule
358 2791355267 Rhizobium sp. L18 Isolate Nodule
359 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
360 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
361 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
362 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
363 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
364 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
365 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
366 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
367 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
368 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
369 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
370 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
371 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
372 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
373 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
374 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
375 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
376 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
377 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
378 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
379 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
380 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
381 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
382 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
383 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
384 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
385 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
386 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
387 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
388 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
389 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
390 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
391 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
392 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
393 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
394 2996893221 Rhizobium sp. R635 Isolate Nodule
395 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
396 8005382845 Rhizobium sp. R634 Isolate Nodule
397 8005395548 Rhizobium sp. R339 Isolate Nodule
398 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
399 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
400 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
401 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
402 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
403 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
404 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
405 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.24
Metatranscriptomes 0.11
Isolates 6.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.84
Nodule 2.41
Rhizoplane 1.15
Rhizosphere 84.88
Stem 0
Stem Tuber 0
Unclassified 3.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0115664 3300037312 Unclassified 1925
2 SwRhRL2b_contig_2056031 2162886007 Bacteria 41625
3 SwRhRL2b_contig_909155 2162886007 Bacteria 5929
4 JGI24735J21928_10044086 3300002067 Bacteria 1296
5 JGI24738J21930_10020408 3300002075 Bacteria 1378
6 JGI25154J39366_1000004 3300002738 Bacteria 346460
7 JGI25157J39369_1006301 3300002741 Bacteria 1821
8 JGI25152J39213_1000178 3300002773 Bacteria 42706
9 JGI25150J39212_1000021 3300002774 Bacteria 133190
10 JGI25151J46595_10000078 3300003187 Bacteria 133190
11 JGI25406J46586_10000254 3300003203 Bacteria 23768
12 JGI25153J46596_10000057 3300003215 Bacteria 133190
13 JGI25153J46596_10029200 3300003215 Bacteria 1897
14 rootH1_10035892 3300003316 Bacteria 7472
15 rootH2_10209339 3300003320 Bacteria 3855
16 rootL2_10019401 3300003322 Bacteria 16988
17 rootH1_10010533 3300003323 Bacteria 22719
18 rootH1_10044234 3300003323 Bacteria 8655
19 rootH1_10072613 3300003323 Bacteria 10925
20 JGI25160J50197_1004985 3300003354 Bacteria 5631
21 Ga0055531_10000151 3300003794 Bacteria 80302
22 Ga0058863_11688669 3300004799 Bacteria 1608
23 Ga0065165_1002699 3300005262 Bacteria 14257
24 Ga0065165_1024492 3300005262 Bacteria 2026
25 Ga0065714_10003347 3300005288 Bacteria 22247
26 Ga0065714_10007490 3300005288 Bacteria 3903
27 Ga0065714_10084037 3300005288 Bacteria 2219
28 Ga0065714_10085601 3300005288 Bacteria 2141
29 Ga0065714_10105575 3300005288 Bacteria 1564
30 Ga0065704_10000208 3300005289 Bacteria 101850
31 Ga0065704_10001802 3300005289 Bacteria 10720
32 Ga0065712_10216383 3300005290 Bacteria 1055
33 Ga0065715_10016699 3300005293 Bacteria 2395
34 Ga0070658_10090806 3300005327 Bacteria 2517
35 Ga0070658_10142292 3300005327 Bacteria 2004
36 Ga0070658_10393274 3300005327 Bacteria 1190
37 Ga0070676_10057975 3300005328 Bacteria 2293
38 Ga0070683_100002599 3300005329 Bacteria 14433
39 Ga0070683_100003284 3300005329 Bacteria 13072
40 Ga0070683_100013362 3300005329 Bacteria 7158
41 Ga0070683_100080685 3300005329 Bacteria 3046
42 Ga0070683_100508283 3300005329 Bacteria 1151
43 Ga0070683_100725931 3300005329 Bacteria 952
44 Ga0070690_100016043 3300005330 Bacteria 4479
45 Ga0070690_100079964 3300005330 Bacteria 2137
46 Ga0070670_100029618 3300005331 Unclassified 4713
47 Ga0070670_100036434 3300005331 Bacteria 4233
48 Ga0070670_100052770 3300005331 Unclassified 3491
49 Ga0070670_100067272 3300005331 Bacteria 3074
50 Ga0070670_100142102 3300005331 Bacteria 2076
51 Ga0070670_100184510 3300005331 Bacteria 1811
52 Ga0070670_100231830 3300005331 Bacteria 1607
53 Ga0070670_100302088 3300005331 Bacteria 1400
54 Ga0070670_100379447 3300005331 Bacteria 1245
55 Ga0070670_100601890 3300005331 Bacteria 984
56 Ga0070677_10185431 3300005333 Bacteria 994
57 Ga0068869_100039234 3300005334 Bacteria 3380
58 Ga0068869_100123818 3300005334 Bacteria 1980
59 Ga0068869_100135545 3300005334 Bacteria 1896
60 Ga0068869_100241345 3300005334 Bacteria 1440
61 Ga0068869_100381515 3300005334 Unclassified 1155
62 Ga0070666_10189427 3300005335 Bacteria 1445
63 Ga0070666_10210984 3300005335 Bacteria 1368
64 Ga0070680_100004414 3300005336 Bacteria 10586
65 Ga0070680_100093459 3300005336 Bacteria 2492
66 Ga0070680_100400147 3300005336 Bacteria 1170
67 Ga0070682_100127057 3300005337 Bacteria 1720
68 Ga0068868_100020461 3300005338 Bacteria 4973
69 Ga0068868_100056313 3300005338 Bacteria 3104
70 Ga0068868_100173668 3300005338 Bacteria 1785
71 Ga0068868_100178822 3300005338 Bacteria 1759
72 Ga0068868_100389799 3300005338 Bacteria 1200
73 Ga0070660_100042079 3300005339 Bacteria 3485
74 Ga0070660_100089693 3300005339 Bacteria 2423
75 Ga0070660_100242632 3300005339 Bacteria 1468
76 Ga0070689_100054288 3300005340 Bacteria 3101
77 Ga0070689_100098596 3300005340 Bacteria 2311
78 Ga0070689_100099781 3300005340 Bacteria 2297
79 Ga0070689_100313811 3300005340 Bacteria 1308
80 Ga0070691_10024735 3300005341 Bacteria 2792
81 Ga0070687_100024118 3300005343 Bacteria 2899
82 Ga0070661_100005419 3300005344 Bacteria 8798
83 Ga0070661_100062929 3300005344 Bacteria 2724
84 Ga0070661_100416070 3300005344 Bacteria 1065
85 Ga0070692_10093181 3300005345 Bacteria 1640
86 Ga0070668_100016313 3300005347 Bacteria 5554
87 Ga0070668_100164808 3300005347 Bacteria 1801
88 Ga0070669_100008697 3300005353 Bacteria 7242
89 Ga0070669_100110488 3300005353 Bacteria 2086
90 Ga0070669_100122108 3300005353 Bacteria 1989
91 Ga0070675_100121052 3300005354 Bacteria 2223
92 Ga0070675_100205455 3300005354 Bacteria 1711
93 Ga0070675_100248375 3300005354 Unclassified 1556
94 Ga0070671_100035724 3300005355 Unclassified 4117
95 Ga0070671_100181309 3300005355 Bacteria 1783
96 Ga0070671_100233840 3300005355 Bacteria 1560
97 Ga0070671_100378922 3300005355 Bacteria 1209
98 Ga0070673_100051414 3300005364 Bacteria 3227
99 Ga0070673_100058753 3300005364 Bacteria 3042
100 Ga0070673_100091911 3300005364 Bacteria 2481
101 Ga0070673_100249163 3300005364 Bacteria 1547
102 Ga0070673_100344836 3300005364 Unclassified 1321
103 Ga0070673_100452645 3300005364 Bacteria 1155
104 Ga0070688_100016696 3300005365 Bacteria 4201
105 Ga0070688_100041035 3300005365 Unclassified 2839
106 Ga0070688_100119872 3300005365 Bacteria 1761
107 Ga0070659_100018639 3300005366 Bacteria 5238
108 Ga0070659_100073750 3300005366 Bacteria 2717
109 Ga0070659_100079203 3300005366 Bacteria 2622
110 Ga0070659_100150254 3300005366 Bacteria 1900
111 Ga0070667_100026222 3300005367 Bacteria 4846
112 Ga0070667_100030328 3300005367 Bacteria 4510
113 Ga0070667_100232597 3300005367 Bacteria 1644
114 Ga0070714_100662671 3300005435 Bacteria 1005
115 Ga0070701_10064463 3300005438 Bacteria 1942
116 Ga0070701_10140581 3300005438 Bacteria 1380
117 Ga0070700_100329322 3300005441 Bacteria 1125
118 Ga0070663_100008726 3300005455 Bacteria 6249
119 Ga0070663_100037948 3300005455 Bacteria 3357
120 Ga0070663_100122107 3300005455 Bacteria 1969
121 Ga0070678_100198856 3300005456 Bacteria 1653
122 Ga0070678_100473103 3300005456 Bacteria 1101
123 Ga0070678_100661807 3300005456 Bacteria 938
124 Ga0070662_100002229 3300005457 Bacteria 11891
125 Ga0070662_100011227 3300005457 Bacteria 5903
126 Ga0070662_100060331 3300005457 Bacteria 2765
127 Ga0070662_100127506 3300005457 Bacteria 1958
128 Ga0070681_10007244 3300005458 Bacteria 10824
129 Ga0070681_10014926 3300005458 Bacteria 7724
130 Ga0070681_10099103 3300005458 Bacteria 2860
131 Ga0068867_100085928 3300005459 Bacteria 2379
132 Ga0068867_100233481 3300005459 Bacteria 1488
133 Ga0070685_10034327 3300005466 Bacteria 2856
134 Ga0070685_10081299 3300005466 Bacteria 1942
135 Ga0070685_10094996 3300005466 Bacteria 1811
136 Ga0070685_10143126 3300005466 Bacteria 1508
137 Ga0070685_10160407 3300005466 Bacteria 1433
138 Ga0070698_100035084 3300005471 Bacteria 5187
139 Ga0070698_100522404 3300005471 Bacteria 1125
140 Ga0070679_100000261 3300005530 Bacteria 44142
141 Ga0070684_100009695 3300005535 Bacteria 7598
142 Ga0070684_100010017 3300005535 Bacteria 7493
143 Ga0070684_100014664 3300005535 Bacteria 6356
144 Ga0070684_100040560 3300005535 Bacteria 4010
145 Ga0070684_100345421 3300005535 Bacteria 1368
146 Ga0068853_100002363 3300005539 Bacteria 14114
147 Ga0068853_100188030 3300005539 Bacteria 1875
148 Ga0068853_100504452 3300005539 Bacteria 1142
149 Ga0068853_100703709 3300005539 Bacteria 964
150 Ga0070672_100056886 3300005543 Bacteria 3069
151 Ga0070672_100111323 3300005543 Bacteria 2232
152 Ga0070672_100258693 3300005543 Bacteria 1467
153 Ga0070672_100495825 3300005543 Bacteria 1056
154 Ga0070672_100587983 3300005543 Bacteria 969
155 Ga0070693_100068419 3300005547 Bacteria 2084
156 Ga0070665_100000205 3300005548 Bacteria 103515
157 Ga0070665_100062451 3300005548 Bacteria 3735
158 Ga0070665_100063508 3300005548 Bacteria 3703
159 Ga0070665_100063617 3300005548 Bacteria 3699
160 Ga0068855_100000033 3300005563 Bacteria 167299
161 Ga0068855_100000724 3300005563 Bacteria 40544
162 Ga0068855_100005855 3300005563 Bacteria 15006
163 Ga0068855_100009537 3300005563 Bacteria 11722
164 Ga0068855_100016101 3300005563 Bacteria 8991
165 Ga0068855_100042678 3300005563 Bacteria 5373
166 Ga0068855_100140971 3300005563 Bacteria 2748
167 Ga0068855_100170729 3300005563 Bacteria 2463
168 Ga0068855_100342501 3300005563 Bacteria 1648
169 Ga0070664_100011685 3300005564 Bacteria 7126
170 Ga0070664_100019632 3300005564 Bacteria 5561
171 Ga0070664_100045032 3300005564 Bacteria 3726
172 Ga0070664_100059352 3300005564 Bacteria 3254
173 Ga0070664_100091776 3300005564 Bacteria 2629
174 Ga0070664_100125970 3300005564 Bacteria 2247
175 Ga0070664_100361684 3300005564 Bacteria 1322
176 Ga0068857_100007316 3300005577 Bacteria 9511
177 Ga0068857_100015569 3300005577 Bacteria 6643
178 Ga0068857_100033142 3300005577 Bacteria 4568
179 Ga0068857_100094269 3300005577 Bacteria 2681
180 Ga0068857_100105507 3300005577 Bacteria 2530
181 Ga0068857_100697698 3300005577 Bacteria 964
182 Ga0068854_100012353 3300005578 Bacteria 5590
183 Ga0068854_100155438 3300005578 Bacteria 1767
184 Ga0068854_100363504 3300005578 Bacteria 1188
185 Ga0068854_100452165 3300005578 Bacteria 1073
186 Ga0068856_100036562 3300005614 Bacteria 4814
187 Ga0068856_100074923 3300005614 Bacteria 3352
188 Ga0068856_100082741 3300005614 Bacteria 3186
189 Ga0070702_100218726 3300005615 Bacteria 1272
190 Ga0068852_100000368 3300005616 Bacteria 30413
191 Ga0068852_100014069 3300005616 Bacteria 6143
192 Ga0068852_100017426 3300005616 Bacteria 5635
193 Ga0068852_100063278 3300005616 Bacteria 3221
194 Ga0068852_100078238 3300005616 Bacteria 2925
195 Ga0068852_100125392 3300005616 Bacteria 2357
196 Ga0068852_100138311 3300005616 Bacteria 2251
197 Ga0068852_100139705 3300005616 Bacteria 2240
198 Ga0068859_100022454 3300005617 Bacteria 6327
199 Ga0068859_100087409 3300005617 Bacteria 3165
200 Ga0068859_100186436 3300005617 Bacteria 2158
201 Ga0068859_100201187 3300005617 Bacteria 2077
202 Ga0068859_100261651 3300005617 Bacteria 1821
203 Ga0068864_100025261 3300005618 Bacteria 5001
204 Ga0068864_100081858 3300005618 Bacteria 2831
205 Ga0068864_100094931 3300005618 Bacteria 2637
206 Ga0068864_100202995 3300005618 Bacteria 1822
207 Ga0068864_100340116 3300005618 Bacteria 1414
208 Ga0068866_10038610 3300005718 Bacteria 2352
209 Ga0068866_10120883 3300005718 Bacteria 1476
210 Ga0068861_100103689 3300005719 Bacteria 2268
211 Ga0068851_10047712 3300005834 Bacteria 2170
212 Ga0068870_10355579 3300005840 Bacteria 941
213 Ga0068863_100013238 3300005841 Bacteria 7957
214 Ga0068863_100047906 3300005841 Bacteria 4053
215 Ga0068863_100373016 3300005841 Bacteria 1393
216 Ga0068863_100550760 3300005841 Bacteria 1139
217 Ga0068858_100024215 3300005842 Bacteria 5658
218 Ga0068858_100113418 3300005842 Bacteria 2532
219 Ga0068860_100009501 3300005843 Bacteria 9658
220 Ga0068860_100032432 3300005843 Bacteria 5019
221 Ga0068860_100044231 3300005843 Bacteria 4245
222 Ga0068862_100051975 3300005844 Bacteria 3506
223 Ga0068862_100180126 3300005844 Bacteria 1896
224 Ga0081539_10001900 3300005985 Bacteria 32389
225 Ga0081539_10038125 3300005985 Unclassified 2852
226 Ga0075363_100002744 3300006048 Bacteria 7292
227 Ga0075369_10000022 3300006186 Bacteria 44375
228 Ga0075366_10000493 3300006195 Bacteria 18252
229 Ga0075366_10003181 3300006195 Bacteria 8602
230 Ga0075366_10028307 3300006195 Bacteria 3289
231 Ga0097621_100067164 3300006237 Bacteria 2955
232 Ga0097621_100118194 3300006237 Bacteria 2247
233 Ga0097621_100398818 3300006237 Bacteria 1231
234 Ga0068871_100029030 3300006358 Unclassified 4342
235 Ga0068871_100182765 3300006358 Bacteria 1803
236 Ga0068871_100326388 3300006358 Bacteria 1353
237 Ga0075428_100014269 3300006844 Bacteria 8837
238 Ga0075428_100017394 3300006844 Bacteria 7946
239 Ga0075428_100160684 3300006844 Bacteria 2439
240 Ga0075428_100169103 3300006844 Bacteria 2371
241 Ga0075430_100014698 3300006846 Bacteria 6668
242 Ga0075430_100052808 3300006846 Bacteria 3423
243 Ga0075431_100024723 3300006847 Bacteria 6159
244 Ga0075431_100049098 3300006847 Bacteria 4352
245 Ga0075431_100240198 3300006847 Bacteria 1843
246 Ga0075433_10256723 3300006852 Bacteria 1550
247 Ga0075429_100006082 3300006880 Bacteria 10440
248 Ga0075429_100102502 3300006880 Bacteria 2498
249 Ga0075429_100577034 3300006880 Bacteria 985
250 Ga0068865_100169652 3300006881 Bacteria 1672
251 Ga0068865_100595465 3300006881 Unclassified 934
252 Ga0075436_100000340 3300006914 Bacteria 29818
253 Ga0097620_100022453 3300006931 Bacteria 6327
254 Ga0097620_100087401 3300006931 Bacteria 3165
255 Ga0097620_100186445 3300006931 Bacteria 2158
256 Ga0097620_100201180 3300006931 Bacteria 2077
257 Ga0097620_100261623 3300006931 Bacteria 1821
258 Ga0105240_10000020 3300009093 Bacteria 399699
259 Ga0105240_10002198 3300009093 Bacteria 31833
260 Ga0105240_10029260 3300009093 Bacteria 7182
261 Ga0105240_10095427 3300009093 Bacteria 3626
262 Ga0105240_10224569 3300009093 Bacteria 2186
263 Ga0105240_10668553 3300009093 Bacteria 1137
264 Ga0111539_10048554 3300009094 Bacteria 5067
265 Ga0105247_10423230 3300009101 Bacteria 954
266 Ga0114129_10040856 3300009147 Bacteria 6538
267 Ga0105241_10063449 3300009174 Bacteria 2850
268 Ga0105241_10179178 3300009174 Bacteria 1756
269 Ga0105241_10193872 3300009174 Bacteria 1693
270 Ga0105241_10341143 3300009174 Bacteria 1298
271 Ga0105241_10608530 3300009174 Bacteria 988
272 Ga0105242_10024277 3300009176 Bacteria 4787
273 Ga0105242_10093451 3300009176 Bacteria 2535
274 Ga0105242_10188128 3300009176 Bacteria 1826
275 Ga0105242_10228529 3300009176 Bacteria 1666
276 Ga0105237_10000143 3300009545 Bacteria 101515
277 Ga0105237_10001072 3300009545 Bacteria 36764
278 Ga0105237_10001440 3300009545 Bacteria 31406
279 Ga0105237_10045725 3300009545 Bacteria 4404
280 Ga0105237_10132929 3300009545 Bacteria 2483
281 Ga0105238_10041777 3300009551 Bacteria 4644
282 Ga0105249_10010289 3300009553 Bacteria 8216
283 Ga0105249_10014619 3300009553 Bacteria 6941
284 Ga0105249_10062101 3300009553 Bacteria 3430
285 Ga0105239_10000002 3300010375 Bacteria 610298
286 Ga0105239_10000136 3300010375 Bacteria 102943
287 Ga0105239_10001354 3300010375 Bacteria 32956
288 Ga0105239_10215387 3300010375 Bacteria 2153
289 Ga0105246_10000302 3300011119 Bacteria 26080
290 Ga0105246_10104980 3300011119 Bacteria 2064
291 Ga0157373_10000064 3300013100 Bacteria 94176
292 Ga0157373_10000154 3300013100 Bacteria 55480
293 Ga0157373_10005219 3300013100 Bacteria 9756
294 Ga0157373_10012974 3300013100 Bacteria 6118
295 Ga0157373_10013107 3300013100 Bacteria 6085
296 Ga0157373_10053286 3300013100 Unclassified 2876
297 Ga0157373_10059948 3300013100 Bacteria 2696
298 Ga0157373_10104812 3300013100 Bacteria 1989
299 Ga0157371_10000135 3300013102 Bacteria 107607
300 Ga0157371_10001388 3300013102 Bacteria 25318
301 Ga0157371_10001497 3300013102 Bacteria 24172
302 Ga0157371_10002087 3300013102 Bacteria 19526
303 Ga0157371_10002968 3300013102 Bacteria 15759
304 Ga0157371_10006874 3300013102 Bacteria 9289
305 Ga0157371_10050066 3300013102 Unclassified 2968
306 Ga0157371_10125589 3300013102 Bacteria 1824
307 Ga0157371_10133198 3300013102 Bacteria 1769
308 Ga0157371_10151309 3300013102 Bacteria 1655
309 Ga0157371_10151585 3300013102 Bacteria 1654
310 Ga0157371_10325152 3300013102 Bacteria 1117
311 Ga0157370_10001449 3300013104 Bacteria 29363
312 Ga0157370_10002674 3300013104 Bacteria 21356
313 Ga0157370_10007812 3300013104 Bacteria 11587
314 Ga0157370_10038640 3300013104 Bacteria 4617
315 Ga0157370_10123063 3300013104 Bacteria 2422
316 Ga0157370_10249387 3300013104 Bacteria 1642
317 Ga0157370_10398592 3300013104 Bacteria 1267
318 Ga0157370_10439379 3300013104 Bacteria 1200
319 Ga0157370_10518708 3300013104 Bacteria 1094
320 Ga0157369_10005954 3300013105 Bacteria 14160
321 Ga0157369_10033631 3300013105 Bacteria 5633
322 Ga0157369_10124437 3300013105 Bacteria 2735
323 Ga0157369_10256644 3300013105 Bacteria 1824
324 Ga0157369_10453443 3300013105 Bacteria 1328
325 Ga0157369_10501742 3300013105 Bacteria 1255
326 Ga0157374_10003869 3300013296 Bacteria 12564
327 Ga0157374_10040129 3300013296 Bacteria 4309
328 Ga0157374_10094858 3300013296 Bacteria 2852
329 Ga0157374_10391017 3300013296 Bacteria 1386
330 Ga0157374_10644700 3300013296 Bacteria 1071
331 Ga0157378_10000557 3300013297 Bacteria 35516
332 Ga0157378_10006087 3300013297 Bacteria 10570
333 Ga0157378_10025884 3300013297 Bacteria 5169
334 Ga0157378_10050643 3300013297 Bacteria 3696
335 Ga0157378_10142229 3300013297 Bacteria 2229
336 Ga0157378_10168685 3300013297 Bacteria 2051
337 Ga0157378_10243617 3300013297 Unclassified 1718
338 Ga0163162_10000254 3300013306 Bacteria 48422
339 Ga0163162_10016096 3300013306 Bacteria 7310
340 Ga0163162_10064751 3300013306 Bacteria 3701
341 Ga0163162_10069871 3300013306 Bacteria 3563
342 Ga0163162_10081298 3300013306 Bacteria 3311
343 Ga0163162_10082667 3300013306 Bacteria 3284
344 Ga0163162_10102532 3300013306 Bacteria 2955
345 Ga0163162_10173159 3300013306 Bacteria 2283
346 Ga0163162_10210054 3300013306 Bacteria 2076
347 Ga0163162_10224616 3300013306 Bacteria 2007
348 Ga0163162_10321898 3300013306 Bacteria 1679
349 Ga0163162_10731147 3300013306 Bacteria 1110
350 Ga0157372_10000029 3300013307 Bacteria 180371
351 Ga0157372_10000061 3300013307 Bacteria 119814
352 Ga0157372_10018416 3300013307 Bacteria 7506
353 Ga0157372_10023276 3300013307 Bacteria 6714
354 Ga0157372_10048744 3300013307 Unclassified 4708
355 Ga0157372_10105425 3300013307 Bacteria 3224
356 Ga0157372_10178130 3300013307 Bacteria 2461
357 Ga0157372_10197959 3300013307 Unclassified 2327
358 Ga0157372_10250687 3300013307 Bacteria 2055
359 Ga0157372_10377530 3300013307 Bacteria 1652
360 Ga0157372_10434000 3300013307 Bacteria 1531
361 Ga0157372_10484761 3300013307 Bacteria 1441
362 Ga0157372_10555015 3300013307 Unclassified 1339
363 Ga0157375_10032527 3300013308 Bacteria 4948
364 Ga0157375_10036964 3300013308 Bacteria 4675
365 Ga0157375_10077202 3300013308 Unclassified 3360
366 Ga0157375_10077731 3300013308 Bacteria 3350
367 Ga0157375_10128523 3300013308 Bacteria 2652
368 Ga0157375_10251899 3300013308 Bacteria 1927
369 Ga0157375_10595993 3300013308 Bacteria 1264
370 Ga0157375_11357778 3300013308 Bacteria 836
371 Ga0163163_10001144 3300014325 Bacteria 22578
372 Ga0163163_10006882 3300014325 Bacteria 9983
373 Ga0163163_10019272 3300014325 Bacteria 6405
374 Ga0163163_10030868 3300014325 Bacteria 5167
375 Ga0163163_10086192 3300014325 Bacteria 3149
376 Ga0163163_10145364 3300014325 Bacteria 2414
377 Ga0163163_10177718 3300014325 Bacteria 2175
378 Ga0157380_10008071 3300014326 Bacteria 7499
379 Ga0157380_10342077 3300014326 Bacteria 1396
380 Ga0157380_10593258 3300014326 Bacteria 1095
381 Ga0157380_10671964 3300014326 Bacteria 1036
382 Ga0157377_10000723 3300014745 Bacteria 13662
383 Ga0157377_10033385 3300014745 Bacteria 2809
384 Ga0157377_10068046 3300014745 Bacteria 2051
385 Ga0157377_10136205 3300014745 Bacteria 1505
386 Ga0157377_10158274 3300014745 Bacteria 1406
387 Ga0157377_10244038 3300014745 Bacteria 1161
388 Ga0157379_10197830 3300014968 Bacteria 1817
389 Ga0157379_10802649 3300014968 Bacteria 888
390 Ga0157376_10124212 3300014969 Bacteria 2292
391 Ga0157376_10171273 3300014969 Bacteria 1977
392 Ga0182006_1000668 3300015261 Bacteria 24095
393 Ga0182006_1013089 3300015261 Bacteria 3611
394 Ga0182007_10023721 3300015262 Bacteria 2154
395 Ga0183373_1004 3300015682 Bacteria 537398
396 Ga0163161_10022366 3300017792 Bacteria 4452
397 Ga0163161_10025767 3300017792 Bacteria 4164
398 Ga0163161_10038137 3300017792 Bacteria 3445
399 Ga0163161_10215799 3300017792 Unclassified 1484
400 Ga0163161_10402573 3300017792 Bacteria 1098
401 Ga0213876_10046993 3300021384 Bacteria 2282
402 Ga0213875_10009671 3300021388 Bacteria 4871
403 Ga0207425_1000004 3300025245 Bacteria 1092421
404 Ga0209646_1000025 3300025246 Bacteria 406493
405 Ga0209026_1000097 3300025250 Bacteria 163212
406 Ga0209026_1000226 3300025250 Bacteria 77076
407 Ga0209026_1007599 3300025250 Bacteria 2404
408 Ga0209148_1001642 3300025254 Bacteria 10220
409 Ga0209129_1000048 3300025258 Bacteria 270192
410 Ga0209233_1001263 3300025261 Bacteria 10155
411 Ga0209455_1001752 3300025272 Bacteria 9192
412 Ga0209025_1000009 3300025294 Bacteria 1092561
413 Ga0209758_1000010 3300025297 Bacteria 1092782
414 Ga0209758_1021370 3300025297 Bacteria 3018
415 Ga0207426_1000220 3300025302 Bacteria 134979
416 Ga0209257_1000013 3300025304 Bacteria 1047305
417 Ga0207656_10033876 3300025321 Bacteria 2130
418 Ga0207682_10048712 3300025893 Bacteria 1747
419 Ga0207682_10203609 3300025893 Bacteria 911
420 Ga0207642_10035445 3300025899 Bacteria 2131
421 Ga0207688_10057097 3300025901 Bacteria 2194
422 Ga0207680_10040907 3300025903 Bacteria 2701
423 Ga0207647_10000105 3300025904 Bacteria 65502
424 Ga0207647_10026086 3300025904 Bacteria 3827
425 Ga0207647_10046356 3300025904 Bacteria 2709
426 Ga0207645_10065399 3300025907 Bacteria 2324
427 Ga0207643_10049704 3300025908 Bacteria 2376
428 Ga0207705_10121483 3300025909 Bacteria 1939
429 Ga0207705_10125744 3300025909 Bacteria 1905
430 Ga0207705_10234134 3300025909 Bacteria 1398
431 Ga0207654_10001489 3300025911 Bacteria 12377
432 Ga0207707_10022653 3300025912 Bacteria 5493
433 Ga0207695_10000020 3300025913 Bacteria 723025
434 Ga0207695_10000076 3300025913 Bacteria 307969
435 Ga0207695_10000090 3300025913 Bacteria 272143
436 Ga0207695_10000183 3300025913 Bacteria 181350
437 Ga0207695_10002461 3300025913 Bacteria 27342
438 Ga0207695_10644465 3300025913 Bacteria 940
439 Ga0207671_10000968 3300025914 Bacteria 35551
440 Ga0207671_10010707 3300025914 Bacteria 7541
441 Ga0207671_10015831 3300025914 Bacteria 5883
442 Ga0207671_10024163 3300025914 Bacteria 4573
443 Ga0207671_10108150 3300025914 Bacteria 2113
444 Ga0207660_10025129 3300025917 Bacteria 4041
445 Ga0207662_10044920 3300025918 Bacteria 2610
446 Ga0207662_10092114 3300025918 Bacteria 1866
447 Ga0207657_10023160 3300025919 Bacteria 5789
448 Ga0207657_10072360 3300025919 Bacteria 2917
449 Ga0207657_10160815 3300025919 Bacteria 1824
450 Ga0207649_10014835 3300025920 Bacteria 4370
451 Ga0207649_10057090 3300025920 Bacteria 2439
452 Ga0207649_10450540 3300025920 Bacteria 971
453 Ga0207652_10000011 3300025921 Bacteria 246742
454 Ga0207652_10000057 3300025921 Bacteria 113664
455 Ga0207681_10109054 3300025923 Bacteria 2011
456 Ga0207650_10014868 3300025925 Bacteria 5415
457 Ga0207650_10020937 3300025925 Bacteria 4620
458 Ga0207650_10078395 3300025925 Bacteria 2499
459 Ga0207650_10198702 3300025925 Bacteria 1605
460 Ga0207650_10357199 3300025925 Bacteria 1203
461 Ga0207650_10406835 3300025925 Bacteria 1127
462 Ga0207659_10106702 3300025926 Bacteria 2121
463 Ga0207644_10210437 3300025931 Bacteria 1537
464 Ga0207690_10025553 3300025932 Bacteria 3710
465 Ga0207690_10036836 3300025932 Bacteria 3171
466 Ga0207690_10109974 3300025932 Bacteria 1983
467 Ga0207690_10213637 3300025932 Bacteria 1472
468 Ga0207706_10001578 3300025933 Bacteria 22611
469 Ga0207706_10002076 3300025933 Bacteria 19622
470 Ga0207706_10005829 3300025933 Bacteria 11461
471 Ga0207706_10016578 3300025933 Bacteria 6651
472 Ga0207706_10027456 3300025933 Bacteria 5089
473 Ga0207706_10112280 3300025933 Bacteria 2398
474 Ga0207706_10154478 3300025933 Bacteria 2019
475 Ga0207706_10379158 3300025933 Bacteria 1227
476 Ga0207686_10000200 3300025934 Bacteria 46234
477 Ga0207686_10048259 3300025934 Bacteria 2637
478 Ga0207686_10190230 3300025934 Unclassified 1462
479 Ga0207686_10584200 3300025934 Bacteria 877
480 Ga0207670_10037753 3300025936 Bacteria 3150
481 Ga0207670_10072649 3300025936 Bacteria 2382
482 Ga0207669_10269836 3300025937 Bacteria 1277
483 Ga0207669_10583069 3300025937 Bacteria 907
484 Ga0207704_10363376 3300025938 Bacteria 1131
485 Ga0207691_10009195 3300025940 Bacteria 9485
486 Ga0207691_10022720 3300025940 Bacteria 5913
487 Ga0207691_10027317 3300025940 Bacteria 5351
488 Ga0207691_10065448 3300025940 Bacteria 3290
489 Ga0207691_10515176 3300025940 Bacteria 1015
490 Ga0207691_10530201 3300025940 Unclassified 999
491 Ga0207689_10019312 3300025942 Bacteria 5745
492 Ga0207689_10024873 3300025942 Bacteria 5020
493 Ga0207689_10081856 3300025942 Bacteria 2654
494 Ga0207689_10129789 3300025942 Bacteria 2074
495 Ga0207689_10216924 3300025942 Bacteria 1581
496 Ga0207661_10001267 3300025944 Bacteria 16895
497 Ga0207661_10003205 3300025944 Bacteria 11339
498 Ga0207661_10013373 3300025944 Bacteria 5995
499 Ga0207661_10018874 3300025944 Bacteria 5132
500 Ga0207661_10816807 3300025944 Bacteria 858
501 Ga0207679_10001116 3300025945 Bacteria 17106
502 Ga0207679_10128873 3300025945 Bacteria 2026
503 Ga0207679_10167758 3300025945 Bacteria 1804
504 Ga0207667_10000046 3300025949 Bacteria 245420
505 Ga0207667_10001827 3300025949 Bacteria 26771
506 Ga0207667_10008253 3300025949 Bacteria 12395
507 Ga0207667_10010255 3300025949 Bacteria 10968
508 Ga0207667_10020033 3300025949 Bacteria 7449
509 Ga0207667_10375090 3300025949 Bacteria 1450
510 Ga0207667_11005440 3300025949 Bacteria 821
511 Ga0207651_10028157 3300025960 Bacteria 3540
512 Ga0207651_10059328 3300025960 Bacteria 2650
513 Ga0207651_10067659 3300025960 Bacteria 2515
514 Ga0207651_10099582 3300025960 Unclassified 2153
515 Ga0207651_10151998 3300025960 Bacteria 1803
516 Ga0207651_10173823 3300025960 Bacteria 1702
517 Ga0207712_10003728 3300025961 Bacteria 9617
518 Ga0207668_10022614 3300025972 Bacteria 4029
519 Ga0207640_10017916 3300025981 Bacteria 4151
520 Ga0207640_10051822 3300025981 Bacteria 2670
521 Ga0207640_10660039 3300025981 Bacteria 892
522 Ga0207640_10701423 3300025981 Bacteria 868
523 Ga0207658_10063971 3300025986 Bacteria 2758
524 Ga0207658_10067976 3300025986 Bacteria 2686
525 Ga0207658_10443663 3300025986 Bacteria 1148
526 Ga0207658_10558323 3300025986 Bacteria 1025
527 Ga0207677_10017707 3300026023 Bacteria 4256
528 Ga0207677_10071979 3300026023 Bacteria 2442
529 Ga0207677_10138691 3300026023 Bacteria 1858
530 Ga0207677_10406427 3300026023 Bacteria 1156
531 Ga0207677_10531383 3300026023 Bacteria 1022
532 Ga0207703_10047038 3300026035 Bacteria 3477
533 Ga0207639_10023309 3300026041 Bacteria 4469
534 Ga0207639_10052640 3300026041 Bacteria 3103
535 Ga0207639_10129475 3300026041 Bacteria 2087
536 Ga0207639_10467119 3300026041 Bacteria 1148
537 Ga0207639_10632677 3300026041 Bacteria 989
538 Ga0207678_10017720 3300026067 Bacteria 6253
539 Ga0207678_10049634 3300026067 Bacteria 3627
540 Ga0207678_10275028 3300026067 Bacteria 1445
541 Ga0207702_10015591 3300026078 Bacteria 6290
542 Ga0207702_10043524 3300026078 Bacteria 3770
543 Ga0207702_10258837 3300026078 Bacteria 1637
544 Ga0207641_10027621 3300026088 Bacteria 4687
545 Ga0207641_10061070 3300026088 Bacteria 3214
546 Ga0207641_10077126 3300026088 Bacteria 2883
547 Ga0207641_10082085 3300026088 Bacteria 2800
548 Ga0207648_10013383 3300026089 Bacteria 7634
549 Ga0207648_10021636 3300026089 Bacteria 5777
550 Ga0207648_10106170 3300026089 Bacteria 2464
551 Ga0207648_10250463 3300026089 Unclassified 1579
552 Ga0207648_10321711 3300026089 Bacteria 1390
553 Ga0207648_10322692 3300026089 Unclassified 1388
554 Ga0207676_10016147 3300026095 Bacteria 5403
555 Ga0207676_10052782 3300026095 Bacteria 3180
556 Ga0207676_10094665 3300026095 Bacteria 2462
557 Ga0207676_10509823 3300026095 Bacteria 1143
558 Ga0207676_10519506 3300026095 Bacteria 1133
559 Ga0207676_10558704 3300026095 Bacteria 1094
560 Ga0207674_10008940 3300026116 Bacteria 11511
561 Ga0207674_10012134 3300026116 Bacteria 9646
562 Ga0207674_10014085 3300026116 Bacteria 8835
563 Ga0207674_10045160 3300026116 Bacteria 4534
564 Ga0207674_10121909 3300026116 Bacteria 2574
565 Ga0207674_10167101 3300026116 Bacteria 2154
566 Ga0207674_10177487 3300026116 Bacteria 2082
567 Ga0207675_100001919 3300026118 Bacteria 20735
568 Ga0207683_10006292 3300026121 Bacteria 10175
569 Ga0207683_10035576 3300026121 Bacteria 4332
570 Ga0207683_10202089 3300026121 Bacteria 1807
571 Ga0207683_10273387 3300026121 Bacteria 1543
572 Ga0207683_10428358 3300026121 Bacteria 1219
573 Ga0207698_10080730 3300026142 Bacteria 2622
574 Ga0207698_10142932 3300026142 Bacteria 2065
575 Ga0207698_10234563 3300026142 Bacteria 1668
576 Ga0207698_10496746 3300026142 Bacteria 1187
577 Ga0207698_10642326 3300026142 Bacteria 1050
578 Ga0207428_10049291 3300027907 Bacteria 3375
579 Ga0268266_10001358 3300028379 Bacteria 29523
580 Ga0268266_10036128 3300028379 Bacteria 4204
581 Ga0268266_10218401 3300028379 Bacteria 1751
582 Ga0268265_10221070 3300028380 Bacteria 1657
583 Ga0268264_10010214 3300028381 Bacteria 7770
584 Ga0268264_10081788 3300028381 Bacteria 2761
585 Ga0307517_10008092 3300028786 Bacteria 15151
586 Ga0307515_10000039 3300028794 Bacteria 323229
587 Ga0307515_10048464 3300028794 Bacteria 6423
588 Ga0307515_10323371 3300028794 Bacteria 1207
589 Ga0316177_1010194 3300030731 Bacteria 10918
590 Ga0316176_1025003 3300030732 Bacteria 24453
591 Ga0307513_10373342 3300031456 Bacteria 1168
592 Ga0307509_10023952 3300031507 Bacteria 6843
593 Ga0307408_100009720 3300031548 Bacteria 6338
594 Ga0307408_100023313 3300031548 Unclassified 4215
595 Ga0307405_10000006 3300031731 Bacteria 361477
596 Ga0307405_10056393 3300031731 Bacteria 2464
597 Ga0307413_10384513 3300031824 Bacteria 1095
598 Ga0307410_10003816 3300031852 Bacteria 7657
599 Ga0307406_10101850 3300031901 Unclassified 1958
600 Ga0307407_10000003 3300031903 Bacteria 271723
601 Ga0307407_10003725 3300031903 Bacteria 6326
602 Ga0307407_10152810 3300031903 Unclassified 1502
603 Ga0307412_10000009 3300031911 Bacteria 445987
604 Ga0307412_10018528 3300031911 Bacteria 4192
605 Ga0307412_10023992 3300031911 Bacteria 3761
606 Ga0307412_10037612 3300031911 Bacteria 3111
607 Ga0307412_10070344 3300031911 Bacteria 2385
608 Ga0307412_10114415 3300031911 Bacteria 1932
609 Ga0307409_100076377 3300031995 Unclassified 2686
610 Ga0307416_100000002 3300032002 Bacteria 509907
611 Ga0307414_10000002 3300032004 Bacteria 623006
612 Ga0307414_10037074 3300032004 Bacteria 3261
613 Ga0307414_10039538 3300032004 Bacteria 3178
614 Ga0307414_10071869 3300032004 Bacteria 2497
615 Ga0307414_10229227 3300032004 Bacteria 1530
616 Ga0307414_10265527 3300032004 Bacteria 1434
617 Ga0307414_10286804 3300032004 Bacteria 1386
618 Ga0307414_10772441 3300032004 Bacteria 875
619 Ga0307411_10000010 3300032005 Bacteria 238134
620 Ga0307411_10471659 3300032005 Bacteria 1055
621 Ga0307415_100002127 3300032126 Bacteria 9812
622 Ga0373943_0033831 3300035170 Bacteria 2437
623 Ga0373955_0028710 3300035172 Bacteria 2887
624 Ga0373933_0062939 3300035724 Bacteria 2242
625 Ga0373937_0006714 3300036401 Bacteria 9925
626 Ga0373937_0114269 3300036401 Bacteria 2513
627 Ga0395899_0000011 3300037312 Bacteria 521331
628 Ga0395899_0000024 3300037312 Bacteria 357402
629 Ga0395899_0005151 3300037312 Bacteria 10169
630 Ga0395900_0003816 3300037418 Bacteria 16111
631 Ga0395900_0088189 3300037418 Bacteria 3189
632 Ga0395900_0377432 3300037418 Bacteria 1386
633 Ga0395898_0005129 3300037466 Bacteria 14180
634 Ga0395898_0135839 3300037466 Unclassified 2355
635 Ga0395898_0170216 3300037466 Bacteria 2082
636 Ga0395905_0202273 3300037471 Bacteria 1862
637 Ga0395905_0357783 3300037471 Bacteria 1352
638 Ga0436364_0518085 3300037853 Bacteria 102110
639 Ga0395901_0014835 3300038443 Bacteria 7916
640 Ga0395901_0037327 3300038443 Bacteria 5025
641 Ga0436365_0262826 3300039437 Bacteria 23593
642 Ga0439433_0017256 3300041999 Bacteria 1602
643 Ga0439462_0024915 3300042015 Bacteria 1574
644 Ga0451577_0005367 3300042876 Bacteria 13153
645 Ga0451577_0729678 3300042876 Bacteria 897
646 Ga0466969_0000262 3300044656 Bacteria 28797
647 Ga0466969_0022399 3300044656 Bacteria 3261
648 Ga0466972_0135572 3300044658 Bacteria 1159
649 Ga0453683_0156002 3300044673 Unclassified 1443
650 Ga0466966_0000114 3300044684 Bacteria 49928
651 Ga0466961_0033151 3300044693 Bacteria 3319
652 Ga0466961_0049507 3300044693 Bacteria 2686
653 Ga0466961_0153324 3300044693 Bacteria 1438
654 Ga0466964_0025102 3300044706 Bacteria 2326
655 Ga0453684_0004533 3300044712 Bacteria 29140
656 Ga0453684_0083924 3300044712 Bacteria 3964
657 Ga0453684_0323132 3300044712 Bacteria 1747
658 Ga0466968_0038250 3300044735 Bacteria 2016
659 Ga0466968_0069192 3300044735 Bacteria 1534
660 Ga0466959_0000049 3300045049 Bacteria 83496
661 Ga0466959_0024789 3300045049 Bacteria 4443
662 Ga0466959_0303585 3300045049 Bacteria 1093
663 Ga0466958_0190894 3300045836 Bacteria 1302
664 Ga0495627_001033 3300046453 Bacteria 18616
665 Ga0495592_0018558 3300046454 Bacteria 5293
666 Ga0495650_0000216 3300046471 Bacteria 121086
667 Ga0495650_0037213 3300046471 Bacteria 2121
668 Ga0495585_0000103 3300046492 Bacteria 90447
669 Ga0495606_0000263 3300046507 Bacteria 92794
670 Ga0495606_0008892 3300046507 Bacteria 8604
671 Ga0495606_0017691 3300046507 Bacteria 5378
672 Ga0495608_0090875 3300046511 Bacteria 1975
673 Ga0495610_0003125 3300046512 Bacteria 13180
674 Ga0495610_0084974 3300046512 Bacteria 1445
675 Ga0495610_0158482 3300046512 Bacteria 959
676 Ga0495616_0067203 3300046513 Bacteria 1743
677 Ga0495628_0021207 3300046516 Bacteria 5349
678 Ga0495630_0008614 3300046517 Bacteria 7321
679 Ga0495637_0078062 3300046520 Bacteria 1324
680 Ga0495643_0002269 3300046522 Bacteria 15545
681 Ga0495648_0034045 3300046524 Bacteria 3321
682 Ga0495663_0000838 3300046525 Bacteria 10511
683 Ga0495652_0240085 3300046529 Bacteria 1349
684 Ga0495652_0371277 3300046529 Bacteria 1020
685 Ga0495598_0097749 3300046537 Bacteria 967
686 Ga0495633_0049879 3300046558 Bacteria 1975
687 Ga0495668_0000115 3300046616 Bacteria 125423
688 Ga0495668_0002946 3300046616 Bacteria 13431
689 Ga0495634_0031017 3300046642 Bacteria 3685
690 Ga0495625_0000125 3300046660 Bacteria 120726
691 Ga0495625_0010849 3300046660 Bacteria 7492
692 Ga0495661_0017390 3300046665 Bacteria 4750
693 Ga0495661_0050902 3300046665 Bacteria 2504
694 Ga0495657_0113681 3300046675 Bacteria 1712
695 Ga0495599_0085578 3300046678 Bacteria 1969
696 Ga0495658_0074600 3300046683 Bacteria 1977
697 Ga0495624_0261831 3300046690 Bacteria 1045
698 Ga0495649_0000044 3300046694 Bacteria 120721
699 Ga0495600_0221464 3300046809 Bacteria 1210
700 Ga0495660_0004886 3300046810 Bacteria 8074
701 Ga0495672_0019853 3300047320 Bacteria 4420
702 Ga0495672_0024130 3300047320 Bacteria 3924
703 Ga0495680_0285582 3300047322 Bacteria 1162
704 Ga0495687_013604 3300047443 Bacteria 4234
705 Ga0495687_088676 3300047443 Bacteria 1190
706 Ga0495675_0288247 3300047444 Bacteria 978
707 Ga0495679_052761 3300047446 Bacteria 1216
708 Ga0495673_0027605 3300047469 Bacteria 2699
709 Ga0495681_0000600 3300047470 Bacteria 27495
710 Ga0495684_0085342 3300047471 Bacteria 2394
711 Ga0495686_0000150 3300047472 Bacteria 135172
712 Ga0495686_0000763 3300047472 Bacteria 42458
713 Ga0495686_0001123 3300047472 Bacteria 31643
714 Ga0495686_0014532 3300047472 Bacteria 5414
715 Ga0495686_0077585 3300047472 Bacteria 2034
716 Ga0495686_0127887 3300047472 Bacteria 1509
717 Ga0496102_0091955 3300048905 Bacteria 2809
718 Ga0496102_0966483 3300048905 Unclassified 773
719 Ga0496104_0297369 3300048907 Bacteria 1527
720 Ga0496107_0044884 3300048910 Bacteria 3178
721 Ga0496109_0554891 3300048912 Bacteria 1084
722 Ga0496112_0173552 3300048915 Bacteria 2121
723 Ga0496112_0877126 3300048915 Bacteria 820
724 Ga0496113_0117724 3300048916 Bacteria 2075
725 Ga0496114_0498130 3300048917 Bacteria 1078
726 Ga0496117_0128934 3300048920 Bacteria 1537
727 Ga0496118_0021877 3300048921 Bacteria 5610
728 Ga0496119_0168618 3300048922 Bacteria 1158
729 Ga0496124_0003599 3300048927 Bacteria 18829
730 Ga0496124_0305346 3300048927 Bacteria 1147
731 Ga0496126_0011237 3300048929 Bacteria 9289
732 Ga0495678_015023 3300049459 Bacteria 3579
733 Ga0501290_002698 3300049513 Bacteria 2277
734 Ga0501291_008920 3300049514 Bacteria 1396
735 Ga0501293_002809 3300049516 Bacteria 1331
736 Ga0501296_009601 3300049519 Bacteria 1136
737 Ga0501298_001396 3300049521 Bacteria 3548
738 Ga0501047_0054598 3300049581 Bacteria 3864
739 Ga0501047_0548429 3300049581 Bacteria 981
740 Ga0501198_002120 3300049649 Bacteria 2642
741 Ga0501206_007264 3300049653 Bacteria 1451
742 Ga0501207_002295 3300049654 Bacteria 2457
743 Ga0501216_039212 3300049660 Bacteria 900
744 Ga0501217_000489 3300049661 Bacteria 6526
745 Ga0501217_054947 3300049661 Unclassified 1050
746 Ga0501223_001730 3300049663 Bacteria 4975
747 Ga0501224_002043 3300049664 Bacteria 2733
748 Ga0501224_009149 3300049664 Bacteria 1448
749 Ga0501233_010382 3300049668 Bacteria 1833
750 Ga0501235_001605 3300049669 Bacteria 4845
751 Ga0501238_000247 3300049671 Bacteria 7436
752 Ga0501240_011501 3300049673 Bacteria 1194
753 Ga0501242_002934 3300049674 Bacteria 1821
754 Ga0501243_008554 3300049675 Bacteria 1579
755 Ga0501249_059929 3300049679 Bacteria 881
756 Ga0501252_004914 3300049682 Bacteria 1438
757 Ga0501253_003346 3300049683 Bacteria 1914
758 Ga0501257_003363 3300049686 Bacteria 3428
759 Ga0501257_054991 3300049686 Bacteria 998
760 Ga0501259_002592 3300049688 Bacteria 2917
761 Ga0501259_006838 3300049688 Bacteria 1819
762 Ga0501260_002621 3300049689 Bacteria 1568
763 Ga0501261_000798 3300049690 Bacteria 3928
764 Ga0501221_005416 3300049704 Bacteria 2131
765 Ga0501234_001087 3300049707 Bacteria 4298
766 Ga0501245_001058 3300049708 Bacteria 3544
767 Ga0501245_001369 3300049708 Bacteria 3141
768 Ga0501232_001573 3300049757 Bacteria 1846
769 Ga0501266_000009 3300049763 Bacteria 233584
770 Ga0501266_014609 3300049763 Bacteria 1031
771 Ga0501268_006041 3300049765 Bacteria 1762
772 Ga0501280_000234 3300049776 Bacteria 13979
773 Ga0501044_0155377 3300049823 Bacteria 2267
774 Ga0501044_0607011 3300049823 Bacteria 987
775 Ga0501212_008257 3300049851 Bacteria 1445
776 nmdc:mga03n38_4510_c1 3300050490 Bacteria 4629
777 nmdc:mga0k408_184175_c1 3300050493 Bacteria 1245
778 nmdc:mga0k408_48_c1 3300050493 Bacteria 60474
779 nmdc:mga0k408_7455_c1 3300050493 Bacteria 5842
780 nmdc:mga07m45_23288_c1 3300050496 Bacteria 3384
781 nmdc:mga07m45_6486_c1 3300050496 Bacteria 5918
782 nmdc:mga05p37_473606_c1 3300050507 Unclassified 1444
783 nmdc:mga09592_20367_c1 3300050508 Bacteria 5452
784 nmdc:mga09592_281014_c1 3300050508 Bacteria 1444
785 nmdc:mga0qj67_124526_c1 3300050509 Bacteria 2086
786 nmdc:mga06r32_103037_c1 3300050510 Bacteria 2802
787 nmdc:mga06r32_442933_c1 3300050510 Bacteria 1279
788 nmdc:mga08y16_72804_c1 3300050511 Bacteria 3581
789 nmdc:mga0n895_558669_c1 3300050512 Bacteria 1150
790 nmdc:mga08x19_644_c1 3300050514 Bacteria 22569
791 nmdc:mga0a205_274466_c1 3300050515 Bacteria 1562
792 nmdc:mga0sz30_35_c1 3300050516 Bacteria 39496
793 Ga0500635_0038275 3300053080 Bacteria 1590
794 Ga0495619_0075549 3300053085 Bacteria 2261
795 Ga0500578_0000029 3300053086 Bacteria 140078
796 Ga0500643_000001 3300053087 Bacteria 1440111
797 Ga0500646_0048854 3300053090 Bacteria 1214
798 Ga0500583_0010625 3300053092 Bacteria 3426
799 Ga0500651_0000596 3300053093 Bacteria 18092
800 Ga0500641_0000048 3300053096 Bacteria 57304
801 Ga0500592_000055 3300053116 Bacteria 33352
802 Ga0500618_000002 3300053125 Bacteria 370822
803 Ga0500559_0015702 3300053136 Bacteria 3197
804 Ga0500568_0013786 3300053139 Bacteria 3673
805 Ga0500568_0070434 3300053139 Bacteria 1340
806 Ga0500568_0131135 3300053139 Bacteria 932
807 Ga0500573_0000358 3300053140 Bacteria 19420
808 Ga0500588_0002830 3300053146 Bacteria 3591
809 Ga0500589_058678 3300053147 Bacteria 1769
810 Ga0500604_0030370 3300053151 Bacteria 1580
811 Ga0500622_0000384 3300053156 Bacteria 42700
812 Ga0500622_0003212 3300053156 Bacteria 11115
813 Ga0500622_0012829 3300053156 Bacteria 4528
814 Ga0466962_0069036 3300061719 Bacteria 1688
815 Ga0466962_0232653 3300061719 Bacteria 904
816 2509442784 2509276033 Bacteria 7180565
817 2644011057 2643221600 Bacteria 5530138
818 2644042592 2643221606 Bacteria 5588032
819 2644683918 2643221725 Bacteria 5087956
820 2739587990 2739367651 Bacteria 6359826
821 2739614361 2739367656 Bacteria 5152243
822 2739646897 2739367663 Bacteria 5040914
823 2765469437 2765235802 Bacteria 5618596
824 2793315441 2791355259 Bacteria 7254731
825 2793328657 2791355261 Bacteria 6661293
826 2793366141 2791355267 Bacteria 7222458
827 2802652193 2802428842 Bacteria 4926114
828 2819679451 2818991460 Bacteria 7595395
829 2838022846 2838022645 Bacteria 6494267
830 2838665211 2838661181 Bacteria 7385261
831 2842201327 2842198810 Bacteria 6608673
832 2842287844 2842285085 Bacteria 6011953
833 2842348413 2842341865 Bacteria 7003929
834 2842367006 2842363717 Bacteria 6844742
835 2842399775 2842395702 Bacteria 6780583
836 2842404628 2842402390 Bacteria 6681310
837 2842411211 2842409023 Bacteria 6687331
838 2842418340 2842415677 Bacteria 6596907
839 2842724241 2842722452 Bacteria 6263924
840 2842906243 2842903701 Bacteria 6986368
841 2842913625 2842909656 Bacteria 6185908
842 2849282563 2849281842 Bacteria 6065644
843 2852626462 2852623160 Bacteria 4376875
844 2857617380 2857613821 Bacteria 4917088
845 2857621284 2857618242 Bacteria 5635925
846 2857631688 2857627736 Bacteria 5625397
847 2884791920 2884791551 Bacteria 8511252
848 2884934888 2884933994 Bacteria 4535041
849 2919186757 2919186247 Bacteria 6244071
850 2919195776 2919191525 Bacteria 5765973
851 2919440705 2919437846 Bacteria 6199444
852 2929179763 2929177148 Bacteria 7883697
853 2929243016 2929239360 Bacteria 7745570
854 2939665974 2939664404 Bacteria 6364494
855 2945982185 2945977869 Bacteria 7777518
856 2945998934 2945997725 Bacteria 6404843
857 2946018424 2946013367 Bacteria 7766675
858 2954021383 2954016120 Bacteria 6446024
859 2965320862 2965320100 Bacteria 3975600
860 2977236834 2977232053 Bacteria 5485925
861 2977268923 2977268062 Bacteria 5243061
862 2996894003 2996893221 Bacteria 5823108
863 8005303743 8005301065 Bacteria 6614431
864 8005384768 8005382845 Bacteria 6732062
865 8005398218 8005395548 Bacteria 6806915
866 8005688469 8005682033 Bacteria 6726518
867 8005691422 8005688590 Bacteria 6610080
868 8005696427 8005695170 Bacteria 6912330
869 8054305148 8054302542 Bacteria 5698134
870 8054309755 8054307821 Bacteria 5212224
871 8055914983 8055909800 Bacteria 7278581
872 8056379831 8056375014 Bacteria 7006639
873 8056387799 8056382006 Bacteria 6408074
874 Ga0395899_0115664
875 SwRhRL2b_contig_2056031
876 SwRhRL2b_contig_909155
877 JGI24735J21928_10044086
878 JGI24738J21930_10020408
879 JGI25154J39366_1000004
880 JGI25157J39369_1006301
881 JGI25152J39213_1000178
882 JGI25150J39212_1000021
883 JGI25151J46595_10000078
884 JGI25406J46586_10000254
885 JGI25153J46596_10000057
886 JGI25153J46596_10029200
887 rootH1_10035892
888 rootH2_10209339
889 rootL2_10019401
890 rootH1_10010533
891 rootH1_10044234
892 rootH1_10072613
893 JGI25160J50197_1004985
894 Ga0055531_10000151
895 Ga0058863_11688669
896 Ga0065165_1002699
897 Ga0065165_1024492
898 Ga0065714_10003347
899 Ga0065714_10007490
900 Ga0065714_10084037
901 Ga0065714_10085601
902 Ga0065714_10105575
903 Ga0065704_10000208
904 Ga0065704_10001802
905 Ga0065712_10216383
906 Ga0065715_10016699
907 Ga0070658_10090806
908 Ga0070658_10142292
909 Ga0070658_10393274
910 Ga0070676_10057975
911 Ga0070683_100002599
912 Ga0070683_100003284
913 Ga0070683_100013362
914 Ga0070683_100080685
915 Ga0070683_100508283
916 Ga0070683_100725931
917 Ga0070690_100016043
918 Ga0070690_100079964
919 Ga0070670_100029618
920 Ga0070670_100036434
921 Ga0070670_100052770
922 Ga0070670_100067272
923 Ga0070670_100142102
924 Ga0070670_100184510
925 Ga0070670_100231830
926 Ga0070670_100302088
927 Ga0070670_100379447
928 Ga0070670_100601890
929 Ga0070677_10185431
930 Ga0068869_100039234
931 Ga0068869_100123818
932 Ga0068869_100135545
933 Ga0068869_100241345
934 Ga0068869_100381515
935 Ga0070666_10189427
936 Ga0070666_10210984
937 Ga0070680_100004414
938 Ga0070680_100093459
939 Ga0070680_100400147
940 Ga0070682_100127057
941 Ga0068868_100020461
942 Ga0068868_100056313
943 Ga0068868_100173668
944 Ga0068868_100178822
945 Ga0068868_100389799
946 Ga0070660_100042079
947 Ga0070660_100089693
948 Ga0070660_100242632
949 Ga0070689_100054288
950 Ga0070689_100098596
951 Ga0070689_100099781
952 Ga0070689_100313811
953 Ga0070691_10024735
954 Ga0070687_100024118
955 Ga0070661_100005419
956 Ga0070661_100062929
957 Ga0070661_100416070
958 Ga0070692_10093181
959 Ga0070668_100016313
960 Ga0070668_100164808
961 Ga0070669_100008697
962 Ga0070669_100110488
963 Ga0070669_100122108
964 Ga0070675_100121052
965 Ga0070675_100205455
966 Ga0070675_100248375
967 Ga0070671_100035724
968 Ga0070671_100181309
969 Ga0070671_100233840
970 Ga0070671_100378922
971 Ga0070673_100051414
972 Ga0070673_100058753
973 Ga0070673_100091911
974 Ga0070673_100249163
975 Ga0070673_100344836
976 Ga0070673_100452645
977 Ga0070688_100016696
978 Ga0070688_100041035
979 Ga0070688_100119872
980 Ga0070659_100018639
981 Ga0070659_100073750
982 Ga0070659_100079203
983 Ga0070659_100150254
984 Ga0070667_100026222
985 Ga0070667_100030328
986 Ga0070667_100232597
987 Ga0070714_100662671
988 Ga0070701_10064463
989 Ga0070701_10140581
990 Ga0070700_100329322
991 Ga0070663_100008726
992 Ga0070663_100037948
993 Ga0070663_100122107
994 Ga0070678_100198856
995 Ga0070678_100473103
996 Ga0070678_100661807
997 Ga0070662_100002229
998 Ga0070662_100011227
999 Ga0070662_100060331
1000 Ga0070662_100127506
1001 Ga0070681_10007244
1002 Ga0070681_10014926
1003 Ga0070681_10099103
1004 Ga0068867_100085928
1005 Ga0068867_100233481
1006 Ga0070685_10034327
1007 Ga0070685_10081299
1008 Ga0070685_10094996
1009 Ga0070685_10143126
1010 Ga0070685_10160407
1011 Ga0070698_100035084
1012 Ga0070698_100522404
1013 Ga0070679_100000261
1014 Ga0070684_100009695
1015 Ga0070684_100010017
1016 Ga0070684_100014664
1017 Ga0070684_100040560
1018 Ga0070684_100345421
1019 Ga0068853_100002363
1020 Ga0068853_100188030
1021 Ga0068853_100504452
1022 Ga0068853_100703709
1023 Ga0070672_100056886
1024 Ga0070672_100111323
1025 Ga0070672_100258693
1026 Ga0070672_100495825
1027 Ga0070672_100587983
1028 Ga0070693_100068419
1029 Ga0070665_100000205
1030 Ga0070665_100062451
1031 Ga0070665_100063508
1032 Ga0070665_100063617
1033 Ga0068855_100000033
1034 Ga0068855_100000724
1035 Ga0068855_100005855
1036 Ga0068855_100009537
1037 Ga0068855_100016101
1038 Ga0068855_100042678
1039 Ga0068855_100140971
1040 Ga0068855_100170729
1041 Ga0068855_100342501
1042 Ga0070664_100011685
1043 Ga0070664_100019632
1044 Ga0070664_100045032
1045 Ga0070664_100059352
1046 Ga0070664_100091776
1047 Ga0070664_100125970
1048 Ga0070664_100361684
1049 Ga0068857_100007316
1050 Ga0068857_100015569
1051 Ga0068857_100033142
1052 Ga0068857_100094269
1053 Ga0068857_100105507
1054 Ga0068857_100697698
1055 Ga0068854_100012353
1056 Ga0068854_100155438
1057 Ga0068854_100363504
1058 Ga0068854_100452165
1059 Ga0068856_100036562
1060 Ga0068856_100074923
1061 Ga0068856_100082741
1062 Ga0070702_100218726
1063 Ga0068852_100000368
1064 Ga0068852_100014069
1065 Ga0068852_100017426
1066 Ga0068852_100063278
1067 Ga0068852_100078238
1068 Ga0068852_100125392
1069 Ga0068852_100138311
1070 Ga0068852_100139705
1071 Ga0068859_100022454
1072 Ga0068859_100087409
1073 Ga0068859_100186436
1074 Ga0068859_100201187
1075 Ga0068859_100261651
1076 Ga0068864_100025261
1077 Ga0068864_100081858
1078 Ga0068864_100094931
1079 Ga0068864_100202995
1080 Ga0068864_100340116
1081 Ga0068866_10038610
1082 Ga0068866_10120883
1083 Ga0068861_100103689
1084 Ga0068851_10047712
1085 Ga0068870_10355579
1086 Ga0068863_100013238
1087 Ga0068863_100047906
1088 Ga0068863_100373016
1089 Ga0068863_100550760
1090 Ga0068858_100024215
1091 Ga0068858_100113418
1092 Ga0068860_100009501
1093 Ga0068860_100032432
1094 Ga0068860_100044231
1095 Ga0068862_100051975
1096 Ga0068862_100180126
1097 Ga0081539_10001900
1098 Ga0081539_10038125
1099 Ga0075363_100002744
1100 Ga0075369_10000022
1101 Ga0075366_10000493
1102 Ga0075366_10003181
1103 Ga0075366_10028307
1104 Ga0097621_100067164
1105 Ga0097621_100118194
1106 Ga0097621_100398818
1107 Ga0068871_100029030
1108 Ga0068871_100182765
1109 Ga0068871_100326388
1110 Ga0075428_100014269
1111 Ga0075428_100017394
1112 Ga0075428_100160684
1113 Ga0075428_100169103
1114 Ga0075430_100014698
1115 Ga0075430_100052808
1116 Ga0075431_100024723
1117 Ga0075431_100049098
1118 Ga0075431_100240198
1119 Ga0075433_10256723
1120 Ga0075429_100006082
1121 Ga0075429_100102502
1122 Ga0075429_100577034
1123 Ga0068865_100169652
1124 Ga0068865_100595465
1125 Ga0075436_100000340
1126 Ga0097620_100022453
1127 Ga0097620_100087401
1128 Ga0097620_100186445
1129 Ga0097620_100201180
1130 Ga0097620_100261623
1131 Ga0105240_10000020
1132 Ga0105240_10002198
1133 Ga0105240_10029260
1134 Ga0105240_10095427
1135 Ga0105240_10224569
1136 Ga0105240_10668553
1137 Ga0111539_10048554
1138 Ga0105247_10423230
1139 Ga0114129_10040856
1140 Ga0105241_10063449
1141 Ga0105241_10179178
1142 Ga0105241_10193872
1143 Ga0105241_10341143
1144 Ga0105241_10608530
1145 Ga0105242_10024277
1146 Ga0105242_10093451
1147 Ga0105242_10188128
1148 Ga0105242_10228529
1149 Ga0105237_10000143
1150 Ga0105237_10001072
1151 Ga0105237_10001440
1152 Ga0105237_10045725
1153 Ga0105237_10132929
1154 Ga0105238_10041777
1155 Ga0105249_10010289
1156 Ga0105249_10014619
1157 Ga0105249_10062101
1158 Ga0105239_10000002
1159 Ga0105239_10000136
1160 Ga0105239_10001354
1161 Ga0105239_10215387
1162 Ga0105246_10000302
1163 Ga0105246_10104980
1164 Ga0157373_10000064
1165 Ga0157373_10000154
1166 Ga0157373_10005219
1167 Ga0157373_10012974
1168 Ga0157373_10013107
1169 Ga0157373_10053286
1170 Ga0157373_10059948
1171 Ga0157373_10104812
1172 Ga0157371_10000135
1173 Ga0157371_10001388
1174 Ga0157371_10001497
1175 Ga0157371_10002087
1176 Ga0157371_10002968
1177 Ga0157371_10006874
1178 Ga0157371_10050066
1179 Ga0157371_10125589
1180 Ga0157371_10133198
1181 Ga0157371_10151309
1182 Ga0157371_10151585
1183 Ga0157371_10325152
1184 Ga0157370_10001449
1185 Ga0157370_10002674
1186 Ga0157370_10007812
1187 Ga0157370_10038640
1188 Ga0157370_10123063
1189 Ga0157370_10249387
1190 Ga0157370_10398592
1191 Ga0157370_10439379
1192 Ga0157370_10518708
1193 Ga0157369_10005954
1194 Ga0157369_10033631
1195 Ga0157369_10124437
1196 Ga0157369_10256644
1197 Ga0157369_10453443
1198 Ga0157369_10501742
1199 Ga0157374_10003869
1200 Ga0157374_10040129
1201 Ga0157374_10094858
1202 Ga0157374_10391017
1203 Ga0157374_10644700
1204 Ga0157378_10000557
1205 Ga0157378_10006087
1206 Ga0157378_10025884
1207 Ga0157378_10050643
1208 Ga0157378_10142229
1209 Ga0157378_10168685
1210 Ga0157378_10243617
1211 Ga0163162_10000254
1212 Ga0163162_10016096
1213 Ga0163162_10064751
1214 Ga0163162_10069871
1215 Ga0163162_10081298
1216 Ga0163162_10082667
1217 Ga0163162_10102532
1218 Ga0163162_10173159
1219 Ga0163162_10210054
1220 Ga0163162_10224616
1221 Ga0163162_10321898
1222 Ga0163162_10731147
1223 Ga0157372_10000029
1224 Ga0157372_10000061
1225 Ga0157372_10018416
1226 Ga0157372_10023276
1227 Ga0157372_10048744
1228 Ga0157372_10105425
1229 Ga0157372_10178130
1230 Ga0157372_10197959
1231 Ga0157372_10250687
1232 Ga0157372_10377530
1233 Ga0157372_10434000
1234 Ga0157372_10484761
1235 Ga0157372_10555015
1236 Ga0157375_10032527
1237 Ga0157375_10036964
1238 Ga0157375_10077202
1239 Ga0157375_10077731
1240 Ga0157375_10128523
1241 Ga0157375_10251899
1242 Ga0157375_10595993
1243 Ga0157375_11357778
1244 Ga0163163_10001144
1245 Ga0163163_10006882
1246 Ga0163163_10019272
1247 Ga0163163_10030868
1248 Ga0163163_10086192
1249 Ga0163163_10145364
1250 Ga0163163_10177718
1251 Ga0157380_10008071
1252 Ga0157380_10342077
1253 Ga0157380_10593258
1254 Ga0157380_10671964
1255 Ga0157377_10000723
1256 Ga0157377_10033385
1257 Ga0157377_10068046
1258 Ga0157377_10136205
1259 Ga0157377_10158274
1260 Ga0157377_10244038
1261 Ga0157379_10197830
1262 Ga0157379_10802649
1263 Ga0157376_10124212
1264 Ga0157376_10171273
1265 Ga0182006_1000668
1266 Ga0182006_1013089
1267 Ga0182007_10023721
1268 Ga0183373_1004
1269 Ga0163161_10022366
1270 Ga0163161_10025767
1271 Ga0163161_10038137
1272 Ga0163161_10215799
1273 Ga0163161_10402573
1274 Ga0213876_10046993
1275 Ga0213875_10009671
1276 Ga0207425_1000004
1277 Ga0209646_1000025
1278 Ga0209026_1000097
1279 Ga0209026_1000226
1280 Ga0209026_1007599
1281 Ga0209148_1001642
1282 Ga0209129_1000048
1283 Ga0209233_1001263
1284 Ga0209455_1001752
1285 Ga0209025_1000009
1286 Ga0209758_1000010
1287 Ga0209758_1021370
1288 Ga0207426_1000220
1289 Ga0209257_1000013
1290 Ga0207656_10033876
1291 Ga0207682_10048712
1292 Ga0207682_10203609
1293 Ga0207642_10035445
1294 Ga0207688_10057097
1295 Ga0207680_10040907
1296 Ga0207647_10000105
1297 Ga0207647_10026086
1298 Ga0207647_10046356
1299 Ga0207645_10065399
1300 Ga0207643_10049704
1301 Ga0207705_10121483
1302 Ga0207705_10125744
1303 Ga0207705_10234134
1304 Ga0207654_10001489
1305 Ga0207707_10022653
1306 Ga0207695_10000020
1307 Ga0207695_10000076
1308 Ga0207695_10000090
1309 Ga0207695_10000183
1310 Ga0207695_10002461
1311 Ga0207695_10644465
1312 Ga0207671_10000968
1313 Ga0207671_10010707
1314 Ga0207671_10015831
1315 Ga0207671_10024163
1316 Ga0207671_10108150
1317 Ga0207660_10025129
1318 Ga0207662_10044920
1319 Ga0207662_10092114
1320 Ga0207657_10023160
1321 Ga0207657_10072360
1322 Ga0207657_10160815
1323 Ga0207649_10014835
1324 Ga0207649_10057090
1325 Ga0207649_10450540
1326 Ga0207652_10000011
1327 Ga0207652_10000057
1328 Ga0207681_10109054
1329 Ga0207650_10014868
1330 Ga0207650_10020937
1331 Ga0207650_10078395
1332 Ga0207650_10198702
1333 Ga0207650_10357199
1334 Ga0207650_10406835
1335 Ga0207659_10106702
1336 Ga0207644_10210437
1337 Ga0207690_10025553
1338 Ga0207690_10036836
1339 Ga0207690_10109974
1340 Ga0207690_10213637
1341 Ga0207706_10001578
1342 Ga0207706_10002076
1343 Ga0207706_10005829
1344 Ga0207706_10016578
1345 Ga0207706_10027456
1346 Ga0207706_10112280
1347 Ga0207706_10154478
1348 Ga0207706_10379158
1349 Ga0207686_10000200
1350 Ga0207686_10048259
1351 Ga0207686_10190230
1352 Ga0207686_10584200
1353 Ga0207670_10037753
1354 Ga0207670_10072649
1355 Ga0207669_10269836
1356 Ga0207669_10583069
1357 Ga0207704_10363376
1358 Ga0207691_10009195
1359 Ga0207691_10022720
1360 Ga0207691_10027317
1361 Ga0207691_10065448
1362 Ga0207691_10515176
1363 Ga0207691_10530201
1364 Ga0207689_10019312
1365 Ga0207689_10024873
1366 Ga0207689_10081856
1367 Ga0207689_10129789
1368 Ga0207689_10216924
1369 Ga0207661_10001267
1370 Ga0207661_10003205
1371 Ga0207661_10013373
1372 Ga0207661_10018874
1373 Ga0207661_10816807
1374 Ga0207679_10001116
1375 Ga0207679_10128873
1376 Ga0207679_10167758
1377 Ga0207667_10000046
1378 Ga0207667_10001827
1379 Ga0207667_10008253
1380 Ga0207667_10010255
1381 Ga0207667_10020033
1382 Ga0207667_10375090
1383 Ga0207667_11005440
1384 Ga0207651_10028157
1385 Ga0207651_10059328
1386 Ga0207651_10067659
1387 Ga0207651_10099582
1388 Ga0207651_10151998
1389 Ga0207651_10173823
1390 Ga0207712_10003728
1391 Ga0207668_10022614
1392 Ga0207640_10017916
1393 Ga0207640_10051822
1394 Ga0207640_10660039
1395 Ga0207640_10701423
1396 Ga0207658_10063971
1397 Ga0207658_10067976
1398 Ga0207658_10443663
1399 Ga0207658_10558323
1400 Ga0207677_10017707
1401 Ga0207677_10071979
1402 Ga0207677_10138691
1403 Ga0207677_10406427
1404 Ga0207677_10531383
1405 Ga0207703_10047038
1406 Ga0207639_10023309
1407 Ga0207639_10052640
1408 Ga0207639_10129475
1409 Ga0207639_10467119
1410 Ga0207639_10632677
1411 Ga0207678_10017720
1412 Ga0207678_10049634
1413 Ga0207678_10275028
1414 Ga0207702_10015591
1415 Ga0207702_10043524
1416 Ga0207702_10258837
1417 Ga0207641_10027621
1418 Ga0207641_10061070
1419 Ga0207641_10077126
1420 Ga0207641_10082085
1421 Ga0207648_10013383
1422 Ga0207648_10021636
1423 Ga0207648_10106170
1424 Ga0207648_10250463
1425 Ga0207648_10321711
1426 Ga0207648_10322692
1427 Ga0207676_10016147
1428 Ga0207676_10052782
1429 Ga0207676_10094665
1430 Ga0207676_10509823
1431 Ga0207676_10519506
1432 Ga0207676_10558704
1433 Ga0207674_10008940
1434 Ga0207674_10012134
1435 Ga0207674_10014085
1436 Ga0207674_10045160
1437 Ga0207674_10121909
1438 Ga0207674_10167101
1439 Ga0207674_10177487
1440 Ga0207675_100001919
1441 Ga0207683_10006292
1442 Ga0207683_10035576
1443 Ga0207683_10202089
1444 Ga0207683_10273387
1445 Ga0207683_10428358
1446 Ga0207698_10080730
1447 Ga0207698_10142932
1448 Ga0207698_10234563
1449 Ga0207698_10496746
1450 Ga0207698_10642326
1451 Ga0207428_10049291
1452 Ga0268266_10001358
1453 Ga0268266_10036128
1454 Ga0268266_10218401
1455 Ga0268265_10221070
1456 Ga0268264_10010214
1457 Ga0268264_10081788
1458 Ga0307517_10008092
1459 Ga0307515_10000039
1460 Ga0307515_10048464
1461 Ga0307515_10323371
1462 Ga0316177_1010194
1463 Ga0316176_1025003
1464 Ga0307513_10373342
1465 Ga0307509_10023952
1466 Ga0307408_100009720
1467 Ga0307408_100023313
1468 Ga0307405_10000006
1469 Ga0307405_10056393
1470 Ga0307413_10384513
1471 Ga0307410_10003816
1472 Ga0307406_10101850
1473 Ga0307407_10000003
1474 Ga0307407_10003725
1475 Ga0307407_10152810
1476 Ga0307412_10000009
1477 Ga0307412_10018528
1478 Ga0307412_10023992
1479 Ga0307412_10037612
1480 Ga0307412_10070344
1481 Ga0307412_10114415
1482 Ga0307409_100076377
1483 Ga0307416_100000002
1484 Ga0307414_10000002
1485 Ga0307414_10037074
1486 Ga0307414_10039538
1487 Ga0307414_10071869
1488 Ga0307414_10229227
1489 Ga0307414_10265527
1490 Ga0307414_10286804
1491 Ga0307414_10772441
1492 Ga0307411_10000010
1493 Ga0307411_10471659
1494 Ga0307415_100002127
1495 Ga0373943_0033831
1496 Ga0373955_0028710
1497 Ga0373933_0062939
1498 Ga0373937_0006714
1499 Ga0373937_0114269
1500 Ga0395899_0000011
1501 Ga0395899_0000024
1502 Ga0395899_0005151
1503 Ga0395900_0003816
1504 Ga0395900_0088189
1505 Ga0395900_0377432
1506 Ga0395898_0005129
1507 Ga0395898_0135839
1508 Ga0395898_0170216
1509 Ga0395905_0202273
1510 Ga0395905_0357783
1511 Ga0436364_0518085
1512 Ga0395901_0014835
1513 Ga0395901_0037327
1514 Ga0436365_0262826
1515 Ga0439433_0017256
1516 Ga0439462_0024915
1517 Ga0451577_0005367
1518 Ga0451577_0729678
1519 Ga0466969_0000262
1520 Ga0466969_0022399
1521 Ga0466972_0135572
1522 Ga0453683_0156002
1523 Ga0466966_0000114
1524 Ga0466961_0033151
1525 Ga0466961_0049507
1526 Ga0466961_0153324
1527 Ga0466964_0025102
1528 Ga0453684_0004533
1529 Ga0453684_0083924
1530 Ga0453684_0323132
1531 Ga0466968_0038250
1532 Ga0466968_0069192
1533 Ga0466959_0000049
1534 Ga0466959_0024789
1535 Ga0466959_0303585
1536 Ga0466958_0190894
1537 Ga0495627_001033
1538 Ga0495592_0018558
1539 Ga0495650_0000216
1540 Ga0495650_0037213
1541 Ga0495585_0000103
1542 Ga0495606_0000263
1543 Ga0495606_0008892
1544 Ga0495606_0017691
1545 Ga0495608_0090875
1546 Ga0495610_0003125
1547 Ga0495610_0084974
1548 Ga0495610_0158482
1549 Ga0495616_0067203
1550 Ga0495628_0021207
1551 Ga0495630_0008614
1552 Ga0495637_0078062
1553 Ga0495643_0002269
1554 Ga0495648_0034045
1555 Ga0495663_0000838
1556 Ga0495652_0240085
1557 Ga0495652_0371277
1558 Ga0495598_0097749
1559 Ga0495633_0049879
1560 Ga0495668_0000115
1561 Ga0495668_0002946
1562 Ga0495634_0031017
1563 Ga0495625_0000125
1564 Ga0495625_0010849
1565 Ga0495661_0017390
1566 Ga0495661_0050902
1567 Ga0495657_0113681
1568 Ga0495599_0085578
1569 Ga0495658_0074600
1570 Ga0495624_0261831
1571 Ga0495649_0000044
1572 Ga0495600_0221464
1573 Ga0495660_0004886
1574 Ga0495672_0019853
1575 Ga0495672_0024130
1576 Ga0495680_0285582
1577 Ga0495687_013604
1578 Ga0495687_088676
1579 Ga0495675_0288247
1580 Ga0495679_052761
1581 Ga0495673_0027605
1582 Ga0495681_0000600
1583 Ga0495684_0085342
1584 Ga0495686_0000150
1585 Ga0495686_0000763
1586 Ga0495686_0001123
1587 Ga0495686_0014532
1588 Ga0495686_0077585
1589 Ga0495686_0127887
1590 Ga0496102_0091955
1591 Ga0496102_0966483
1592 Ga0496104_0297369
1593 Ga0496107_0044884
1594 Ga0496109_0554891
1595 Ga0496112_0173552
1596 Ga0496112_0877126
1597 Ga0496113_0117724
1598 Ga0496114_0498130
1599 Ga0496117_0128934
1600 Ga0496118_0021877
1601 Ga0496119_0168618
1602 Ga0496124_0003599
1603 Ga0496124_0305346
1604 Ga0496126_0011237
1605 Ga0495678_015023
1606 Ga0501290_002698
1607 Ga0501291_008920
1608 Ga0501293_002809
1609 Ga0501296_009601
1610 Ga0501298_001396
1611 Ga0501047_0054598
1612 Ga0501047_0548429
1613 Ga0501198_002120
1614 Ga0501206_007264
1615 Ga0501207_002295
1616 Ga0501216_039212
1617 Ga0501217_000489
1618 Ga0501217_054947
1619 Ga0501223_001730
1620 Ga0501224_002043
1621 Ga0501224_009149
1622 Ga0501233_010382
1623 Ga0501235_001605
1624 Ga0501238_000247
1625 Ga0501240_011501
1626 Ga0501242_002934
1627 Ga0501243_008554
1628 Ga0501249_059929
1629 Ga0501252_004914
1630 Ga0501253_003346
1631 Ga0501257_003363
1632 Ga0501257_054991
1633 Ga0501259_002592
1634 Ga0501259_006838
1635 Ga0501260_002621
1636 Ga0501261_000798
1637 Ga0501221_005416
1638 Ga0501234_001087
1639 Ga0501245_001058
1640 Ga0501245_001369
1641 Ga0501232_001573
1642 Ga0501266_000009
1643 Ga0501266_014609
1644 Ga0501268_006041
1645 Ga0501280_000234
1646 Ga0501044_0155377
1647 Ga0501044_0607011
1648 Ga0501212_008257
1649 nmdc:mga03n38_4510_c1
1650 nmdc:mga0k408_184175_c1
1651 nmdc:mga0k408_48_c1
1652 nmdc:mga0k408_7455_c1
1653 nmdc:mga07m45_23288_c1
1654 nmdc:mga07m45_6486_c1
1655 nmdc:mga05p37_473606_c1
1656 nmdc:mga09592_20367_c1
1657 nmdc:mga09592_281014_c1
1658 nmdc:mga0qj67_124526_c1
1659 nmdc:mga06r32_103037_c1
1660 nmdc:mga06r32_442933_c1
1661 nmdc:mga08y16_72804_c1
1662 nmdc:mga0n895_558669_c1
1663 nmdc:mga08x19_644_c1
1664 nmdc:mga0a205_274466_c1
1665 nmdc:mga0sz30_35_c1
1666 Ga0500635_0038275
1667 Ga0495619_0075549
1668 Ga0500578_0000029
1669 Ga0500643_000001
1670 Ga0500646_0048854
1671 Ga0500583_0010625
1672 Ga0500651_0000596
1673 Ga0500641_0000048
1674 Ga0500592_000055
1675 Ga0500618_000002
1676 Ga0500559_0015702
1677 Ga0500568_0013786
1678 Ga0500568_0070434
1679 Ga0500568_0131135
1680 Ga0500573_0000358
1681 Ga0500588_0002830
1682 Ga0500589_058678
1683 Ga0500604_0030370
1684 Ga0500622_0000384
1685 Ga0500622_0003212
1686 Ga0500622_0012829
1687 Ga0466962_0069036
1688 Ga0466962_0232653
1689 2509442784
1690 2644011057
1691 2644042592
1692 2644683918
1693 2739587990
1694 2739614361
1695 2739646897
1696 2765469437
1697 2793315441
1698 2793328657
1699 2793366141
1700 2802652193
1701 2819679451
1702 2838022846
1703 2838665211
1704 2842201327
1705 2842287844
1706 2842348413
1707 2842367006
1708 2842399775
1709 2842404628
1710 2842411211
1711 2842418340
1712 2842724241
1713 2842906243
1714 2842913625
1715 2849282563
1716 2852626462
1717 2857617380
1718 2857621284
1719 2857631688
1720 2884791920
1721 2884934888
1722 2919186757
1723 2919195776
1724 2919440705
1725 2929179763
1726 2929243016
1727 2939665974
1728 2945982185
1729 2945998934
1730 2946018424
1731 2954021383
1732 2965320862
1733 2977236834
1734 2977268923
1735 2996894003
1736 8005303743
1737 8005384768
1738 8005398218
1739 8005688469
1740 8005691422
1741 8005696427
1742 8054305148
1743 8054309755
1744 8055914983
1745 8056379831
1746 8056387799

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

43

287

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jc4-assembly1.cif.gz_A 3'-5' exonuclease (nexo) from neisseria meningitidis 0.9676 1 256
2voa-assembly1.cif.gz_B structure of an ap endonuclease from archaeoglobus fulgidus 0.9629 1 257
6fke-assembly1.cif.gz_A structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin 0.9625 1 256
2jc4-assembly1.cif.gz_A 3'-5' exonuclease (nexo) from neisseria meningitidis 0.9603 1 256
2voa-assembly1.cif.gz_B structure of an ap endonuclease from archaeoglobus fulgidus 0.9556 1 257
ID Description Score Start End Superfamily
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9683 1 256 3.60.10.10
2voaB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9604 1 257 3.60.10.10
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9573 1 256 3.60.10.10
2voaB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9531 1 257 3.60.10.10
af_P09030_1_268_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9464 1 257 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A4R1TEC2-F1-model_v4 deleted 0.991 100 255
AF-A0A561GS97-F1-model_v4 deleted 0.99 1 258
AF-A0A7W9XPU7-F1-model_v4 Exodeoxyribonuclease III 0.9899 151 258 GO:0006281
GO:0008311
AF-A0A6H9HGF6-F1-model_v4 Endonuclease/exonuclease/phosphatase domain-containing protein 0.9881 145 258 GO:0006281
GO:0008311
AF-A0A6I3SU57-F1-model_v4 Exodeoxyribonuclease III (EC 3.1.11.2) 0.9874 1 256 GO:0006281
GO:0008311
GO:0046872

Map