F484258
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 873 | 405 | 1746 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0115664|Ga0395899_0115664_640_1530 |
| Length | 296 |
| Sequence | LALQERFITKEDKNFVVKLHKIFIEDLMQFQLNSRIKFVMKIATYNVNGVNGRLPVLLRWLNETSPDVVCLQELKAPQEKFPEEAIKDAGYNAIWHGQKSWNGVAILARNGMPEEICRVLPGDPEDSHSRYIEAIVNGVIIGCLYLPNGNPLPGPKFDYKLRWFERLTAHASQLLASDKPVLLTGDFNVMPTEIDVYKPERWVNDALFRPEVRAAFKTLVSQGWTDAIRKLYPDEVIYTFWDYFRNAYGRNAGLRIDHFLLSSHLDKRLVGAGVDRNVRGWEKTSDHAPVWIELSD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 17 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 126 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 127 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 129 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 193 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 194 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 195 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 196 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 197 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 201 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 202 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 203 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 204 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 213 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 215 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 216 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 217 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 218 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 219 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 220 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 221 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 222 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 223 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 224 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 225 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 226 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 227 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 228 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 229 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 230 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 231 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 232 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 233 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 271 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 272 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 273 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 275 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 276 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 277 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 278 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 279 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 280 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 281 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 282 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 284 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 285 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 286 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 287 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 288 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 290 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 291 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 292 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 293 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 294 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 295 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 296 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 297 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 298 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 299 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 300 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 301 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 302 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 303 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 304 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 305 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 306 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 307 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 308 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 309 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 310 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 311 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 312 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 313 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 314 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 315 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 316 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 318 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 319 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 320 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 321 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 330 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 331 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 333 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 334 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 335 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 336 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 337 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 338 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 339 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 341 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 342 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 343 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 344 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 345 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 346 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 347 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 348 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 349 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 350 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 351 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 352 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 353 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 354 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 355 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 356 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 357 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 358 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 359 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 360 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 361 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 362 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 363 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 364 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 365 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 366 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 367 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 368 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 369 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 370 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 371 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 372 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 373 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 374 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 375 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 376 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 377 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 378 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 379 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 380 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 381 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 382 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 383 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 384 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 385 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 386 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 387 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 388 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 389 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 390 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 391 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 392 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 393 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 394 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 395 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 396 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 397 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 398 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 399 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 400 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 401 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 402 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 403 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 404 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 405 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.24 |
| Metatranscriptomes | 0.11 |
| Isolates | 6.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.84 |
| Nodule | 2.41 |
| Rhizoplane | 1.15 |
| Rhizosphere | 84.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395899_0115664 | 3300037312 | Unclassified | 1925 |
| 2 | SwRhRL2b_contig_2056031 | 2162886007 | Bacteria | 41625 |
| 3 | SwRhRL2b_contig_909155 | 2162886007 | Bacteria | 5929 |
| 4 | JGI24735J21928_10044086 | 3300002067 | Bacteria | 1296 |
| 5 | JGI24738J21930_10020408 | 3300002075 | Bacteria | 1378 |
| 6 | JGI25154J39366_1000004 | 3300002738 | Bacteria | 346460 |
| 7 | JGI25157J39369_1006301 | 3300002741 | Bacteria | 1821 |
| 8 | JGI25152J39213_1000178 | 3300002773 | Bacteria | 42706 |
| 9 | JGI25150J39212_1000021 | 3300002774 | Bacteria | 133190 |
| 10 | JGI25151J46595_10000078 | 3300003187 | Bacteria | 133190 |
| 11 | JGI25406J46586_10000254 | 3300003203 | Bacteria | 23768 |
| 12 | JGI25153J46596_10000057 | 3300003215 | Bacteria | 133190 |
| 13 | JGI25153J46596_10029200 | 3300003215 | Bacteria | 1897 |
| 14 | rootH1_10035892 | 3300003316 | Bacteria | 7472 |
| 15 | rootH2_10209339 | 3300003320 | Bacteria | 3855 |
| 16 | rootL2_10019401 | 3300003322 | Bacteria | 16988 |
| 17 | rootH1_10010533 | 3300003323 | Bacteria | 22719 |
| 18 | rootH1_10044234 | 3300003323 | Bacteria | 8655 |
| 19 | rootH1_10072613 | 3300003323 | Bacteria | 10925 |
| 20 | JGI25160J50197_1004985 | 3300003354 | Bacteria | 5631 |
| 21 | Ga0055531_10000151 | 3300003794 | Bacteria | 80302 |
| 22 | Ga0058863_11688669 | 3300004799 | Bacteria | 1608 |
| 23 | Ga0065165_1002699 | 3300005262 | Bacteria | 14257 |
| 24 | Ga0065165_1024492 | 3300005262 | Bacteria | 2026 |
| 25 | Ga0065714_10003347 | 3300005288 | Bacteria | 22247 |
| 26 | Ga0065714_10007490 | 3300005288 | Bacteria | 3903 |
| 27 | Ga0065714_10084037 | 3300005288 | Bacteria | 2219 |
| 28 | Ga0065714_10085601 | 3300005288 | Bacteria | 2141 |
| 29 | Ga0065714_10105575 | 3300005288 | Bacteria | 1564 |
| 30 | Ga0065704_10000208 | 3300005289 | Bacteria | 101850 |
| 31 | Ga0065704_10001802 | 3300005289 | Bacteria | 10720 |
| 32 | Ga0065712_10216383 | 3300005290 | Bacteria | 1055 |
| 33 | Ga0065715_10016699 | 3300005293 | Bacteria | 2395 |
| 34 | Ga0070658_10090806 | 3300005327 | Bacteria | 2517 |
| 35 | Ga0070658_10142292 | 3300005327 | Bacteria | 2004 |
| 36 | Ga0070658_10393274 | 3300005327 | Bacteria | 1190 |
| 37 | Ga0070676_10057975 | 3300005328 | Bacteria | 2293 |
| 38 | Ga0070683_100002599 | 3300005329 | Bacteria | 14433 |
| 39 | Ga0070683_100003284 | 3300005329 | Bacteria | 13072 |
| 40 | Ga0070683_100013362 | 3300005329 | Bacteria | 7158 |
| 41 | Ga0070683_100080685 | 3300005329 | Bacteria | 3046 |
| 42 | Ga0070683_100508283 | 3300005329 | Bacteria | 1151 |
| 43 | Ga0070683_100725931 | 3300005329 | Bacteria | 952 |
| 44 | Ga0070690_100016043 | 3300005330 | Bacteria | 4479 |
| 45 | Ga0070690_100079964 | 3300005330 | Bacteria | 2137 |
| 46 | Ga0070670_100029618 | 3300005331 | Unclassified | 4713 |
| 47 | Ga0070670_100036434 | 3300005331 | Bacteria | 4233 |
| 48 | Ga0070670_100052770 | 3300005331 | Unclassified | 3491 |
| 49 | Ga0070670_100067272 | 3300005331 | Bacteria | 3074 |
| 50 | Ga0070670_100142102 | 3300005331 | Bacteria | 2076 |
| 51 | Ga0070670_100184510 | 3300005331 | Bacteria | 1811 |
| 52 | Ga0070670_100231830 | 3300005331 | Bacteria | 1607 |
| 53 | Ga0070670_100302088 | 3300005331 | Bacteria | 1400 |
| 54 | Ga0070670_100379447 | 3300005331 | Bacteria | 1245 |
| 55 | Ga0070670_100601890 | 3300005331 | Bacteria | 984 |
| 56 | Ga0070677_10185431 | 3300005333 | Bacteria | 994 |
| 57 | Ga0068869_100039234 | 3300005334 | Bacteria | 3380 |
| 58 | Ga0068869_100123818 | 3300005334 | Bacteria | 1980 |
| 59 | Ga0068869_100135545 | 3300005334 | Bacteria | 1896 |
| 60 | Ga0068869_100241345 | 3300005334 | Bacteria | 1440 |
| 61 | Ga0068869_100381515 | 3300005334 | Unclassified | 1155 |
| 62 | Ga0070666_10189427 | 3300005335 | Bacteria | 1445 |
| 63 | Ga0070666_10210984 | 3300005335 | Bacteria | 1368 |
| 64 | Ga0070680_100004414 | 3300005336 | Bacteria | 10586 |
| 65 | Ga0070680_100093459 | 3300005336 | Bacteria | 2492 |
| 66 | Ga0070680_100400147 | 3300005336 | Bacteria | 1170 |
| 67 | Ga0070682_100127057 | 3300005337 | Bacteria | 1720 |
| 68 | Ga0068868_100020461 | 3300005338 | Bacteria | 4973 |
| 69 | Ga0068868_100056313 | 3300005338 | Bacteria | 3104 |
| 70 | Ga0068868_100173668 | 3300005338 | Bacteria | 1785 |
| 71 | Ga0068868_100178822 | 3300005338 | Bacteria | 1759 |
| 72 | Ga0068868_100389799 | 3300005338 | Bacteria | 1200 |
| 73 | Ga0070660_100042079 | 3300005339 | Bacteria | 3485 |
| 74 | Ga0070660_100089693 | 3300005339 | Bacteria | 2423 |
| 75 | Ga0070660_100242632 | 3300005339 | Bacteria | 1468 |
| 76 | Ga0070689_100054288 | 3300005340 | Bacteria | 3101 |
| 77 | Ga0070689_100098596 | 3300005340 | Bacteria | 2311 |
| 78 | Ga0070689_100099781 | 3300005340 | Bacteria | 2297 |
| 79 | Ga0070689_100313811 | 3300005340 | Bacteria | 1308 |
| 80 | Ga0070691_10024735 | 3300005341 | Bacteria | 2792 |
| 81 | Ga0070687_100024118 | 3300005343 | Bacteria | 2899 |
| 82 | Ga0070661_100005419 | 3300005344 | Bacteria | 8798 |
| 83 | Ga0070661_100062929 | 3300005344 | Bacteria | 2724 |
| 84 | Ga0070661_100416070 | 3300005344 | Bacteria | 1065 |
| 85 | Ga0070692_10093181 | 3300005345 | Bacteria | 1640 |
| 86 | Ga0070668_100016313 | 3300005347 | Bacteria | 5554 |
| 87 | Ga0070668_100164808 | 3300005347 | Bacteria | 1801 |
| 88 | Ga0070669_100008697 | 3300005353 | Bacteria | 7242 |
| 89 | Ga0070669_100110488 | 3300005353 | Bacteria | 2086 |
| 90 | Ga0070669_100122108 | 3300005353 | Bacteria | 1989 |
| 91 | Ga0070675_100121052 | 3300005354 | Bacteria | 2223 |
| 92 | Ga0070675_100205455 | 3300005354 | Bacteria | 1711 |
| 93 | Ga0070675_100248375 | 3300005354 | Unclassified | 1556 |
| 94 | Ga0070671_100035724 | 3300005355 | Unclassified | 4117 |
| 95 | Ga0070671_100181309 | 3300005355 | Bacteria | 1783 |
| 96 | Ga0070671_100233840 | 3300005355 | Bacteria | 1560 |
| 97 | Ga0070671_100378922 | 3300005355 | Bacteria | 1209 |
| 98 | Ga0070673_100051414 | 3300005364 | Bacteria | 3227 |
| 99 | Ga0070673_100058753 | 3300005364 | Bacteria | 3042 |
| 100 | Ga0070673_100091911 | 3300005364 | Bacteria | 2481 |
| 101 | Ga0070673_100249163 | 3300005364 | Bacteria | 1547 |
| 102 | Ga0070673_100344836 | 3300005364 | Unclassified | 1321 |
| 103 | Ga0070673_100452645 | 3300005364 | Bacteria | 1155 |
| 104 | Ga0070688_100016696 | 3300005365 | Bacteria | 4201 |
| 105 | Ga0070688_100041035 | 3300005365 | Unclassified | 2839 |
| 106 | Ga0070688_100119872 | 3300005365 | Bacteria | 1761 |
| 107 | Ga0070659_100018639 | 3300005366 | Bacteria | 5238 |
| 108 | Ga0070659_100073750 | 3300005366 | Bacteria | 2717 |
| 109 | Ga0070659_100079203 | 3300005366 | Bacteria | 2622 |
| 110 | Ga0070659_100150254 | 3300005366 | Bacteria | 1900 |
| 111 | Ga0070667_100026222 | 3300005367 | Bacteria | 4846 |
| 112 | Ga0070667_100030328 | 3300005367 | Bacteria | 4510 |
| 113 | Ga0070667_100232597 | 3300005367 | Bacteria | 1644 |
| 114 | Ga0070714_100662671 | 3300005435 | Bacteria | 1005 |
| 115 | Ga0070701_10064463 | 3300005438 | Bacteria | 1942 |
| 116 | Ga0070701_10140581 | 3300005438 | Bacteria | 1380 |
| 117 | Ga0070700_100329322 | 3300005441 | Bacteria | 1125 |
| 118 | Ga0070663_100008726 | 3300005455 | Bacteria | 6249 |
| 119 | Ga0070663_100037948 | 3300005455 | Bacteria | 3357 |
| 120 | Ga0070663_100122107 | 3300005455 | Bacteria | 1969 |
| 121 | Ga0070678_100198856 | 3300005456 | Bacteria | 1653 |
| 122 | Ga0070678_100473103 | 3300005456 | Bacteria | 1101 |
| 123 | Ga0070678_100661807 | 3300005456 | Bacteria | 938 |
| 124 | Ga0070662_100002229 | 3300005457 | Bacteria | 11891 |
| 125 | Ga0070662_100011227 | 3300005457 | Bacteria | 5903 |
| 126 | Ga0070662_100060331 | 3300005457 | Bacteria | 2765 |
| 127 | Ga0070662_100127506 | 3300005457 | Bacteria | 1958 |
| 128 | Ga0070681_10007244 | 3300005458 | Bacteria | 10824 |
| 129 | Ga0070681_10014926 | 3300005458 | Bacteria | 7724 |
| 130 | Ga0070681_10099103 | 3300005458 | Bacteria | 2860 |
| 131 | Ga0068867_100085928 | 3300005459 | Bacteria | 2379 |
| 132 | Ga0068867_100233481 | 3300005459 | Bacteria | 1488 |
| 133 | Ga0070685_10034327 | 3300005466 | Bacteria | 2856 |
| 134 | Ga0070685_10081299 | 3300005466 | Bacteria | 1942 |
| 135 | Ga0070685_10094996 | 3300005466 | Bacteria | 1811 |
| 136 | Ga0070685_10143126 | 3300005466 | Bacteria | 1508 |
| 137 | Ga0070685_10160407 | 3300005466 | Bacteria | 1433 |
| 138 | Ga0070698_100035084 | 3300005471 | Bacteria | 5187 |
| 139 | Ga0070698_100522404 | 3300005471 | Bacteria | 1125 |
| 140 | Ga0070679_100000261 | 3300005530 | Bacteria | 44142 |
| 141 | Ga0070684_100009695 | 3300005535 | Bacteria | 7598 |
| 142 | Ga0070684_100010017 | 3300005535 | Bacteria | 7493 |
| 143 | Ga0070684_100014664 | 3300005535 | Bacteria | 6356 |
| 144 | Ga0070684_100040560 | 3300005535 | Bacteria | 4010 |
| 145 | Ga0070684_100345421 | 3300005535 | Bacteria | 1368 |
| 146 | Ga0068853_100002363 | 3300005539 | Bacteria | 14114 |
| 147 | Ga0068853_100188030 | 3300005539 | Bacteria | 1875 |
| 148 | Ga0068853_100504452 | 3300005539 | Bacteria | 1142 |
| 149 | Ga0068853_100703709 | 3300005539 | Bacteria | 964 |
| 150 | Ga0070672_100056886 | 3300005543 | Bacteria | 3069 |
| 151 | Ga0070672_100111323 | 3300005543 | Bacteria | 2232 |
| 152 | Ga0070672_100258693 | 3300005543 | Bacteria | 1467 |
| 153 | Ga0070672_100495825 | 3300005543 | Bacteria | 1056 |
| 154 | Ga0070672_100587983 | 3300005543 | Bacteria | 969 |
| 155 | Ga0070693_100068419 | 3300005547 | Bacteria | 2084 |
| 156 | Ga0070665_100000205 | 3300005548 | Bacteria | 103515 |
| 157 | Ga0070665_100062451 | 3300005548 | Bacteria | 3735 |
| 158 | Ga0070665_100063508 | 3300005548 | Bacteria | 3703 |
| 159 | Ga0070665_100063617 | 3300005548 | Bacteria | 3699 |
| 160 | Ga0068855_100000033 | 3300005563 | Bacteria | 167299 |
| 161 | Ga0068855_100000724 | 3300005563 | Bacteria | 40544 |
| 162 | Ga0068855_100005855 | 3300005563 | Bacteria | 15006 |
| 163 | Ga0068855_100009537 | 3300005563 | Bacteria | 11722 |
| 164 | Ga0068855_100016101 | 3300005563 | Bacteria | 8991 |
| 165 | Ga0068855_100042678 | 3300005563 | Bacteria | 5373 |
| 166 | Ga0068855_100140971 | 3300005563 | Bacteria | 2748 |
| 167 | Ga0068855_100170729 | 3300005563 | Bacteria | 2463 |
| 168 | Ga0068855_100342501 | 3300005563 | Bacteria | 1648 |
| 169 | Ga0070664_100011685 | 3300005564 | Bacteria | 7126 |
| 170 | Ga0070664_100019632 | 3300005564 | Bacteria | 5561 |
| 171 | Ga0070664_100045032 | 3300005564 | Bacteria | 3726 |
| 172 | Ga0070664_100059352 | 3300005564 | Bacteria | 3254 |
| 173 | Ga0070664_100091776 | 3300005564 | Bacteria | 2629 |
| 174 | Ga0070664_100125970 | 3300005564 | Bacteria | 2247 |
| 175 | Ga0070664_100361684 | 3300005564 | Bacteria | 1322 |
| 176 | Ga0068857_100007316 | 3300005577 | Bacteria | 9511 |
| 177 | Ga0068857_100015569 | 3300005577 | Bacteria | 6643 |
| 178 | Ga0068857_100033142 | 3300005577 | Bacteria | 4568 |
| 179 | Ga0068857_100094269 | 3300005577 | Bacteria | 2681 |
| 180 | Ga0068857_100105507 | 3300005577 | Bacteria | 2530 |
| 181 | Ga0068857_100697698 | 3300005577 | Bacteria | 964 |
| 182 | Ga0068854_100012353 | 3300005578 | Bacteria | 5590 |
| 183 | Ga0068854_100155438 | 3300005578 | Bacteria | 1767 |
| 184 | Ga0068854_100363504 | 3300005578 | Bacteria | 1188 |
| 185 | Ga0068854_100452165 | 3300005578 | Bacteria | 1073 |
| 186 | Ga0068856_100036562 | 3300005614 | Bacteria | 4814 |
| 187 | Ga0068856_100074923 | 3300005614 | Bacteria | 3352 |
| 188 | Ga0068856_100082741 | 3300005614 | Bacteria | 3186 |
| 189 | Ga0070702_100218726 | 3300005615 | Bacteria | 1272 |
| 190 | Ga0068852_100000368 | 3300005616 | Bacteria | 30413 |
| 191 | Ga0068852_100014069 | 3300005616 | Bacteria | 6143 |
| 192 | Ga0068852_100017426 | 3300005616 | Bacteria | 5635 |
| 193 | Ga0068852_100063278 | 3300005616 | Bacteria | 3221 |
| 194 | Ga0068852_100078238 | 3300005616 | Bacteria | 2925 |
| 195 | Ga0068852_100125392 | 3300005616 | Bacteria | 2357 |
| 196 | Ga0068852_100138311 | 3300005616 | Bacteria | 2251 |
| 197 | Ga0068852_100139705 | 3300005616 | Bacteria | 2240 |
| 198 | Ga0068859_100022454 | 3300005617 | Bacteria | 6327 |
| 199 | Ga0068859_100087409 | 3300005617 | Bacteria | 3165 |
| 200 | Ga0068859_100186436 | 3300005617 | Bacteria | 2158 |
| 201 | Ga0068859_100201187 | 3300005617 | Bacteria | 2077 |
| 202 | Ga0068859_100261651 | 3300005617 | Bacteria | 1821 |
| 203 | Ga0068864_100025261 | 3300005618 | Bacteria | 5001 |
| 204 | Ga0068864_100081858 | 3300005618 | Bacteria | 2831 |
| 205 | Ga0068864_100094931 | 3300005618 | Bacteria | 2637 |
| 206 | Ga0068864_100202995 | 3300005618 | Bacteria | 1822 |
| 207 | Ga0068864_100340116 | 3300005618 | Bacteria | 1414 |
| 208 | Ga0068866_10038610 | 3300005718 | Bacteria | 2352 |
| 209 | Ga0068866_10120883 | 3300005718 | Bacteria | 1476 |
| 210 | Ga0068861_100103689 | 3300005719 | Bacteria | 2268 |
| 211 | Ga0068851_10047712 | 3300005834 | Bacteria | 2170 |
| 212 | Ga0068870_10355579 | 3300005840 | Bacteria | 941 |
| 213 | Ga0068863_100013238 | 3300005841 | Bacteria | 7957 |
| 214 | Ga0068863_100047906 | 3300005841 | Bacteria | 4053 |
| 215 | Ga0068863_100373016 | 3300005841 | Bacteria | 1393 |
| 216 | Ga0068863_100550760 | 3300005841 | Bacteria | 1139 |
| 217 | Ga0068858_100024215 | 3300005842 | Bacteria | 5658 |
| 218 | Ga0068858_100113418 | 3300005842 | Bacteria | 2532 |
| 219 | Ga0068860_100009501 | 3300005843 | Bacteria | 9658 |
| 220 | Ga0068860_100032432 | 3300005843 | Bacteria | 5019 |
| 221 | Ga0068860_100044231 | 3300005843 | Bacteria | 4245 |
| 222 | Ga0068862_100051975 | 3300005844 | Bacteria | 3506 |
| 223 | Ga0068862_100180126 | 3300005844 | Bacteria | 1896 |
| 224 | Ga0081539_10001900 | 3300005985 | Bacteria | 32389 |
| 225 | Ga0081539_10038125 | 3300005985 | Unclassified | 2852 |
| 226 | Ga0075363_100002744 | 3300006048 | Bacteria | 7292 |
| 227 | Ga0075369_10000022 | 3300006186 | Bacteria | 44375 |
| 228 | Ga0075366_10000493 | 3300006195 | Bacteria | 18252 |
| 229 | Ga0075366_10003181 | 3300006195 | Bacteria | 8602 |
| 230 | Ga0075366_10028307 | 3300006195 | Bacteria | 3289 |
| 231 | Ga0097621_100067164 | 3300006237 | Bacteria | 2955 |
| 232 | Ga0097621_100118194 | 3300006237 | Bacteria | 2247 |
| 233 | Ga0097621_100398818 | 3300006237 | Bacteria | 1231 |
| 234 | Ga0068871_100029030 | 3300006358 | Unclassified | 4342 |
| 235 | Ga0068871_100182765 | 3300006358 | Bacteria | 1803 |
| 236 | Ga0068871_100326388 | 3300006358 | Bacteria | 1353 |
| 237 | Ga0075428_100014269 | 3300006844 | Bacteria | 8837 |
| 238 | Ga0075428_100017394 | 3300006844 | Bacteria | 7946 |
| 239 | Ga0075428_100160684 | 3300006844 | Bacteria | 2439 |
| 240 | Ga0075428_100169103 | 3300006844 | Bacteria | 2371 |
| 241 | Ga0075430_100014698 | 3300006846 | Bacteria | 6668 |
| 242 | Ga0075430_100052808 | 3300006846 | Bacteria | 3423 |
| 243 | Ga0075431_100024723 | 3300006847 | Bacteria | 6159 |
| 244 | Ga0075431_100049098 | 3300006847 | Bacteria | 4352 |
| 245 | Ga0075431_100240198 | 3300006847 | Bacteria | 1843 |
| 246 | Ga0075433_10256723 | 3300006852 | Bacteria | 1550 |
| 247 | Ga0075429_100006082 | 3300006880 | Bacteria | 10440 |
| 248 | Ga0075429_100102502 | 3300006880 | Bacteria | 2498 |
| 249 | Ga0075429_100577034 | 3300006880 | Bacteria | 985 |
| 250 | Ga0068865_100169652 | 3300006881 | Bacteria | 1672 |
| 251 | Ga0068865_100595465 | 3300006881 | Unclassified | 934 |
| 252 | Ga0075436_100000340 | 3300006914 | Bacteria | 29818 |
| 253 | Ga0097620_100022453 | 3300006931 | Bacteria | 6327 |
| 254 | Ga0097620_100087401 | 3300006931 | Bacteria | 3165 |
| 255 | Ga0097620_100186445 | 3300006931 | Bacteria | 2158 |
| 256 | Ga0097620_100201180 | 3300006931 | Bacteria | 2077 |
| 257 | Ga0097620_100261623 | 3300006931 | Bacteria | 1821 |
| 258 | Ga0105240_10000020 | 3300009093 | Bacteria | 399699 |
| 259 | Ga0105240_10002198 | 3300009093 | Bacteria | 31833 |
| 260 | Ga0105240_10029260 | 3300009093 | Bacteria | 7182 |
| 261 | Ga0105240_10095427 | 3300009093 | Bacteria | 3626 |
| 262 | Ga0105240_10224569 | 3300009093 | Bacteria | 2186 |
| 263 | Ga0105240_10668553 | 3300009093 | Bacteria | 1137 |
| 264 | Ga0111539_10048554 | 3300009094 | Bacteria | 5067 |
| 265 | Ga0105247_10423230 | 3300009101 | Bacteria | 954 |
| 266 | Ga0114129_10040856 | 3300009147 | Bacteria | 6538 |
| 267 | Ga0105241_10063449 | 3300009174 | Bacteria | 2850 |
| 268 | Ga0105241_10179178 | 3300009174 | Bacteria | 1756 |
| 269 | Ga0105241_10193872 | 3300009174 | Bacteria | 1693 |
| 270 | Ga0105241_10341143 | 3300009174 | Bacteria | 1298 |
| 271 | Ga0105241_10608530 | 3300009174 | Bacteria | 988 |
| 272 | Ga0105242_10024277 | 3300009176 | Bacteria | 4787 |
| 273 | Ga0105242_10093451 | 3300009176 | Bacteria | 2535 |
| 274 | Ga0105242_10188128 | 3300009176 | Bacteria | 1826 |
| 275 | Ga0105242_10228529 | 3300009176 | Bacteria | 1666 |
| 276 | Ga0105237_10000143 | 3300009545 | Bacteria | 101515 |
| 277 | Ga0105237_10001072 | 3300009545 | Bacteria | 36764 |
| 278 | Ga0105237_10001440 | 3300009545 | Bacteria | 31406 |
| 279 | Ga0105237_10045725 | 3300009545 | Bacteria | 4404 |
| 280 | Ga0105237_10132929 | 3300009545 | Bacteria | 2483 |
| 281 | Ga0105238_10041777 | 3300009551 | Bacteria | 4644 |
| 282 | Ga0105249_10010289 | 3300009553 | Bacteria | 8216 |
| 283 | Ga0105249_10014619 | 3300009553 | Bacteria | 6941 |
| 284 | Ga0105249_10062101 | 3300009553 | Bacteria | 3430 |
| 285 | Ga0105239_10000002 | 3300010375 | Bacteria | 610298 |
| 286 | Ga0105239_10000136 | 3300010375 | Bacteria | 102943 |
| 287 | Ga0105239_10001354 | 3300010375 | Bacteria | 32956 |
| 288 | Ga0105239_10215387 | 3300010375 | Bacteria | 2153 |
| 289 | Ga0105246_10000302 | 3300011119 | Bacteria | 26080 |
| 290 | Ga0105246_10104980 | 3300011119 | Bacteria | 2064 |
| 291 | Ga0157373_10000064 | 3300013100 | Bacteria | 94176 |
| 292 | Ga0157373_10000154 | 3300013100 | Bacteria | 55480 |
| 293 | Ga0157373_10005219 | 3300013100 | Bacteria | 9756 |
| 294 | Ga0157373_10012974 | 3300013100 | Bacteria | 6118 |
| 295 | Ga0157373_10013107 | 3300013100 | Bacteria | 6085 |
| 296 | Ga0157373_10053286 | 3300013100 | Unclassified | 2876 |
| 297 | Ga0157373_10059948 | 3300013100 | Bacteria | 2696 |
| 298 | Ga0157373_10104812 | 3300013100 | Bacteria | 1989 |
| 299 | Ga0157371_10000135 | 3300013102 | Bacteria | 107607 |
| 300 | Ga0157371_10001388 | 3300013102 | Bacteria | 25318 |
| 301 | Ga0157371_10001497 | 3300013102 | Bacteria | 24172 |
| 302 | Ga0157371_10002087 | 3300013102 | Bacteria | 19526 |
| 303 | Ga0157371_10002968 | 3300013102 | Bacteria | 15759 |
| 304 | Ga0157371_10006874 | 3300013102 | Bacteria | 9289 |
| 305 | Ga0157371_10050066 | 3300013102 | Unclassified | 2968 |
| 306 | Ga0157371_10125589 | 3300013102 | Bacteria | 1824 |
| 307 | Ga0157371_10133198 | 3300013102 | Bacteria | 1769 |
| 308 | Ga0157371_10151309 | 3300013102 | Bacteria | 1655 |
| 309 | Ga0157371_10151585 | 3300013102 | Bacteria | 1654 |
| 310 | Ga0157371_10325152 | 3300013102 | Bacteria | 1117 |
| 311 | Ga0157370_10001449 | 3300013104 | Bacteria | 29363 |
| 312 | Ga0157370_10002674 | 3300013104 | Bacteria | 21356 |
| 313 | Ga0157370_10007812 | 3300013104 | Bacteria | 11587 |
| 314 | Ga0157370_10038640 | 3300013104 | Bacteria | 4617 |
| 315 | Ga0157370_10123063 | 3300013104 | Bacteria | 2422 |
| 316 | Ga0157370_10249387 | 3300013104 | Bacteria | 1642 |
| 317 | Ga0157370_10398592 | 3300013104 | Bacteria | 1267 |
| 318 | Ga0157370_10439379 | 3300013104 | Bacteria | 1200 |
| 319 | Ga0157370_10518708 | 3300013104 | Bacteria | 1094 |
| 320 | Ga0157369_10005954 | 3300013105 | Bacteria | 14160 |
| 321 | Ga0157369_10033631 | 3300013105 | Bacteria | 5633 |
| 322 | Ga0157369_10124437 | 3300013105 | Bacteria | 2735 |
| 323 | Ga0157369_10256644 | 3300013105 | Bacteria | 1824 |
| 324 | Ga0157369_10453443 | 3300013105 | Bacteria | 1328 |
| 325 | Ga0157369_10501742 | 3300013105 | Bacteria | 1255 |
| 326 | Ga0157374_10003869 | 3300013296 | Bacteria | 12564 |
| 327 | Ga0157374_10040129 | 3300013296 | Bacteria | 4309 |
| 328 | Ga0157374_10094858 | 3300013296 | Bacteria | 2852 |
| 329 | Ga0157374_10391017 | 3300013296 | Bacteria | 1386 |
| 330 | Ga0157374_10644700 | 3300013296 | Bacteria | 1071 |
| 331 | Ga0157378_10000557 | 3300013297 | Bacteria | 35516 |
| 332 | Ga0157378_10006087 | 3300013297 | Bacteria | 10570 |
| 333 | Ga0157378_10025884 | 3300013297 | Bacteria | 5169 |
| 334 | Ga0157378_10050643 | 3300013297 | Bacteria | 3696 |
| 335 | Ga0157378_10142229 | 3300013297 | Bacteria | 2229 |
| 336 | Ga0157378_10168685 | 3300013297 | Bacteria | 2051 |
| 337 | Ga0157378_10243617 | 3300013297 | Unclassified | 1718 |
| 338 | Ga0163162_10000254 | 3300013306 | Bacteria | 48422 |
| 339 | Ga0163162_10016096 | 3300013306 | Bacteria | 7310 |
| 340 | Ga0163162_10064751 | 3300013306 | Bacteria | 3701 |
| 341 | Ga0163162_10069871 | 3300013306 | Bacteria | 3563 |
| 342 | Ga0163162_10081298 | 3300013306 | Bacteria | 3311 |
| 343 | Ga0163162_10082667 | 3300013306 | Bacteria | 3284 |
| 344 | Ga0163162_10102532 | 3300013306 | Bacteria | 2955 |
| 345 | Ga0163162_10173159 | 3300013306 | Bacteria | 2283 |
| 346 | Ga0163162_10210054 | 3300013306 | Bacteria | 2076 |
| 347 | Ga0163162_10224616 | 3300013306 | Bacteria | 2007 |
| 348 | Ga0163162_10321898 | 3300013306 | Bacteria | 1679 |
| 349 | Ga0163162_10731147 | 3300013306 | Bacteria | 1110 |
| 350 | Ga0157372_10000029 | 3300013307 | Bacteria | 180371 |
| 351 | Ga0157372_10000061 | 3300013307 | Bacteria | 119814 |
| 352 | Ga0157372_10018416 | 3300013307 | Bacteria | 7506 |
| 353 | Ga0157372_10023276 | 3300013307 | Bacteria | 6714 |
| 354 | Ga0157372_10048744 | 3300013307 | Unclassified | 4708 |
| 355 | Ga0157372_10105425 | 3300013307 | Bacteria | 3224 |
| 356 | Ga0157372_10178130 | 3300013307 | Bacteria | 2461 |
| 357 | Ga0157372_10197959 | 3300013307 | Unclassified | 2327 |
| 358 | Ga0157372_10250687 | 3300013307 | Bacteria | 2055 |
| 359 | Ga0157372_10377530 | 3300013307 | Bacteria | 1652 |
| 360 | Ga0157372_10434000 | 3300013307 | Bacteria | 1531 |
| 361 | Ga0157372_10484761 | 3300013307 | Bacteria | 1441 |
| 362 | Ga0157372_10555015 | 3300013307 | Unclassified | 1339 |
| 363 | Ga0157375_10032527 | 3300013308 | Bacteria | 4948 |
| 364 | Ga0157375_10036964 | 3300013308 | Bacteria | 4675 |
| 365 | Ga0157375_10077202 | 3300013308 | Unclassified | 3360 |
| 366 | Ga0157375_10077731 | 3300013308 | Bacteria | 3350 |
| 367 | Ga0157375_10128523 | 3300013308 | Bacteria | 2652 |
| 368 | Ga0157375_10251899 | 3300013308 | Bacteria | 1927 |
| 369 | Ga0157375_10595993 | 3300013308 | Bacteria | 1264 |
| 370 | Ga0157375_11357778 | 3300013308 | Bacteria | 836 |
| 371 | Ga0163163_10001144 | 3300014325 | Bacteria | 22578 |
| 372 | Ga0163163_10006882 | 3300014325 | Bacteria | 9983 |
| 373 | Ga0163163_10019272 | 3300014325 | Bacteria | 6405 |
| 374 | Ga0163163_10030868 | 3300014325 | Bacteria | 5167 |
| 375 | Ga0163163_10086192 | 3300014325 | Bacteria | 3149 |
| 376 | Ga0163163_10145364 | 3300014325 | Bacteria | 2414 |
| 377 | Ga0163163_10177718 | 3300014325 | Bacteria | 2175 |
| 378 | Ga0157380_10008071 | 3300014326 | Bacteria | 7499 |
| 379 | Ga0157380_10342077 | 3300014326 | Bacteria | 1396 |
| 380 | Ga0157380_10593258 | 3300014326 | Bacteria | 1095 |
| 381 | Ga0157380_10671964 | 3300014326 | Bacteria | 1036 |
| 382 | Ga0157377_10000723 | 3300014745 | Bacteria | 13662 |
| 383 | Ga0157377_10033385 | 3300014745 | Bacteria | 2809 |
| 384 | Ga0157377_10068046 | 3300014745 | Bacteria | 2051 |
| 385 | Ga0157377_10136205 | 3300014745 | Bacteria | 1505 |
| 386 | Ga0157377_10158274 | 3300014745 | Bacteria | 1406 |
| 387 | Ga0157377_10244038 | 3300014745 | Bacteria | 1161 |
| 388 | Ga0157379_10197830 | 3300014968 | Bacteria | 1817 |
| 389 | Ga0157379_10802649 | 3300014968 | Bacteria | 888 |
| 390 | Ga0157376_10124212 | 3300014969 | Bacteria | 2292 |
| 391 | Ga0157376_10171273 | 3300014969 | Bacteria | 1977 |
| 392 | Ga0182006_1000668 | 3300015261 | Bacteria | 24095 |
| 393 | Ga0182006_1013089 | 3300015261 | Bacteria | 3611 |
| 394 | Ga0182007_10023721 | 3300015262 | Bacteria | 2154 |
| 395 | Ga0183373_1004 | 3300015682 | Bacteria | 537398 |
| 396 | Ga0163161_10022366 | 3300017792 | Bacteria | 4452 |
| 397 | Ga0163161_10025767 | 3300017792 | Bacteria | 4164 |
| 398 | Ga0163161_10038137 | 3300017792 | Bacteria | 3445 |
| 399 | Ga0163161_10215799 | 3300017792 | Unclassified | 1484 |
| 400 | Ga0163161_10402573 | 3300017792 | Bacteria | 1098 |
| 401 | Ga0213876_10046993 | 3300021384 | Bacteria | 2282 |
| 402 | Ga0213875_10009671 | 3300021388 | Bacteria | 4871 |
| 403 | Ga0207425_1000004 | 3300025245 | Bacteria | 1092421 |
| 404 | Ga0209646_1000025 | 3300025246 | Bacteria | 406493 |
| 405 | Ga0209026_1000097 | 3300025250 | Bacteria | 163212 |
| 406 | Ga0209026_1000226 | 3300025250 | Bacteria | 77076 |
| 407 | Ga0209026_1007599 | 3300025250 | Bacteria | 2404 |
| 408 | Ga0209148_1001642 | 3300025254 | Bacteria | 10220 |
| 409 | Ga0209129_1000048 | 3300025258 | Bacteria | 270192 |
| 410 | Ga0209233_1001263 | 3300025261 | Bacteria | 10155 |
| 411 | Ga0209455_1001752 | 3300025272 | Bacteria | 9192 |
| 412 | Ga0209025_1000009 | 3300025294 | Bacteria | 1092561 |
| 413 | Ga0209758_1000010 | 3300025297 | Bacteria | 1092782 |
| 414 | Ga0209758_1021370 | 3300025297 | Bacteria | 3018 |
| 415 | Ga0207426_1000220 | 3300025302 | Bacteria | 134979 |
| 416 | Ga0209257_1000013 | 3300025304 | Bacteria | 1047305 |
| 417 | Ga0207656_10033876 | 3300025321 | Bacteria | 2130 |
| 418 | Ga0207682_10048712 | 3300025893 | Bacteria | 1747 |
| 419 | Ga0207682_10203609 | 3300025893 | Bacteria | 911 |
| 420 | Ga0207642_10035445 | 3300025899 | Bacteria | 2131 |
| 421 | Ga0207688_10057097 | 3300025901 | Bacteria | 2194 |
| 422 | Ga0207680_10040907 | 3300025903 | Bacteria | 2701 |
| 423 | Ga0207647_10000105 | 3300025904 | Bacteria | 65502 |
| 424 | Ga0207647_10026086 | 3300025904 | Bacteria | 3827 |
| 425 | Ga0207647_10046356 | 3300025904 | Bacteria | 2709 |
| 426 | Ga0207645_10065399 | 3300025907 | Bacteria | 2324 |
| 427 | Ga0207643_10049704 | 3300025908 | Bacteria | 2376 |
| 428 | Ga0207705_10121483 | 3300025909 | Bacteria | 1939 |
| 429 | Ga0207705_10125744 | 3300025909 | Bacteria | 1905 |
| 430 | Ga0207705_10234134 | 3300025909 | Bacteria | 1398 |
| 431 | Ga0207654_10001489 | 3300025911 | Bacteria | 12377 |
| 432 | Ga0207707_10022653 | 3300025912 | Bacteria | 5493 |
| 433 | Ga0207695_10000020 | 3300025913 | Bacteria | 723025 |
| 434 | Ga0207695_10000076 | 3300025913 | Bacteria | 307969 |
| 435 | Ga0207695_10000090 | 3300025913 | Bacteria | 272143 |
| 436 | Ga0207695_10000183 | 3300025913 | Bacteria | 181350 |
| 437 | Ga0207695_10002461 | 3300025913 | Bacteria | 27342 |
| 438 | Ga0207695_10644465 | 3300025913 | Bacteria | 940 |
| 439 | Ga0207671_10000968 | 3300025914 | Bacteria | 35551 |
| 440 | Ga0207671_10010707 | 3300025914 | Bacteria | 7541 |
| 441 | Ga0207671_10015831 | 3300025914 | Bacteria | 5883 |
| 442 | Ga0207671_10024163 | 3300025914 | Bacteria | 4573 |
| 443 | Ga0207671_10108150 | 3300025914 | Bacteria | 2113 |
| 444 | Ga0207660_10025129 | 3300025917 | Bacteria | 4041 |
| 445 | Ga0207662_10044920 | 3300025918 | Bacteria | 2610 |
| 446 | Ga0207662_10092114 | 3300025918 | Bacteria | 1866 |
| 447 | Ga0207657_10023160 | 3300025919 | Bacteria | 5789 |
| 448 | Ga0207657_10072360 | 3300025919 | Bacteria | 2917 |
| 449 | Ga0207657_10160815 | 3300025919 | Bacteria | 1824 |
| 450 | Ga0207649_10014835 | 3300025920 | Bacteria | 4370 |
| 451 | Ga0207649_10057090 | 3300025920 | Bacteria | 2439 |
| 452 | Ga0207649_10450540 | 3300025920 | Bacteria | 971 |
| 453 | Ga0207652_10000011 | 3300025921 | Bacteria | 246742 |
| 454 | Ga0207652_10000057 | 3300025921 | Bacteria | 113664 |
| 455 | Ga0207681_10109054 | 3300025923 | Bacteria | 2011 |
| 456 | Ga0207650_10014868 | 3300025925 | Bacteria | 5415 |
| 457 | Ga0207650_10020937 | 3300025925 | Bacteria | 4620 |
| 458 | Ga0207650_10078395 | 3300025925 | Bacteria | 2499 |
| 459 | Ga0207650_10198702 | 3300025925 | Bacteria | 1605 |
| 460 | Ga0207650_10357199 | 3300025925 | Bacteria | 1203 |
| 461 | Ga0207650_10406835 | 3300025925 | Bacteria | 1127 |
| 462 | Ga0207659_10106702 | 3300025926 | Bacteria | 2121 |
| 463 | Ga0207644_10210437 | 3300025931 | Bacteria | 1537 |
| 464 | Ga0207690_10025553 | 3300025932 | Bacteria | 3710 |
| 465 | Ga0207690_10036836 | 3300025932 | Bacteria | 3171 |
| 466 | Ga0207690_10109974 | 3300025932 | Bacteria | 1983 |
| 467 | Ga0207690_10213637 | 3300025932 | Bacteria | 1472 |
| 468 | Ga0207706_10001578 | 3300025933 | Bacteria | 22611 |
| 469 | Ga0207706_10002076 | 3300025933 | Bacteria | 19622 |
| 470 | Ga0207706_10005829 | 3300025933 | Bacteria | 11461 |
| 471 | Ga0207706_10016578 | 3300025933 | Bacteria | 6651 |
| 472 | Ga0207706_10027456 | 3300025933 | Bacteria | 5089 |
| 473 | Ga0207706_10112280 | 3300025933 | Bacteria | 2398 |
| 474 | Ga0207706_10154478 | 3300025933 | Bacteria | 2019 |
| 475 | Ga0207706_10379158 | 3300025933 | Bacteria | 1227 |
| 476 | Ga0207686_10000200 | 3300025934 | Bacteria | 46234 |
| 477 | Ga0207686_10048259 | 3300025934 | Bacteria | 2637 |
| 478 | Ga0207686_10190230 | 3300025934 | Unclassified | 1462 |
| 479 | Ga0207686_10584200 | 3300025934 | Bacteria | 877 |
| 480 | Ga0207670_10037753 | 3300025936 | Bacteria | 3150 |
| 481 | Ga0207670_10072649 | 3300025936 | Bacteria | 2382 |
| 482 | Ga0207669_10269836 | 3300025937 | Bacteria | 1277 |
| 483 | Ga0207669_10583069 | 3300025937 | Bacteria | 907 |
| 484 | Ga0207704_10363376 | 3300025938 | Bacteria | 1131 |
| 485 | Ga0207691_10009195 | 3300025940 | Bacteria | 9485 |
| 486 | Ga0207691_10022720 | 3300025940 | Bacteria | 5913 |
| 487 | Ga0207691_10027317 | 3300025940 | Bacteria | 5351 |
| 488 | Ga0207691_10065448 | 3300025940 | Bacteria | 3290 |
| 489 | Ga0207691_10515176 | 3300025940 | Bacteria | 1015 |
| 490 | Ga0207691_10530201 | 3300025940 | Unclassified | 999 |
| 491 | Ga0207689_10019312 | 3300025942 | Bacteria | 5745 |
| 492 | Ga0207689_10024873 | 3300025942 | Bacteria | 5020 |
| 493 | Ga0207689_10081856 | 3300025942 | Bacteria | 2654 |
| 494 | Ga0207689_10129789 | 3300025942 | Bacteria | 2074 |
| 495 | Ga0207689_10216924 | 3300025942 | Bacteria | 1581 |
| 496 | Ga0207661_10001267 | 3300025944 | Bacteria | 16895 |
| 497 | Ga0207661_10003205 | 3300025944 | Bacteria | 11339 |
| 498 | Ga0207661_10013373 | 3300025944 | Bacteria | 5995 |
| 499 | Ga0207661_10018874 | 3300025944 | Bacteria | 5132 |
| 500 | Ga0207661_10816807 | 3300025944 | Bacteria | 858 |
| 501 | Ga0207679_10001116 | 3300025945 | Bacteria | 17106 |
| 502 | Ga0207679_10128873 | 3300025945 | Bacteria | 2026 |
| 503 | Ga0207679_10167758 | 3300025945 | Bacteria | 1804 |
| 504 | Ga0207667_10000046 | 3300025949 | Bacteria | 245420 |
| 505 | Ga0207667_10001827 | 3300025949 | Bacteria | 26771 |
| 506 | Ga0207667_10008253 | 3300025949 | Bacteria | 12395 |
| 507 | Ga0207667_10010255 | 3300025949 | Bacteria | 10968 |
| 508 | Ga0207667_10020033 | 3300025949 | Bacteria | 7449 |
| 509 | Ga0207667_10375090 | 3300025949 | Bacteria | 1450 |
| 510 | Ga0207667_11005440 | 3300025949 | Bacteria | 821 |
| 511 | Ga0207651_10028157 | 3300025960 | Bacteria | 3540 |
| 512 | Ga0207651_10059328 | 3300025960 | Bacteria | 2650 |
| 513 | Ga0207651_10067659 | 3300025960 | Bacteria | 2515 |
| 514 | Ga0207651_10099582 | 3300025960 | Unclassified | 2153 |
| 515 | Ga0207651_10151998 | 3300025960 | Bacteria | 1803 |
| 516 | Ga0207651_10173823 | 3300025960 | Bacteria | 1702 |
| 517 | Ga0207712_10003728 | 3300025961 | Bacteria | 9617 |
| 518 | Ga0207668_10022614 | 3300025972 | Bacteria | 4029 |
| 519 | Ga0207640_10017916 | 3300025981 | Bacteria | 4151 |
| 520 | Ga0207640_10051822 | 3300025981 | Bacteria | 2670 |
| 521 | Ga0207640_10660039 | 3300025981 | Bacteria | 892 |
| 522 | Ga0207640_10701423 | 3300025981 | Bacteria | 868 |
| 523 | Ga0207658_10063971 | 3300025986 | Bacteria | 2758 |
| 524 | Ga0207658_10067976 | 3300025986 | Bacteria | 2686 |
| 525 | Ga0207658_10443663 | 3300025986 | Bacteria | 1148 |
| 526 | Ga0207658_10558323 | 3300025986 | Bacteria | 1025 |
| 527 | Ga0207677_10017707 | 3300026023 | Bacteria | 4256 |
| 528 | Ga0207677_10071979 | 3300026023 | Bacteria | 2442 |
| 529 | Ga0207677_10138691 | 3300026023 | Bacteria | 1858 |
| 530 | Ga0207677_10406427 | 3300026023 | Bacteria | 1156 |
| 531 | Ga0207677_10531383 | 3300026023 | Bacteria | 1022 |
| 532 | Ga0207703_10047038 | 3300026035 | Bacteria | 3477 |
| 533 | Ga0207639_10023309 | 3300026041 | Bacteria | 4469 |
| 534 | Ga0207639_10052640 | 3300026041 | Bacteria | 3103 |
| 535 | Ga0207639_10129475 | 3300026041 | Bacteria | 2087 |
| 536 | Ga0207639_10467119 | 3300026041 | Bacteria | 1148 |
| 537 | Ga0207639_10632677 | 3300026041 | Bacteria | 989 |
| 538 | Ga0207678_10017720 | 3300026067 | Bacteria | 6253 |
| 539 | Ga0207678_10049634 | 3300026067 | Bacteria | 3627 |
| 540 | Ga0207678_10275028 | 3300026067 | Bacteria | 1445 |
| 541 | Ga0207702_10015591 | 3300026078 | Bacteria | 6290 |
| 542 | Ga0207702_10043524 | 3300026078 | Bacteria | 3770 |
| 543 | Ga0207702_10258837 | 3300026078 | Bacteria | 1637 |
| 544 | Ga0207641_10027621 | 3300026088 | Bacteria | 4687 |
| 545 | Ga0207641_10061070 | 3300026088 | Bacteria | 3214 |
| 546 | Ga0207641_10077126 | 3300026088 | Bacteria | 2883 |
| 547 | Ga0207641_10082085 | 3300026088 | Bacteria | 2800 |
| 548 | Ga0207648_10013383 | 3300026089 | Bacteria | 7634 |
| 549 | Ga0207648_10021636 | 3300026089 | Bacteria | 5777 |
| 550 | Ga0207648_10106170 | 3300026089 | Bacteria | 2464 |
| 551 | Ga0207648_10250463 | 3300026089 | Unclassified | 1579 |
| 552 | Ga0207648_10321711 | 3300026089 | Bacteria | 1390 |
| 553 | Ga0207648_10322692 | 3300026089 | Unclassified | 1388 |
| 554 | Ga0207676_10016147 | 3300026095 | Bacteria | 5403 |
| 555 | Ga0207676_10052782 | 3300026095 | Bacteria | 3180 |
| 556 | Ga0207676_10094665 | 3300026095 | Bacteria | 2462 |
| 557 | Ga0207676_10509823 | 3300026095 | Bacteria | 1143 |
| 558 | Ga0207676_10519506 | 3300026095 | Bacteria | 1133 |
| 559 | Ga0207676_10558704 | 3300026095 | Bacteria | 1094 |
| 560 | Ga0207674_10008940 | 3300026116 | Bacteria | 11511 |
| 561 | Ga0207674_10012134 | 3300026116 | Bacteria | 9646 |
| 562 | Ga0207674_10014085 | 3300026116 | Bacteria | 8835 |
| 563 | Ga0207674_10045160 | 3300026116 | Bacteria | 4534 |
| 564 | Ga0207674_10121909 | 3300026116 | Bacteria | 2574 |
| 565 | Ga0207674_10167101 | 3300026116 | Bacteria | 2154 |
| 566 | Ga0207674_10177487 | 3300026116 | Bacteria | 2082 |
| 567 | Ga0207675_100001919 | 3300026118 | Bacteria | 20735 |
| 568 | Ga0207683_10006292 | 3300026121 | Bacteria | 10175 |
| 569 | Ga0207683_10035576 | 3300026121 | Bacteria | 4332 |
| 570 | Ga0207683_10202089 | 3300026121 | Bacteria | 1807 |
| 571 | Ga0207683_10273387 | 3300026121 | Bacteria | 1543 |
| 572 | Ga0207683_10428358 | 3300026121 | Bacteria | 1219 |
| 573 | Ga0207698_10080730 | 3300026142 | Bacteria | 2622 |
| 574 | Ga0207698_10142932 | 3300026142 | Bacteria | 2065 |
| 575 | Ga0207698_10234563 | 3300026142 | Bacteria | 1668 |
| 576 | Ga0207698_10496746 | 3300026142 | Bacteria | 1187 |
| 577 | Ga0207698_10642326 | 3300026142 | Bacteria | 1050 |
| 578 | Ga0207428_10049291 | 3300027907 | Bacteria | 3375 |
| 579 | Ga0268266_10001358 | 3300028379 | Bacteria | 29523 |
| 580 | Ga0268266_10036128 | 3300028379 | Bacteria | 4204 |
| 581 | Ga0268266_10218401 | 3300028379 | Bacteria | 1751 |
| 582 | Ga0268265_10221070 | 3300028380 | Bacteria | 1657 |
| 583 | Ga0268264_10010214 | 3300028381 | Bacteria | 7770 |
| 584 | Ga0268264_10081788 | 3300028381 | Bacteria | 2761 |
| 585 | Ga0307517_10008092 | 3300028786 | Bacteria | 15151 |
| 586 | Ga0307515_10000039 | 3300028794 | Bacteria | 323229 |
| 587 | Ga0307515_10048464 | 3300028794 | Bacteria | 6423 |
| 588 | Ga0307515_10323371 | 3300028794 | Bacteria | 1207 |
| 589 | Ga0316177_1010194 | 3300030731 | Bacteria | 10918 |
| 590 | Ga0316176_1025003 | 3300030732 | Bacteria | 24453 |
| 591 | Ga0307513_10373342 | 3300031456 | Bacteria | 1168 |
| 592 | Ga0307509_10023952 | 3300031507 | Bacteria | 6843 |
| 593 | Ga0307408_100009720 | 3300031548 | Bacteria | 6338 |
| 594 | Ga0307408_100023313 | 3300031548 | Unclassified | 4215 |
| 595 | Ga0307405_10000006 | 3300031731 | Bacteria | 361477 |
| 596 | Ga0307405_10056393 | 3300031731 | Bacteria | 2464 |
| 597 | Ga0307413_10384513 | 3300031824 | Bacteria | 1095 |
| 598 | Ga0307410_10003816 | 3300031852 | Bacteria | 7657 |
| 599 | Ga0307406_10101850 | 3300031901 | Unclassified | 1958 |
| 600 | Ga0307407_10000003 | 3300031903 | Bacteria | 271723 |
| 601 | Ga0307407_10003725 | 3300031903 | Bacteria | 6326 |
| 602 | Ga0307407_10152810 | 3300031903 | Unclassified | 1502 |
| 603 | Ga0307412_10000009 | 3300031911 | Bacteria | 445987 |
| 604 | Ga0307412_10018528 | 3300031911 | Bacteria | 4192 |
| 605 | Ga0307412_10023992 | 3300031911 | Bacteria | 3761 |
| 606 | Ga0307412_10037612 | 3300031911 | Bacteria | 3111 |
| 607 | Ga0307412_10070344 | 3300031911 | Bacteria | 2385 |
| 608 | Ga0307412_10114415 | 3300031911 | Bacteria | 1932 |
| 609 | Ga0307409_100076377 | 3300031995 | Unclassified | 2686 |
| 610 | Ga0307416_100000002 | 3300032002 | Bacteria | 509907 |
| 611 | Ga0307414_10000002 | 3300032004 | Bacteria | 623006 |
| 612 | Ga0307414_10037074 | 3300032004 | Bacteria | 3261 |
| 613 | Ga0307414_10039538 | 3300032004 | Bacteria | 3178 |
| 614 | Ga0307414_10071869 | 3300032004 | Bacteria | 2497 |
| 615 | Ga0307414_10229227 | 3300032004 | Bacteria | 1530 |
| 616 | Ga0307414_10265527 | 3300032004 | Bacteria | 1434 |
| 617 | Ga0307414_10286804 | 3300032004 | Bacteria | 1386 |
| 618 | Ga0307414_10772441 | 3300032004 | Bacteria | 875 |
| 619 | Ga0307411_10000010 | 3300032005 | Bacteria | 238134 |
| 620 | Ga0307411_10471659 | 3300032005 | Bacteria | 1055 |
| 621 | Ga0307415_100002127 | 3300032126 | Bacteria | 9812 |
| 622 | Ga0373943_0033831 | 3300035170 | Bacteria | 2437 |
| 623 | Ga0373955_0028710 | 3300035172 | Bacteria | 2887 |
| 624 | Ga0373933_0062939 | 3300035724 | Bacteria | 2242 |
| 625 | Ga0373937_0006714 | 3300036401 | Bacteria | 9925 |
| 626 | Ga0373937_0114269 | 3300036401 | Bacteria | 2513 |
| 627 | Ga0395899_0000011 | 3300037312 | Bacteria | 521331 |
| 628 | Ga0395899_0000024 | 3300037312 | Bacteria | 357402 |
| 629 | Ga0395899_0005151 | 3300037312 | Bacteria | 10169 |
| 630 | Ga0395900_0003816 | 3300037418 | Bacteria | 16111 |
| 631 | Ga0395900_0088189 | 3300037418 | Bacteria | 3189 |
| 632 | Ga0395900_0377432 | 3300037418 | Bacteria | 1386 |
| 633 | Ga0395898_0005129 | 3300037466 | Bacteria | 14180 |
| 634 | Ga0395898_0135839 | 3300037466 | Unclassified | 2355 |
| 635 | Ga0395898_0170216 | 3300037466 | Bacteria | 2082 |
| 636 | Ga0395905_0202273 | 3300037471 | Bacteria | 1862 |
| 637 | Ga0395905_0357783 | 3300037471 | Bacteria | 1352 |
| 638 | Ga0436364_0518085 | 3300037853 | Bacteria | 102110 |
| 639 | Ga0395901_0014835 | 3300038443 | Bacteria | 7916 |
| 640 | Ga0395901_0037327 | 3300038443 | Bacteria | 5025 |
| 641 | Ga0436365_0262826 | 3300039437 | Bacteria | 23593 |
| 642 | Ga0439433_0017256 | 3300041999 | Bacteria | 1602 |
| 643 | Ga0439462_0024915 | 3300042015 | Bacteria | 1574 |
| 644 | Ga0451577_0005367 | 3300042876 | Bacteria | 13153 |
| 645 | Ga0451577_0729678 | 3300042876 | Bacteria | 897 |
| 646 | Ga0466969_0000262 | 3300044656 | Bacteria | 28797 |
| 647 | Ga0466969_0022399 | 3300044656 | Bacteria | 3261 |
| 648 | Ga0466972_0135572 | 3300044658 | Bacteria | 1159 |
| 649 | Ga0453683_0156002 | 3300044673 | Unclassified | 1443 |
| 650 | Ga0466966_0000114 | 3300044684 | Bacteria | 49928 |
| 651 | Ga0466961_0033151 | 3300044693 | Bacteria | 3319 |
| 652 | Ga0466961_0049507 | 3300044693 | Bacteria | 2686 |
| 653 | Ga0466961_0153324 | 3300044693 | Bacteria | 1438 |
| 654 | Ga0466964_0025102 | 3300044706 | Bacteria | 2326 |
| 655 | Ga0453684_0004533 | 3300044712 | Bacteria | 29140 |
| 656 | Ga0453684_0083924 | 3300044712 | Bacteria | 3964 |
| 657 | Ga0453684_0323132 | 3300044712 | Bacteria | 1747 |
| 658 | Ga0466968_0038250 | 3300044735 | Bacteria | 2016 |
| 659 | Ga0466968_0069192 | 3300044735 | Bacteria | 1534 |
| 660 | Ga0466959_0000049 | 3300045049 | Bacteria | 83496 |
| 661 | Ga0466959_0024789 | 3300045049 | Bacteria | 4443 |
| 662 | Ga0466959_0303585 | 3300045049 | Bacteria | 1093 |
| 663 | Ga0466958_0190894 | 3300045836 | Bacteria | 1302 |
| 664 | Ga0495627_001033 | 3300046453 | Bacteria | 18616 |
| 665 | Ga0495592_0018558 | 3300046454 | Bacteria | 5293 |
| 666 | Ga0495650_0000216 | 3300046471 | Bacteria | 121086 |
| 667 | Ga0495650_0037213 | 3300046471 | Bacteria | 2121 |
| 668 | Ga0495585_0000103 | 3300046492 | Bacteria | 90447 |
| 669 | Ga0495606_0000263 | 3300046507 | Bacteria | 92794 |
| 670 | Ga0495606_0008892 | 3300046507 | Bacteria | 8604 |
| 671 | Ga0495606_0017691 | 3300046507 | Bacteria | 5378 |
| 672 | Ga0495608_0090875 | 3300046511 | Bacteria | 1975 |
| 673 | Ga0495610_0003125 | 3300046512 | Bacteria | 13180 |
| 674 | Ga0495610_0084974 | 3300046512 | Bacteria | 1445 |
| 675 | Ga0495610_0158482 | 3300046512 | Bacteria | 959 |
| 676 | Ga0495616_0067203 | 3300046513 | Bacteria | 1743 |
| 677 | Ga0495628_0021207 | 3300046516 | Bacteria | 5349 |
| 678 | Ga0495630_0008614 | 3300046517 | Bacteria | 7321 |
| 679 | Ga0495637_0078062 | 3300046520 | Bacteria | 1324 |
| 680 | Ga0495643_0002269 | 3300046522 | Bacteria | 15545 |
| 681 | Ga0495648_0034045 | 3300046524 | Bacteria | 3321 |
| 682 | Ga0495663_0000838 | 3300046525 | Bacteria | 10511 |
| 683 | Ga0495652_0240085 | 3300046529 | Bacteria | 1349 |
| 684 | Ga0495652_0371277 | 3300046529 | Bacteria | 1020 |
| 685 | Ga0495598_0097749 | 3300046537 | Bacteria | 967 |
| 686 | Ga0495633_0049879 | 3300046558 | Bacteria | 1975 |
| 687 | Ga0495668_0000115 | 3300046616 | Bacteria | 125423 |
| 688 | Ga0495668_0002946 | 3300046616 | Bacteria | 13431 |
| 689 | Ga0495634_0031017 | 3300046642 | Bacteria | 3685 |
| 690 | Ga0495625_0000125 | 3300046660 | Bacteria | 120726 |
| 691 | Ga0495625_0010849 | 3300046660 | Bacteria | 7492 |
| 692 | Ga0495661_0017390 | 3300046665 | Bacteria | 4750 |
| 693 | Ga0495661_0050902 | 3300046665 | Bacteria | 2504 |
| 694 | Ga0495657_0113681 | 3300046675 | Bacteria | 1712 |
| 695 | Ga0495599_0085578 | 3300046678 | Bacteria | 1969 |
| 696 | Ga0495658_0074600 | 3300046683 | Bacteria | 1977 |
| 697 | Ga0495624_0261831 | 3300046690 | Bacteria | 1045 |
| 698 | Ga0495649_0000044 | 3300046694 | Bacteria | 120721 |
| 699 | Ga0495600_0221464 | 3300046809 | Bacteria | 1210 |
| 700 | Ga0495660_0004886 | 3300046810 | Bacteria | 8074 |
| 701 | Ga0495672_0019853 | 3300047320 | Bacteria | 4420 |
| 702 | Ga0495672_0024130 | 3300047320 | Bacteria | 3924 |
| 703 | Ga0495680_0285582 | 3300047322 | Bacteria | 1162 |
| 704 | Ga0495687_013604 | 3300047443 | Bacteria | 4234 |
| 705 | Ga0495687_088676 | 3300047443 | Bacteria | 1190 |
| 706 | Ga0495675_0288247 | 3300047444 | Bacteria | 978 |
| 707 | Ga0495679_052761 | 3300047446 | Bacteria | 1216 |
| 708 | Ga0495673_0027605 | 3300047469 | Bacteria | 2699 |
| 709 | Ga0495681_0000600 | 3300047470 | Bacteria | 27495 |
| 710 | Ga0495684_0085342 | 3300047471 | Bacteria | 2394 |
| 711 | Ga0495686_0000150 | 3300047472 | Bacteria | 135172 |
| 712 | Ga0495686_0000763 | 3300047472 | Bacteria | 42458 |
| 713 | Ga0495686_0001123 | 3300047472 | Bacteria | 31643 |
| 714 | Ga0495686_0014532 | 3300047472 | Bacteria | 5414 |
| 715 | Ga0495686_0077585 | 3300047472 | Bacteria | 2034 |
| 716 | Ga0495686_0127887 | 3300047472 | Bacteria | 1509 |
| 717 | Ga0496102_0091955 | 3300048905 | Bacteria | 2809 |
| 718 | Ga0496102_0966483 | 3300048905 | Unclassified | 773 |
| 719 | Ga0496104_0297369 | 3300048907 | Bacteria | 1527 |
| 720 | Ga0496107_0044884 | 3300048910 | Bacteria | 3178 |
| 721 | Ga0496109_0554891 | 3300048912 | Bacteria | 1084 |
| 722 | Ga0496112_0173552 | 3300048915 | Bacteria | 2121 |
| 723 | Ga0496112_0877126 | 3300048915 | Bacteria | 820 |
| 724 | Ga0496113_0117724 | 3300048916 | Bacteria | 2075 |
| 725 | Ga0496114_0498130 | 3300048917 | Bacteria | 1078 |
| 726 | Ga0496117_0128934 | 3300048920 | Bacteria | 1537 |
| 727 | Ga0496118_0021877 | 3300048921 | Bacteria | 5610 |
| 728 | Ga0496119_0168618 | 3300048922 | Bacteria | 1158 |
| 729 | Ga0496124_0003599 | 3300048927 | Bacteria | 18829 |
| 730 | Ga0496124_0305346 | 3300048927 | Bacteria | 1147 |
| 731 | Ga0496126_0011237 | 3300048929 | Bacteria | 9289 |
| 732 | Ga0495678_015023 | 3300049459 | Bacteria | 3579 |
| 733 | Ga0501290_002698 | 3300049513 | Bacteria | 2277 |
| 734 | Ga0501291_008920 | 3300049514 | Bacteria | 1396 |
| 735 | Ga0501293_002809 | 3300049516 | Bacteria | 1331 |
| 736 | Ga0501296_009601 | 3300049519 | Bacteria | 1136 |
| 737 | Ga0501298_001396 | 3300049521 | Bacteria | 3548 |
| 738 | Ga0501047_0054598 | 3300049581 | Bacteria | 3864 |
| 739 | Ga0501047_0548429 | 3300049581 | Bacteria | 981 |
| 740 | Ga0501198_002120 | 3300049649 | Bacteria | 2642 |
| 741 | Ga0501206_007264 | 3300049653 | Bacteria | 1451 |
| 742 | Ga0501207_002295 | 3300049654 | Bacteria | 2457 |
| 743 | Ga0501216_039212 | 3300049660 | Bacteria | 900 |
| 744 | Ga0501217_000489 | 3300049661 | Bacteria | 6526 |
| 745 | Ga0501217_054947 | 3300049661 | Unclassified | 1050 |
| 746 | Ga0501223_001730 | 3300049663 | Bacteria | 4975 |
| 747 | Ga0501224_002043 | 3300049664 | Bacteria | 2733 |
| 748 | Ga0501224_009149 | 3300049664 | Bacteria | 1448 |
| 749 | Ga0501233_010382 | 3300049668 | Bacteria | 1833 |
| 750 | Ga0501235_001605 | 3300049669 | Bacteria | 4845 |
| 751 | Ga0501238_000247 | 3300049671 | Bacteria | 7436 |
| 752 | Ga0501240_011501 | 3300049673 | Bacteria | 1194 |
| 753 | Ga0501242_002934 | 3300049674 | Bacteria | 1821 |
| 754 | Ga0501243_008554 | 3300049675 | Bacteria | 1579 |
| 755 | Ga0501249_059929 | 3300049679 | Bacteria | 881 |
| 756 | Ga0501252_004914 | 3300049682 | Bacteria | 1438 |
| 757 | Ga0501253_003346 | 3300049683 | Bacteria | 1914 |
| 758 | Ga0501257_003363 | 3300049686 | Bacteria | 3428 |
| 759 | Ga0501257_054991 | 3300049686 | Bacteria | 998 |
| 760 | Ga0501259_002592 | 3300049688 | Bacteria | 2917 |
| 761 | Ga0501259_006838 | 3300049688 | Bacteria | 1819 |
| 762 | Ga0501260_002621 | 3300049689 | Bacteria | 1568 |
| 763 | Ga0501261_000798 | 3300049690 | Bacteria | 3928 |
| 764 | Ga0501221_005416 | 3300049704 | Bacteria | 2131 |
| 765 | Ga0501234_001087 | 3300049707 | Bacteria | 4298 |
| 766 | Ga0501245_001058 | 3300049708 | Bacteria | 3544 |
| 767 | Ga0501245_001369 | 3300049708 | Bacteria | 3141 |
| 768 | Ga0501232_001573 | 3300049757 | Bacteria | 1846 |
| 769 | Ga0501266_000009 | 3300049763 | Bacteria | 233584 |
| 770 | Ga0501266_014609 | 3300049763 | Bacteria | 1031 |
| 771 | Ga0501268_006041 | 3300049765 | Bacteria | 1762 |
| 772 | Ga0501280_000234 | 3300049776 | Bacteria | 13979 |
| 773 | Ga0501044_0155377 | 3300049823 | Bacteria | 2267 |
| 774 | Ga0501044_0607011 | 3300049823 | Bacteria | 987 |
| 775 | Ga0501212_008257 | 3300049851 | Bacteria | 1445 |
| 776 | nmdc:mga03n38_4510_c1 | 3300050490 | Bacteria | 4629 |
| 777 | nmdc:mga0k408_184175_c1 | 3300050493 | Bacteria | 1245 |
| 778 | nmdc:mga0k408_48_c1 | 3300050493 | Bacteria | 60474 |
| 779 | nmdc:mga0k408_7455_c1 | 3300050493 | Bacteria | 5842 |
| 780 | nmdc:mga07m45_23288_c1 | 3300050496 | Bacteria | 3384 |
| 781 | nmdc:mga07m45_6486_c1 | 3300050496 | Bacteria | 5918 |
| 782 | nmdc:mga05p37_473606_c1 | 3300050507 | Unclassified | 1444 |
| 783 | nmdc:mga09592_20367_c1 | 3300050508 | Bacteria | 5452 |
| 784 | nmdc:mga09592_281014_c1 | 3300050508 | Bacteria | 1444 |
| 785 | nmdc:mga0qj67_124526_c1 | 3300050509 | Bacteria | 2086 |
| 786 | nmdc:mga06r32_103037_c1 | 3300050510 | Bacteria | 2802 |
| 787 | nmdc:mga06r32_442933_c1 | 3300050510 | Bacteria | 1279 |
| 788 | nmdc:mga08y16_72804_c1 | 3300050511 | Bacteria | 3581 |
| 789 | nmdc:mga0n895_558669_c1 | 3300050512 | Bacteria | 1150 |
| 790 | nmdc:mga08x19_644_c1 | 3300050514 | Bacteria | 22569 |
| 791 | nmdc:mga0a205_274466_c1 | 3300050515 | Bacteria | 1562 |
| 792 | nmdc:mga0sz30_35_c1 | 3300050516 | Bacteria | 39496 |
| 793 | Ga0500635_0038275 | 3300053080 | Bacteria | 1590 |
| 794 | Ga0495619_0075549 | 3300053085 | Bacteria | 2261 |
| 795 | Ga0500578_0000029 | 3300053086 | Bacteria | 140078 |
| 796 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 797 | Ga0500646_0048854 | 3300053090 | Bacteria | 1214 |
| 798 | Ga0500583_0010625 | 3300053092 | Bacteria | 3426 |
| 799 | Ga0500651_0000596 | 3300053093 | Bacteria | 18092 |
| 800 | Ga0500641_0000048 | 3300053096 | Bacteria | 57304 |
| 801 | Ga0500592_000055 | 3300053116 | Bacteria | 33352 |
| 802 | Ga0500618_000002 | 3300053125 | Bacteria | 370822 |
| 803 | Ga0500559_0015702 | 3300053136 | Bacteria | 3197 |
| 804 | Ga0500568_0013786 | 3300053139 | Bacteria | 3673 |
| 805 | Ga0500568_0070434 | 3300053139 | Bacteria | 1340 |
| 806 | Ga0500568_0131135 | 3300053139 | Bacteria | 932 |
| 807 | Ga0500573_0000358 | 3300053140 | Bacteria | 19420 |
| 808 | Ga0500588_0002830 | 3300053146 | Bacteria | 3591 |
| 809 | Ga0500589_058678 | 3300053147 | Bacteria | 1769 |
| 810 | Ga0500604_0030370 | 3300053151 | Bacteria | 1580 |
| 811 | Ga0500622_0000384 | 3300053156 | Bacteria | 42700 |
| 812 | Ga0500622_0003212 | 3300053156 | Bacteria | 11115 |
| 813 | Ga0500622_0012829 | 3300053156 | Bacteria | 4528 |
| 814 | Ga0466962_0069036 | 3300061719 | Bacteria | 1688 |
| 815 | Ga0466962_0232653 | 3300061719 | Bacteria | 904 |
| 816 | 2509442784 | 2509276033 | Bacteria | 7180565 |
| 817 | 2644011057 | 2643221600 | Bacteria | 5530138 |
| 818 | 2644042592 | 2643221606 | Bacteria | 5588032 |
| 819 | 2644683918 | 2643221725 | Bacteria | 5087956 |
| 820 | 2739587990 | 2739367651 | Bacteria | 6359826 |
| 821 | 2739614361 | 2739367656 | Bacteria | 5152243 |
| 822 | 2739646897 | 2739367663 | Bacteria | 5040914 |
| 823 | 2765469437 | 2765235802 | Bacteria | 5618596 |
| 824 | 2793315441 | 2791355259 | Bacteria | 7254731 |
| 825 | 2793328657 | 2791355261 | Bacteria | 6661293 |
| 826 | 2793366141 | 2791355267 | Bacteria | 7222458 |
| 827 | 2802652193 | 2802428842 | Bacteria | 4926114 |
| 828 | 2819679451 | 2818991460 | Bacteria | 7595395 |
| 829 | 2838022846 | 2838022645 | Bacteria | 6494267 |
| 830 | 2838665211 | 2838661181 | Bacteria | 7385261 |
| 831 | 2842201327 | 2842198810 | Bacteria | 6608673 |
| 832 | 2842287844 | 2842285085 | Bacteria | 6011953 |
| 833 | 2842348413 | 2842341865 | Bacteria | 7003929 |
| 834 | 2842367006 | 2842363717 | Bacteria | 6844742 |
| 835 | 2842399775 | 2842395702 | Bacteria | 6780583 |
| 836 | 2842404628 | 2842402390 | Bacteria | 6681310 |
| 837 | 2842411211 | 2842409023 | Bacteria | 6687331 |
| 838 | 2842418340 | 2842415677 | Bacteria | 6596907 |
| 839 | 2842724241 | 2842722452 | Bacteria | 6263924 |
| 840 | 2842906243 | 2842903701 | Bacteria | 6986368 |
| 841 | 2842913625 | 2842909656 | Bacteria | 6185908 |
| 842 | 2849282563 | 2849281842 | Bacteria | 6065644 |
| 843 | 2852626462 | 2852623160 | Bacteria | 4376875 |
| 844 | 2857617380 | 2857613821 | Bacteria | 4917088 |
| 845 | 2857621284 | 2857618242 | Bacteria | 5635925 |
| 846 | 2857631688 | 2857627736 | Bacteria | 5625397 |
| 847 | 2884791920 | 2884791551 | Bacteria | 8511252 |
| 848 | 2884934888 | 2884933994 | Bacteria | 4535041 |
| 849 | 2919186757 | 2919186247 | Bacteria | 6244071 |
| 850 | 2919195776 | 2919191525 | Bacteria | 5765973 |
| 851 | 2919440705 | 2919437846 | Bacteria | 6199444 |
| 852 | 2929179763 | 2929177148 | Bacteria | 7883697 |
| 853 | 2929243016 | 2929239360 | Bacteria | 7745570 |
| 854 | 2939665974 | 2939664404 | Bacteria | 6364494 |
| 855 | 2945982185 | 2945977869 | Bacteria | 7777518 |
| 856 | 2945998934 | 2945997725 | Bacteria | 6404843 |
| 857 | 2946018424 | 2946013367 | Bacteria | 7766675 |
| 858 | 2954021383 | 2954016120 | Bacteria | 6446024 |
| 859 | 2965320862 | 2965320100 | Bacteria | 3975600 |
| 860 | 2977236834 | 2977232053 | Bacteria | 5485925 |
| 861 | 2977268923 | 2977268062 | Bacteria | 5243061 |
| 862 | 2996894003 | 2996893221 | Bacteria | 5823108 |
| 863 | 8005303743 | 8005301065 | Bacteria | 6614431 |
| 864 | 8005384768 | 8005382845 | Bacteria | 6732062 |
| 865 | 8005398218 | 8005395548 | Bacteria | 6806915 |
| 866 | 8005688469 | 8005682033 | Bacteria | 6726518 |
| 867 | 8005691422 | 8005688590 | Bacteria | 6610080 |
| 868 | 8005696427 | 8005695170 | Bacteria | 6912330 |
| 869 | 8054305148 | 8054302542 | Bacteria | 5698134 |
| 870 | 8054309755 | 8054307821 | Bacteria | 5212224 |
| 871 | 8055914983 | 8055909800 | Bacteria | 7278581 |
| 872 | 8056379831 | 8056375014 | Bacteria | 7006639 |
| 873 | 8056387799 | 8056382006 | Bacteria | 6408074 |
| 874 | Ga0395899_0115664 | |||
| 875 | SwRhRL2b_contig_2056031 | |||
| 876 | SwRhRL2b_contig_909155 | |||
| 877 | JGI24735J21928_10044086 | |||
| 878 | JGI24738J21930_10020408 | |||
| 879 | JGI25154J39366_1000004 | |||
| 880 | JGI25157J39369_1006301 | |||
| 881 | JGI25152J39213_1000178 | |||
| 882 | JGI25150J39212_1000021 | |||
| 883 | JGI25151J46595_10000078 | |||
| 884 | JGI25406J46586_10000254 | |||
| 885 | JGI25153J46596_10000057 | |||
| 886 | JGI25153J46596_10029200 | |||
| 887 | rootH1_10035892 | |||
| 888 | rootH2_10209339 | |||
| 889 | rootL2_10019401 | |||
| 890 | rootH1_10010533 | |||
| 891 | rootH1_10044234 | |||
| 892 | rootH1_10072613 | |||
| 893 | JGI25160J50197_1004985 | |||
| 894 | Ga0055531_10000151 | |||
| 895 | Ga0058863_11688669 | |||
| 896 | Ga0065165_1002699 | |||
| 897 | Ga0065165_1024492 | |||
| 898 | Ga0065714_10003347 | |||
| 899 | Ga0065714_10007490 | |||
| 900 | Ga0065714_10084037 | |||
| 901 | Ga0065714_10085601 | |||
| 902 | Ga0065714_10105575 | |||
| 903 | Ga0065704_10000208 | |||
| 904 | Ga0065704_10001802 | |||
| 905 | Ga0065712_10216383 | |||
| 906 | Ga0065715_10016699 | |||
| 907 | Ga0070658_10090806 | |||
| 908 | Ga0070658_10142292 | |||
| 909 | Ga0070658_10393274 | |||
| 910 | Ga0070676_10057975 | |||
| 911 | Ga0070683_100002599 | |||
| 912 | Ga0070683_100003284 | |||
| 913 | Ga0070683_100013362 | |||
| 914 | Ga0070683_100080685 | |||
| 915 | Ga0070683_100508283 | |||
| 916 | Ga0070683_100725931 | |||
| 917 | Ga0070690_100016043 | |||
| 918 | Ga0070690_100079964 | |||
| 919 | Ga0070670_100029618 | |||
| 920 | Ga0070670_100036434 | |||
| 921 | Ga0070670_100052770 | |||
| 922 | Ga0070670_100067272 | |||
| 923 | Ga0070670_100142102 | |||
| 924 | Ga0070670_100184510 | |||
| 925 | Ga0070670_100231830 | |||
| 926 | Ga0070670_100302088 | |||
| 927 | Ga0070670_100379447 | |||
| 928 | Ga0070670_100601890 | |||
| 929 | Ga0070677_10185431 | |||
| 930 | Ga0068869_100039234 | |||
| 931 | Ga0068869_100123818 | |||
| 932 | Ga0068869_100135545 | |||
| 933 | Ga0068869_100241345 | |||
| 934 | Ga0068869_100381515 | |||
| 935 | Ga0070666_10189427 | |||
| 936 | Ga0070666_10210984 | |||
| 937 | Ga0070680_100004414 | |||
| 938 | Ga0070680_100093459 | |||
| 939 | Ga0070680_100400147 | |||
| 940 | Ga0070682_100127057 | |||
| 941 | Ga0068868_100020461 | |||
| 942 | Ga0068868_100056313 | |||
| 943 | Ga0068868_100173668 | |||
| 944 | Ga0068868_100178822 | |||
| 945 | Ga0068868_100389799 | |||
| 946 | Ga0070660_100042079 | |||
| 947 | Ga0070660_100089693 | |||
| 948 | Ga0070660_100242632 | |||
| 949 | Ga0070689_100054288 | |||
| 950 | Ga0070689_100098596 | |||
| 951 | Ga0070689_100099781 | |||
| 952 | Ga0070689_100313811 | |||
| 953 | Ga0070691_10024735 | |||
| 954 | Ga0070687_100024118 | |||
| 955 | Ga0070661_100005419 | |||
| 956 | Ga0070661_100062929 | |||
| 957 | Ga0070661_100416070 | |||
| 958 | Ga0070692_10093181 | |||
| 959 | Ga0070668_100016313 | |||
| 960 | Ga0070668_100164808 | |||
| 961 | Ga0070669_100008697 | |||
| 962 | Ga0070669_100110488 | |||
| 963 | Ga0070669_100122108 | |||
| 964 | Ga0070675_100121052 | |||
| 965 | Ga0070675_100205455 | |||
| 966 | Ga0070675_100248375 | |||
| 967 | Ga0070671_100035724 | |||
| 968 | Ga0070671_100181309 | |||
| 969 | Ga0070671_100233840 | |||
| 970 | Ga0070671_100378922 | |||
| 971 | Ga0070673_100051414 | |||
| 972 | Ga0070673_100058753 | |||
| 973 | Ga0070673_100091911 | |||
| 974 | Ga0070673_100249163 | |||
| 975 | Ga0070673_100344836 | |||
| 976 | Ga0070673_100452645 | |||
| 977 | Ga0070688_100016696 | |||
| 978 | Ga0070688_100041035 | |||
| 979 | Ga0070688_100119872 | |||
| 980 | Ga0070659_100018639 | |||
| 981 | Ga0070659_100073750 | |||
| 982 | Ga0070659_100079203 | |||
| 983 | Ga0070659_100150254 | |||
| 984 | Ga0070667_100026222 | |||
| 985 | Ga0070667_100030328 | |||
| 986 | Ga0070667_100232597 | |||
| 987 | Ga0070714_100662671 | |||
| 988 | Ga0070701_10064463 | |||
| 989 | Ga0070701_10140581 | |||
| 990 | Ga0070700_100329322 | |||
| 991 | Ga0070663_100008726 | |||
| 992 | Ga0070663_100037948 | |||
| 993 | Ga0070663_100122107 | |||
| 994 | Ga0070678_100198856 | |||
| 995 | Ga0070678_100473103 | |||
| 996 | Ga0070678_100661807 | |||
| 997 | Ga0070662_100002229 | |||
| 998 | Ga0070662_100011227 | |||
| 999 | Ga0070662_100060331 | |||
| 1000 | Ga0070662_100127506 | |||
| 1001 | Ga0070681_10007244 | |||
| 1002 | Ga0070681_10014926 | |||
| 1003 | Ga0070681_10099103 | |||
| 1004 | Ga0068867_100085928 | |||
| 1005 | Ga0068867_100233481 | |||
| 1006 | Ga0070685_10034327 | |||
| 1007 | Ga0070685_10081299 | |||
| 1008 | Ga0070685_10094996 | |||
| 1009 | Ga0070685_10143126 | |||
| 1010 | Ga0070685_10160407 | |||
| 1011 | Ga0070698_100035084 | |||
| 1012 | Ga0070698_100522404 | |||
| 1013 | Ga0070679_100000261 | |||
| 1014 | Ga0070684_100009695 | |||
| 1015 | Ga0070684_100010017 | |||
| 1016 | Ga0070684_100014664 | |||
| 1017 | Ga0070684_100040560 | |||
| 1018 | Ga0070684_100345421 | |||
| 1019 | Ga0068853_100002363 | |||
| 1020 | Ga0068853_100188030 | |||
| 1021 | Ga0068853_100504452 | |||
| 1022 | Ga0068853_100703709 | |||
| 1023 | Ga0070672_100056886 | |||
| 1024 | Ga0070672_100111323 | |||
| 1025 | Ga0070672_100258693 | |||
| 1026 | Ga0070672_100495825 | |||
| 1027 | Ga0070672_100587983 | |||
| 1028 | Ga0070693_100068419 | |||
| 1029 | Ga0070665_100000205 | |||
| 1030 | Ga0070665_100062451 | |||
| 1031 | Ga0070665_100063508 | |||
| 1032 | Ga0070665_100063617 | |||
| 1033 | Ga0068855_100000033 | |||
| 1034 | Ga0068855_100000724 | |||
| 1035 | Ga0068855_100005855 | |||
| 1036 | Ga0068855_100009537 | |||
| 1037 | Ga0068855_100016101 | |||
| 1038 | Ga0068855_100042678 | |||
| 1039 | Ga0068855_100140971 | |||
| 1040 | Ga0068855_100170729 | |||
| 1041 | Ga0068855_100342501 | |||
| 1042 | Ga0070664_100011685 | |||
| 1043 | Ga0070664_100019632 | |||
| 1044 | Ga0070664_100045032 | |||
| 1045 | Ga0070664_100059352 | |||
| 1046 | Ga0070664_100091776 | |||
| 1047 | Ga0070664_100125970 | |||
| 1048 | Ga0070664_100361684 | |||
| 1049 | Ga0068857_100007316 | |||
| 1050 | Ga0068857_100015569 | |||
| 1051 | Ga0068857_100033142 | |||
| 1052 | Ga0068857_100094269 | |||
| 1053 | Ga0068857_100105507 | |||
| 1054 | Ga0068857_100697698 | |||
| 1055 | Ga0068854_100012353 | |||
| 1056 | Ga0068854_100155438 | |||
| 1057 | Ga0068854_100363504 | |||
| 1058 | Ga0068854_100452165 | |||
| 1059 | Ga0068856_100036562 | |||
| 1060 | Ga0068856_100074923 | |||
| 1061 | Ga0068856_100082741 | |||
| 1062 | Ga0070702_100218726 | |||
| 1063 | Ga0068852_100000368 | |||
| 1064 | Ga0068852_100014069 | |||
| 1065 | Ga0068852_100017426 | |||
| 1066 | Ga0068852_100063278 | |||
| 1067 | Ga0068852_100078238 | |||
| 1068 | Ga0068852_100125392 | |||
| 1069 | Ga0068852_100138311 | |||
| 1070 | Ga0068852_100139705 | |||
| 1071 | Ga0068859_100022454 | |||
| 1072 | Ga0068859_100087409 | |||
| 1073 | Ga0068859_100186436 | |||
| 1074 | Ga0068859_100201187 | |||
| 1075 | Ga0068859_100261651 | |||
| 1076 | Ga0068864_100025261 | |||
| 1077 | Ga0068864_100081858 | |||
| 1078 | Ga0068864_100094931 | |||
| 1079 | Ga0068864_100202995 | |||
| 1080 | Ga0068864_100340116 | |||
| 1081 | Ga0068866_10038610 | |||
| 1082 | Ga0068866_10120883 | |||
| 1083 | Ga0068861_100103689 | |||
| 1084 | Ga0068851_10047712 | |||
| 1085 | Ga0068870_10355579 | |||
| 1086 | Ga0068863_100013238 | |||
| 1087 | Ga0068863_100047906 | |||
| 1088 | Ga0068863_100373016 | |||
| 1089 | Ga0068863_100550760 | |||
| 1090 | Ga0068858_100024215 | |||
| 1091 | Ga0068858_100113418 | |||
| 1092 | Ga0068860_100009501 | |||
| 1093 | Ga0068860_100032432 | |||
| 1094 | Ga0068860_100044231 | |||
| 1095 | Ga0068862_100051975 | |||
| 1096 | Ga0068862_100180126 | |||
| 1097 | Ga0081539_10001900 | |||
| 1098 | Ga0081539_10038125 | |||
| 1099 | Ga0075363_100002744 | |||
| 1100 | Ga0075369_10000022 | |||
| 1101 | Ga0075366_10000493 | |||
| 1102 | Ga0075366_10003181 | |||
| 1103 | Ga0075366_10028307 | |||
| 1104 | Ga0097621_100067164 | |||
| 1105 | Ga0097621_100118194 | |||
| 1106 | Ga0097621_100398818 | |||
| 1107 | Ga0068871_100029030 | |||
| 1108 | Ga0068871_100182765 | |||
| 1109 | Ga0068871_100326388 | |||
| 1110 | Ga0075428_100014269 | |||
| 1111 | Ga0075428_100017394 | |||
| 1112 | Ga0075428_100160684 | |||
| 1113 | Ga0075428_100169103 | |||
| 1114 | Ga0075430_100014698 | |||
| 1115 | Ga0075430_100052808 | |||
| 1116 | Ga0075431_100024723 | |||
| 1117 | Ga0075431_100049098 | |||
| 1118 | Ga0075431_100240198 | |||
| 1119 | Ga0075433_10256723 | |||
| 1120 | Ga0075429_100006082 | |||
| 1121 | Ga0075429_100102502 | |||
| 1122 | Ga0075429_100577034 | |||
| 1123 | Ga0068865_100169652 | |||
| 1124 | Ga0068865_100595465 | |||
| 1125 | Ga0075436_100000340 | |||
| 1126 | Ga0097620_100022453 | |||
| 1127 | Ga0097620_100087401 | |||
| 1128 | Ga0097620_100186445 | |||
| 1129 | Ga0097620_100201180 | |||
| 1130 | Ga0097620_100261623 | |||
| 1131 | Ga0105240_10000020 | |||
| 1132 | Ga0105240_10002198 | |||
| 1133 | Ga0105240_10029260 | |||
| 1134 | Ga0105240_10095427 | |||
| 1135 | Ga0105240_10224569 | |||
| 1136 | Ga0105240_10668553 | |||
| 1137 | Ga0111539_10048554 | |||
| 1138 | Ga0105247_10423230 | |||
| 1139 | Ga0114129_10040856 | |||
| 1140 | Ga0105241_10063449 | |||
| 1141 | Ga0105241_10179178 | |||
| 1142 | Ga0105241_10193872 | |||
| 1143 | Ga0105241_10341143 | |||
| 1144 | Ga0105241_10608530 | |||
| 1145 | Ga0105242_10024277 | |||
| 1146 | Ga0105242_10093451 | |||
| 1147 | Ga0105242_10188128 | |||
| 1148 | Ga0105242_10228529 | |||
| 1149 | Ga0105237_10000143 | |||
| 1150 | Ga0105237_10001072 | |||
| 1151 | Ga0105237_10001440 | |||
| 1152 | Ga0105237_10045725 | |||
| 1153 | Ga0105237_10132929 | |||
| 1154 | Ga0105238_10041777 | |||
| 1155 | Ga0105249_10010289 | |||
| 1156 | Ga0105249_10014619 | |||
| 1157 | Ga0105249_10062101 | |||
| 1158 | Ga0105239_10000002 | |||
| 1159 | Ga0105239_10000136 | |||
| 1160 | Ga0105239_10001354 | |||
| 1161 | Ga0105239_10215387 | |||
| 1162 | Ga0105246_10000302 | |||
| 1163 | Ga0105246_10104980 | |||
| 1164 | Ga0157373_10000064 | |||
| 1165 | Ga0157373_10000154 | |||
| 1166 | Ga0157373_10005219 | |||
| 1167 | Ga0157373_10012974 | |||
| 1168 | Ga0157373_10013107 | |||
| 1169 | Ga0157373_10053286 | |||
| 1170 | Ga0157373_10059948 | |||
| 1171 | Ga0157373_10104812 | |||
| 1172 | Ga0157371_10000135 | |||
| 1173 | Ga0157371_10001388 | |||
| 1174 | Ga0157371_10001497 | |||
| 1175 | Ga0157371_10002087 | |||
| 1176 | Ga0157371_10002968 | |||
| 1177 | Ga0157371_10006874 | |||
| 1178 | Ga0157371_10050066 | |||
| 1179 | Ga0157371_10125589 | |||
| 1180 | Ga0157371_10133198 | |||
| 1181 | Ga0157371_10151309 | |||
| 1182 | Ga0157371_10151585 | |||
| 1183 | Ga0157371_10325152 | |||
| 1184 | Ga0157370_10001449 | |||
| 1185 | Ga0157370_10002674 | |||
| 1186 | Ga0157370_10007812 | |||
| 1187 | Ga0157370_10038640 | |||
| 1188 | Ga0157370_10123063 | |||
| 1189 | Ga0157370_10249387 | |||
| 1190 | Ga0157370_10398592 | |||
| 1191 | Ga0157370_10439379 | |||
| 1192 | Ga0157370_10518708 | |||
| 1193 | Ga0157369_10005954 | |||
| 1194 | Ga0157369_10033631 | |||
| 1195 | Ga0157369_10124437 | |||
| 1196 | Ga0157369_10256644 | |||
| 1197 | Ga0157369_10453443 | |||
| 1198 | Ga0157369_10501742 | |||
| 1199 | Ga0157374_10003869 | |||
| 1200 | Ga0157374_10040129 | |||
| 1201 | Ga0157374_10094858 | |||
| 1202 | Ga0157374_10391017 | |||
| 1203 | Ga0157374_10644700 | |||
| 1204 | Ga0157378_10000557 | |||
| 1205 | Ga0157378_10006087 | |||
| 1206 | Ga0157378_10025884 | |||
| 1207 | Ga0157378_10050643 | |||
| 1208 | Ga0157378_10142229 | |||
| 1209 | Ga0157378_10168685 | |||
| 1210 | Ga0157378_10243617 | |||
| 1211 | Ga0163162_10000254 | |||
| 1212 | Ga0163162_10016096 | |||
| 1213 | Ga0163162_10064751 | |||
| 1214 | Ga0163162_10069871 | |||
| 1215 | Ga0163162_10081298 | |||
| 1216 | Ga0163162_10082667 | |||
| 1217 | Ga0163162_10102532 | |||
| 1218 | Ga0163162_10173159 | |||
| 1219 | Ga0163162_10210054 | |||
| 1220 | Ga0163162_10224616 | |||
| 1221 | Ga0163162_10321898 | |||
| 1222 | Ga0163162_10731147 | |||
| 1223 | Ga0157372_10000029 | |||
| 1224 | Ga0157372_10000061 | |||
| 1225 | Ga0157372_10018416 | |||
| 1226 | Ga0157372_10023276 | |||
| 1227 | Ga0157372_10048744 | |||
| 1228 | Ga0157372_10105425 | |||
| 1229 | Ga0157372_10178130 | |||
| 1230 | Ga0157372_10197959 | |||
| 1231 | Ga0157372_10250687 | |||
| 1232 | Ga0157372_10377530 | |||
| 1233 | Ga0157372_10434000 | |||
| 1234 | Ga0157372_10484761 | |||
| 1235 | Ga0157372_10555015 | |||
| 1236 | Ga0157375_10032527 | |||
| 1237 | Ga0157375_10036964 | |||
| 1238 | Ga0157375_10077202 | |||
| 1239 | Ga0157375_10077731 | |||
| 1240 | Ga0157375_10128523 | |||
| 1241 | Ga0157375_10251899 | |||
| 1242 | Ga0157375_10595993 | |||
| 1243 | Ga0157375_11357778 | |||
| 1244 | Ga0163163_10001144 | |||
| 1245 | Ga0163163_10006882 | |||
| 1246 | Ga0163163_10019272 | |||
| 1247 | Ga0163163_10030868 | |||
| 1248 | Ga0163163_10086192 | |||
| 1249 | Ga0163163_10145364 | |||
| 1250 | Ga0163163_10177718 | |||
| 1251 | Ga0157380_10008071 | |||
| 1252 | Ga0157380_10342077 | |||
| 1253 | Ga0157380_10593258 | |||
| 1254 | Ga0157380_10671964 | |||
| 1255 | Ga0157377_10000723 | |||
| 1256 | Ga0157377_10033385 | |||
| 1257 | Ga0157377_10068046 | |||
| 1258 | Ga0157377_10136205 | |||
| 1259 | Ga0157377_10158274 | |||
| 1260 | Ga0157377_10244038 | |||
| 1261 | Ga0157379_10197830 | |||
| 1262 | Ga0157379_10802649 | |||
| 1263 | Ga0157376_10124212 | |||
| 1264 | Ga0157376_10171273 | |||
| 1265 | Ga0182006_1000668 | |||
| 1266 | Ga0182006_1013089 | |||
| 1267 | Ga0182007_10023721 | |||
| 1268 | Ga0183373_1004 | |||
| 1269 | Ga0163161_10022366 | |||
| 1270 | Ga0163161_10025767 | |||
| 1271 | Ga0163161_10038137 | |||
| 1272 | Ga0163161_10215799 | |||
| 1273 | Ga0163161_10402573 | |||
| 1274 | Ga0213876_10046993 | |||
| 1275 | Ga0213875_10009671 | |||
| 1276 | Ga0207425_1000004 | |||
| 1277 | Ga0209646_1000025 | |||
| 1278 | Ga0209026_1000097 | |||
| 1279 | Ga0209026_1000226 | |||
| 1280 | Ga0209026_1007599 | |||
| 1281 | Ga0209148_1001642 | |||
| 1282 | Ga0209129_1000048 | |||
| 1283 | Ga0209233_1001263 | |||
| 1284 | Ga0209455_1001752 | |||
| 1285 | Ga0209025_1000009 | |||
| 1286 | Ga0209758_1000010 | |||
| 1287 | Ga0209758_1021370 | |||
| 1288 | Ga0207426_1000220 | |||
| 1289 | Ga0209257_1000013 | |||
| 1290 | Ga0207656_10033876 | |||
| 1291 | Ga0207682_10048712 | |||
| 1292 | Ga0207682_10203609 | |||
| 1293 | Ga0207642_10035445 | |||
| 1294 | Ga0207688_10057097 | |||
| 1295 | Ga0207680_10040907 | |||
| 1296 | Ga0207647_10000105 | |||
| 1297 | Ga0207647_10026086 | |||
| 1298 | Ga0207647_10046356 | |||
| 1299 | Ga0207645_10065399 | |||
| 1300 | Ga0207643_10049704 | |||
| 1301 | Ga0207705_10121483 | |||
| 1302 | Ga0207705_10125744 | |||
| 1303 | Ga0207705_10234134 | |||
| 1304 | Ga0207654_10001489 | |||
| 1305 | Ga0207707_10022653 | |||
| 1306 | Ga0207695_10000020 | |||
| 1307 | Ga0207695_10000076 | |||
| 1308 | Ga0207695_10000090 | |||
| 1309 | Ga0207695_10000183 | |||
| 1310 | Ga0207695_10002461 | |||
| 1311 | Ga0207695_10644465 | |||
| 1312 | Ga0207671_10000968 | |||
| 1313 | Ga0207671_10010707 | |||
| 1314 | Ga0207671_10015831 | |||
| 1315 | Ga0207671_10024163 | |||
| 1316 | Ga0207671_10108150 | |||
| 1317 | Ga0207660_10025129 | |||
| 1318 | Ga0207662_10044920 | |||
| 1319 | Ga0207662_10092114 | |||
| 1320 | Ga0207657_10023160 | |||
| 1321 | Ga0207657_10072360 | |||
| 1322 | Ga0207657_10160815 | |||
| 1323 | Ga0207649_10014835 | |||
| 1324 | Ga0207649_10057090 | |||
| 1325 | Ga0207649_10450540 | |||
| 1326 | Ga0207652_10000011 | |||
| 1327 | Ga0207652_10000057 | |||
| 1328 | Ga0207681_10109054 | |||
| 1329 | Ga0207650_10014868 | |||
| 1330 | Ga0207650_10020937 | |||
| 1331 | Ga0207650_10078395 | |||
| 1332 | Ga0207650_10198702 | |||
| 1333 | Ga0207650_10357199 | |||
| 1334 | Ga0207650_10406835 | |||
| 1335 | Ga0207659_10106702 | |||
| 1336 | Ga0207644_10210437 | |||
| 1337 | Ga0207690_10025553 | |||
| 1338 | Ga0207690_10036836 | |||
| 1339 | Ga0207690_10109974 | |||
| 1340 | Ga0207690_10213637 | |||
| 1341 | Ga0207706_10001578 | |||
| 1342 | Ga0207706_10002076 | |||
| 1343 | Ga0207706_10005829 | |||
| 1344 | Ga0207706_10016578 | |||
| 1345 | Ga0207706_10027456 | |||
| 1346 | Ga0207706_10112280 | |||
| 1347 | Ga0207706_10154478 | |||
| 1348 | Ga0207706_10379158 | |||
| 1349 | Ga0207686_10000200 | |||
| 1350 | Ga0207686_10048259 | |||
| 1351 | Ga0207686_10190230 | |||
| 1352 | Ga0207686_10584200 | |||
| 1353 | Ga0207670_10037753 | |||
| 1354 | Ga0207670_10072649 | |||
| 1355 | Ga0207669_10269836 | |||
| 1356 | Ga0207669_10583069 | |||
| 1357 | Ga0207704_10363376 | |||
| 1358 | Ga0207691_10009195 | |||
| 1359 | Ga0207691_10022720 | |||
| 1360 | Ga0207691_10027317 | |||
| 1361 | Ga0207691_10065448 | |||
| 1362 | Ga0207691_10515176 | |||
| 1363 | Ga0207691_10530201 | |||
| 1364 | Ga0207689_10019312 | |||
| 1365 | Ga0207689_10024873 | |||
| 1366 | Ga0207689_10081856 | |||
| 1367 | Ga0207689_10129789 | |||
| 1368 | Ga0207689_10216924 | |||
| 1369 | Ga0207661_10001267 | |||
| 1370 | Ga0207661_10003205 | |||
| 1371 | Ga0207661_10013373 | |||
| 1372 | Ga0207661_10018874 | |||
| 1373 | Ga0207661_10816807 | |||
| 1374 | Ga0207679_10001116 | |||
| 1375 | Ga0207679_10128873 | |||
| 1376 | Ga0207679_10167758 | |||
| 1377 | Ga0207667_10000046 | |||
| 1378 | Ga0207667_10001827 | |||
| 1379 | Ga0207667_10008253 | |||
| 1380 | Ga0207667_10010255 | |||
| 1381 | Ga0207667_10020033 | |||
| 1382 | Ga0207667_10375090 | |||
| 1383 | Ga0207667_11005440 | |||
| 1384 | Ga0207651_10028157 | |||
| 1385 | Ga0207651_10059328 | |||
| 1386 | Ga0207651_10067659 | |||
| 1387 | Ga0207651_10099582 | |||
| 1388 | Ga0207651_10151998 | |||
| 1389 | Ga0207651_10173823 | |||
| 1390 | Ga0207712_10003728 | |||
| 1391 | Ga0207668_10022614 | |||
| 1392 | Ga0207640_10017916 | |||
| 1393 | Ga0207640_10051822 | |||
| 1394 | Ga0207640_10660039 | |||
| 1395 | Ga0207640_10701423 | |||
| 1396 | Ga0207658_10063971 | |||
| 1397 | Ga0207658_10067976 | |||
| 1398 | Ga0207658_10443663 | |||
| 1399 | Ga0207658_10558323 | |||
| 1400 | Ga0207677_10017707 | |||
| 1401 | Ga0207677_10071979 | |||
| 1402 | Ga0207677_10138691 | |||
| 1403 | Ga0207677_10406427 | |||
| 1404 | Ga0207677_10531383 | |||
| 1405 | Ga0207703_10047038 | |||
| 1406 | Ga0207639_10023309 | |||
| 1407 | Ga0207639_10052640 | |||
| 1408 | Ga0207639_10129475 | |||
| 1409 | Ga0207639_10467119 | |||
| 1410 | Ga0207639_10632677 | |||
| 1411 | Ga0207678_10017720 | |||
| 1412 | Ga0207678_10049634 | |||
| 1413 | Ga0207678_10275028 | |||
| 1414 | Ga0207702_10015591 | |||
| 1415 | Ga0207702_10043524 | |||
| 1416 | Ga0207702_10258837 | |||
| 1417 | Ga0207641_10027621 | |||
| 1418 | Ga0207641_10061070 | |||
| 1419 | Ga0207641_10077126 | |||
| 1420 | Ga0207641_10082085 | |||
| 1421 | Ga0207648_10013383 | |||
| 1422 | Ga0207648_10021636 | |||
| 1423 | Ga0207648_10106170 | |||
| 1424 | Ga0207648_10250463 | |||
| 1425 | Ga0207648_10321711 | |||
| 1426 | Ga0207648_10322692 | |||
| 1427 | Ga0207676_10016147 | |||
| 1428 | Ga0207676_10052782 | |||
| 1429 | Ga0207676_10094665 | |||
| 1430 | Ga0207676_10509823 | |||
| 1431 | Ga0207676_10519506 | |||
| 1432 | Ga0207676_10558704 | |||
| 1433 | Ga0207674_10008940 | |||
| 1434 | Ga0207674_10012134 | |||
| 1435 | Ga0207674_10014085 | |||
| 1436 | Ga0207674_10045160 | |||
| 1437 | Ga0207674_10121909 | |||
| 1438 | Ga0207674_10167101 | |||
| 1439 | Ga0207674_10177487 | |||
| 1440 | Ga0207675_100001919 | |||
| 1441 | Ga0207683_10006292 | |||
| 1442 | Ga0207683_10035576 | |||
| 1443 | Ga0207683_10202089 | |||
| 1444 | Ga0207683_10273387 | |||
| 1445 | Ga0207683_10428358 | |||
| 1446 | Ga0207698_10080730 | |||
| 1447 | Ga0207698_10142932 | |||
| 1448 | Ga0207698_10234563 | |||
| 1449 | Ga0207698_10496746 | |||
| 1450 | Ga0207698_10642326 | |||
| 1451 | Ga0207428_10049291 | |||
| 1452 | Ga0268266_10001358 | |||
| 1453 | Ga0268266_10036128 | |||
| 1454 | Ga0268266_10218401 | |||
| 1455 | Ga0268265_10221070 | |||
| 1456 | Ga0268264_10010214 | |||
| 1457 | Ga0268264_10081788 | |||
| 1458 | Ga0307517_10008092 | |||
| 1459 | Ga0307515_10000039 | |||
| 1460 | Ga0307515_10048464 | |||
| 1461 | Ga0307515_10323371 | |||
| 1462 | Ga0316177_1010194 | |||
| 1463 | Ga0316176_1025003 | |||
| 1464 | Ga0307513_10373342 | |||
| 1465 | Ga0307509_10023952 | |||
| 1466 | Ga0307408_100009720 | |||
| 1467 | Ga0307408_100023313 | |||
| 1468 | Ga0307405_10000006 | |||
| 1469 | Ga0307405_10056393 | |||
| 1470 | Ga0307413_10384513 | |||
| 1471 | Ga0307410_10003816 | |||
| 1472 | Ga0307406_10101850 | |||
| 1473 | Ga0307407_10000003 | |||
| 1474 | Ga0307407_10003725 | |||
| 1475 | Ga0307407_10152810 | |||
| 1476 | Ga0307412_10000009 | |||
| 1477 | Ga0307412_10018528 | |||
| 1478 | Ga0307412_10023992 | |||
| 1479 | Ga0307412_10037612 | |||
| 1480 | Ga0307412_10070344 | |||
| 1481 | Ga0307412_10114415 | |||
| 1482 | Ga0307409_100076377 | |||
| 1483 | Ga0307416_100000002 | |||
| 1484 | Ga0307414_10000002 | |||
| 1485 | Ga0307414_10037074 | |||
| 1486 | Ga0307414_10039538 | |||
| 1487 | Ga0307414_10071869 | |||
| 1488 | Ga0307414_10229227 | |||
| 1489 | Ga0307414_10265527 | |||
| 1490 | Ga0307414_10286804 | |||
| 1491 | Ga0307414_10772441 | |||
| 1492 | Ga0307411_10000010 | |||
| 1493 | Ga0307411_10471659 | |||
| 1494 | Ga0307415_100002127 | |||
| 1495 | Ga0373943_0033831 | |||
| 1496 | Ga0373955_0028710 | |||
| 1497 | Ga0373933_0062939 | |||
| 1498 | Ga0373937_0006714 | |||
| 1499 | Ga0373937_0114269 | |||
| 1500 | Ga0395899_0000011 | |||
| 1501 | Ga0395899_0000024 | |||
| 1502 | Ga0395899_0005151 | |||
| 1503 | Ga0395900_0003816 | |||
| 1504 | Ga0395900_0088189 | |||
| 1505 | Ga0395900_0377432 | |||
| 1506 | Ga0395898_0005129 | |||
| 1507 | Ga0395898_0135839 | |||
| 1508 | Ga0395898_0170216 | |||
| 1509 | Ga0395905_0202273 | |||
| 1510 | Ga0395905_0357783 | |||
| 1511 | Ga0436364_0518085 | |||
| 1512 | Ga0395901_0014835 | |||
| 1513 | Ga0395901_0037327 | |||
| 1514 | Ga0436365_0262826 | |||
| 1515 | Ga0439433_0017256 | |||
| 1516 | Ga0439462_0024915 | |||
| 1517 | Ga0451577_0005367 | |||
| 1518 | Ga0451577_0729678 | |||
| 1519 | Ga0466969_0000262 | |||
| 1520 | Ga0466969_0022399 | |||
| 1521 | Ga0466972_0135572 | |||
| 1522 | Ga0453683_0156002 | |||
| 1523 | Ga0466966_0000114 | |||
| 1524 | Ga0466961_0033151 | |||
| 1525 | Ga0466961_0049507 | |||
| 1526 | Ga0466961_0153324 | |||
| 1527 | Ga0466964_0025102 | |||
| 1528 | Ga0453684_0004533 | |||
| 1529 | Ga0453684_0083924 | |||
| 1530 | Ga0453684_0323132 | |||
| 1531 | Ga0466968_0038250 | |||
| 1532 | Ga0466968_0069192 | |||
| 1533 | Ga0466959_0000049 | |||
| 1534 | Ga0466959_0024789 | |||
| 1535 | Ga0466959_0303585 | |||
| 1536 | Ga0466958_0190894 | |||
| 1537 | Ga0495627_001033 | |||
| 1538 | Ga0495592_0018558 | |||
| 1539 | Ga0495650_0000216 | |||
| 1540 | Ga0495650_0037213 | |||
| 1541 | Ga0495585_0000103 | |||
| 1542 | Ga0495606_0000263 | |||
| 1543 | Ga0495606_0008892 | |||
| 1544 | Ga0495606_0017691 | |||
| 1545 | Ga0495608_0090875 | |||
| 1546 | Ga0495610_0003125 | |||
| 1547 | Ga0495610_0084974 | |||
| 1548 | Ga0495610_0158482 | |||
| 1549 | Ga0495616_0067203 | |||
| 1550 | Ga0495628_0021207 | |||
| 1551 | Ga0495630_0008614 | |||
| 1552 | Ga0495637_0078062 | |||
| 1553 | Ga0495643_0002269 | |||
| 1554 | Ga0495648_0034045 | |||
| 1555 | Ga0495663_0000838 | |||
| 1556 | Ga0495652_0240085 | |||
| 1557 | Ga0495652_0371277 | |||
| 1558 | Ga0495598_0097749 | |||
| 1559 | Ga0495633_0049879 | |||
| 1560 | Ga0495668_0000115 | |||
| 1561 | Ga0495668_0002946 | |||
| 1562 | Ga0495634_0031017 | |||
| 1563 | Ga0495625_0000125 | |||
| 1564 | Ga0495625_0010849 | |||
| 1565 | Ga0495661_0017390 | |||
| 1566 | Ga0495661_0050902 | |||
| 1567 | Ga0495657_0113681 | |||
| 1568 | Ga0495599_0085578 | |||
| 1569 | Ga0495658_0074600 | |||
| 1570 | Ga0495624_0261831 | |||
| 1571 | Ga0495649_0000044 | |||
| 1572 | Ga0495600_0221464 | |||
| 1573 | Ga0495660_0004886 | |||
| 1574 | Ga0495672_0019853 | |||
| 1575 | Ga0495672_0024130 | |||
| 1576 | Ga0495680_0285582 | |||
| 1577 | Ga0495687_013604 | |||
| 1578 | Ga0495687_088676 | |||
| 1579 | Ga0495675_0288247 | |||
| 1580 | Ga0495679_052761 | |||
| 1581 | Ga0495673_0027605 | |||
| 1582 | Ga0495681_0000600 | |||
| 1583 | Ga0495684_0085342 | |||
| 1584 | Ga0495686_0000150 | |||
| 1585 | Ga0495686_0000763 | |||
| 1586 | Ga0495686_0001123 | |||
| 1587 | Ga0495686_0014532 | |||
| 1588 | Ga0495686_0077585 | |||
| 1589 | Ga0495686_0127887 | |||
| 1590 | Ga0496102_0091955 | |||
| 1591 | Ga0496102_0966483 | |||
| 1592 | Ga0496104_0297369 | |||
| 1593 | Ga0496107_0044884 | |||
| 1594 | Ga0496109_0554891 | |||
| 1595 | Ga0496112_0173552 | |||
| 1596 | Ga0496112_0877126 | |||
| 1597 | Ga0496113_0117724 | |||
| 1598 | Ga0496114_0498130 | |||
| 1599 | Ga0496117_0128934 | |||
| 1600 | Ga0496118_0021877 | |||
| 1601 | Ga0496119_0168618 | |||
| 1602 | Ga0496124_0003599 | |||
| 1603 | Ga0496124_0305346 | |||
| 1604 | Ga0496126_0011237 | |||
| 1605 | Ga0495678_015023 | |||
| 1606 | Ga0501290_002698 | |||
| 1607 | Ga0501291_008920 | |||
| 1608 | Ga0501293_002809 | |||
| 1609 | Ga0501296_009601 | |||
| 1610 | Ga0501298_001396 | |||
| 1611 | Ga0501047_0054598 | |||
| 1612 | Ga0501047_0548429 | |||
| 1613 | Ga0501198_002120 | |||
| 1614 | Ga0501206_007264 | |||
| 1615 | Ga0501207_002295 | |||
| 1616 | Ga0501216_039212 | |||
| 1617 | Ga0501217_000489 | |||
| 1618 | Ga0501217_054947 | |||
| 1619 | Ga0501223_001730 | |||
| 1620 | Ga0501224_002043 | |||
| 1621 | Ga0501224_009149 | |||
| 1622 | Ga0501233_010382 | |||
| 1623 | Ga0501235_001605 | |||
| 1624 | Ga0501238_000247 | |||
| 1625 | Ga0501240_011501 | |||
| 1626 | Ga0501242_002934 | |||
| 1627 | Ga0501243_008554 | |||
| 1628 | Ga0501249_059929 | |||
| 1629 | Ga0501252_004914 | |||
| 1630 | Ga0501253_003346 | |||
| 1631 | Ga0501257_003363 | |||
| 1632 | Ga0501257_054991 | |||
| 1633 | Ga0501259_002592 | |||
| 1634 | Ga0501259_006838 | |||
| 1635 | Ga0501260_002621 | |||
| 1636 | Ga0501261_000798 | |||
| 1637 | Ga0501221_005416 | |||
| 1638 | Ga0501234_001087 | |||
| 1639 | Ga0501245_001058 | |||
| 1640 | Ga0501245_001369 | |||
| 1641 | Ga0501232_001573 | |||
| 1642 | Ga0501266_000009 | |||
| 1643 | Ga0501266_014609 | |||
| 1644 | Ga0501268_006041 | |||
| 1645 | Ga0501280_000234 | |||
| 1646 | Ga0501044_0155377 | |||
| 1647 | Ga0501044_0607011 | |||
| 1648 | Ga0501212_008257 | |||
| 1649 | nmdc:mga03n38_4510_c1 | |||
| 1650 | nmdc:mga0k408_184175_c1 | |||
| 1651 | nmdc:mga0k408_48_c1 | |||
| 1652 | nmdc:mga0k408_7455_c1 | |||
| 1653 | nmdc:mga07m45_23288_c1 | |||
| 1654 | nmdc:mga07m45_6486_c1 | |||
| 1655 | nmdc:mga05p37_473606_c1 | |||
| 1656 | nmdc:mga09592_20367_c1 | |||
| 1657 | nmdc:mga09592_281014_c1 | |||
| 1658 | nmdc:mga0qj67_124526_c1 | |||
| 1659 | nmdc:mga06r32_103037_c1 | |||
| 1660 | nmdc:mga06r32_442933_c1 | |||
| 1661 | nmdc:mga08y16_72804_c1 | |||
| 1662 | nmdc:mga0n895_558669_c1 | |||
| 1663 | nmdc:mga08x19_644_c1 | |||
| 1664 | nmdc:mga0a205_274466_c1 | |||
| 1665 | nmdc:mga0sz30_35_c1 | |||
| 1666 | Ga0500635_0038275 | |||
| 1667 | Ga0495619_0075549 | |||
| 1668 | Ga0500578_0000029 | |||
| 1669 | Ga0500643_000001 | |||
| 1670 | Ga0500646_0048854 | |||
| 1671 | Ga0500583_0010625 | |||
| 1672 | Ga0500651_0000596 | |||
| 1673 | Ga0500641_0000048 | |||
| 1674 | Ga0500592_000055 | |||
| 1675 | Ga0500618_000002 | |||
| 1676 | Ga0500559_0015702 | |||
| 1677 | Ga0500568_0013786 | |||
| 1678 | Ga0500568_0070434 | |||
| 1679 | Ga0500568_0131135 | |||
| 1680 | Ga0500573_0000358 | |||
| 1681 | Ga0500588_0002830 | |||
| 1682 | Ga0500589_058678 | |||
| 1683 | Ga0500604_0030370 | |||
| 1684 | Ga0500622_0000384 | |||
| 1685 | Ga0500622_0003212 | |||
| 1686 | Ga0500622_0012829 | |||
| 1687 | Ga0466962_0069036 | |||
| 1688 | Ga0466962_0232653 | |||
| 1689 | 2509442784 | |||
| 1690 | 2644011057 | |||
| 1691 | 2644042592 | |||
| 1692 | 2644683918 | |||
| 1693 | 2739587990 | |||
| 1694 | 2739614361 | |||
| 1695 | 2739646897 | |||
| 1696 | 2765469437 | |||
| 1697 | 2793315441 | |||
| 1698 | 2793328657 | |||
| 1699 | 2793366141 | |||
| 1700 | 2802652193 | |||
| 1701 | 2819679451 | |||
| 1702 | 2838022846 | |||
| 1703 | 2838665211 | |||
| 1704 | 2842201327 | |||
| 1705 | 2842287844 | |||
| 1706 | 2842348413 | |||
| 1707 | 2842367006 | |||
| 1708 | 2842399775 | |||
| 1709 | 2842404628 | |||
| 1710 | 2842411211 | |||
| 1711 | 2842418340 | |||
| 1712 | 2842724241 | |||
| 1713 | 2842906243 | |||
| 1714 | 2842913625 | |||
| 1715 | 2849282563 | |||
| 1716 | 2852626462 | |||
| 1717 | 2857617380 | |||
| 1718 | 2857621284 | |||
| 1719 | 2857631688 | |||
| 1720 | 2884791920 | |||
| 1721 | 2884934888 | |||
| 1722 | 2919186757 | |||
| 1723 | 2919195776 | |||
| 1724 | 2919440705 | |||
| 1725 | 2929179763 | |||
| 1726 | 2929243016 | |||
| 1727 | 2939665974 | |||
| 1728 | 2945982185 | |||
| 1729 | 2945998934 | |||
| 1730 | 2946018424 | |||
| 1731 | 2954021383 | |||
| 1732 | 2965320862 | |||
| 1733 | 2977236834 | |||
| 1734 | 2977268923 | |||
| 1735 | 2996894003 | |||
| 1736 | 8005303743 | |||
| 1737 | 8005384768 | |||
| 1738 | 8005398218 | |||
| 1739 | 8005688469 | |||
| 1740 | 8005691422 | |||
| 1741 | 8005696427 | |||
| 1742 | 8054305148 | |||
| 1743 | 8054309755 | |||
| 1744 | 8055914983 | |||
| 1745 | 8056379831 | |||
| 1746 | 8056387799 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2jc4-assembly1.cif.gz_A | 3'-5' exonuclease (nexo) from neisseria meningitidis | 0.9676 | 1 | 256 |
| 2voa-assembly1.cif.gz_B | structure of an ap endonuclease from archaeoglobus fulgidus | 0.9629 | 1 | 257 |
| 6fke-assembly1.cif.gz_A | structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin | 0.9625 | 1 | 256 |
| 2jc4-assembly1.cif.gz_A | 3'-5' exonuclease (nexo) from neisseria meningitidis | 0.9603 | 1 | 256 |
| 2voa-assembly1.cif.gz_B | structure of an ap endonuclease from archaeoglobus fulgidus | 0.9556 | 1 | 257 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6fk4A00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9683 | 1 | 256 | 3.60.10.10 |
| 2voaB00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9604 | 1 | 257 | 3.60.10.10 |
| 6fk4A00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9573 | 1 | 256 | 3.60.10.10 |
| 2voaB00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9531 | 1 | 257 | 3.60.10.10 |
| af_P09030_1_268_3.60.10.10 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9464 | 1 | 257 | 3.60.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R1TEC2-F1-model_v4 | deleted | 0.991 | 100 | 255 |
|
| AF-A0A561GS97-F1-model_v4 | deleted | 0.99 | 1 | 258 |
|
| AF-A0A7W9XPU7-F1-model_v4 | Exodeoxyribonuclease III | 0.9899 | 151 | 258 |
GO:0006281
GO:0008311 |
| AF-A0A6H9HGF6-F1-model_v4 | Endonuclease/exonuclease/phosphatase domain-containing protein | 0.9881 | 145 | 258 |
GO:0006281
GO:0008311 |
| AF-A0A6I3SU57-F1-model_v4 | Exodeoxyribonuclease III (EC 3.1.11.2) | 0.9874 | 1 | 256 |
GO:0006281
GO:0008311 GO:0046872 |