metagRoot

F484262

General Info

Members	Datasets	Scaffolds	Average Seq Length
873	549	747	229

Family's Representative Sequence

Representative Sequence	3300041453\|Ga0451797_1494679\|Ga0451797_1494679_21_812
Length	263
Sequence	MLEIKDLRVSYGQSEVIHGVNLSTERGRIVSVMGRNGMGKTTLFKAVMGVLPSKAGSIVVDGKDVTRLPSYERVRSGLAYVPQGRMIFPTLTVWENLLTGLEGSKTKRLPDDIFTLFPILKDMRSRRGGNLSGGQQQQLAIARALAADPKVLLLDEPTEGLQPSIIKDIAQVLLKIRDSRNLTILVSEQVLSFTLQITDRMLVIEGGRFTADEPPPDSTPASAWPPMTAMLPICLENGSSFRSLRSNTAPASAACRAINPSAS

Samples

	Sample ID	Description	Type	Environment
1	2162886006	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1	Metagenome	Rhizosphere
2	2501025504	Paraburkholderia silvatlantica SRMrh-20	Isolate	Unclassified
3	2510917014	Paraburkholderia silvatlantica SRMrh-20	Isolate	Unclassified
4	2510917015	Paraburkholderia silvatlantica PVA5	Isolate	Unclassified
5	2511231002	Polaromonas sp. CF318	Isolate	Rhizosphere
6	2512047030	Paraburkholderia tuberum STM678	Isolate	Nodule
7	2513237094	Bradyrhizobium sp. WSM3983	Isolate	Nodule
8	2513237095	Bradyrhizobium diazoefficiens USDA 122	Isolate	Nodule
9	2513237096	Bradyrhizobium pachyrhizi USDA 3259	Isolate	Nodule
10	2513237101	Bradyrhizobium murdochi WSM1741	Isolate	Nodule
11	2513237137	Bradyrhizobium elkanii USDA 94	Isolate	Nodule
12	2513237145	Bradyrhizobium elkanii USDA 3254	Isolate	Nodule
13	2517572143	Bradyrhizobium elkanii USDA 76	Isolate	Nodule
14	2524023205	Bradyrhizobium sp. Cp5.3	Isolate	Nodule
15	2524023228	Bradyrhizobium sp. Th.b2	Isolate	Nodule
16	2528768022	Bradyrhizobium japonicum USDA 123	Isolate	Nodule
17	2585428062	Methylibium sp. CF059	Isolate	Rhizosphere
18	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
19	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
20	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
21	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
22	2602042107	Bradyrhizobium sp. NFR13	Isolate	Rhizoplane
23	2643221683	Variovorax sp. Root473	Isolate	Unclassified
24	2667528175	Rhizobium tropici NFR14	Isolate	Rhizoplane
25	2721755755	Bradyrhizobium icense LMTR 13	Isolate	Nodule
26	2728368998	Bradyrhizobium macuxiense BR 10303	Isolate	Nodule
27	2738543013	Variovorax sp. BT01	Isolate	Unclassified
28	2744054633	Bradyrhizobium neotropicale BR 10247	Isolate	Unclassified
29	2791355196	Bradyrhizobium sp. Y36	Isolate	Nodule
30	2791355197	Bradyrhizobium sp. C9	Isolate	Nodule
31	2791355199
32	2816332527	Bradyrhizobium diazoefficiens Y21	Isolate	Nodule
33	2818991446	Variovorax sp. 1180	Isolate	Unclassified
34	2824661429	Bradyrhizobium sp. HAMBI 2115	Isolate	Unclassified
35	2838054893	Variovorax guangxiensis 34/80	Isolate	Nodule
36	2844315083	Bradyrhizobium guangzhouense CCBAU 51670	Isolate	Unclassified
37	2847930680	Bradyrhizobium zhanjiangense CCBAU 51778	Isolate	Unclassified
38	2857509624	Bradyrhizobium sp. R-73088	Isolate	Unclassified
39	2857524615	Tardiphaga sp. R-73074	Isolate	Unclassified
40	2858950400	Achromobacter sp. K91	Isolate	Unclassified
41	2874604998	Bradyrhizobium sp. LMTR 3	Isolate	Nodule
42	2876761206	Bradyrhizobium centrolobii BR 10245	Isolate	Nodule
43	2876808645	Bradyrhizobium algeriense RST89	Isolate	Unclassified
44	2879083081	Bradyrhizobium zhanjiangense CCBAU 51787	Isolate	Unclassified
45	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
46	2885198086	Variovorax sp. 679	Isolate	Unclassified
47	2885211737	Variovorax sp. 553	Isolate	Unclassified
48	2885374607	Bradyrhizobium sp. NAS96.2	Isolate	Unclassified
49	2885409591	Bradyrhizobium sp. NAS80.1	Isolate	Unclassified
50	2887375801	Parapusillimonas sp. SGNA-6	Isolate	Rhizosphere
51	2888378607	Bradyrhizobium sp. LCT2	Isolate	Unclassified
52	2893066018	Tardiphaga sp. P9-11	Isolate	Unclassified
53	2903727486	Bradyrhizobium guangzhouense CCBAU 53424	Isolate	Unclassified
54	2903748898	Bradyrhizobium uaiense UFLA 03-164	Isolate	Nodule
55	2903768456	Bradyrhizobium sp. Leo121	Isolate	Unclassified
56	2904449895	Variovorax sp. 1763	Isolate	Rhizosphere
57	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
58	2904690495	Bradyrhizobium ivorense CI-1B	Isolate	Nodule
59	2904699407
60	2906602504	Bradyrhizobium guangzhouense CCBAU 53426	Isolate	Unclassified
61	2906610324
62	2906635258	Bradyrhizobium sp. USDA 3458	Isolate	Unclassified
63	2906643746	Bradyrhizobium genosp. SA-3 Rp7b	Isolate	Unclassified
64	2906660503	Bradyrhizobium brasilense UFLA 03-321	Isolate	Unclassified
65	2908739725	Bradyrhizobium sp. UFLA03-84	Isolate	Nodule
66	2908756301	Bradyrhizobium ivorense CI-41S	Isolate	Nodule
67	2919073203	Tardiphaga robiniae 1155	Isolate	Unclassified
68	2922361189	Bradyrhizobium australiense WSM 1791	Isolate	Nodule
69	2922368715
70	2922386360	Bradyrhizobium archetypum WSM 1744	Isolate	Nodule
71	2922425934
72	2928037797	Variovorax sp. 1126	Isolate	Unclassified
73	2928044640	Variovorax sp. 1128	Isolate	Unclassified
74	2928051484	Variovorax sp. 1133	Isolate	Unclassified
75	2928064002	Variovorax sp. 1140	Isolate	Rhizosphere
76	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
77	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
78	2932784394	Bradyrhizobium sp. S3.2.12	Isolate	Nodule
79	2932794094	Bradyrhizobium sp. S3.2.6	Isolate	Nodule
80	2932828146	Bradyrhizobium sp. S3.9.2	Isolate	Nodule
81	2935616580	Bradyrhizobium sp. RT7a	Isolate	Nodule
82	2935630451	Bradyrhizobium sp. I1.14.4	Isolate	Nodule
83	2935638405	Bradyrhizobium sp. JR19.8	Isolate	Nodule
84	2935665750	Bradyrhizobium sp. JR7.2	Isolate	Nodule
85	2935675223	Bradyrhizobium sp. LA2.1	Isolate	Nodule
86	2935684952	Bradyrhizobium sp. LA3.X	Isolate	Nodule
87	2935703347	Bradyrhizobium sp. LA6.10	Isolate	Nodule
88	2935713505	Bradyrhizobium sp. LA6.12	Isolate	Nodule
89	2935722832	Bradyrhizobium sp. LA6.3	Isolate	Nodule
90	2935732158	Bradyrhizobium sp. LA6.4	Isolate	Nodule
91	2935741537	Bradyrhizobium sp. LA6.7	Isolate	Nodule
92	2935750917	Bradyrhizobium sp. LA6.8	Isolate	Nodule
93	2935801545	Bradyrhizobium sp. RT10b	Isolate	Nodule
94	2935810662	Bradyrhizobium sp. RT3a	Isolate	Nodule
95	2935827899	Bradyrhizobium sp. RT4a	Isolate	Nodule
96	2935837841	Bradyrhizobium sp. RT4b	Isolate	Nodule
97	2935855204	Bradyrhizobium sp. RT7b	Isolate	Nodule
98	2935864058	Bradyrhizobium sp. RT9a	Isolate	Nodule
99	2935873716	Bradyrhizobium sp. RT9b	Isolate	Nodule
100	2935959822	Bradyrhizobium sp. F1.4.3	Isolate	Nodule
101	2935992306	Bradyrhizobium sp. I1.7.5	Isolate	Nodule
102	2936002035	Bradyrhizobium sp. I1.8.5	Isolate	Nodule
103	2936037263	Bradyrhizobium sp. JR18.2	Isolate	Nodule
104	2940556831	Bradyrhizobium sp. LA8.1	Isolate	Nodule
105	2941507105	Bradyrhizobium sp. i1.12.3	Isolate	Nodule
106	2941515067	Bradyrhizobium sp. i1.14.1	Isolate	Nodule
107	2941523033	Bradyrhizobium sp. i1.8.4	Isolate	Nodule
108	2941538514	Bradyrhizobium sp. RT11b	Isolate	Nodule
109	3005474847	Bradyrhizobium sp. CCBAU 53421	Isolate	Nodule
110	3005594810	Bradyrhizobium sp. CCBAU 53340	Isolate	Nodule
111	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
112	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
113	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
114	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
115	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
116	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
117	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
118	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
119	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
120	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
121	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
122	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
123	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
124	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
125	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
126	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
127	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
128	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
129	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
130	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
131	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
132	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
133	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
134	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
135	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
136	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
137	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
138	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
139	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
140	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
141	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
142	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
143	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
144	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
145	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
146	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
147	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
148	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
149	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
150	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
151	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
152	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
153	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
154	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
155	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
156	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
157	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
158	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
159	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
160	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
161	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
162	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
163	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
164	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
165	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
166	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
167	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
168	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
169	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
170	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
171	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
172	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
173	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
174	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
175	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
176	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
177	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
178	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
179	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
180	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
181	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
182	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
183	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
184	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
185	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
186	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
187	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
188	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
189	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
190	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
191	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
192	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
193	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
194	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
195	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
196	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
197	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
198	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
199	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
200	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
201	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
202	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
203	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
204	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
205	3300006943	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW	Metagenome	Nodule
206	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
207	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
208	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
209	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
210	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
211	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
212	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
213	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
214	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
215	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
216	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
217	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
218	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
219	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
220	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
221	3300009982	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG	Metagenome	Rhizosphere
222	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
223	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
224	3300012502	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610	Metagenome	Rhizosphere
225	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
226	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
227	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
228	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
229	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
230	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
231	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
232	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
233	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
234	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
235	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
236	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
237	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
238	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
239	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
240	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
241	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
242	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
243	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
244	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
245	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
246	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
247	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
248	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
249	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
250	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
251	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
252	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
253	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
254	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
255	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
256	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
257	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
260	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
270	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
271	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
272	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
274	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
275	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
276	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
278	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
279	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
280	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
281	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
282	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
283	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
284	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
285	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
286	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
287	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
288	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
289	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
290	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
291	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
292	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
293	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
294	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
295	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
296	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
297	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
298	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
299	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
300	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
301	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
302	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
303	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
304	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
305	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
306	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
307	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
308	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
309	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
310	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
311	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
312	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
313	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
314	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
315	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
316	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
317	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
318	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
319	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
320	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
321	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
322	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
323	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
324	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
325	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
326	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
327	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
328	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
329	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
330	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
331	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
332	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
333	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
334	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
335	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
336	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
337	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
338	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
339	3300033442	Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1	Metagenome	Nodule
340	3300033528	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
341	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
342	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
343	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
344	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
345	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
346	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
347	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
348	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
349	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
350	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
351	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
352	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
353	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
354	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
355	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
356	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
357	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
358	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
359	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
360	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
361	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
362	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
363	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
364	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
365	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
366	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
367	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
368	3300042128	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123	Metagenome	Rhizosphere
369	3300042133	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134	Metagenome	Rhizosphere
370	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
371	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
372	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
373	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
374	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
375	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
376	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
377	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
378	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
379	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
380	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
381	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
382	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
383	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
384	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
385	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
386	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
387	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
388	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
389	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
390	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
391	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
392	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
393	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
394	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
395	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
396	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
397	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
398	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
399	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
400	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
401	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
402	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
403	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
404	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
405	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
406	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
407	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
408	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
409	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
410	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
411	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
412	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
413	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
414	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
415	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
416	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
417	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
418	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
419	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
420	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
421	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
422	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
423	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
424	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
425	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
426	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
427	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
428	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
429	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
430	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
431	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
432	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
433	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
434	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
435	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
436	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
437	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
438	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
439	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
440	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
441	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
442	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
443	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
444	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
445	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
446	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
447	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
448	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
449	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
450	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
451	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
452	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
453	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
454	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
455	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
456	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
457	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
458	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
459	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
460	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
461	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
462	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
463	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
464	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
465	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
466	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
467	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
468	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
469	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
470	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
471	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
472	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
473	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
474	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
475	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
476	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
477	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
478	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
479	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
480	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
481	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
482	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
483	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
484	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
485	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
486	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
487	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
488	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
489	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
490	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
491	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
492	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
493	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
494	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
495	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
496	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
497	3300053089	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere	Metagenome	Endosphere
498	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
499	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
500	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
501	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
502	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
503	3300053095	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere	Metagenome	Endosphere
504	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
505	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
506	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
507	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
508	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
509	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
510	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
511	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
512	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
513	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
514	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
515	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
516	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
517	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
518	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
519	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
520	3300053145	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere	Metagenome	Endosphere
521	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
522	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
523	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
524	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
525	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
526	3300053159	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere	Metagenome	Endosphere
527	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
528	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
529	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
530	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
531	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
532	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
533	8006933436	Bradyrhizobium septentrionale 7(2017)	Isolate	Unclassified
534	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
535	8006973647	Bradyrhizobium septentrionale 162S2	Isolate	Nodule
536	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
537	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule
538	8016511872	Bradyrhizobium sp. S3.14.4	Isolate	Nodule
539	8017057580	Bradyrhizobium sp. S3.7.6	Isolate	Nodule
540	8019555841	Bradyrhizobium sp. JR6.1	Isolate	Nodule
541	8019565922	Bradyrhizobium sp. JR3.5	Isolate	Nodule
542	8019576017	Bradyrhizobium sp. i1.7.7	Isolate	Nodule
543	8019586578	Bradyrhizobium sp. i1.4.4	Isolate	Nodule
544	8019597564	Bradyrhizobium sp. i1.3.6	Isolate	Nodule
545	8019608314	Bradyrhizobium sp. i1.3.1	Isolate	Nodule
546	8019648815	Bradyrhizobium sp. GM24.11	Isolate	Nodule
547	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule
548	8056689827	Bradyrhizobium semiaridum WSM 1704	Isolate	Nodule
549	8056967851	Bradyrhizobium zhengyangense WYCCWR 12678	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	85.83
Metatranscriptomes	0.23
Isolates	13.94

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	17.3
Nodule	9.62
Rhizoplane	2.75
Rhizosphere	55.56
Stem	0
Stem Tuber	0
Unclassified	14.78

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL3b_contig_1238020	2162886006	Bacteria	906
2	JGI24750J21931_1013206	3300002070	Bacteria	1102
3	JGI25159J45721_1000816	3300002987	Bacteria	13575
4	JGI25151J46595_10002642	3300003187	Bacteria	10549
5	JGI25153J46596_10007303	3300003215	Bacteria	5459
6	JGI25153J46596_10008730	3300003215	Bacteria	4802
7	JGI25153J46596_10074515	3300003215	Bacteria	867
8	rootH2_10236421	3300003320	Bacteria	1568
9	rootH1_10071046	3300003323	Bacteria	1120
10	rootH1_10071047	3300003323	Bacteria	1099
11	rootH1_10078959	3300003323	Bacteria	1731
12	rootH1_10112413	3300003323	Bacteria	1838
13	rootH1_10143955	3300003323	Bacteria	1495
14	JGI25160J50197_1000098	3300003354	Bacteria	87307
15	JGI25160J50197_1051849	3300003354	Bacteria	866
16	JGI25161J50226_1000037	3300003374	Bacteria	133331
17	Ga0006562J51391_1088900	3300003578	Bacteria	2948
18	Ga0055529_1008113	3300003763	Bacteria	1404
19	Ga0055537_1002928	3300003773	Bacteria	5435
20	Ga0055536_1005074	3300003781	Bacteria	6533
21	Ga0055534_1011333	3300003784	Bacteria	1818
22	Ga0055528_1006502	3300003790	Bacteria	5297
23	Ga0055530_10000358	3300003791	Bacteria	41173
24	Ga0055540_1000184	3300003792	Bacteria	60646
25	Ga0055540_1002572	3300003792	Bacteria	9462
26	Ga0055540_1004932	3300003792	Bacteria	5815
27	Ga0055531_10007321	3300003794	Bacteria	6050
28	Ga0055543_1000497	3300004625	Bacteria	22716
29	Ga0065165_1003507	3300005262	Bacteria	10899
30	Ga0065165_1005429	3300005262	Bacteria	7171
31	Ga0065707_10084400	3300005295	Bacteria	7240
32	Ga0070658_10001105	3300005327	Bacteria	23012
33	Ga0070658_10802114	3300005327	Bacteria	818
34	Ga0070677_10010390	3300005333	Bacteria	3184
35	Ga0068869_100089288	3300005334	Bacteria	2314
36	Ga0068869_100430277	3300005334	Bacteria	1090
37	Ga0070682_100004212	3300005337	Bacteria	7981
38	Ga0070682_100225158	3300005337	Bacteria	1337
39	Ga0070682_100231187	3300005337	Bacteria	1322
40	Ga0068868_100170776	3300005338	Bacteria	1800
41	Ga0070660_100272659	3300005339	Bacteria	1383
42	Ga0070689_100000001	3300005340	Bacteria	1334580
43	Ga0070687_100109508	3300005343	Bacteria	1561
44	Ga0070661_100169704	3300005344	Bacteria	1656
45	Ga0070668_100047101	3300005347	Bacteria	3313
46	Ga0070669_100069310	3300005353	Bacteria	2605
47	Ga0070669_100193411	3300005353	Bacteria	1597
48	Ga0070669_100210499	3300005353	Bacteria	1534
49	Ga0070675_100039997	3300005354	Bacteria	3827
50	Ga0070675_100112227	3300005354	Bacteria	2308
51	Ga0070671_100080948	3300005355	Bacteria	2715
52	Ga0070674_100465225	3300005356	Bacteria	1046
53	Ga0070673_100144915	3300005364	Bacteria	2007
54	Ga0070659_100097337	3300005366	Bacteria	2365
55	Ga0070667_100338829	3300005367	Bacteria	1359
56	Ga0070709_10010218	3300005434	Bacteria	5190
57	Ga0070709_10023884	3300005434	Bacteria	3595
58	Ga0070714_100034368	3300005435	Bacteria	4246
59	Ga0070714_100563328	3300005435	Bacteria	1092
60	Ga0070713_100021922	3300005436	Bacteria	4927
61	Ga0070713_100029770	3300005436	Bacteria	4327
62	Ga0070713_100734826	3300005436	Bacteria	944
63	Ga0070710_10045296	3300005437	Bacteria	2445
64	Ga0070711_100001277	3300005439	Bacteria	13671
65	Ga0070711_100011775	3300005439	Bacteria	5441
66	Ga0070711_100033622	3300005439	Bacteria	3415
67	Ga0070705_100050929	3300005440	Bacteria	2412
68	Ga0070708_100442554	3300005445	Bacteria	1226
69	Ga0070663_100018048	3300005455	Bacteria	4617
70	Ga0070663_100663840	3300005455	Bacteria	883
71	Ga0070678_100020333	3300005456	Bacteria	4353
72	Ga0070678_100121263	3300005456	Bacteria	2062
73	Ga0070662_100044005	3300005457	Bacteria	3197
74	Ga0070681_10039786	3300005458	Bacteria	4713
75	Ga0070706_100023429	3300005467	Bacteria	5685
76	Ga0070706_100152682	3300005467	Bacteria	2156
77	Ga0070706_100527355	3300005467	Bacteria	1099
78	Ga0070707_100003493	3300005468	Bacteria	14831
79	Ga0070698_100010386	3300005471	Bacteria	9944
80	Ga0070698_100077569	3300005471	Bacteria	3322
81	Ga0070699_100023882	3300005518	Bacteria	5270
82	Ga0070699_100051293	3300005518	Bacteria	3572
83	Ga0070699_100110458	3300005518	Bacteria	2413
84	Ga0070699_100147650	3300005518	Bacteria	2078
85	Ga0070684_100752475	3300005535	Bacteria	910
86	Ga0070697_100023386	3300005536	Bacteria	4913
87	Ga0070697_100315534	3300005536	Bacteria	1345
88	Ga0068853_100003441	3300005539	Bacteria	12109
89	Ga0068853_100070176	3300005539	Bacteria	3049
90	Ga0068853_100113688	3300005539	Bacteria	2407
91	Ga0070696_100414138	3300005546	Bacteria	1057
92	Ga0070693_100066004	3300005547	Bacteria	2117
93	Ga0070693_100241966	3300005547	Bacteria	1192
94	Ga0070665_100053421	3300005548	Bacteria	4052
95	Ga0070665_100115134	3300005548	Bacteria	2691
96	Ga0070665_100487683	3300005548	Bacteria	1243
97	Ga0070665_100855314	3300005548	Bacteria	923
98	Ga0070665_101047843	3300005548	Bacteria	827
99	Ga0070704_100267527	3300005549	Bacteria	1411
100	Ga0068855_100001976	3300005563	Bacteria	25473
101	Ga0068855_100046285	3300005563	Bacteria	5143
102	Ga0068855_100124947	3300005563	Bacteria	2942
103	Ga0068855_100654906	3300005563	Bacteria	1127
104	Ga0068857_100090580	3300005577	Bacteria	2737
105	Ga0068857_101063229	3300005577	Bacteria	780
106	Ga0068854_100175887	3300005578	Bacteria	1669
107	Ga0068856_100035409	3300005614	Bacteria	4892
108	Ga0068856_100135779	3300005614	Bacteria	2465
109	Ga0068856_100138137	3300005614	Bacteria	2443
110	Ga0068856_100398239	3300005614	Bacteria	1396
111	Ga0070702_100177824	3300005615	Bacteria	1390
112	Ga0068852_100793932	3300005616	Bacteria	960
113	Ga0068859_100062750	3300005617	Bacteria	3746
114	Ga0068859_100530743	3300005617	Bacteria	1272
115	Ga0068864_100092604	3300005618	Bacteria	2668
116	Ga0068864_100882137	3300005618	Bacteria	883
117	Ga0068864_100892161	3300005618	Bacteria	878
118	Ga0068861_100073695	3300005719	Bacteria	2653
119	Ga0068861_100103930	3300005719	Bacteria	2265
120	Ga0068851_10002794	3300005834	Bacteria	7692
121	Ga0068863_100539031	3300005841	Bacteria	1151
122	Ga0068860_100006055	3300005843	Bacteria	12173
123	Ga0068860_100484086	3300005843	Bacteria	1234
124	Ga0068862_100256051	3300005844	Bacteria	1596
125	Ga0068862_100284097	3300005844	Bacteria	1517
126	Ga0068862_100294070	3300005844	Bacteria	1492
127	Ga0081455_10461714	3300005937	Bacteria	864
128	Ga0081540_1011585	3300005983	Bacteria	5886
129	Ga0081540_1012130	3300005983	Bacteria	5699
130	Ga0081540_1045487	3300005983	Bacteria	2228
131	Ga0081539_10002350	3300005985	Bacteria	27182
132	Ga0081539_10189053	3300005985	Bacteria	960
133	Ga0081539_10235049	3300005985	Bacteria	824
134	Ga0070717_10543671	3300006028	Bacteria	1052
135	Ga0070717_10599018	3300006028	Bacteria	1000
136	Ga0075365_10147509	3300006038	Bacteria	1635
137	Ga0075365_10192285	3300006038	Bacteria	1428
138	Ga0075365_10361342	3300006038	Bacteria	1024
139	Ga0075363_100028797	3300006048	Bacteria	2861
140	Ga0075363_100029159	3300006048	Bacteria	2846
141	Ga0075363_100037949	3300006048	Bacteria	2531
142	Ga0075363_100077076	3300006048	Bacteria	1819
143	Ga0075364_10062210	3300006051	Bacteria	2449
144	Ga0075364_10351520	3300006051	Bacteria	1005
145	Ga0075364_10352054	3300006051	Bacteria	1004
146	Ga0070715_10184915	3300006163	Bacteria	1048
147	Ga0070716_100106728	3300006173	Bacteria	1728
148	Ga0070712_100029964	3300006175	Bacteria	3652
149	Ga0075362_10016617	3300006177	Bacteria	3016
150	Ga0075362_10032523	3300006177	Bacteria	2263
151	Ga0075362_10043582	3300006177	Bacteria	1987
152	Ga0075362_10197035	3300006177	Bacteria	980
153	Ga0075367_10005456	3300006178	Bacteria	6317
154	Ga0075367_10041321	3300006178	Bacteria	2695
155	Ga0075367_10214687	3300006178	Bacteria	1203
156	Ga0075369_10005854	3300006186	Bacteria	4621
157	Ga0075369_10033816	3300006186	Bacteria	2168
158	Ga0075366_10000857	3300006195	Bacteria	14672
159	Ga0075366_10116389	3300006195	Bacteria	1610
160	Ga0075366_10197976	3300006195	Bacteria	1221
161	Ga0097621_100104347	3300006237	Bacteria	2389
162	Ga0075370_10003260	3300006353	Bacteria	7689
163	Ga0075370_10010598	3300006353	Bacteria	4827
164	Ga0075370_10045526	3300006353	Bacteria	2481
165	Ga0068871_100174028	3300006358	Bacteria	1847
166	Ga0075428_100967490	3300006844	Bacteria	902
167	Ga0075434_100000932	3300006871	Bacteria	23496
168	Ga0075434_100229465	3300006871	Bacteria	1876
169	Ga0075434_100380898	3300006871	Bacteria	1431
170	Ga0075436_100004513	3300006914	Bacteria	9549
171	Ga0075436_100013837	3300006914	Bacteria	5526
172	Ga0097620_100062751	3300006931	Bacteria	3746
173	Ga0097620_100530740	3300006931	Bacteria	1272
174	Ga0099824_1033654	3300006942	Bacteria	1715
175	Ga0099822_1006869	3300006943	Bacteria	14775
176	Ga0099823_1045448	3300006944	Bacteria	2926
177	Ga0075435_100004811	3300007076	Bacteria	9339
178	Ga0099795_10019563	3300007788	Bacteria	2194
179	Ga0099795_10087927	3300007788	Bacteria	1200
180	Ga0105240_10000309	3300009093	Bacteria	93964
181	Ga0105240_10000565	3300009093	Bacteria	68589
182	Ga0105240_10001377	3300009093	Bacteria	41807
183	Ga0105240_10103703	3300009093	Bacteria	3455
184	Ga0105240_10105433	3300009093	Bacteria	3422
185	Ga0105240_10364986	3300009093	Bacteria	1634
186	Ga0111539_10069205	3300009094	Bacteria	4168
187	Ga0111539_10761647	3300009094	Bacteria	1127
188	Ga0105245_10044415	3300009098	Bacteria	3966
189	Ga0105245_10812281	3300009098	Bacteria	974
190	Ga0105247_10000116	3300009101	Bacteria	78228
191	Ga0114129_10018519	3300009147	Bacteria	9913
192	Ga0105243_10003118	3300009148	Bacteria	13622
193	Ga0105243_10090809	3300009148	Bacteria	2514
194	Ga0105243_10123374	3300009148	Bacteria	2188
195	Ga0105243_10142382	3300009148	Bacteria	2047
196	Ga0105243_10760194	3300009148	Bacteria	951
197	Ga0105241_10109588	3300009174	Bacteria	2208
198	Ga0105241_10561622	3300009174	Bacteria	1026
199	Ga0105241_10635768	3300009174	Bacteria	968
200	Ga0105242_10499305	3300009176	Bacteria	1157
201	Ga0105248_10040984	3300009177	Bacteria	5192
202	Ga0105248_10721809	3300009177	Bacteria	1125
203	Ga0105237_10000197	3300009545	Bacteria	85308
204	Ga0105237_10003925	3300009545	Bacteria	17419
205	Ga0105237_10009767	3300009545	Bacteria	10263
206	Ga0105237_10030930	3300009545	Bacteria	5430
207	Ga0105237_10036637	3300009545	Bacteria	4964
208	Ga0105237_10088966	3300009545	Bacteria	3077
209	Ga0105237_10402494	3300009545	Bacteria	1373
210	Ga0105238_10009635	3300009551	Bacteria	9664
211	Ga0105238_10016742	3300009551	Bacteria	7430
212	Ga0105238_10033064	3300009551	Bacteria	5262
213	Ga0105238_10156872	3300009551	Bacteria	2251
214	Ga0105238_10211526	3300009551	Bacteria	1915
215	Ga0105249_10108438	3300009553	Bacteria	2621
216	Ga0105249_10752576	3300009553	Bacteria	1037
217	Ga0105147_104762	3300009982	Bacteria	1139
218	Ga0099796_10012085	3300010159	Bacteria	2427
219	Ga0105239_10002899	3300010375	Bacteria	21425
220	Ga0105239_10040562	3300010375	Bacteria	5100
221	Ga0105239_10064526	3300010375	Bacteria	4020
222	Ga0105239_10064829	3300010375	Bacteria	4011
223	Ga0105239_10121243	3300010375	Bacteria	2904
224	Ga0105239_10152944	3300010375	Bacteria	2575
225	Ga0105239_10173240	3300010375	Bacteria	2413
226	Ga0105239_10607262	3300010375	Bacteria	1248
227	Ga0157347_1005055	3300012502	Bacteria	1249
228	Ga0157373_10000027	3300013100	Bacteria	133695
229	Ga0157373_10065586	3300013100	Bacteria	2569
230	Ga0157371_10041430	3300013102	Bacteria	3286
231	Ga0157370_10012712	3300013104	Bacteria	8711
232	Ga0157378_10071250	3300013297	Bacteria	3121
233	Ga0157378_10132490	3300013297	Bacteria	2309
234	Ga0157378_10598963	3300013297	Bacteria	1113
235	Ga0157378_10918147	3300013297	Bacteria	907
236	Ga0163162_10388975	3300013306	Bacteria	1527
237	Ga0157375_10912797	3300013308	Bacteria	1022
238	Ga0157380_10542872	3300014326	Bacteria	1139
239	Ga0157376_10945855	3300014969	Bacteria	882
240	Ga0182006_1039094	3300015261	Bacteria	1874
241	Ga0163161_10000446	3300017792	Bacteria	34480
242	Ga0163161_10028289	3300017792	Bacteria	3980
243	Ga0163161_10275315	3300017792	Bacteria	1318
244	Ga0213876_10110878	3300021384	Bacteria	1456
245	Ga0213875_10085621	3300021388	Bacteria	1470
246	Ga0209436_105359	3300025208	Bacteria	2968
247	Ga0207425_1002709	3300025245	Bacteria	6052
248	Ga0209677_102734	3300025253	Bacteria	6324
249	Ga0209148_1000334	3300025254	Bacteria	64148
250	Ga0209129_1004239	3300025258	Bacteria	5740
251	Ga0209233_1001804	3300025261	Bacteria	8242
252	Ga0209233_1008944	3300025261	Bacteria	3066
253	Ga0209565_1001371	3300025263	Bacteria	10952
254	Ga0209455_1004147	3300025272	Bacteria	4851
255	Ga0209673_1002874	3300025273	Bacteria	10952
256	Ga0209130_1000141	3300025284	Bacteria	115378
257	Ga0209675_1005201	3300025291	Bacteria	5514
258	Ga0209676_1000432	3300025292	Bacteria	72513
259	Ga0209676_1001071	3300025292	Bacteria	31088
260	Ga0209025_1000294	3300025294	Bacteria	111598
261	Ga0209025_1004609	3300025294	Bacteria	11792
262	Ga0209564_1024100	3300025295	Bacteria	2089
263	Ga0209564_1030148	3300025295	Bacteria	1686
264	Ga0209758_1000249	3300025297	Bacteria	110026
265	Ga0209758_1001476	3300025297	Bacteria	27510
266	Ga0209758_1004383	3300025297	Bacteria	11792
267	Ga0209758_1011353	3300025297	Bacteria	5173
268	Ga0209050_1000015	3300025298	Bacteria	759102
269	Ga0209050_1004667	3300025298	Bacteria	9108
270	Ga0209256_1042224	3300025299	Bacteria	1153
271	Ga0207426_1000145	3300025302	Bacteria	191065
272	Ga0207426_1000942	3300025302	Bacteria	28876
273	Ga0209051_1000081	3300025303	Bacteria	195619
274	Ga0209051_1000622	3300025303	Bacteria	40749
275	Ga0209257_1003557	3300025304	Bacteria	13237
276	Ga0209257_1008029	3300025304	Bacteria	6149
277	Ga0209257_1024427	3300025304	Bacteria	2093
278	Ga0207656_10002219	3300025321	Bacteria	6503
279	Ga0207656_10134803	3300025321	Bacteria	1160
280	Ga0207682_10013101	3300025893	Bacteria	3232
281	Ga0207692_10057994	3300025898	Bacteria	1993
282	Ga0207710_10000418	3300025900	Bacteria	28048
283	Ga0207688_10163985	3300025901	Bacteria	1319
284	Ga0207685_10119631	3300025905	Bacteria	1154
285	Ga0207699_10022976	3300025906	Bacteria	3388
286	Ga0207699_10038622	3300025906	Bacteria	2737
287	Ga0207699_10267994	3300025906	Bacteria	1182
288	Ga0207645_10190666	3300025907	Bacteria	1347
289	Ga0207705_10076636	3300025909	Bacteria	2431
290	Ga0207705_10572300	3300025909	Bacteria	878
291	Ga0207684_10028736	3300025910	Bacteria	4736
292	Ga0207684_10089458	3300025910	Bacteria	2623
293	Ga0207684_10177822	3300025910	Bacteria	1835
294	Ga0207695_10000062	3300025913	Bacteria	351979
295	Ga0207695_10000635	3300025913	Bacteria	70312
296	Ga0207695_10013961	3300025913	Bacteria	9544
297	Ga0207695_10028199	3300025913	Bacteria	6233
298	Ga0207695_10400196	3300025913	Bacteria	1257
299	Ga0207671_10000092	3300025914	Bacteria	139546
300	Ga0207671_10001542	3300025914	Bacteria	26352
301	Ga0207671_10009825	3300025914	Bacteria	7962
302	Ga0207671_10038038	3300025914	Bacteria	3567
303	Ga0207693_10019913	3300025915	Bacteria	5336
304	Ga0207693_10043663	3300025915	Bacteria	3525
305	Ga0207663_10015201	3300025916	Bacteria	4240
306	Ga0207657_10256747	3300025919	Bacteria	1392
307	Ga0207652_10032949	3300025921	Bacteria	4361
308	Ga0207646_10002497	3300025922	Bacteria	21730
309	Ga0207681_10072121	3300025923	Bacteria	2411
310	Ga0207681_10076479	3300025923	Bacteria	2351
311	Ga0207694_10017263	3300025924	Bacteria	5455
312	Ga0207694_10017771	3300025924	Bacteria	5374
313	Ga0207694_10084911	3300025924	Bacteria	2491
314	Ga0207650_10774650	3300025925	Bacteria	812
315	Ga0207659_10128879	3300025926	Bacteria	1949
316	Ga0207687_10496494	3300025927	Bacteria	1018
317	Ga0207687_10508832	3300025927	Bacteria	1006
318	Ga0207700_10014831	3300025928	Bacteria	5119
319	Ga0207700_10017552	3300025928	Bacteria	4784
320	Ga0207700_10154742	3300025928	Bacteria	1898
321	Ga0207700_10256390	3300025928	Bacteria	1496
322	Ga0207664_10058493	3300025929	Bacteria	3066
323	Ga0207664_10449439	3300025929	Bacteria	1150
324	Ga0207690_10051486	3300025932	Bacteria	2754
325	Ga0207706_10057225	3300025933	Bacteria	3436
326	Ga0207706_10508681	3300025933	Bacteria	1039
327	Ga0207709_10000234	3300025935	Bacteria	70092
328	Ga0207709_10359196	3300025935	Bacteria	1102
329	Ga0207670_10000002	3300025936	Bacteria	783058
330	Ga0207665_10133713	3300025939	Bacteria	1763
331	Ga0207691_10001208	3300025940	Bacteria	25729
332	Ga0207691_10169528	3300025940	Bacteria	1912
333	Ga0207691_10229063	3300025940	Bacteria	1609
334	Ga0207711_10045791	3300025941	Bacteria	3738
335	Ga0207711_10077163	3300025941	Bacteria	2903
336	Ga0207689_10057386	3300025942	Bacteria	3203
337	Ga0207679_10668827	3300025945	Bacteria	940
338	Ga0207667_10001145	3300025949	Bacteria	33320
339	Ga0207667_10032537	3300025949	Bacteria	5618
340	Ga0207667_10151895	3300025949	Bacteria	2383
341	Ga0207667_10368925	3300025949	Bacteria	1463
342	Ga0207651_10097753	3300025960	Bacteria	2169
343	Ga0207712_10171241	3300025961	Bacteria	1697
344	Ga0207668_10041674	3300025972	Bacteria	3105
345	Ga0207668_10099407	3300025972	Bacteria	2158
346	Ga0207668_10452090	3300025972	Bacteria	1096
347	Ga0207668_10650335	3300025972	Bacteria	923
348	Ga0207640_10441851	3300025981	Bacteria	1070
349	Ga0207677_10178141	3300026023	Bacteria	1670
350	Ga0207677_10225718	3300026023	Bacteria	1505
351	Ga0207677_10282668	3300026023	Bacteria	1363
352	Ga0207639_10023520	3300026041	Bacteria	4450
353	Ga0207639_10121594	3300026041	Bacteria	2146
354	Ga0207639_10320293	3300026041	Bacteria	1376
355	Ga0207639_10325153	3300026041	Bacteria	1367
356	Ga0207678_10029063	3300026067	Bacteria	4825
357	Ga0207678_10097478	3300026067	Bacteria	2513
358	Ga0207678_10136110	3300026067	Bacteria	2096
359	Ga0207678_10467319	3300026067	Bacteria	1098
360	Ga0207702_10120251	3300026078	Bacteria	2349
361	Ga0207702_10174470	3300026078	Bacteria	1974
362	Ga0207702_10260285	3300026078	Bacteria	1633
363	Ga0207702_10548536	3300026078	Bacteria	1130
364	Ga0207641_10843073	3300026088	Bacteria	908
365	Ga0207676_10442556	3300026095	Bacteria	1223
366	Ga0207674_10067179	3300026116	Bacteria	3610
367	Ga0207674_10401043	3300026116	Bacteria	1325
368	Ga0207683_10488150	3300026121	Bacteria	1137
369	Ga0207683_10556851	3300026121	Bacteria	1060
370	Ga0209389_1000064	3300027296	Bacteria	102177
371	Ga0209371_1033240	3300027312	Bacteria	1103
372	Ga0209589_1000001	3300027357	Bacteria	794224
373	Ga0209489_100001	3300027361	Bacteria	794224
374	Ga0209489_104185	3300027361	Bacteria	26861
375	Ga0209700_100001	3300027363	Bacteria	794224
376	Ga0209700_100014	3300027363	Bacteria	299349
377	Ga0209179_1082758	3300027512	Bacteria	709
378	Ga0207428_10078804	3300027907	Bacteria	2577
379	Ga0268266_10002834	3300028379	Bacteria	18070
380	Ga0268266_10065384	3300028379	Bacteria	3144
381	Ga0268266_10457369	3300028379	Bacteria	1214
382	Ga0268265_10028815	3300028380	Bacteria	3979
383	Ga0268265_10676695	3300028380	Bacteria	994
384	Ga0268264_10000427	3300028381	Bacteria	58342
385	Ga0265337_1008184	3300028556	Bacteria	3827
386	Ga0265319_1036810	3300028563	Bacteria	1671
387	Ga0307515_10000109	3300028794	Bacteria	195895
388	Ga0268256_1044003	3300030500	Bacteria	981
389	Ga0307512_10097214	3300030522	Bacteria	2015
390	Ga0307512_10228006	3300030522	Bacteria	962
391	Ga0265330_10052677	3300031235	Bacteria	1782
392	Ga0265332_10072186	3300031238	Bacteria	1470
393	Ga0265320_10018243	3300031240	Bacteria	3870
394	Ga0265340_10026474	3300031247	Bacteria	2931
395	Ga0265316_10132291	3300031344	Bacteria	1878
396	Ga0265316_10155884	3300031344	Bacteria	1709
397	Ga0307513_10000015	3300031456	Bacteria	296183
398	Ga0307513_10020111	3300031456	Bacteria	7921
399	Ga0307513_10045412	3300031456	Bacteria	4802
400	Ga0307513_10055215	3300031456	Bacteria	4252
401	Ga0307513_10098953	3300031456	Bacteria	2946
402	Ga0307513_10128857	3300031456	Bacteria	2479
403	Ga0307513_10148613	3300031456	Bacteria	2257
404	Ga0307509_10491567	3300031507	Bacteria	913
405	Ga0307509_10521620	3300031507	Bacteria	869
406	Ga0307408_100042038	3300031548	Bacteria	3243
407	Ga0307408_100214957	3300031548	Bacteria	1565
408	Ga0307408_100879520	3300031548	Bacteria	819
409	Ga0265313_10076856	3300031595	Bacteria	1525
410	Ga0265313_10121681	3300031595	Bacteria	1137
411	Ga0307508_10000246	3300031616	Bacteria	65693
412	Ga0307508_10006278	3300031616	Bacteria	11192
413	Ga0307508_10009734	3300031616	Bacteria	8815
414	Ga0307508_10018036	3300031616	Bacteria	6414
415	Ga0307508_10143179	3300031616	Bacteria	1995
416	Ga0307514_10020362	3300031649	Bacteria	5413
417	Ga0265342_10088475	3300031712	Bacteria	1778
418	Ga0307516_10006708	3300031730	Bacteria	13452
419	Ga0307516_10123935	3300031730	Bacteria	2371
420	Ga0307405_10077124	3300031731	Bacteria	2164
421	Ga0307405_10092740	3300031731	Bacteria	2004
422	Ga0307413_10154788	3300031824	Bacteria	1602
423	Ga0307413_10538529	3300031824	Bacteria	945
424	Ga0307409_100383772	3300031995	Bacteria	1336
425	Ga0307416_100023421	3300032002	Bacteria	4480
426	Ga0307416_100873102	3300032002	Bacteria	998
427	Ga0307414_10612364	3300032004	Bacteria	978
428	Ga0307411_10453620	3300032005	Bacteria	1073
429	Ga0307411_10462305	3300032005	Bacteria	1064
430	Ga0307507_10043771	3300033179	Bacteria	4438
431	Ga0307507_10236786	3300033179	Bacteria	1201
432	Ga0307510_10007100	3300033180	Bacteria	13342
433	Ga0307510_10020152	3300033180	Bacteria	7803
434	Ga0307510_10059830	3300033180	Bacteria	3928
435	Ga0307510_10217439	3300033180	Bacteria	1426
436	Ga0315911_1000002	3300033442	Bacteria	926833
437	Ga0316588_1049097	3300033528	Bacteria	1021
438	Ga0373934_0051717	3300035086	Bacteria	1629
439	Ga0373944_0028431	3300035089	Bacteria	1664
440	Ga0373923_0049895	3300035111	Bacteria	1751
441	Ga0373943_0022548	3300035170	Bacteria	2919
442	Ga0373924_0089893	3300035410	Bacteria	1313
443	Ga0373933_0000164	3300035724	Bacteria	43241
444	Ga0373937_0261117	3300036401	Bacteria	1633
445	Ga0373925_0038084	3300037068	Bacteria	3552
446	Ga0395898_0237261	3300037466	Bacteria	1739
447	Ga0395905_0015214	3300037471	Bacteria	7316
448	Ga0436364_0166031	3300037853	Bacteria	824
449	Ga0436364_0176246	3300037853	Bacteria	1750
450	Ga0395901_0320216	3300038443	Bacteria	1605
451	Ga0400490_59588	3300038726	Bacteria	10370
452	Ga0400483_037459	3300039062	Bacteria	2216
453	Ga0400483_079217	3300039062	Bacteria	83041
454	Ga0400483_092352	3300039062	Bacteria	246443
455	Ga0400483_222230	3300039062	Bacteria	4185
456	Ga0400483_222800	3300039062	Bacteria	244239
457	Ga0436365_0022917	3300039437	Bacteria	1279
458	Ga0436365_0694465	3300039437	Bacteria	2443
459	Ga0439436_0001353	3300041404	Bacteria	7051
460	Ga0439438_024843	3300041405	Bacteria	1638
461	Ga0439439_0002684	3300041406	Bacteria	3814
462	Ga0439461_0023308	3300041410	Bacteria	1245
463	Ga0451789_0190617	3300041443	Bacteria	901
464	Ga0451797_0912266	3300041453	Bacteria	762
465	Ga0451797_1494679	3300041453	Bacteria	2468
466	Ga0451807_0885740	3300041486	Bacteria	6515
467	Ga0451807_2272697	3300041486	Bacteria	1795
468	Ga0439433_0022342	3300041999	Bacteria	1418
469	Ga0439432_004573	3300042006	Bacteria	5049
470	Ga0439449_0004052	3300042007	Bacteria	5672
471	Ga0439452_001303	3300042010	Bacteria	10505
472	Ga0439457_014966	3300042014	Bacteria	1733
473	Ga0450897_003577	3300042128	Bacteria	1254
474	Ga0450896_025860	3300042133	Bacteria	874
475	Ga0450910_003635	3300042147	Bacteria	2055
476	Ga0450909_016170	3300042185	Bacteria	1101
477	Ga0451577_0017106	3300042876	Bacteria	6704
478	Ga0451577_0024143	3300042876	Bacteria	5532
479	Ga0466969_0152366	3300044656	Bacteria	1065
480	Ga0453683_0163556	3300044673	Bacteria	1408
481	Ga0466965_0206433	3300044683	Bacteria	1043
482	Ga0466961_0353826	3300044693	Bacteria	894
483	Ga0466963_0145419	3300044694	Bacteria	1644
484	Ga0466964_0225110	3300044706	Bacteria	913
485	Ga0453684_0138384	3300044712	Bacteria	2912
486	Ga0466957_0164597	3300044842	Bacteria	1442
487	Ga0451576_0130666	3300045051	Bacteria	2618
488	Ga0466967_0822628	3300045976	Bacteria	922
489	Ga0495617_114028	3300046452	Bacteria	873
490	Ga0495627_021305	3300046453	Bacteria	2150
491	Ga0495592_0022519	3300046454	Bacteria	4794
492	Ga0495603_0047679	3300046455	Bacteria	2551
493	Ga0495590_0049205	3300046457	Bacteria	1471
494	Ga0495591_000353	3300046458	Bacteria	40689
495	Ga0495591_004510	3300046458	Bacteria	6780
496	Ga0495638_0018358	3300046460	Bacteria	4645
497	Ga0495638_0094282	3300046460	Bacteria	1800
498	Ga0495638_0240898	3300046460	Bacteria	1001
499	Ga0495641_0067953	3300046461	Bacteria	1602
500	Ga0495580_0056114	3300046472	Bacteria	2774
501	Ga0495582_0086227	3300046473	Bacteria	1747
502	Ga0495582_0235766	3300046473	Bacteria	1048
503	Ga0495605_0000436	3300046474	Bacteria	37694
504	Ga0495605_0001028	3300046474	Bacteria	18772
505	Ga0495639_0118631	3300046475	Bacteria	1261
506	Ga0495664_0003029	3300046477	Bacteria	9098
507	Ga0495584_0216591	3300046491	Bacteria	973
508	Ga0495585_0119051	3300046492	Bacteria	1398
509	Ga0495594_0005421	3300046499	Bacteria	6555
510	Ga0495594_0186964	3300046499	Bacteria	1180
511	Ga0495594_0232494	3300046499	Bacteria	1051
512	Ga0495607_0009324	3300046501	Bacteria	6651
513	Ga0495607_0075075	3300046501	Bacteria	1874
514	Ga0495583_0000028	3300046506	Bacteria	255787
515	Ga0495606_0127987	3300046507	Bacteria	1512
516	Ga0495606_0198783	3300046507	Bacteria	1144
517	Ga0495606_0275738	3300046507	Bacteria	922
518	Ga0495610_0017908	3300046512	Bacteria	4021
519	Ga0495610_0090366	3300046512	Bacteria	1389
520	Ga0495616_0198743	3300046513	Bacteria	882
521	Ga0495616_0202819	3300046513	Bacteria	871
522	Ga0495618_0035740	3300046514	Bacteria	3119
523	Ga0495620_0000028	3300046515	Bacteria	123172
524	Ga0495620_0046712	3300046515	Bacteria	1868
525	Ga0495620_0111270	3300046515	Bacteria	1085
526	Ga0495628_0088858	3300046516	Bacteria	2394
527	Ga0495630_0081340	3300046517	Bacteria	2444
528	Ga0495631_0019696	3300046518	Bacteria	3163
529	Ga0495631_0143208	3300046518	Bacteria	1026
530	Ga0495631_0176428	3300046518	Bacteria	916
531	Ga0495632_0075399	3300046519	Bacteria	1614
532	Ga0495637_0058026	3300046520	Bacteria	1596
533	Ga0495637_0087414	3300046520	Bacteria	1234
534	Ga0495643_0000057	3300046522	Bacteria	195145
535	Ga0495643_0007531	3300046522	Bacteria	7005
536	Ga0495643_0148394	3300046522	Bacteria	1163
537	Ga0495644_0134473	3300046523	Bacteria	943
538	Ga0495648_0018358	3300046524	Bacteria	4954
539	Ga0495648_0105183	3300046524	Bacteria	1548
540	Ga0495648_0229435	3300046524	Bacteria	910
541	Ga0495652_0121872	3300046529	Bacteria	2078
542	Ga0495652_0203451	3300046529	Bacteria	1501
543	Ga0495654_0001115	3300046530	Bacteria	19367
544	Ga0495654_0066737	3300046530	Bacteria	1714
545	Ga0495654_0073586	3300046530	Bacteria	1616
546	Ga0495654_0152662	3300046530	Bacteria	1020
547	Ga0495665_0097196	3300046531	Bacteria	1546
548	Ga0495640_0083808	3300046533	Bacteria	2115
549	Ga0495586_0163432	3300046535	Bacteria	1256
550	Ga0495598_0089915	3300046537	Bacteria	999
551	Ga0495609_0000081	3300046538	Bacteria	116100
552	Ga0495621_0132401	3300046539	Bacteria	971
553	Ga0495597_0000037	3300046542	Bacteria	113832
554	Ga0495597_0026112	3300046542	Bacteria	2684
555	Ga0495622_0086965	3300046557	Bacteria	1437
556	Ga0495622_0167545	3300046557	Bacteria	989
557	Ga0495633_0000028	3300046558	Bacteria	203214
558	Ga0495656_0141514	3300046615	Bacteria	1154
559	Ga0495668_0074227	3300046616	Bacteria	1868
560	Ga0495668_0265863	3300046616	Bacteria	939
561	Ga0495668_0317735	3300046616	Bacteria	854
562	Ga0495611_0008756	3300046648	Bacteria	4278
563	Ga0495611_0111947	3300046648	Bacteria	1271
564	Ga0495625_0130041	3300046660	Bacteria	1706
565	Ga0495625_0178502	3300046660	Bacteria	1414
566	Ga0495661_0000217	3300046665	Bacteria	66241
567	Ga0495661_0010263	3300046665	Bacteria	6398
568	Ga0495661_0142128	3300046665	Bacteria	1305
569	Ga0495588_0259671	3300046674	Bacteria	915
570	Ga0495588_0279796	3300046674	Bacteria	879
571	Ga0495647_0021985	3300046681	Bacteria	2302
572	Ga0495624_0108077	3300046690	Bacteria	1711
573	Ga0495670_0001463	3300046691	Bacteria	11538
574	Ga0495671_0006278	3300046692	Bacteria	6880
575	Ga0495671_0033794	3300046692	Bacteria	2603
576	Ga0495671_0276521	3300046692	Bacteria	809
577	Ga0495649_0316663	3300046694	Bacteria	792
578	Ga0495589_0010125	3300046794	Bacteria	4898
579	Ga0495660_0000568	3300046810	Bacteria	29899
580	Ga0495660_0003536	3300046810	Bacteria	9636
581	Ga0495660_0015689	3300046810	Bacteria	4374
582	Ga0495660_0203201	3300046810	Bacteria	945
583	Ga0495604_0172449	3300047317	Bacteria	1520
584	Ga0495674_0037149	3300047319	Bacteria	4377
585	Ga0495672_0072361	3300047320	Bacteria	1947
586	Ga0495672_0101109	3300047320	Bacteria	1563
587	Ga0495672_0244747	3300047320	Bacteria	874
588	Ga0495683_0000060	3300047323	Bacteria	115881
589	Ga0495683_0112253	3300047323	Bacteria	1300
590	Ga0495683_0222511	3300047323	Bacteria	841
591	Ga0495687_049654	3300047443	Bacteria	1792
592	Ga0495679_000823	3300047446	Bacteria	19731
593	Ga0495681_0024953	3300047470	Bacteria	3135
594	Ga0495686_0095860	3300047472	Bacteria	1796
595	Ga0495686_0327534	3300047472	Bacteria	838
596	Ga0495602_0225582	3300048088	Bacteria	1411
597	Ga0496102_0190387	3300048905	Bacteria	1933
598	Ga0496103_0010374	3300048906	Bacteria	5513
599	Ga0496104_0201716	3300048907	Bacteria	1901
600	Ga0496106_0000002	3300048909	Bacteria	377020
601	Ga0496106_0258759	3300048909	Bacteria	1392
602	Ga0496107_0028046	3300048910	Bacteria	4001
603	Ga0496108_0198145	3300048911	Bacteria	1742
604	Ga0496109_0283565	3300048912	Bacteria	1561
605	Ga0496110_0303802	3300048913	Bacteria	1453
606	Ga0496111_0063380	3300048914	Bacteria	2681
607	Ga0496112_0019936	3300048915	Bacteria	6346
608	Ga0496112_0436698	3300048915	Bacteria	1247
609	Ga0496113_0270307	3300048916	Bacteria	1358
610	Ga0496114_0377032	3300048917	Bacteria	1256
611	Ga0496116_0042778	3300048919	Bacteria	3093
612	Ga0496116_0066692	3300048919	Bacteria	2302
613	Ga0496117_0080858	3300048920	Bacteria	2135
614	Ga0496117_0090460	3300048920	Bacteria	1972
615	Ga0496117_0291583	3300048920	Bacteria	868
616	Ga0496117_0320977	3300048920	Bacteria	811
617	Ga0496118_0074574	3300048921	Bacteria	2424
618	Ga0496118_0075118	3300048921	Bacteria	2412
619	Ga0496118_0164712	3300048921	Bacteria	1364
620	Ga0496118_0299639	3300048921	Bacteria	883
621	Ga0496118_0331017	3300048921	Bacteria	821
622	Ga0496119_0170381	3300048922	Bacteria	1150
623	Ga0496120_0133123	3300048923	Bacteria	1271
624	Ga0496121_0002830	3300048924	Bacteria	25630
625	Ga0496121_0025670	3300048924	Bacteria	5583
626	Ga0496121_0027094	3300048924	Bacteria	5373
627	Ga0496121_0085899	3300048924	Bacteria	2474
628	Ga0496121_0168730	3300048924	Bacteria	1592
629	Ga0496121_0235102	3300048924	Bacteria	1281
630	Ga0496121_0238341	3300048924	Bacteria	1269
631	Ga0496121_0289078	3300048924	Bacteria	1118
632	Ga0496121_0418563	3300048924	Bacteria	872
633	Ga0496121_0433577	3300048924	Bacteria	852
634	Ga0496122_0011516	3300048925	Bacteria	8946
635	Ga0496122_0033725	3300048925	Bacteria	4204
636	Ga0496122_0228024	3300048925	Bacteria	1062
637	Ga0496123_0000314	3300048926	Bacteria	92927
638	Ga0496123_0038366	3300048926	Bacteria	3368
639	Ga0496123_0091378	3300048926	Bacteria	1805
640	Ga0496124_0272098	3300048927	Bacteria	1240
641	Ga0496124_0290361	3300048927	Bacteria	1187
642	Ga0496124_0386655	3300048927	Bacteria	976
643	Ga0496125_0002440	3300048928	Bacteria	24147
644	Ga0496125_0051382	3300048928	Bacteria	3400
645	Ga0496125_0171134	3300048928	Bacteria	1460
646	Ga0496126_0012386	3300048929	Bacteria	8743
647	Ga0496126_0031229	3300048929	Bacteria	5036
648	Ga0496126_0034574	3300048929	Bacteria	4746
649	Ga0496126_0189625	3300048929	Bacteria	1742
650	Ga0496126_0209436	3300048929	Bacteria	1642
651	Ga0496126_0367270	3300048929	Bacteria	1174
652	Ga0496126_0375518	3300048929	Bacteria	1158
653	Ga0496126_0550610	3300048929	Bacteria	915
654	Ga0496126_0625567	3300048929	Bacteria	845
655	Ga0495678_000020	3300049459	Bacteria	253654
656	Ga0501031_0061738	3300049568	Bacteria	2442
657	Ga0501033_0466496	3300049570	Bacteria	876
658	Ga0501047_0017499	3300049581	Bacteria	6865
659	Ga0501048_0001083	3300049582	Bacteria	20423
660	Ga0501067_0104958	3300049583	Bacteria	1570
661	Ga0501070_0433096	3300049586	Bacteria	1061
662	Ga0501080_0008470	3300049742	Bacteria	9318
663	Ga0501035_0171787	3300049822	Bacteria	1872
664	Ga0501044_0031380	3300049823	Bacteria	5593
665	Ga0501044_0581210	3300049823	Bacteria	1015
666	nmdc:mga03683_24199_c1	3300050489	Bacteria	2374
667	nmdc:mga03683_246495_c1	3300050489	Bacteria	829
668	nmdc:mga03683_26419_c1	3300050489	Bacteria	2290
669	nmdc:mga03683_36720_c1	3300050489	Bacteria	1994
670	nmdc:mga03n38_12752_c1	3300050490	Bacteria	3172
671	nmdc:mga03n38_144255_c1	3300050490	Bacteria	1192
672	nmdc:mga03n38_34390_c1	3300050490	Bacteria	2164
673	nmdc:mga03n38_72711_c1	3300050490	Bacteria	1595
674	nmdc:mga00v17_153444_c1	3300050491	Bacteria	1480
675	nmdc:mga00v17_43195_c1	3300050491	Bacteria	2713
676	nmdc:mga00v17_65780_c1	3300050491	Bacteria	2237
677	nmdc:mga00v17_84082_c1	3300050491	Bacteria	1991
678	nmdc:mga0yw44_197834_c1	3300050492	Bacteria	1327
679	nmdc:mga0yw44_201313_c1	3300050492	Bacteria	1315
680	nmdc:mga0k408_125833_c1	3300050493	Bacteria	1520
681	nmdc:mga0k408_184951_c1	3300050493	Bacteria	1243
682	nmdc:mga0k408_218754_c1	3300050493	Bacteria	1137
683	nmdc:mga0k408_233813_c1	3300050493	Bacteria	1097
684	nmdc:mga0k408_667_c1	3300050493	Bacteria	18809
685	nmdc:mga0k408_73324_c1	3300050493	Bacteria	1999
686	nmdc:mga06z11_33139_c1	3300050494	Bacteria	2525
687	nmdc:mga06z11_45724_c1	3300050494	Bacteria	2215
688	nmdc:mga06z11_91252_c1	3300050494	Bacteria	1654
689	nmdc:mga06z11_91278_c1	3300050494	Bacteria	1654
690	nmdc:mga07m45_64277_c1	3300050496	Bacteria	2082
691	nmdc:mga05p37_24646_c1	3300050507	Bacteria	7312
692	nmdc:mga08y16_684570_c1	3300050511	Bacteria	1027
693	nmdc:mga0n895_332819_c1	3300050512	Bacteria	1538
694	nmdc:mga0rr50_19965_c1	3300050513	Bacteria	4538
695	nmdc:mga08x19_191018_c1	3300050514	Bacteria	1401
696	nmdc:mga08x19_273905_c1	3300050514	Bacteria	1168
697	nmdc:mga0a205_288615_c1	3300050515	Bacteria	1515
698	nmdc:mga0sz30_121528_c1	3300050516	Bacteria	1148
699	nmdc:mga0sz30_178204_c1	3300050516	Bacteria	943
700	nmdc:mga0sz30_30521_c1	3300050516	Bacteria	2226
701	Ga0495655_0038438	3300053083	Bacteria	1208
702	Ga0495655_0049109	3300053083	Bacteria	1110
703	Ga0500643_001635	3300053087	Bacteria	12518
704	Ga0500644_0003163	3300053088	Bacteria	4079
705	Ga0500644_0094479	3300053088	Bacteria	1125
706	Ga0500581_020365	3300053089	Bacteria	3348
707	Ga0500646_0027161	3300053090	Bacteria	1556
708	Ga0500647_0141254	3300053091	Bacteria	1129
709	Ga0500583_0064544	3300053092	Bacteria	1736
710	Ga0500651_0115319	3300053093	Bacteria	1636
711	Ga0500651_0165488	3300053093	Bacteria	1320
712	Ga0500566_0041846	3300053094	Bacteria	2645
713	Ga0500566_0067562	3300053094	Bacteria	2012
714	Ga0500566_0188741	3300053094	Bacteria	1051
715	Ga0500640_048736	3300053095	Bacteria	1856
716	Ga0500641_0036253	3300053096	Bacteria	1972
717	Ga0500650_0001279	3300053098	Bacteria	7435
718	Ga0500650_0055751	3300053098	Bacteria	1841
719	Ga0500556_0000015	3300053104	Bacteria	202598
720	Ga0500557_000822	3300053105	Bacteria	4511
721	Ga0500569_003618	3300053109	Bacteria	3178
722	Ga0500592_020250	3300053116	Bacteria	1071
723	Ga0500593_035827	3300053117	Bacteria	2220
724	Ga0500594_0150818	3300053118	Bacteria	747
725	Ga0500595_000002	3300053119	Bacteria	1074388
726	Ga0500607_051290	3300053121	Bacteria	2194
727	Ga0500608_001202	3300053122	Bacteria	9261
728	Ga0500614_022890	3300053123	Bacteria	1463
729	Ga0500618_044278	3300053125	Bacteria	1016
730	Ga0500642_0000044	3300053130	Bacteria	82877
731	Ga0500652_000638	3300053131	Bacteria	11977
732	Ga0500568_0000661	3300053139	Bacteria	24893
733	Ga0500586_003197	3300053145	Bacteria	3839
734	Ga0500603_007887	3300053150	Bacteria	2345
735	Ga0500604_0005252	3300053151	Bacteria	3424
736	Ga0500616_0000001	3300053153	Bacteria	1986011
737	Ga0500616_0000041	3300053153	Bacteria	359328
738	Ga0500622_0000700	3300053156	Bacteria	29484
739	Ga0500627_0184689	3300053158	Bacteria	937
740	Ga0500630_056839	3300053159	Bacteria	1878
741	Ga0500634_0177705	3300053161	Bacteria	962
742	Ga0500639_004098	3300053163	Bacteria	7401
743	Ga0500636_0009242	3300053177	Bacteria	5729
744	Ga0500636_0015565	3300053177	Bacteria	4483
745	Ga0500625_096922	3300053729	Bacteria	1246
746	Ga0500645_010186	3300053730	Bacteria	3123
747	Ga0501082_0346876	3300060353	Bacteria	1294

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300003792	Ga0055540_1000184	Ga0055540_10001842	210
2	3300041453	Ga0451797_0912266	Ga0451797_0912266_98_742	214
3	3300048920	Ga0496117_0291583	Ga0496117_0291583_15_659	214
4	3300050493	nmdc:mga0k408_184951_c1	nmdc:mga0k408_184951_c1_569_1213	214
5	3300049582	Ga0501048_0001083	Ga0501048_0001083_3137_3826	215
6	3300005518	Ga0070699_100023882	Ga0070699_1000238821	221
7	3300053098	Ga0500650_0055751	Ga0500650_0055751_763_1464	222
8	3300005549	Ga0070704_100267527	Ga0070704_1002675271	224
9	3300005985	Ga0081539_10002350	Ga0081539_100023505	225
10	3300031456	Ga0307513_10020111	Ga0307513_100201114	225
11	iso_pu_bacteria	2501025504	2501407527	225
12	iso_pu_bacteria	2510917014	2511097395	225
13	iso_pu_bacteria	2510917015	2511105650	225
14	iso_pu_bacteria	2511231002	2511244051	225
15	iso_pu_bacteria	2512047030	2512346550	225
16	iso_pu_bacteria	2513237094	2513639593	225
17	iso_pu_bacteria	2513237095	2513647921	225
18	iso_pu_bacteria	2513237096	2513653728	225
19	iso_pu_bacteria	2513237101	2513693661	225
20	iso_pu_bacteria	2513237137	2513856168	225
21	iso_pu_bacteria	2513237145	2513918068	225
22	iso_pu_bacteria	2517572143	2517891692	225
23	iso_pu_bacteria	2524023205	2524437231	225
24	iso_pu_bacteria	2524023228	2524536687	225
25	iso_pu_bacteria	2585428062	2587757677	225
26	iso_pu_bacteria	2599185214	2599621349	225
27	iso_pu_bacteria	2599185226	2599670967	225
28	iso_pu_bacteria	2599185227	2599679457	225
29	iso_pu_bacteria	2599185229	2599690860	225
30	iso_pu_bacteria	2602042107	2603860763	225
31	iso_pu_bacteria	2643221683	2644465584	225
32	iso_pu_bacteria	2667528175	2671118538	225
33	iso_pu_bacteria	2721755755	2723843567	225
34	iso_pu_bacteria	2728368998	2728754845	225
35	iso_pu_bacteria	2744054633	2745076449	225
36	iso_pu_bacteria	2791355196	2793063071	225
37	iso_pu_bacteria	2791355197	2793067066	225
38	iso_pu_bacteria	2791355199	2793082894	225
39	iso_pu_bacteria	2816332527	2818237321	225
40	iso_pu_bacteria	2818991446	2819597529	225
41	iso_pu_bacteria	2824661429	2824664773	225
42	iso_pu_bacteria	2838054893	2838057947	225
43	iso_pu_bacteria	2844315083	2844321865	225
44	iso_pu_bacteria	2847930680	2847931428	225
45	iso_pu_bacteria	2857509624	2857511611	225
46	iso_pu_bacteria	2857524615	2857524798	225
47	iso_pu_bacteria	2858950400	2858953914	225
48	iso_pu_bacteria	2874604998	2874611524	225
49	iso_pu_bacteria	2876761206	2876769002	225
50	iso_pu_bacteria	2876808645	2876816595	225
51	iso_pu_bacteria	2879083081	2879087536	225
52	iso_pu_bacteria	2879110137	2879114969	225
53	iso_pu_bacteria	2885198086	2885200197	225
54	iso_pu_bacteria	2885211737	2885213849	225
55	iso_pu_bacteria	2885374607	2885381022	225
56	iso_pu_bacteria	2885409591	2885418350	225
57	iso_pu_bacteria	2887375801	2887379161	225
58	iso_pu_bacteria	2888378607	2888379922	225
59	iso_pu_bacteria	2893066018	2893069312	225
60	iso_pu_bacteria	2903727486	2903727585	225
61	iso_pu_bacteria	2903748898	2903755400	225
62	iso_pu_bacteria	2903768456	2903768500	225
63	iso_pu_bacteria	2904449895	2904451478	225
64	iso_pu_bacteria	2904541872	2904543122	225
65	iso_pu_bacteria	2904690495	2904698497	225
66	iso_pu_bacteria	2904699407	2904704550	225
67	iso_pu_bacteria	2906602504	2906602925	225
68	iso_pu_bacteria	2906610324	2906616867	225
69	iso_pu_bacteria	2906635258	2906642906	225
70	iso_pu_bacteria	2906643746	2906649058	225
71	iso_pu_bacteria	2906660503	2906667196	225
72	iso_pu_bacteria	2908739725	2908742054	225
73	iso_pu_bacteria	2908756301	2908762491	225
74	iso_pu_bacteria	2919073203	2919078684	225
75	iso_pu_bacteria	2922361189	2922361823	225
76	iso_pu_bacteria	2922368715	2922378304	225
77	iso_pu_bacteria	2922386360	2922386939	225
78	iso_pu_bacteria	2922425934	2922431060	225
79	iso_pu_bacteria	2928037797	2928040616	225
80	iso_pu_bacteria	2928044640	2928046635	225
81	iso_pu_bacteria	2928051484	2928058181	225
82	iso_pu_bacteria	2928064002	2928067482	225
83	iso_pu_bacteria	2928070936	2928072009	225
84	iso_pu_bacteria	2929160207	2929160355	225
85	iso_pu_bacteria	2932784394	2932786390	225
86	iso_pu_bacteria	2932794094	2932794645	225
87	iso_pu_bacteria	2932828146	2932829628	225
88	iso_pu_bacteria	2935616580	2935618146	225
89	iso_pu_bacteria	2935630451	2935636944	225
90	iso_pu_bacteria	2935638405	2935641456	225
91	iso_pu_bacteria	2935665750	2935669486	225
92	iso_pu_bacteria	2935675223	2935677916	225
93	iso_pu_bacteria	2935684952	2935689635	225
94	iso_pu_bacteria	2935703347	2935707311	225
95	iso_pu_bacteria	2935713505	2935717155	225
96	iso_pu_bacteria	2935722832	2935730011	225
97	iso_pu_bacteria	2935732158	2935738570	225
98	iso_pu_bacteria	2935741537	2935749182	225
99	iso_pu_bacteria	2935750917	2935756989	225
100	iso_pu_bacteria	2935801545	2935804310	225
101	iso_pu_bacteria	2935810662	2935815394	225
102	iso_pu_bacteria	2935827899	2935831187	225
103	iso_pu_bacteria	2935837841	2935841796	225
104	iso_pu_bacteria	2935855204	2935856355	225
105	iso_pu_bacteria	2935864058	2935866313	225
106	iso_pu_bacteria	2935873716	2935874619	225
107	iso_pu_bacteria	2935959822	2935962322	225
108	iso_pu_bacteria	2935992306	2935994080	225
109	iso_pu_bacteria	2936002035	2936004909	225
110	iso_pu_bacteria	2936037263	2936045049	225
111	iso_pu_bacteria	2940556831	2940562903	225
112	iso_pu_bacteria	2941507105	2941513600	225
113	iso_pu_bacteria	2941515067	2941521544	225
114	iso_pu_bacteria	2941523033	2941529298	225
115	iso_pu_bacteria	2941538514	2941543869	225
116	iso_pu_bacteria	3005474847	3005480883	225
117	iso_pu_bacteria	3005594810	3005597659	225
118	iso_pu_bacteria	8006933436	8006939835	225
119	iso_pu_bacteria	8006964411	8006966933	225
120	iso_pu_bacteria	8006973647	8006979605	225
121	iso_pu_bacteria	8006984368	8006984743	225
122	iso_pu_bacteria	8006994254	8006994558	225
123	iso_pu_bacteria	8016511872	8016518575	225
124	iso_pu_bacteria	8017057580	8017058090	225
125	iso_pu_bacteria	8019555841	8019565735	225
126	iso_pu_bacteria	8019565922	8019575825	225
127	iso_pu_bacteria	8019576017	8019577643	225
128	iso_pu_bacteria	8019586578	8019595736	225
129	iso_pu_bacteria	8019597564	8019606024	225
130	iso_pu_bacteria	8019608314	8019612507	225
131	iso_pu_bacteria	8019648815	8019652834	225
132	iso_pu_bacteria	8056673599	8056680976	225
133	iso_pu_bacteria	8056689827	8056690662	225
134	iso_pu_bacteria	8056967851	8056970960	225
135	3300005327	Ga0070658_10001105	Ga0070658_1000110513	228
136	3300005337	Ga0070682_100225158	Ga0070682_1002251581	228
137	3300005337	Ga0070682_100231187	Ga0070682_1002311871	228
138	3300005338	Ga0068868_100170776	Ga0068868_1001707762	228
139	3300005339	Ga0070660_100272659	Ga0070660_1002726592	228
140	3300005340	Ga0070689_100000001	Ga0070689_100000001513	228
141	3300005366	Ga0070659_100097337	Ga0070659_1000973372	228
142	3300005435	Ga0070714_100034368	Ga0070714_1000343681	228
143	3300005455	Ga0070663_100663840	Ga0070663_1006638401	228
144	3300005458	Ga0070681_10039786	Ga0070681_100397865	228
145	3300005539	Ga0068853_100003441	Ga0068853_10000344113	228
146	3300005539	Ga0068853_100113688	Ga0068853_1001136882	228
147	3300005563	Ga0068855_100124947	Ga0068855_1001249472	228
148	3300005563	Ga0068855_100654906	Ga0068855_1006549062	228
149	3300005614	Ga0068856_100135779	Ga0068856_1001357791	228
150	3300005617	Ga0068859_100062750	Ga0068859_1000627503	228
151	3300005719	Ga0068861_100073695	Ga0068861_1000736952	228
152	3300006195	Ga0075366_10000857	Ga0075366_1000085713	228
153	3300006931	Ga0097620_100062751	Ga0097620_1000627512	228
154	3300009093	Ga0105240_10000565	Ga0105240_1000056555	228
155	3300009093	Ga0105240_10103703	Ga0105240_101037034	228
156	3300009174	Ga0105241_10561622	Ga0105241_105616221	228
157	3300009174	Ga0105241_10635768	Ga0105241_106357682	228
158	3300009545	Ga0105237_10000197	Ga0105237_1000019723	228
159	3300009545	Ga0105237_10003925	Ga0105237_1000392520	228
160	3300009545	Ga0105237_10030930	Ga0105237_100309302	228
161	3300009551	Ga0105238_10009635	Ga0105238_100096354	228
162	3300009551	Ga0105238_10016742	Ga0105238_100167422	228
163	3300009551	Ga0105238_10033064	Ga0105238_100330644	228
164	3300010375	Ga0105239_10002899	Ga0105239_1000289919	228
165	3300010375	Ga0105239_10064829	Ga0105239_100648292	228
166	3300010375	Ga0105239_10173240	Ga0105239_101732402	228
167	3300025909	Ga0207705_10076636	Ga0207705_100766363	228
168	3300025913	Ga0207695_10013961	Ga0207695_100139616	228
169	3300025913	Ga0207695_10028199	Ga0207695_100281997	228
170	3300025914	Ga0207671_10000092	Ga0207671_1000009297	228
171	3300025914	Ga0207671_10001542	Ga0207671_1000154211	228
172	3300025919	Ga0207657_10256747	Ga0207657_102567472	228
173	3300025921	Ga0207652_10032949	Ga0207652_100329493	228
174	3300025924	Ga0207694_10017771	Ga0207694_100177712	228
175	3300025924	Ga0207694_10084911	Ga0207694_100849112	228
176	3300025929	Ga0207664_10058493	Ga0207664_100584935	228
177	3300025932	Ga0207690_10051486	Ga0207690_100514863	228
178	3300025936	Ga0207670_10000002	Ga0207670_10000002410	228
179	3300025949	Ga0207667_10032537	Ga0207667_100325372	228
180	3300025949	Ga0207667_10151895	Ga0207667_101518951	228
181	3300026023	Ga0207677_10225718	Ga0207677_102257182	228
182	3300026023	Ga0207677_10282668	Ga0207677_102826681	228
183	3300026041	Ga0207639_10023520	Ga0207639_100235204	228
184	3300026041	Ga0207639_10325153	Ga0207639_103251531	228
185	3300026078	Ga0207702_10120251	Ga0207702_101202511	228
186	3300028563	Ga0265319_1036810	Ga0265319_10368102	228
187	3300031595	Ga0265313_10076856	Ga0265313_100768562	228
188	3300031595	Ga0265313_10121681	Ga0265313_101216812	228
189	3300050493	nmdc:mga0k408_667_c1	nmdc:mga0k408_667_c1_979_1680	228
190	2162886006	SwRhRL3b_contig_1238020	SwRhRL3b_0838.00001170	229
191	3300002070	JGI24750J21931_1013206	JGI24750J21931_10132061	229
192	3300002987	JGI25159J45721_1000816	JGI25159J45721_10008168	229
193	3300003187	JGI25151J46595_10002642	JGI25151J46595_100026422	229
194	3300003215	JGI25153J46596_10007303	JGI25153J46596_100073036	229
195	3300003215	JGI25153J46596_10008730	JGI25153J46596_100087305	229
196	3300003215	JGI25153J46596_10074515	JGI25153J46596_100745151	229
197	3300003320	rootH2_10236421	rootH2_102364212	229
198	3300003323	rootH1_10071046	rootH1_100710461	229
199	3300003323	rootH1_10071047	rootH1_100710472	229
200	3300003323	rootH1_10078959	rootH1_100789592	229
201	3300003323	rootH1_10112413	rootH1_101124131	229
202	3300003323	rootH1_10143955	rootH1_101439552	229
203	3300003354	JGI25160J50197_1000098	JGI25160J50197_100009837	229
204	3300003354	JGI25160J50197_1051849	JGI25160J50197_10518491	229
205	3300003374	JGI25161J50226_1000037	JGI25161J50226_100003775	229
206	3300003578	Ga0006562J51391_1088900	Ga0006562J51391_10889002	229
207	3300003763	Ga0055529_1008113	Ga0055529_10081132	229
208	3300003773	Ga0055537_1002928	Ga0055537_10029286	229
209	3300003781	Ga0055536_1005074	Ga0055536_10050743	229
210	3300003784	Ga0055534_1011333	Ga0055534_10113333	229
211	3300003790	Ga0055528_1006502	Ga0055528_10065025	229
212	3300003791	Ga0055530_10000358	Ga0055530_1000035838	229
213	3300003792	Ga0055540_1002572	Ga0055540_100257210	229
214	3300003792	Ga0055540_1004932	Ga0055540_10049322	229
215	3300003794	Ga0055531_10007321	Ga0055531_100073212	229
216	3300004625	Ga0055543_1000497	Ga0055543_100049710	229
217	3300005262	Ga0065165_1003507	Ga0065165_10035071	229
218	3300005262	Ga0065165_1005429	Ga0065165_10054294	229
219	3300005295	Ga0065707_10084400	Ga0065707_100844008	229
220	3300005327	Ga0070658_10802114	Ga0070658_108021141	229
221	3300005333	Ga0070677_10010390	Ga0070677_100103903	229
222	3300005334	Ga0068869_100089288	Ga0068869_1000892881	229
223	3300005334	Ga0068869_100430277	Ga0068869_1004302771	229
224	3300005337	Ga0070682_100004212	Ga0070682_1000042124	229
225	3300005343	Ga0070687_100109508	Ga0070687_1001095081	229
226	3300005344	Ga0070661_100169704	Ga0070661_1001697042	229
227	3300005347	Ga0070668_100047101	Ga0070668_1000471014	229
228	3300005353	Ga0070669_100069310	Ga0070669_1000693102	229
229	3300005353	Ga0070669_100193411	Ga0070669_1001934112	229
230	3300005353	Ga0070669_100210499	Ga0070669_1002104992	229
231	3300005354	Ga0070675_100039997	Ga0070675_1000399974	229
232	3300005354	Ga0070675_100112227	Ga0070675_1001122271	229
233	3300005355	Ga0070671_100080948	Ga0070671_1000809482	229
234	3300005356	Ga0070674_100465225	Ga0070674_1004652251	229
235	3300005364	Ga0070673_100144915	Ga0070673_1001449152	229
236	3300005367	Ga0070667_100338829	Ga0070667_1003388292	229
237	3300005434	Ga0070709_10010218	Ga0070709_100102183	229
238	3300005434	Ga0070709_10023884	Ga0070709_100238842	229
239	3300005435	Ga0070714_100563328	Ga0070714_1005633281	229
240	3300005436	Ga0070713_100021922	Ga0070713_1000219224	229
241	3300005436	Ga0070713_100029770	Ga0070713_1000297705	229
242	3300005436	Ga0070713_100734826	Ga0070713_1007348261	229
243	3300005437	Ga0070710_10045296	Ga0070710_100452962	229
244	3300005439	Ga0070711_100001277	Ga0070711_1000012772	229
245	3300005439	Ga0070711_100011775	Ga0070711_1000117752	229
246	3300005439	Ga0070711_100033622	Ga0070711_1000336222	229
247	3300005440	Ga0070705_100050929	Ga0070705_1000509292	229
248	3300005445	Ga0070708_100442554	Ga0070708_1004425542	229
249	3300005455	Ga0070663_100018048	Ga0070663_1000180485	229
250	3300005456	Ga0070678_100020333	Ga0070678_1000203332	229
251	3300005456	Ga0070678_100121263	Ga0070678_1001212632	229
252	3300005457	Ga0070662_100044005	Ga0070662_1000440053	229
253	3300005467	Ga0070706_100023429	Ga0070706_1000234296	229
254	3300005467	Ga0070706_100152682	Ga0070706_1001526823	229
255	3300005467	Ga0070706_100527355	Ga0070706_1005273551	229
256	3300005468	Ga0070707_100003493	Ga0070707_10000349312	229
257	3300005471	Ga0070698_100010386	Ga0070698_1000103867	229
258	3300005471	Ga0070698_100077569	Ga0070698_1000775693	229
259	3300005518	Ga0070699_100051293	Ga0070699_1000512932	229
260	3300005518	Ga0070699_100110458	Ga0070699_1001104583	229
261	3300005518	Ga0070699_100147650	Ga0070699_1001476503	229
262	3300005535	Ga0070684_100752475	Ga0070684_1007524751	229
263	3300005536	Ga0070697_100023386	Ga0070697_1000233864	229
264	3300005536	Ga0070697_100315534	Ga0070697_1003155342	229
265	3300005539	Ga0068853_100070176	Ga0068853_1000701762	229
266	3300005546	Ga0070696_100414138	Ga0070696_1004141381	229
267	3300005547	Ga0070693_100066004	Ga0070693_1000660041	229
268	3300005547	Ga0070693_100241966	Ga0070693_1002419662	229
269	3300005548	Ga0070665_100053421	Ga0070665_1000534214	229
270	3300005548	Ga0070665_100115134	Ga0070665_1001151343	229
271	3300005548	Ga0070665_100487683	Ga0070665_1004876832	229
272	3300005548	Ga0070665_100855314	Ga0070665_1008553141	229
273	3300005548	Ga0070665_101047843	Ga0070665_1010478431	229
274	3300005563	Ga0068855_100001976	Ga0068855_10000197611	229
275	3300005563	Ga0068855_100046285	Ga0068855_1000462854	229
276	3300005577	Ga0068857_100090580	Ga0068857_1000905803	229
277	3300005577	Ga0068857_101063229	Ga0068857_1010632291	229
278	3300005578	Ga0068854_100175887	Ga0068854_1001758872	229
279	3300005614	Ga0068856_100035409	Ga0068856_1000354095	229
280	3300005614	Ga0068856_100138137	Ga0068856_1001381372	229
281	3300005614	Ga0068856_100398239	Ga0068856_1003982392	229
282	3300005615	Ga0070702_100177824	Ga0070702_1001778242	229
283	3300005616	Ga0068852_100793932	Ga0068852_1007939322	229
284	3300005617	Ga0068859_100530743	Ga0068859_1005307432	229
285	3300005618	Ga0068864_100092604	Ga0068864_1000926043	229
286	3300005618	Ga0068864_100882137	Ga0068864_1008821371	229
287	3300005618	Ga0068864_100892161	Ga0068864_1008921611	229
288	3300005719	Ga0068861_100103930	Ga0068861_1001039303	229
289	3300005834	Ga0068851_10002794	Ga0068851_100027944	229
290	3300005841	Ga0068863_100539031	Ga0068863_1005390312	229
291	3300005843	Ga0068860_100006055	Ga0068860_1000060556	229
292	3300005843	Ga0068860_100484086	Ga0068860_1004840862	229
293	3300005844	Ga0068862_100256051	Ga0068862_1002560512	229
294	3300005844	Ga0068862_100284097	Ga0068862_1002840972	229
295	3300005844	Ga0068862_100294070	Ga0068862_1002940702	229
296	3300005937	Ga0081455_10461714	Ga0081455_104617141	229
297	3300005983	Ga0081540_1011585	Ga0081540_10115853	229
298	3300005983	Ga0081540_1012130	Ga0081540_10121304	229
299	3300005983	Ga0081540_1045487	Ga0081540_10454873	229
300	3300005985	Ga0081539_10189053	Ga0081539_101890532	229
301	3300005985	Ga0081539_10235049	Ga0081539_102350491	229
302	3300006028	Ga0070717_10543671	Ga0070717_105436712	229
303	3300006028	Ga0070717_10599018	Ga0070717_105990182	229
304	3300006038	Ga0075365_10147509	Ga0075365_101475092	229
305	3300006038	Ga0075365_10192285	Ga0075365_101922851	229
306	3300006038	Ga0075365_10361342	Ga0075365_103613422	229
307	3300006048	Ga0075363_100028797	Ga0075363_1000287972	229
308	3300006048	Ga0075363_100029159	Ga0075363_1000291593	229
309	3300006048	Ga0075363_100037949	Ga0075363_1000379492	229
310	3300006048	Ga0075363_100077076	Ga0075363_1000770762	229
311	3300006051	Ga0075364_10062210	Ga0075364_100622102	229
312	3300006051	Ga0075364_10351520	Ga0075364_103515202	229
313	3300006051	Ga0075364_10352054	Ga0075364_103520542	229
314	3300006163	Ga0070715_10184915	Ga0070715_101849152	229
315	3300006173	Ga0070716_100106728	Ga0070716_1001067282	229
316	3300006175	Ga0070712_100029964	Ga0070712_1000299642	229
317	3300006177	Ga0075362_10016617	Ga0075362_100166173	229
318	3300006177	Ga0075362_10032523	Ga0075362_100325232	229
319	3300006177	Ga0075362_10043582	Ga0075362_100435822	229
320	3300006177	Ga0075362_10197035	Ga0075362_101970352	229
321	3300006178	Ga0075367_10005456	Ga0075367_100054563	229
322	3300006178	Ga0075367_10041321	Ga0075367_100413212	229
323	3300006178	Ga0075367_10214687	Ga0075367_102146872	229
324	3300006186	Ga0075369_10005854	Ga0075369_100058544	229
325	3300006186	Ga0075369_10033816	Ga0075369_100338163	229
326	3300006195	Ga0075366_10116389	Ga0075366_101163892	229
327	3300006195	Ga0075366_10197976	Ga0075366_101979762	229
328	3300006237	Ga0097621_100104347	Ga0097621_1001043472	229
329	3300006353	Ga0075370_10003260	Ga0075370_100032601	229
330	3300006353	Ga0075370_10010598	Ga0075370_100105984	229
331	3300006353	Ga0075370_10045526	Ga0075370_100455263	229
332	3300006358	Ga0068871_100174028	Ga0068871_1001740281	229
333	3300006844	Ga0075428_100967490	Ga0075428_1009674901	229
334	3300006871	Ga0075434_100000932	Ga0075434_1000009327	229
335	3300006871	Ga0075434_100229465	Ga0075434_1002294652	229
336	3300006871	Ga0075434_100380898	Ga0075434_1003808982	229
337	3300006914	Ga0075436_100004513	Ga0075436_1000045137	229
338	3300006914	Ga0075436_100013837	Ga0075436_1000138375	229
339	3300006931	Ga0097620_100530740	Ga0097620_1005307402	229
340	3300006942	Ga0099824_1033654	Ga0099824_10336542	229
341	3300006943	Ga0099822_1006869	Ga0099822_10068697	229
342	3300006944	Ga0099823_1045448	Ga0099823_10454481	229
343	3300007076	Ga0075435_100004811	Ga0075435_1000048116	229
344	3300007788	Ga0099795_10019563	Ga0099795_100195631	229
345	3300007788	Ga0099795_10087927	Ga0099795_100879272	229
346	3300009093	Ga0105240_10000309	Ga0105240_1000030949	229
347	3300009093	Ga0105240_10001377	Ga0105240_100013776	229
348	3300009093	Ga0105240_10105433	Ga0105240_101054335	229
349	3300009093	Ga0105240_10364986	Ga0105240_103649862	229
350	3300009094	Ga0111539_10069205	Ga0111539_100692053	229
351	3300009094	Ga0111539_10761647	Ga0111539_107616472	229
352	3300009098	Ga0105245_10044415	Ga0105245_100444152	229
353	3300009098	Ga0105245_10812281	Ga0105245_108122811	229
354	3300009101	Ga0105247_10000116	Ga0105247_1000011618	229
355	3300009147	Ga0114129_10018519	Ga0114129_100185199	229
356	3300009148	Ga0105243_10003118	Ga0105243_100031182	229
357	3300009148	Ga0105243_10090809	Ga0105243_100908092	229
358	3300009148	Ga0105243_10123374	Ga0105243_101233742	229
359	3300009148	Ga0105243_10142382	Ga0105243_101423823	229
360	3300009148	Ga0105243_10760194	Ga0105243_107601942	229
361	3300009174	Ga0105241_10109588	Ga0105241_101095882	229
362	3300009176	Ga0105242_10499305	Ga0105242_104993051	229
363	3300009177	Ga0105248_10040984	Ga0105248_100409845	229
364	3300009177	Ga0105248_10721809	Ga0105248_107218091	229
365	3300009545	Ga0105237_10009767	Ga0105237_100097679	229
366	3300009545	Ga0105237_10036637	Ga0105237_100366375	229
367	3300009545	Ga0105237_10088966	Ga0105237_100889663	229
368	3300009545	Ga0105237_10402494	Ga0105237_104024942	229
369	3300009551	Ga0105238_10156872	Ga0105238_101568722	229
370	3300009551	Ga0105238_10211526	Ga0105238_102115262	229
371	3300009553	Ga0105249_10108438	Ga0105249_101084383	229
372	3300009553	Ga0105249_10752576	Ga0105249_107525762	229
373	3300009982	Ga0105147_104762	Ga0105147_1047621	229
374	3300010159	Ga0099796_10012085	Ga0099796_100120853	229
375	3300010375	Ga0105239_10040562	Ga0105239_100405625	229
376	3300010375	Ga0105239_10064526	Ga0105239_100645263	229
377	3300010375	Ga0105239_10121243	Ga0105239_101212431	229
378	3300010375	Ga0105239_10152944	Ga0105239_101529442	229
379	3300010375	Ga0105239_10607262	Ga0105239_106072622	229
380	3300012502	Ga0157347_1005055	Ga0157347_10050552	229
381	3300013100	Ga0157373_10000027	Ga0157373_1000002722	229
382	3300013100	Ga0157373_10065586	Ga0157373_100655863	229
383	3300013102	Ga0157371_10041430	Ga0157371_100414303	229
384	3300013104	Ga0157370_10012712	Ga0157370_100127126	229
385	3300013297	Ga0157378_10071250	Ga0157378_100712502	229
386	3300013297	Ga0157378_10132490	Ga0157378_101324903	229
387	3300013297	Ga0157378_10598963	Ga0157378_105989632	229
388	3300013297	Ga0157378_10918147	Ga0157378_109181472	229
389	3300013306	Ga0163162_10388975	Ga0163162_103889752	229
390	3300013308	Ga0157375_10912797	Ga0157375_109127971	229
391	3300014326	Ga0157380_10542872	Ga0157380_105428722	229
392	3300014969	Ga0157376_10945855	Ga0157376_109458551	229
393	3300015261	Ga0182006_1039094	Ga0182006_10390942	229
394	3300017792	Ga0163161_10000446	Ga0163161_1000044626	229
395	3300017792	Ga0163161_10028289	Ga0163161_100282894	229
396	3300017792	Ga0163161_10275315	Ga0163161_102753152	229
397	3300021384	Ga0213876_10110878	Ga0213876_101108782	229
398	3300021388	Ga0213875_10085621	Ga0213875_100856212	229
399	3300025208	Ga0209436_105359	Ga0209436_1053593	229
400	3300025245	Ga0207425_1002709	Ga0207425_10027096	229
401	3300025253	Ga0209677_102734	Ga0209677_1027345	229
402	3300025254	Ga0209148_1000334	Ga0209148_100033444	229
403	3300025258	Ga0209129_1004239	Ga0209129_10042392	229
404	3300025261	Ga0209233_1001804	Ga0209233_10018045	229
405	3300025261	Ga0209233_1008944	Ga0209233_10089443	229
406	3300025263	Ga0209565_1001371	Ga0209565_10013717	229
407	3300025272	Ga0209455_1004147	Ga0209455_10041473	229
408	3300025273	Ga0209673_1002874	Ga0209673_10028747	229
409	3300025284	Ga0209130_1000141	Ga0209130_100014155	229
410	3300025291	Ga0209675_1005201	Ga0209675_10052012	229
411	3300025292	Ga0209676_1000432	Ga0209676_100043252	229
412	3300025292	Ga0209676_1001071	Ga0209676_100107126	229
413	3300025294	Ga0209025_1000294	Ga0209025_100029459	229
414	3300025294	Ga0209025_1004609	Ga0209025_10046096	229
415	3300025295	Ga0209564_1024100	Ga0209564_10241002	229
416	3300025295	Ga0209564_1030148	Ga0209564_10301482	229
417	3300025297	Ga0209758_1000249	Ga0209758_100024922	229
418	3300025297	Ga0209758_1001476	Ga0209758_100147619	229
419	3300025297	Ga0209758_1004383	Ga0209758_10043836	229
420	3300025297	Ga0209758_1011353	Ga0209758_10113532	229
421	3300025298	Ga0209050_1000015	Ga0209050_1000015689	229
422	3300025298	Ga0209050_1004667	Ga0209050_10046676	229
423	3300025299	Ga0209256_1042224	Ga0209256_10422242	229
424	3300025302	Ga0207426_1000145	Ga0207426_100014552	229
425	3300025302	Ga0207426_1000942	Ga0207426_100094225	229
426	3300025303	Ga0209051_1000081	Ga0209051_100008133	229
427	3300025303	Ga0209051_1000622	Ga0209051_100062223	229
428	3300025304	Ga0209257_1003557	Ga0209257_10035572	229
429	3300025304	Ga0209257_1008029	Ga0209257_10080292	229
430	3300025304	Ga0209257_1024427	Ga0209257_10244272	229
431	3300025321	Ga0207656_10002219	Ga0207656_100022192	229
432	3300025321	Ga0207656_10134803	Ga0207656_101348031	229
433	3300025893	Ga0207682_10013101	Ga0207682_100131013	229
434	3300025898	Ga0207692_10057994	Ga0207692_100579942	229
435	3300025900	Ga0207710_10000418	Ga0207710_1000041817	229
436	3300025901	Ga0207688_10163985	Ga0207688_101639852	229
437	3300025905	Ga0207685_10119631	Ga0207685_101196312	229
438	3300025906	Ga0207699_10022976	Ga0207699_100229762	229
439	3300025906	Ga0207699_10038622	Ga0207699_100386222	229
440	3300025906	Ga0207699_10267994	Ga0207699_102679941	229
441	3300025907	Ga0207645_10190666	Ga0207645_101906662	229
442	3300025909	Ga0207705_10572300	Ga0207705_105723001	229
443	3300025910	Ga0207684_10028736	Ga0207684_100287366	229
444	3300025910	Ga0207684_10089458	Ga0207684_100894582	229
445	3300025910	Ga0207684_10177822	Ga0207684_101778222	229
446	3300025913	Ga0207695_10000062	Ga0207695_100000626	229
447	3300025913	Ga0207695_10000635	Ga0207695_1000063548	229
448	3300025913	Ga0207695_10400196	Ga0207695_104001962	229
449	3300025914	Ga0207671_10009825	Ga0207671_100098256	229
450	3300025914	Ga0207671_10038038	Ga0207671_100380381	229
451	3300025915	Ga0207693_10019913	Ga0207693_100199134	229
452	3300025915	Ga0207693_10043663	Ga0207693_100436635	229
453	3300025916	Ga0207663_10015201	Ga0207663_100152014	229
454	3300025922	Ga0207646_10002497	Ga0207646_1000249714	229
455	3300025923	Ga0207681_10072121	Ga0207681_100721212	229
456	3300025923	Ga0207681_10076479	Ga0207681_100764793	229
457	3300025924	Ga0207694_10017263	Ga0207694_100172634	229
458	3300025925	Ga0207650_10774650	Ga0207650_107746501	229
459	3300025926	Ga0207659_10128879	Ga0207659_101288792	229
460	3300025927	Ga0207687_10496494	Ga0207687_104964942	229
461	3300025927	Ga0207687_10508832	Ga0207687_105088321	229
462	3300025928	Ga0207700_10014831	Ga0207700_100148313	229
463	3300025928	Ga0207700_10017552	Ga0207700_100175524	229
464	3300025928	Ga0207700_10154742	Ga0207700_101547422	229
465	3300025928	Ga0207700_10256390	Ga0207700_102563902	229
466	3300025929	Ga0207664_10449439	Ga0207664_104494392	229
467	3300025933	Ga0207706_10057225	Ga0207706_100572253	229
468	3300025933	Ga0207706_10508681	Ga0207706_105086812	229
469	3300025935	Ga0207709_10000234	Ga0207709_1000023442	229
470	3300025935	Ga0207709_10359196	Ga0207709_103591962	229
471	3300025939	Ga0207665_10133713	Ga0207665_101337131	229
472	3300025940	Ga0207691_10001208	Ga0207691_100012082	229
473	3300025940	Ga0207691_10169528	Ga0207691_101695282	229
474	3300025940	Ga0207691_10229063	Ga0207691_102290632	229
475	3300025941	Ga0207711_10045791	Ga0207711_100457914	229
476	3300025941	Ga0207711_10077163	Ga0207711_100771633	229
477	3300025942	Ga0207689_10057386	Ga0207689_100573863	229
478	3300025945	Ga0207679_10668827	Ga0207679_106688271	229
479	3300025949	Ga0207667_10001145	Ga0207667_1000114521	229
480	3300025949	Ga0207667_10368925	Ga0207667_103689252	229
481	3300025960	Ga0207651_10097753	Ga0207651_100977532	229
482	3300025961	Ga0207712_10171241	Ga0207712_101712412	229
483	3300025972	Ga0207668_10041674	Ga0207668_100416742	229
484	3300025972	Ga0207668_10099407	Ga0207668_100994073	229
485	3300025972	Ga0207668_10452090	Ga0207668_104520901	229
486	3300025972	Ga0207668_10650335	Ga0207668_106503351	229
487	3300025981	Ga0207640_10441851	Ga0207640_104418512	229
488	3300026023	Ga0207677_10178141	Ga0207677_101781412	229
489	3300026041	Ga0207639_10121594	Ga0207639_101215943	229
490	3300026041	Ga0207639_10320293	Ga0207639_103202932	229
491	3300026067	Ga0207678_10029063	Ga0207678_100290632	229
492	3300026067	Ga0207678_10097478	Ga0207678_100974783	229
493	3300026067	Ga0207678_10136110	Ga0207678_101361103	229
494	3300026067	Ga0207678_10467319	Ga0207678_104673192	229
495	3300026078	Ga0207702_10174470	Ga0207702_101744702	229
496	3300026078	Ga0207702_10260285	Ga0207702_102602852	229
497	3300026078	Ga0207702_10548536	Ga0207702_105485362	229
498	3300026088	Ga0207641_10843073	Ga0207641_108430731	229
499	3300026095	Ga0207676_10442556	Ga0207676_104425562	229
500	3300026116	Ga0207674_10067179	Ga0207674_100671795	229
501	3300026116	Ga0207674_10401043	Ga0207674_104010431	229
502	3300026121	Ga0207683_10488150	Ga0207683_104881502	229
503	3300026121	Ga0207683_10556851	Ga0207683_105568511	229
504	3300027296	Ga0209389_1000064	Ga0209389_100006416	229
505	3300027312	Ga0209371_1033240	Ga0209371_10332402	229
506	3300027357	Ga0209589_1000001	Ga0209589_1000001429	229
507	3300027361	Ga0209489_100001	Ga0209489_100001429	229
508	3300027361	Ga0209489_104185	Ga0209489_1041857	229
509	3300027363	Ga0209700_100001	Ga0209700_100001429	229
510	3300027363	Ga0209700_100014	Ga0209700_100014141	229
511	3300027512	Ga0209179_1082758	Ga0209179_10827581	229
512	3300027907	Ga0207428_10078804	Ga0207428_100788042	229
513	3300028379	Ga0268266_10002834	Ga0268266_100028344	229
514	3300028379	Ga0268266_10065384	Ga0268266_100653842	229
515	3300028379	Ga0268266_10457369	Ga0268266_104573692	229
516	3300028380	Ga0268265_10028815	Ga0268265_100288151	229
517	3300028380	Ga0268265_10676695	Ga0268265_106766951	229
518	3300028381	Ga0268264_10000427	Ga0268264_1000042718	229
519	3300028556	Ga0265337_1008184	Ga0265337_10081845	229
520	3300028794	Ga0307515_10000109	Ga0307515_10000109191	229
521	3300030500	Ga0268256_1044003	Ga0268256_10440032	229
522	3300030522	Ga0307512_10097214	Ga0307512_100972142	229
523	3300030522	Ga0307512_10228006	Ga0307512_102280062	229
524	3300031235	Ga0265330_10052677	Ga0265330_100526772	229
525	3300031238	Ga0265332_10072186	Ga0265332_100721862	229
526	3300031240	Ga0265320_10018243	Ga0265320_100182435	229
527	3300031247	Ga0265340_10026474	Ga0265340_100264743	229
528	3300031344	Ga0265316_10132291	Ga0265316_101322912	229
529	3300031344	Ga0265316_10155884	Ga0265316_101558842	229
530	3300031456	Ga0307513_10000015	Ga0307513_10000015218	229
531	3300031456	Ga0307513_10045412	Ga0307513_100454125	229
532	3300031456	Ga0307513_10055215	Ga0307513_100552155	229
533	3300031456	Ga0307513_10098953	Ga0307513_100989534	229
534	3300031456	Ga0307513_10128857	Ga0307513_101288572	229
535	3300031456	Ga0307513_10148613	Ga0307513_101486132	229
536	3300031507	Ga0307509_10491567	Ga0307509_104915672	229
537	3300031507	Ga0307509_10521620	Ga0307509_105216201	229
538	3300031548	Ga0307408_100042038	Ga0307408_1000420382	229
539	3300031548	Ga0307408_100214957	Ga0307408_1002149572	229
540	3300031548	Ga0307408_100879520	Ga0307408_1008795201	229
541	3300031616	Ga0307508_10000246	Ga0307508_1000024629	229
542	3300031616	Ga0307508_10006278	Ga0307508_100062784	229
543	3300031616	Ga0307508_10009734	Ga0307508_100097348	229
544	3300031616	Ga0307508_10018036	Ga0307508_100180364	229
545	3300031616	Ga0307508_10143179	Ga0307508_101431792	229
546	3300031649	Ga0307514_10020362	Ga0307514_100203622	229
547	3300031712	Ga0265342_10088475	Ga0265342_100884751	229
548	3300031730	Ga0307516_10006708	Ga0307516_100067089	229
549	3300031730	Ga0307516_10123935	Ga0307516_101239353	229
550	3300031731	Ga0307405_10077124	Ga0307405_100771243	229
551	3300031731	Ga0307405_10092740	Ga0307405_100927402	229
552	3300031824	Ga0307413_10154788	Ga0307413_101547882	229
553	3300031824	Ga0307413_10538529	Ga0307413_105385291	229
554	3300031995	Ga0307409_100383772	Ga0307409_1003837722	229
555	3300032002	Ga0307416_100023421	Ga0307416_1000234213	229
556	3300032002	Ga0307416_100873102	Ga0307416_1008731021	229
557	3300032004	Ga0307414_10612364	Ga0307414_106123641	229
558	3300032005	Ga0307411_10453620	Ga0307411_104536201	229
559	3300032005	Ga0307411_10462305	Ga0307411_104623052	229
560	3300033179	Ga0307507_10043771	Ga0307507_100437714	229
561	3300033179	Ga0307507_10236786	Ga0307507_102367861	229
562	3300033180	Ga0307510_10007100	Ga0307510_100071001	229
563	3300033180	Ga0307510_10020152	Ga0307510_100201525	229
564	3300033180	Ga0307510_10059830	Ga0307510_100598302	229
565	3300033180	Ga0307510_10217439	Ga0307510_102174391	229
566	3300033442	Ga0315911_1000002	Ga0315911_1000002497	229
567	3300033528	Ga0316588_1049097	Ga0316588_10490971	229
568	3300035086	Ga0373934_0051717	Ga0373934_0051717_272_961	229
569	3300035089	Ga0373944_0028431	Ga0373944_0028431_941_1630	229
570	3300035111	Ga0373923_0049895	Ga0373923_0049895_272_961	229
571	3300035170	Ga0373943_0022548	Ga0373943_0022548_740_1429	229
572	3300035410	Ga0373924_0089893	Ga0373924_0089893_234_923	229
573	3300035724	Ga0373933_0000164	Ga0373933_0000164_9363_10052	229
574	3300036401	Ga0373937_0261117	Ga0373937_0261117_166_855	229
575	3300037068	Ga0373925_0038084	Ga0373925_0038084_2312_3001	229
576	3300037466	Ga0395898_0237261	Ga0395898_0237261_962_1651	229
577	3300037471	Ga0395905_0015214	Ga0395905_0015214_2099_2788	229
578	3300037853	Ga0436364_0166031	Ga0436364_0166031_79_768	229
579	3300037853	Ga0436364_0176246	Ga0436364_0176246_277_966	229
580	3300038443	Ga0395901_0320216	Ga0395901_0320216_335_1024	229
581	3300038726	Ga0400490_59588	Ga0400490_59588_9410_10099	229
582	3300039062	Ga0400483_037459	Ga0400483_037459_1125_1814	229
583	3300039062	Ga0400483_079217	Ga0400483_079217_45970_46659	229
584	3300039062	Ga0400483_092352	Ga0400483_092352_59504_60193	229
585	3300039062	Ga0400483_222230	Ga0400483_222230_1763_2452	229
586	3300039062	Ga0400483_222800	Ga0400483_222800_136496_137185	229
587	3300039437	Ga0436365_0022917	Ga0436365_0022917_199_888	229
588	3300039437	Ga0436365_0694465	Ga0436365_0694465_650_1339	229
589	3300041404	Ga0439436_0001353	Ga0439436_0001353_5448_6137	229
590	3300041405	Ga0439438_024843	Ga0439438_024843_618_1307	229
591	3300041406	Ga0439439_0002684	Ga0439439_0002684_1722_2411	229
592	3300041410	Ga0439461_0023308	Ga0439461_0023308_270_959	229
593	3300041443	Ga0451789_0190617	Ga0451789_0190617_16_705	229
594	3300041453	Ga0451797_1494679	Ga0451797_1494679_21_812	229
595	3300041486	Ga0451807_0885740	Ga0451807_0885740_3095_3784	229
596	3300041486	Ga0451807_2272697	Ga0451807_2272697_176_865	229
597	3300041999	Ga0439433_0022342	Ga0439433_0022342_323_1012	229
598	3300042006	Ga0439432_004573	Ga0439432_004573_2542_3261	229
599	3300042007	Ga0439449_0004052	Ga0439449_0004052_2189_2878	229
600	3300042010	Ga0439452_001303	Ga0439452_001303_5277_5966	229
601	3300042014	Ga0439457_014966	Ga0439457_014966_204_893	229
602	3300042128	Ga0450897_003577	Ga0450897_003577_236_925	229
603	3300042133	Ga0450896_025860	Ga0450896_025860_114_803	229
604	3300042147	Ga0450910_003635	Ga0450910_003635_1233_1922	229
605	3300042185	Ga0450909_016170	Ga0450909_016170_114_803	229
606	3300042876	Ga0451577_0017106	Ga0451577_0017106_2363_3061	229
607	3300042876	Ga0451577_0024143	Ga0451577_0024143_4571_5272	229
608	3300044656	Ga0466969_0152366	Ga0466969_0152366_325_1014	229
609	3300044673	Ga0453683_0163556	Ga0453683_0163556_326_1027	229
610	3300044683	Ga0466965_0206433	Ga0466965_0206433_236_925	229
611	3300044693	Ga0466961_0353826	Ga0466961_0353826_38_727	229
612	3300044694	Ga0466963_0145419	Ga0466963_0145419_857_1546	229
613	3300044706	Ga0466964_0225110	Ga0466964_0225110_113_802	229
614	3300044712	Ga0453684_0138384	Ga0453684_0138384_1178_1876	229
615	3300044842	Ga0466957_0164597	Ga0466957_0164597_592_1281	229
616	3300045051	Ga0451576_0130666	Ga0451576_0130666_254_955	229
617	3300045976	Ga0466967_0822628	Ga0466967_0822628_53_742	229
618	3300046452	Ga0495617_114028	Ga0495617_114028_120_809	229
619	3300046453	Ga0495627_021305	Ga0495627_021305_1449_2138	229
620	3300046454	Ga0495592_0022519	Ga0495592_0022519_217_906	229
621	3300046455	Ga0495603_0047679	Ga0495603_0047679_352_1041	229
622	3300046457	Ga0495590_0049205	Ga0495590_0049205_614_1303	229
623	3300046458	Ga0495591_000353	Ga0495591_000353_23682_24371	229
624	3300046458	Ga0495591_004510	Ga0495591_004510_6079_6768	229
625	3300046460	Ga0495638_0018358	Ga0495638_0018358_3876_4565	229
626	3300046460	Ga0495638_0094282	Ga0495638_0094282_1031_1720	229
627	3300046460	Ga0495638_0240898	Ga0495638_0240898_127_816	229
628	3300046461	Ga0495641_0067953	Ga0495641_0067953_199_888	229
629	3300046472	Ga0495580_0056114	Ga0495580_0056114_957_1646	229
630	3300046473	Ga0495582_0086227	Ga0495582_0086227_460_1149	229
631	3300046473	Ga0495582_0235766	Ga0495582_0235766_173_862	229
632	3300046474	Ga0495605_0000436	Ga0495605_0000436_21604_22293	229
633	3300046474	Ga0495605_0001028	Ga0495605_0001028_14285_14974	229
634	3300046475	Ga0495639_0118631	Ga0495639_0118631_547_1236	229
635	3300046477	Ga0495664_0003029	Ga0495664_0003029_1283_1972	229
636	3300046491	Ga0495584_0216591	Ga0495584_0216591_185_874	229
637	3300046492	Ga0495585_0119051	Ga0495585_0119051_115_804	229
638	3300046499	Ga0495594_0005421	Ga0495594_0005421_4505_5194	229
639	3300046499	Ga0495594_0186964	Ga0495594_0186964_284_973	229
640	3300046499	Ga0495594_0232494	Ga0495594_0232494_212_901	229
641	3300046501	Ga0495607_0009324	Ga0495607_0009324_1315_2004	229
642	3300046501	Ga0495607_0075075	Ga0495607_0075075_1151_1840	229
643	3300046506	Ga0495583_0000028	Ga0495583_0000028_240539_241228	229
644	3300046507	Ga0495606_0127987	Ga0495606_0127987_88_777	229
645	3300046507	Ga0495606_0198783	Ga0495606_0198783_14_703	229
646	3300046507	Ga0495606_0275738	Ga0495606_0275738_149_838	229
647	3300046512	Ga0495610_0017908	Ga0495610_0017908_605_1294	229
648	3300046512	Ga0495610_0090366	Ga0495610_0090366_527_1216	229
649	3300046513	Ga0495616_0198743	Ga0495616_0198743_14_703	229
650	3300046513	Ga0495616_0202819	Ga0495616_0202819_57_746	229
651	3300046514	Ga0495618_0035740	Ga0495618_0035740_224_913	229
652	3300046515	Ga0495620_0000028	Ga0495620_0000028_108036_108725	229
653	3300046515	Ga0495620_0046712	Ga0495620_0046712_122_811	229
654	3300046515	Ga0495620_0111270	Ga0495620_0111270_232_921	229
655	3300046516	Ga0495628_0088858	Ga0495628_0088858_253_942	229
656	3300046517	Ga0495630_0081340	Ga0495630_0081340_302_991	229
657	3300046518	Ga0495631_0019696	Ga0495631_0019696_1109_1798	229
658	3300046518	Ga0495631_0143208	Ga0495631_0143208_178_867	229
659	3300046518	Ga0495631_0176428	Ga0495631_0176428_16_705	229
660	3300046519	Ga0495632_0075399	Ga0495632_0075399_232_921	229
661	3300046520	Ga0495637_0058026	Ga0495637_0058026_40_729	229
662	3300046520	Ga0495637_0087414	Ga0495637_0087414_60_749	229
663	3300046522	Ga0495643_0000057	Ga0495643_0000057_33456_34145	229
664	3300046522	Ga0495643_0007531	Ga0495643_0007531_2797_3489	229
665	3300046522	Ga0495643_0148394	Ga0495643_0148394_321_1010	229
666	3300046523	Ga0495644_0134473	Ga0495644_0134473_89_778	229
667	3300046524	Ga0495648_0018358	Ga0495648_0018358_3954_4643	229
668	3300046524	Ga0495648_0105183	Ga0495648_0105183_87_776	229
669	3300046524	Ga0495648_0229435	Ga0495648_0229435_68_757	229
670	3300046529	Ga0495652_0121872	Ga0495652_0121872_429_1118	229
671	3300046529	Ga0495652_0203451	Ga0495652_0203451_733_1422	229
672	3300046530	Ga0495654_0001115	Ga0495654_0001115_9557_10246	229
673	3300046530	Ga0495654_0066737	Ga0495654_0066737_721_1410	229
674	3300046530	Ga0495654_0073586	Ga0495654_0073586_168_857	229
675	3300046530	Ga0495654_0152662	Ga0495654_0152662_209_898	229
676	3300046531	Ga0495665_0097196	Ga0495665_0097196_396_1085	229
677	3300046533	Ga0495640_0083808	Ga0495640_0083808_643_1332	229
678	3300046535	Ga0495586_0163432	Ga0495586_0163432_353_1042	229
679	3300046537	Ga0495598_0089915	Ga0495598_0089915_69_758	229
680	3300046538	Ga0495609_0000081	Ga0495609_0000081_14712_15401	229
681	3300046539	Ga0495621_0132401	Ga0495621_0132401_240_929	229
682	3300046542	Ga0495597_0000037	Ga0495597_0000037_26689_27378	229
683	3300046542	Ga0495597_0026112	Ga0495597_0026112_1741_2430	229
684	3300046557	Ga0495622_0086965	Ga0495622_0086965_342_1031	229
685	3300046557	Ga0495622_0167545	Ga0495622_0167545_134_823	229
686	3300046558	Ga0495633_0000028	Ga0495633_0000028_14428_15117	229
687	3300046615	Ga0495656_0141514	Ga0495656_0141514_22_711	229
688	3300046616	Ga0495668_0074227	Ga0495668_0074227_1007_1696	229
689	3300046616	Ga0495668_0265863	Ga0495668_0265863_217_906	229
690	3300046616	Ga0495668_0317735	Ga0495668_0317735_71_760	229
691	3300046648	Ga0495611_0008756	Ga0495611_0008756_75_764	229
692	3300046648	Ga0495611_0111947	Ga0495611_0111947_59_748	229
693	3300046660	Ga0495625_0130041	Ga0495625_0130041_635_1324	229
694	3300046660	Ga0495625_0178502	Ga0495625_0178502_43_732	229
695	3300046665	Ga0495661_0000217	Ga0495661_0000217_51360_52049	229
696	3300046665	Ga0495661_0010263	Ga0495661_0010263_3934_4623	229
697	3300046665	Ga0495661_0142128	Ga0495661_0142128_245_934	229
698	3300046674	Ga0495588_0259671	Ga0495588_0259671_193_882	229
699	3300046674	Ga0495588_0279796	Ga0495588_0279796_77_766	229
700	3300046681	Ga0495647_0021985	Ga0495647_0021985_1450_2139	229
701	3300046690	Ga0495624_0108077	Ga0495624_0108077_232_921	229
702	3300046691	Ga0495670_0001463	Ga0495670_0001463_7089_7778	229
703	3300046692	Ga0495671_0006278	Ga0495671_0006278_5698_6387	229
704	3300046692	Ga0495671_0033794	Ga0495671_0033794_182_871	229
705	3300046692	Ga0495671_0276521	Ga0495671_0276521_22_711	229
706	3300046694	Ga0495649_0316663	Ga0495649_0316663_81_770	229
707	3300046794	Ga0495589_0010125	Ga0495589_0010125_3723_4412	229
708	3300046810	Ga0495660_0000568	Ga0495660_0000568_3688_4377	229
709	3300046810	Ga0495660_0003536	Ga0495660_0003536_323_1012	229
710	3300046810	Ga0495660_0015689	Ga0495660_0015689_2204_2893	229
711	3300046810	Ga0495660_0203201	Ga0495660_0203201_142_831	229
712	3300047317	Ga0495604_0172449	Ga0495604_0172449_689_1378	229
713	3300047319	Ga0495674_0037149	Ga0495674_0037149_3271_3960	229
714	3300047320	Ga0495672_0072361	Ga0495672_0072361_1185_1874	229
715	3300047320	Ga0495672_0101109	Ga0495672_0101109_79_768	229
716	3300047320	Ga0495672_0244747	Ga0495672_0244747_61_750	229
717	3300047323	Ga0495683_0000060	Ga0495683_0000060_99795_100484	229
718	3300047323	Ga0495683_0112253	Ga0495683_0112253_524_1216	229
719	3300047323	Ga0495683_0222511	Ga0495683_0222511_69_758	229
720	3300047443	Ga0495687_049654	Ga0495687_049654_846_1538	229
721	3300047446	Ga0495679_000823	Ga0495679_000823_14557_15246	229
722	3300047470	Ga0495681_0024953	Ga0495681_0024953_31_720	229
723	3300047472	Ga0495686_0095860	Ga0495686_0095860_990_1700	229
724	3300047472	Ga0495686_0327534	Ga0495686_0327534_100_789	229
725	3300048088	Ga0495602_0225582	Ga0495602_0225582_615_1304	229
726	3300048905	Ga0496102_0190387	Ga0496102_0190387_265_954	229
727	3300048906	Ga0496103_0010374	Ga0496103_0010374_241_933	229
728	3300048907	Ga0496104_0201716	Ga0496104_0201716_940_1629	229
729	3300048909	Ga0496106_0000002	Ga0496106_0000002_189470_190159	229
730	3300048909	Ga0496106_0258759	Ga0496106_0258759_84_773	229
731	3300048910	Ga0496107_0028046	Ga0496107_0028046_205_897	229
732	3300048911	Ga0496108_0198145	Ga0496108_0198145_861_1553	229
733	3300048912	Ga0496109_0283565	Ga0496109_0283565_366_1058	229
734	3300048913	Ga0496110_0303802	Ga0496110_0303802_640_1329	229
735	3300048914	Ga0496111_0063380	Ga0496111_0063380_1861_2553	229
736	3300048915	Ga0496112_0019936	Ga0496112_0019936_1451_2140	229
737	3300048915	Ga0496112_0436698	Ga0496112_0436698_306_995	229
738	3300048916	Ga0496113_0270307	Ga0496113_0270307_29_721	229
739	3300048917	Ga0496114_0377032	Ga0496114_0377032_354_1043	229
740	3300048919	Ga0496116_0042778	Ga0496116_0042778_1636_2334	229
741	3300048919	Ga0496116_0066692	Ga0496116_0066692_178_867	229
742	3300048920	Ga0496117_0080858	Ga0496117_0080858_576_1298	229
743	3300048920	Ga0496117_0090460	Ga0496117_0090460_363_1052	229
744	3300048920	Ga0496117_0320977	Ga0496117_0320977_65_754	229
745	3300048921	Ga0496118_0074574	Ga0496118_0074574_334_1023	229
746	3300048921	Ga0496118_0075118	Ga0496118_0075118_624_1346	229
747	3300048921	Ga0496118_0164712	Ga0496118_0164712_81_770	229
748	3300048921	Ga0496118_0299639	Ga0496118_0299639_33_725	229
749	3300048921	Ga0496118_0331017	Ga0496118_0331017_61_750	229
750	3300048922	Ga0496119_0170381	Ga0496119_0170381_309_1001	229
751	3300048923	Ga0496120_0133123	Ga0496120_0133123_527_1216	229
752	3300048924	Ga0496121_0002830	Ga0496121_0002830_24648_25337	229
753	3300048924	Ga0496121_0025670	Ga0496121_0025670_2853_3542	229
754	3300048924	Ga0496121_0027094	Ga0496121_0027094_2593_3282	229
755	3300048924	Ga0496121_0085899	Ga0496121_0085899_801_1490	229
756	3300048924	Ga0496121_0168730	Ga0496121_0168730_315_1004	229
757	3300048924	Ga0496121_0235102	Ga0496121_0235102_225_914	229
758	3300048924	Ga0496121_0238341	Ga0496121_0238341_500_1189	229
759	3300048924	Ga0496121_0289078	Ga0496121_0289078_200_889	229
760	3300048924	Ga0496121_0418563	Ga0496121_0418563_158_847	229
761	3300048924	Ga0496121_0433577	Ga0496121_0433577_25_717	229
762	3300048925	Ga0496122_0011516	Ga0496122_0011516_3981_4670	229
763	3300048925	Ga0496122_0033725	Ga0496122_0033725_2214_2903	229
764	3300048925	Ga0496122_0228024	Ga0496122_0228024_159_881	229
765	3300048926	Ga0496123_0000314	Ga0496123_0000314_2333_3070	229
766	3300048926	Ga0496123_0038366	Ga0496123_0038366_943_1632	229
767	3300048926	Ga0496123_0091378	Ga0496123_0091378_167_856	229
768	3300048927	Ga0496124_0272098	Ga0496124_0272098_203_892	229
769	3300048927	Ga0496124_0290361	Ga0496124_0290361_113_814	229
770	3300048927	Ga0496124_0386655	Ga0496124_0386655_203_892	229
771	3300048928	Ga0496125_0002440	Ga0496125_0002440_10634_11323	229
772	3300048928	Ga0496125_0051382	Ga0496125_0051382_2498_3220	229
773	3300048928	Ga0496125_0171134	Ga0496125_0171134_495_1184	229
774	3300048929	Ga0496126_0012386	Ga0496126_0012386_538_1227	229
775	3300048929	Ga0496126_0031229	Ga0496126_0031229_949_1638	229
776	3300048929	Ga0496126_0034574	Ga0496126_0034574_3599_4288	229
777	3300048929	Ga0496126_0189625	Ga0496126_0189625_146_835	229
778	3300048929	Ga0496126_0209436	Ga0496126_0209436_182_877	229
779	3300048929	Ga0496126_0367270	Ga0496126_0367270_337_1026	229
780	3300048929	Ga0496126_0375518	Ga0496126_0375518_117_806	229
781	3300048929	Ga0496126_0550610	Ga0496126_0550610_192_881	229
782	3300048929	Ga0496126_0625567	Ga0496126_0625567_14_703	229
783	3300049459	Ga0495678_000020	Ga0495678_000020_238666_239355	229
784	3300049568	Ga0501031_0061738	Ga0501031_0061738_732_1454	229
785	3300049570	Ga0501033_0466496	Ga0501033_0466496_176_865	229
786	3300049581	Ga0501047_0017499	Ga0501047_0017499_4560_5249	229
787	3300049583	Ga0501067_0104958	Ga0501067_0104958_241_930	229
788	3300049586	Ga0501070_0433096	Ga0501070_0433096_112_801	229
789	3300049742	Ga0501080_0008470	Ga0501080_0008470_1419_2108	229
790	3300049822	Ga0501035_0171787	Ga0501035_0171787_1025_1714	229
791	3300049823	Ga0501044_0031380	Ga0501044_0031380_1469_2158	229
792	3300049823	Ga0501044_0581210	Ga0501044_0581210_18_707	229
793	3300050489	nmdc:mga03683_24199_c1	nmdc:mga03683_24199_c1_342_1061	229
794	3300050489	nmdc:mga03683_246495_c1	nmdc:mga03683_246495_c1_98_787	229
795	3300050489	nmdc:mga03683_26419_c1	nmdc:mga03683_26419_c1_1046_1735	229
796	3300050489	nmdc:mga03683_36720_c1	nmdc:mga03683_36720_c1_439_1128	229
797	3300050490	nmdc:mga03n38_12752_c1	nmdc:mga03n38_12752_c1_324_1013	229
798	3300050490	nmdc:mga03n38_144255_c1	nmdc:mga03n38_144255_c1_210_899	229
799	3300050490	nmdc:mga03n38_34390_c1	nmdc:mga03n38_34390_c1_755_1444	229
800	3300050490	nmdc:mga03n38_72711_c1	nmdc:mga03n38_72711_c1_466_1155	229
801	3300050491	nmdc:mga00v17_153444_c1	nmdc:mga00v17_153444_c1_623_1312	229
802	3300050491	nmdc:mga00v17_43195_c1	nmdc:mga00v17_43195_c1_111_800	229
803	3300050491	nmdc:mga00v17_65780_c1	nmdc:mga00v17_65780_c1_376_1068	229
804	3300050491	nmdc:mga00v17_84082_c1	nmdc:mga00v17_84082_c1_735_1424	229
805	3300050492	nmdc:mga0yw44_197834_c1	nmdc:mga0yw44_197834_c1_534_1289	229
806	3300050492	nmdc:mga0yw44_201313_c1	nmdc:mga0yw44_201313_c1_495_1184	229
807	3300050493	nmdc:mga0k408_125833_c1	nmdc:mga0k408_125833_c1_777_1469	229
808	3300050493	nmdc:mga0k408_218754_c1	nmdc:mga0k408_218754_c1_346_1035	229
809	3300050493	nmdc:mga0k408_233813_c1	nmdc:mga0k408_233813_c1_349_1038	229
810	3300050493	nmdc:mga0k408_73324_c1	nmdc:mga0k408_73324_c1_532_1221	229
811	3300050494	nmdc:mga06z11_33139_c1	nmdc:mga06z11_33139_c1_1169_1861	229
812	3300050494	nmdc:mga06z11_45724_c1	nmdc:mga06z11_45724_c1_569_1258	229
813	3300050494	nmdc:mga06z11_91252_c1	nmdc:mga06z11_91252_c1_230_919	229
814	3300050494	nmdc:mga06z11_91278_c1	nmdc:mga06z11_91278_c1_90_779	229
815	3300050496	nmdc:mga07m45_64277_c1	nmdc:mga07m45_64277_c1_895_1584	229
816	3300050507	nmdc:mga05p37_24646_c1	nmdc:mga05p37_24646_c1_6317_7030	229
817	3300050511	nmdc:mga08y16_684570_c1	nmdc:mga08y16_684570_c1_148_837	229
818	3300050512	nmdc:mga0n895_332819_c1	nmdc:mga0n895_332819_c1_414_1115	229
819	3300050513	nmdc:mga0rr50_19965_c1	nmdc:mga0rr50_19965_c1_850_1563	229
820	3300050514	nmdc:mga08x19_191018_c1	nmdc:mga08x19_191018_c1_325_1020	229
821	3300050514	nmdc:mga08x19_273905_c1	nmdc:mga08x19_273905_c1_40_729	229
822	3300050515	nmdc:mga0a205_288615_c1	nmdc:mga0a205_288615_c1_340_1029	229
823	3300050516	nmdc:mga0sz30_121528_c1	nmdc:mga0sz30_121528_c1_126_815	229
824	3300050516	nmdc:mga0sz30_178204_c1	nmdc:mga0sz30_178204_c1_113_835	229
825	3300050516	nmdc:mga0sz30_30521_c1	nmdc:mga0sz30_30521_c1_724_1413	229
826	3300053083	Ga0495655_0038438	Ga0495655_0038438_347_1042	229
827	3300053083	Ga0495655_0049109	Ga0495655_0049109_25_714	229
828	3300053087	Ga0500643_001635	Ga0500643_001635_6186_6875	229
829	3300053088	Ga0500644_0003163	Ga0500644_0003163_108_797	229
830	3300053088	Ga0500644_0094479	Ga0500644_0094479_116_805	229
831	3300053089	Ga0500581_020365	Ga0500581_020365_140_829	229
832	3300053090	Ga0500646_0027161	Ga0500646_0027161_383_1072	229
833	3300053091	Ga0500647_0141254	Ga0500647_0141254_358_1047	229
834	3300053092	Ga0500583_0064544	Ga0500583_0064544_58_747	229
835	3300053093	Ga0500651_0115319	Ga0500651_0115319_155_844	229
836	3300053093	Ga0500651_0165488	Ga0500651_0165488_138_827	229
837	3300053094	Ga0500566_0041846	Ga0500566_0041846_397_1086	229
838	3300053094	Ga0500566_0067562	Ga0500566_0067562_443_1132	229
839	3300053094	Ga0500566_0188741	Ga0500566_0188741_51_740	229
840	3300053095	Ga0500640_048736	Ga0500640_048736_254_943	229
841	3300053096	Ga0500641_0036253	Ga0500641_0036253_225_914	229
842	3300053098	Ga0500650_0001279	Ga0500650_0001279_1317_2006	229
843	3300053104	Ga0500556_0000015	Ga0500556_0000015_52313_53002	229
844	3300053105	Ga0500557_000822	Ga0500557_000822_816_1505	229
845	3300053109	Ga0500569_003618	Ga0500569_003618_1838_2527	229
846	3300053116	Ga0500592_020250	Ga0500592_020250_175_864	229
847	3300053117	Ga0500593_035827	Ga0500593_035827_173_862	229
848	3300053118	Ga0500594_0150818	Ga0500594_0150818_41_730	229
849	3300053119	Ga0500595_000002	Ga0500595_000002_467386_468075	229
850	3300053121	Ga0500607_051290	Ga0500607_051290_883_1572	229
851	3300053122	Ga0500608_001202	Ga0500608_001202_46_735	229
852	3300053123	Ga0500614_022890	Ga0500614_022890_140_829	229
853	3300053125	Ga0500618_044278	Ga0500618_044278_79_768	229
854	3300053130	Ga0500642_0000044	Ga0500642_0000044_51560_52249	229
855	3300053131	Ga0500652_000638	Ga0500652_000638_831_1520	229
856	3300053139	Ga0500568_0000661	Ga0500568_0000661_14729_15418	229
857	3300053145	Ga0500586_003197	Ga0500586_003197_2898_3587	229
858	3300053150	Ga0500603_007887	Ga0500603_007887_1079_1768	229
859	3300053151	Ga0500604_0005252	Ga0500604_0005252_2025_2714	229
860	3300053153	Ga0500616_0000001	Ga0500616_0000001_829926_830615	229
861	3300053153	Ga0500616_0000041	Ga0500616_0000041_177325_178014	229
862	3300053156	Ga0500622_0000700	Ga0500622_0000700_20062_20751	229
863	3300053158	Ga0500627_0184689	Ga0500627_0184689_91_780	229
864	3300053159	Ga0500630_056839	Ga0500630_056839_566_1255	229
865	3300053161	Ga0500634_0177705	Ga0500634_0177705_177_866	229
866	3300053163	Ga0500639_004098	Ga0500639_004098_6107_6796	229
867	3300053177	Ga0500636_0009242	Ga0500636_0009242_3839_4528	229
868	3300053177	Ga0500636_0015565	Ga0500636_0015565_3002_3691	229
869	3300053729	Ga0500625_096922	Ga0500625_096922_90_779	229
870	3300053730	Ga0500645_010186	Ga0500645_010186_185_874	229
871	3300060353	Ga0501082_0346876	Ga0501082_0346876_435_1124	229
872	iso_pu_bacteria	2528768022	2528851632	229
873	iso_pu_bacteria	2738543013	2739249202	229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

17

159

0.92 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1ji0-assembly1.cif.gz_A	crystal structure analysis of the abc transporter from thermotoga maritima	0.9336	2	229
1ji0-assembly1.cif.gz_A	crystal structure analysis of the abc transporter from thermotoga maritima	0.9258	2	229
2awo-assembly2.cif.gz_D	crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg)	0.9209	2	216
6z67-assembly3.cif.gz_E	ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution	0.9097	2	215
4tqu-assembly1.cif.gz_T	crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate	0.9096	2	216

ID	Description	Score	Start	End	Superfamily
af_P22731_1_237_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9394	1	228	3.40.50.300
af_P77257_8_237_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9345	2	227	3.40.50.300
af_P22731_1_237_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9315	1	228	3.40.50.300
af_P0AAI1_7_218_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9312	2	215	3.40.50.300
2awoD01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9205	2	213	3.40.50.300

ID	Description	Score	Start	End	GO Terms
AF-A0A7W5IBP4-F1-model_v4	deleted	0.9709	1	228
AF-A0A269XWW6-F1-model_v4	Urea ABC transporter ATP-binding subunit UrtE	0.9702	2	229	GO:0005524 GO:0015658 GO:0015807 GO:0016887
AF-A0A382XKN7-F1-model_v4	ABC transporter domain-containing protein	0.963	4	211	GO:0005524 GO:0015658 GO:0015807 GO:0016887
AF-A0A7W5IBP4-F1-model_v4	deleted	0.9626	1	228
AF-A0A269XWW6-F1-model_v4	Urea ABC transporter ATP-binding subunit UrtE	0.9618	2	229	GO:0005524 GO:0015658 GO:0015807 GO:0016887

Feature Viewer

pLDDT	pTM	Quality
93.59	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F484262

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00005

ABC_tran

ABC transporter

17

159

0.92

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map