F484267
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 873 | 310 | 1746 | 271 |
Family's Representative Sequence
| Representative Sequence | 3300048918|Ga0496115_0077793|Ga0496115_0077793_1041_1781 |
| Length | 246 |
| Sequence | MSERIFSLASLTVLELSPPQMVEVAARAGYSHVGLRLEPATPEEHHFAVIAGFEKILAVGAEFGASELLVAGNDSDEQRLTENFARLCDLAAPYGLHPHLEFMPWTDARNLQQAVRIVENARRENGAVLVDAFHFDRSASRLEDLARVAPSRLRYAQLCDVAGPRPTDMAEILRQARNERRFPGDGECDLAGLLRCLPSDIALSLEIPTVQLLEQGMSGLQRAQMALDKTRELLARLARDVFDFKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 13 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 19 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 20 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 21 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 22 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 23 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 24 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 25 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 26 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 27 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 28 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 29 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 30 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 31 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 32 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 33 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 43 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 51 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 52 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 53 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 54 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 56 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 62 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 81 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 82 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 84 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 86 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 87 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 88 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 89 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 90 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 91 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 92 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 93 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 94 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 95 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 96 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 97 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 98 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 99 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 100 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 101 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 102 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 103 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 104 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 105 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 106 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 107 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 108 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 109 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 110 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 111 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 112 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 113 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 192 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 193 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 194 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 195 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 196 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 197 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 198 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 199 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 200 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 201 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 202 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 203 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 204 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 205 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 206 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 207 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 214 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 215 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 216 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 217 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 218 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 219 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 221 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 222 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 223 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 224 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 225 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 226 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 227 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 228 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 229 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 230 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 231 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 232 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 233 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 234 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 235 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 236 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 237 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 238 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 239 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 240 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 241 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 242 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 243 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 244 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 245 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 246 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 247 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 248 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 249 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 250 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 251 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 252 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 253 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 254 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 255 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 256 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 257 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 258 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 259 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 260 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 261 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 262 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 263 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 264 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 265 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 266 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 267 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 268 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 269 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 270 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 271 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 272 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 273 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 274 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 275 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 276 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 277 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 278 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 279 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 280 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 281 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 282 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 283 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 284 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 285 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 286 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 287 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 288 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 289 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 290 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 291 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 292 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 293 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 294 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 295 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 296 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 297 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 298 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 299 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 300 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 301 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 302 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 303 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 304 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 305 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 306 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 307 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 308 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 309 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 310 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.26 |
| Metatranscriptomes | 0 |
| Isolates | 9.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.76 |
| Nodule | 1.72 |
| Rhizoplane | 3.78 |
| Rhizosphere | 77.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496115_0077793 | 3300048918 | Bacteria | 2698 |
| 2 | MRS2a_Contig_1751 | 2124908027 | Bacteria | 2428 |
| 3 | SwRhRL2b_contig_105308 | 2162886007 | Bacteria | 2375 |
| 4 | JGI25162J39368_1000136 | 3300002737 | Bacteria | 79587 |
| 5 | JGI25162J39368_1000155 | 3300002737 | Bacteria | 75225 |
| 6 | JGI25163J39215_1000507 | 3300002771 | Bacteria | 11511 |
| 7 | JGI25163J39215_1000670 | 3300002771 | Bacteria | 9187 |
| 8 | JGI25164J39214_1000121 | 3300002772 | Bacteria | 75225 |
| 9 | JGI25164J39214_1000258 | 3300002772 | Bacteria | 39842 |
| 10 | JGI25165J46597_1000222 | 3300003214 | Bacteria | 79609 |
| 11 | JGI25165J46597_1000240 | 3300003214 | Bacteria | 75225 |
| 12 | Ga0055536_1000059 | 3300003781 | Bacteria | 103307 |
| 13 | Ga0055530_10000096 | 3300003791 | Bacteria | 73950 |
| 14 | Ga0055530_10000898 | 3300003791 | Bacteria | 24479 |
| 15 | Ga0055540_1000084 | 3300003792 | Bacteria | 107482 |
| 16 | Ga0055540_1000650 | 3300003792 | Bacteria | 24393 |
| 17 | Ga0055531_10000266 | 3300003794 | Bacteria | 54559 |
| 18 | Ga0058692_1014283 | 3300003856 | Bacteria | 1824 |
| 19 | Ga0065714_10009327 | 3300005288 | Bacteria | 3379 |
| 20 | Ga0065714_10017536 | 3300005288 | Bacteria | 2019 |
| 21 | Ga0065714_10021149 | 3300005288 | Bacteria | 1620 |
| 22 | Ga0065714_10125523 | 3300005288 | Bacteria | 1300 |
| 23 | Ga0068869_100030387 | 3300005334 | Bacteria | 3792 |
| 24 | Ga0070674_100500037 | 3300005356 | Bacteria | 1012 |
| 25 | Ga0070659_100228593 | 3300005366 | Bacteria | 1537 |
| 26 | Ga0070665_100005810 | 3300005548 | Bacteria | 12655 |
| 27 | Ga0068857_100190118 | 3300005577 | Bacteria | 1870 |
| 28 | Ga0068854_100401334 | 3300005578 | Bacteria | 1134 |
| 29 | Ga0068852_100046773 | 3300005616 | Bacteria | 3688 |
| 30 | Ga0075368_10002639 | 3300006042 | Bacteria | 5893 |
| 31 | Ga0075364_10014525 | 3300006051 | Bacteria | 4868 |
| 32 | Ga0075364_10030360 | 3300006051 | Bacteria | 3468 |
| 33 | Ga0075364_10085184 | 3300006051 | Bacteria | 2093 |
| 34 | Ga0075432_10000232 | 3300006058 | Bacteria | 14893 |
| 35 | Ga0075362_10006013 | 3300006177 | Bacteria | 4492 |
| 36 | Ga0075362_10061595 | 3300006177 | Bacteria | 1698 |
| 37 | Ga0075362_10088168 | 3300006177 | Bacteria | 1437 |
| 38 | Ga0075367_10010373 | 3300006178 | Bacteria | 4894 |
| 39 | Ga0075369_10015597 | 3300006186 | Bacteria | 3053 |
| 40 | Ga0075366_10071302 | 3300006195 | Bacteria | 2070 |
| 41 | Ga0075370_10006145 | 3300006353 | Bacteria | 6024 |
| 42 | Ga0068865_100420039 | 3300006881 | Bacteria | 1099 |
| 43 | Ga0075436_100132420 | 3300006914 | Bacteria | 1749 |
| 44 | Ga0075436_100166259 | 3300006914 | Bacteria | 1556 |
| 45 | Ga0075436_100296306 | 3300006914 | Bacteria | 1158 |
| 46 | Ga0099823_1000027 | 3300006944 | Bacteria | 69973 |
| 47 | Ga0079104_1000116 | 3300006946 | Bacteria | 114868 |
| 48 | Ga0105251_10000214 | 3300009011 | Bacteria | 58941 |
| 49 | Ga0105251_10000972 | 3300009011 | Bacteria | 25444 |
| 50 | Ga0105251_10004871 | 3300009011 | Bacteria | 8958 |
| 51 | Ga0105251_10025484 | 3300009011 | Bacteria | 3025 |
| 52 | Ga0105251_10051051 | 3300009011 | Bacteria | 1974 |
| 53 | Ga0105251_10109055 | 3300009011 | Bacteria | 1262 |
| 54 | Ga0105251_10259741 | 3300009011 | Bacteria | 784 |
| 55 | Ga0105244_10012065 | 3300009036 | Bacteria | 5135 |
| 56 | Ga0105244_10016510 | 3300009036 | Bacteria | 4204 |
| 57 | Ga0105244_10034937 | 3300009036 | Bacteria | 2643 |
| 58 | Ga0105244_10040774 | 3300009036 | Bacteria | 2409 |
| 59 | Ga0105244_10054174 | 3300009036 | Bacteria | 2036 |
| 60 | Ga0105250_10000130 | 3300009092 | Bacteria | 65133 |
| 61 | Ga0105250_10001047 | 3300009092 | Bacteria | 15843 |
| 62 | Ga0105250_10005902 | 3300009092 | Bacteria | 5423 |
| 63 | Ga0105250_10016882 | 3300009092 | Bacteria | 2970 |
| 64 | Ga0105250_10024700 | 3300009092 | Bacteria | 2421 |
| 65 | Ga0105250_10043106 | 3300009092 | Bacteria | 1808 |
| 66 | Ga0105250_10130398 | 3300009092 | Bacteria | 1037 |
| 67 | Ga0105240_10082882 | 3300009093 | Bacteria | 3938 |
| 68 | Ga0105243_10000115 | 3300009148 | Bacteria | 92572 |
| 69 | Ga0105243_10000363 | 3300009148 | Bacteria | 48413 |
| 70 | Ga0105243_10008823 | 3300009148 | Bacteria | 7721 |
| 71 | Ga0105243_10062776 | 3300009148 | Bacteria | 2975 |
| 72 | Ga0105243_10116894 | 3300009148 | Bacteria | 2241 |
| 73 | Ga0105237_10015544 | 3300009545 | Bacteria | 7916 |
| 74 | Ga0105249_10144978 | 3300009553 | Bacteria | 2280 |
| 75 | Ga0105239_10008302 | 3300010375 | Bacteria | 11836 |
| 76 | Ga0105246_10006648 | 3300011119 | Bacteria | 7070 |
| 77 | Ga0105246_10064594 | 3300011119 | Bacteria | 2557 |
| 78 | Ga0157345_1000036 | 3300012498 | Bacteria | 32322 |
| 79 | Ga0157373_10001343 | 3300013100 | Bacteria | 18842 |
| 80 | Ga0157373_10010768 | 3300013100 | Bacteria | 6729 |
| 81 | Ga0157373_10014057 | 3300013100 | Bacteria | 5869 |
| 82 | Ga0157371_10000282 | 3300013102 | Bacteria | 68612 |
| 83 | Ga0157371_10066050 | 3300013102 | Bacteria | 2562 |
| 84 | Ga0157370_10060384 | 3300013104 | Bacteria | 3599 |
| 85 | Ga0157369_10003099 | 3300013105 | Bacteria | 19853 |
| 86 | Ga0163162_10002655 | 3300013306 | Bacteria | 16953 |
| 87 | Ga0157372_10000654 | 3300013307 | Bacteria | 38081 |
| 88 | Ga0157375_10102162 | 3300013308 | Bacteria | 2952 |
| 89 | Ga0157375_10804341 | 3300013308 | Bacteria | 1089 |
| 90 | Ga0182008_10000852 | 3300014497 | Bacteria | 21165 |
| 91 | Ga0182008_10002337 | 3300014497 | Bacteria | 11944 |
| 92 | Ga0182008_10004259 | 3300014497 | Bacteria | 8388 |
| 93 | Ga0182008_10012538 | 3300014497 | Bacteria | 4473 |
| 94 | Ga0182008_10040048 | 3300014497 | Bacteria | 2341 |
| 95 | Ga0182006_1000547 | 3300015261 | Bacteria | 28375 |
| 96 | Ga0182006_1018500 | 3300015261 | Bacteria | 2943 |
| 97 | Ga0182006_1067183 | 3300015261 | Bacteria | 1338 |
| 98 | Ga0182007_10000290 | 3300015262 | Bacteria | 32620 |
| 99 | Ga0182005_1000454 | 3300015265 | Bacteria | 21690 |
| 100 | Ga0182005_1000471 | 3300015265 | Bacteria | 20927 |
| 101 | Ga0182005_1004003 | 3300015265 | Bacteria | 4849 |
| 102 | Ga0163161_10002713 | 3300017792 | Bacteria | 12585 |
| 103 | Ga0163161_10008413 | 3300017792 | Bacteria | 7138 |
| 104 | Ga0163161_10051431 | 3300017792 | Bacteria | 2984 |
| 105 | Ga0163161_10152119 | 3300017792 | Bacteria | 1759 |
| 106 | Ga0213872_10063428 | 3300021361 | Bacteria | 1670 |
| 107 | Ga0209760_100102 | 3300025207 | Bacteria | 65474 |
| 108 | Ga0209760_100190 | 3300025207 | Bacteria | 30518 |
| 109 | Ga0209563_100197 | 3300025230 | Bacteria | 33048 |
| 110 | Ga0207427_100056 | 3300025231 | Bacteria | 204343 |
| 111 | Ga0207427_100063 | 3300025231 | Bacteria | 177711 |
| 112 | Ga0209437_100065 | 3300025233 | Bacteria | 332417 |
| 113 | Ga0209437_100133 | 3300025233 | Bacteria | 178493 |
| 114 | Ga0209233_1000085 | 3300025261 | Bacteria | 333078 |
| 115 | Ga0209233_1000133 | 3300025261 | Bacteria | 202716 |
| 116 | Ga0209675_1011284 | 3300025291 | Bacteria | 2974 |
| 117 | Ga0209676_1000076 | 3300025292 | Bacteria | 301393 |
| 118 | Ga0209676_1000313 | 3300025292 | Bacteria | 94925 |
| 119 | Ga0209676_1002349 | 3300025292 | Bacteria | 13678 |
| 120 | Ga0209050_1000063 | 3300025298 | Bacteria | 314955 |
| 121 | Ga0209050_1000106 | 3300025298 | Bacteria | 224396 |
| 122 | Ga0209051_1000045 | 3300025303 | Bacteria | 297882 |
| 123 | Ga0209051_1000139 | 3300025303 | Bacteria | 136281 |
| 124 | Ga0209257_1000539 | 3300025304 | Bacteria | 64964 |
| 125 | Ga0209257_1020769 | 3300025304 | Bacteria | 2412 |
| 126 | Ga0207696_1000018 | 3300025711 | Bacteria | 478605 |
| 127 | Ga0207696_1000047 | 3300025711 | Bacteria | 285005 |
| 128 | Ga0207696_1000255 | 3300025711 | Bacteria | 69740 |
| 129 | Ga0207696_1000797 | 3300025711 | Bacteria | 20496 |
| 130 | Ga0207696_1001669 | 3300025711 | Bacteria | 11597 |
| 131 | Ga0207696_1008741 | 3300025711 | Bacteria | 3838 |
| 132 | Ga0207655_1000027 | 3300025728 | Bacteria | 444552 |
| 133 | Ga0207655_1000039 | 3300025728 | Bacteria | 341249 |
| 134 | Ga0207655_1001095 | 3300025728 | Bacteria | 26574 |
| 135 | Ga0207655_1003266 | 3300025728 | Bacteria | 12167 |
| 136 | Ga0207655_1003395 | 3300025728 | Bacteria | 11893 |
| 137 | Ga0207655_1003706 | 3300025728 | Bacteria | 11255 |
| 138 | Ga0207655_1008194 | 3300025728 | Bacteria | 6667 |
| 139 | Ga0207655_1016822 | 3300025728 | Bacteria | 3977 |
| 140 | Ga0207655_1037112 | 3300025728 | Bacteria | 2150 |
| 141 | Ga0207655_1051174 | 3300025728 | Bacteria | 1672 |
| 142 | Ga0207655_1101778 | 3300025728 | Bacteria | 987 |
| 143 | Ga0207713_1000049 | 3300025735 | Bacteria | 227882 |
| 144 | Ga0207713_1000680 | 3300025735 | Bacteria | 31842 |
| 145 | Ga0207713_1003337 | 3300025735 | Bacteria | 11025 |
| 146 | Ga0207713_1005794 | 3300025735 | Bacteria | 7649 |
| 147 | Ga0207713_1007310 | 3300025735 | Bacteria | 6541 |
| 148 | Ga0207713_1012470 | 3300025735 | Bacteria | 4539 |
| 149 | Ga0207713_1028694 | 3300025735 | Bacteria | 2505 |
| 150 | Ga0207713_1031653 | 3300025735 | Bacteria | 2335 |
| 151 | Ga0207713_1051690 | 3300025735 | Bacteria | 1632 |
| 152 | Ga0207713_1054212 | 3300025735 | Bacteria | 1574 |
| 153 | Ga0207713_1065762 | 3300025735 | Bacteria | 1360 |
| 154 | Ga0207713_1076258 | 3300025735 | Bacteria | 1221 |
| 155 | Ga0207695_10118248 | 3300025913 | Bacteria | 2622 |
| 156 | Ga0207671_10018298 | 3300025914 | Bacteria | 5378 |
| 157 | Ga0207681_10007962 | 3300025923 | Bacteria | 6478 |
| 158 | Ga0207644_10011201 | 3300025931 | Bacteria | 5928 |
| 159 | Ga0207706_10053735 | 3300025933 | Bacteria | 3555 |
| 160 | Ga0207709_10000030 | 3300025935 | Bacteria | 331710 |
| 161 | Ga0207709_10000127 | 3300025935 | Bacteria | 112650 |
| 162 | Ga0207709_10017271 | 3300025935 | Bacteria | 4025 |
| 163 | Ga0207689_10083386 | 3300025942 | Bacteria | 2628 |
| 164 | Ga0207712_10028506 | 3300025961 | Bacteria | 3735 |
| 165 | Ga0207678_10696421 | 3300026067 | Bacteria | 894 |
| 166 | Ga0207674_10072794 | 3300026116 | Bacteria | 3451 |
| 167 | Ga0207698_10193959 | 3300026142 | Bacteria | 1812 |
| 168 | Ga0209281_1000070 | 3300027111 | Bacteria | 277098 |
| 169 | Ga0209389_1000118 | 3300027296 | Bacteria | 70923 |
| 170 | Ga0209371_1000368 | 3300027312 | Bacteria | 48559 |
| 171 | Ga0207428_10003112 | 3300027907 | Bacteria | 16302 |
| 172 | Ga0207428_10049659 | 3300027907 | Bacteria | 3360 |
| 173 | Ga0207428_10051963 | 3300027907 | Bacteria | 3275 |
| 174 | Ga0207428_10101707 | 3300027907 | Bacteria | 2220 |
| 175 | Ga0268266_10013293 | 3300028379 | Bacteria | 7095 |
| 176 | Ga0268266_10058989 | 3300028379 | Bacteria | 3306 |
| 177 | Ga0268256_1000313 | 3300030500 | Bacteria | 48562 |
| 178 | Ga0307516_10061532 | 3300031730 | Bacteria | 3642 |
| 179 | Ga0307510_10016569 | 3300033180 | Bacteria | 8701 |
| 180 | Ga0436361_0310261 | 3300039447 | Bacteria | 4779 |
| 181 | Ga0439436_0021433 | 3300041404 | Bacteria | 1920 |
| 182 | Ga0439438_003723 | 3300041405 | Bacteria | 6056 |
| 183 | Ga0439438_004040 | 3300041405 | Bacteria | 5764 |
| 184 | Ga0439438_005559 | 3300041405 | Bacteria | 4612 |
| 185 | Ga0439438_014195 | 3300041405 | Bacteria | 2377 |
| 186 | Ga0439447_000895 | 3300041407 | Bacteria | 10892 |
| 187 | Ga0439447_001873 | 3300041407 | Bacteria | 7693 |
| 188 | Ga0439447_004201 | 3300041407 | Bacteria | 4999 |
| 189 | Ga0439447_012666 | 3300041407 | Bacteria | 2415 |
| 190 | Ga0439466_0004797 | 3300041411 | Bacteria | 5197 |
| 191 | Ga0439466_0006688 | 3300041411 | Bacteria | 4374 |
| 192 | Ga0439466_0021442 | 3300041411 | Bacteria | 2288 |
| 193 | Ga0439466_0051433 | 3300041411 | Bacteria | 1349 |
| 194 | Ga0439432_007880 | 3300042006 | Bacteria | 3754 |
| 195 | Ga0439432_022580 | 3300042006 | Bacteria | 2078 |
| 196 | Ga0439452_000136 | 3300042010 | Bacteria | 55807 |
| 197 | Ga0439452_013071 | 3300042010 | Bacteria | 2340 |
| 198 | Ga0439452_024353 | 3300042010 | Bacteria | 1548 |
| 199 | Ga0439452_048243 | 3300042010 | Bacteria | 983 |
| 200 | Ga0439456_000013 | 3300042013 | Bacteria | 72544 |
| 201 | Ga0439456_000877 | 3300042013 | Bacteria | 6045 |
| 202 | Ga0439456_017538 | 3300042013 | Bacteria | 1501 |
| 203 | Ga0439463_000178 | 3300042016 | Bacteria | 16747 |
| 204 | Ga0450911_001222 | 3300042115 | Bacteria | 6232 |
| 205 | Ga0450911_002928 | 3300042115 | Bacteria | 3167 |
| 206 | Ga0450911_004864 | 3300042115 | Bacteria | 2149 |
| 207 | Ga0450919_001594 | 3300042121 | Bacteria | 2964 |
| 208 | Ga0450920_022723 | 3300042122 | Bacteria | 1215 |
| 209 | Ga0450922_000237 | 3300042124 | Bacteria | 5933 |
| 210 | Ga0450900_009647 | 3300042136 | Bacteria | 1226 |
| 211 | Ga0450902_000077 | 3300042137 | Bacteria | 9755 |
| 212 | Ga0450902_008772 | 3300042137 | Bacteria | 1583 |
| 213 | Ga0450903_000941 | 3300042138 | Bacteria | 5580 |
| 214 | Ga0450903_003183 | 3300042138 | Bacteria | 2859 |
| 215 | Ga0450903_004221 | 3300042138 | Bacteria | 2459 |
| 216 | Ga0450904_009078 | 3300042139 | Bacteria | 980 |
| 217 | Ga0450905_000204 | 3300042142 | Bacteria | 6765 |
| 218 | Ga0450905_000844 | 3300042142 | Bacteria | 3818 |
| 219 | Ga0450906_001422 | 3300042145 | Bacteria | 5212 |
| 220 | Ga0450907_001925 | 3300042146 | Bacteria | 4197 |
| 221 | Ga0450910_000932 | 3300042147 | Bacteria | 3544 |
| 222 | Ga0450908_002978 | 3300042184 | Bacteria | 3300 |
| 223 | Ga0450908_025936 | 3300042184 | Bacteria | 1023 |
| 224 | Ga0439464_0003868 | 3300042439 | Bacteria | 3807 |
| 225 | Ga0439460_0000687 | 3300042461 | Bacteria | 7495 |
| 226 | Ga0450893_0002358 | 3300042532 | Bacteria | 2936 |
| 227 | Ga0495617_001187 | 3300046452 | Bacteria | 11733 |
| 228 | Ga0495617_004986 | 3300046452 | Bacteria | 4772 |
| 229 | Ga0495617_010065 | 3300046452 | Bacteria | 3240 |
| 230 | Ga0495617_015530 | 3300046452 | Bacteria | 2579 |
| 231 | Ga0495617_016633 | 3300046452 | Bacteria | 2488 |
| 232 | Ga0495617_017155 | 3300046452 | Bacteria | 2444 |
| 233 | Ga0495617_017939 | 3300046452 | Bacteria | 2392 |
| 234 | Ga0495617_019450 | 3300046452 | Bacteria | 2296 |
| 235 | Ga0495617_023646 | 3300046452 | Bacteria | 2075 |
| 236 | Ga0495617_036749 | 3300046452 | Bacteria | 1641 |
| 237 | Ga0495617_077495 | 3300046452 | Bacteria | 1090 |
| 238 | Ga0495617_110502 | 3300046452 | Bacteria | 889 |
| 239 | Ga0495627_000221 | 3300046453 | Bacteria | 61299 |
| 240 | Ga0495627_000979 | 3300046453 | Bacteria | 19489 |
| 241 | Ga0495627_001645 | 3300046453 | Bacteria | 12411 |
| 242 | Ga0495627_001651 | 3300046453 | Bacteria | 12391 |
| 243 | Ga0495627_009676 | 3300046453 | Bacteria | 3538 |
| 244 | Ga0495627_009826 | 3300046453 | Bacteria | 3504 |
| 245 | Ga0495627_015577 | 3300046453 | Bacteria | 2622 |
| 246 | Ga0495627_017738 | 3300046453 | Bacteria | 2412 |
| 247 | Ga0495627_027365 | 3300046453 | Bacteria | 1830 |
| 248 | Ga0495603_0021559 | 3300046455 | Bacteria | 3902 |
| 249 | Ga0495603_0088774 | 3300046455 | Bacteria | 1809 |
| 250 | Ga0495603_0126988 | 3300046455 | Bacteria | 1486 |
| 251 | Ga0495590_0001731 | 3300046457 | Bacteria | 9272 |
| 252 | Ga0495590_0002333 | 3300046457 | Bacteria | 7889 |
| 253 | Ga0495590_0004779 | 3300046457 | Bacteria | 5428 |
| 254 | Ga0495590_0006417 | 3300046457 | Bacteria | 4590 |
| 255 | Ga0495590_0010734 | 3300046457 | Bacteria | 3433 |
| 256 | Ga0495590_0012103 | 3300046457 | Bacteria | 3209 |
| 257 | Ga0495590_0018520 | 3300046457 | Bacteria | 2492 |
| 258 | Ga0495591_000165 | 3300046458 | Bacteria | 70496 |
| 259 | Ga0495591_000425 | 3300046458 | Bacteria | 34847 |
| 260 | Ga0495591_000963 | 3300046458 | Bacteria | 19664 |
| 261 | Ga0495591_002134 | 3300046458 | Bacteria | 11359 |
| 262 | Ga0495591_003769 | 3300046458 | Bacteria | 7669 |
| 263 | Ga0495591_007040 | 3300046458 | Bacteria | 4850 |
| 264 | Ga0495591_008735 | 3300046458 | Bacteria | 4113 |
| 265 | Ga0495591_012361 | 3300046458 | Bacteria | 3182 |
| 266 | Ga0495591_015690 | 3300046458 | Bacteria | 2665 |
| 267 | Ga0495591_019585 | 3300046458 | Bacteria | 2259 |
| 268 | Ga0495591_025920 | 3300046458 | Bacteria | 1831 |
| 269 | Ga0495629_0156908 | 3300046459 | Unclassified | 1581 |
| 270 | Ga0495638_0001999 | 3300046460 | Bacteria | 17405 |
| 271 | Ga0495638_0006143 | 3300046460 | Bacteria | 8782 |
| 272 | Ga0495638_0007777 | 3300046460 | Bacteria | 7654 |
| 273 | Ga0495638_0012518 | 3300046460 | Bacteria | 5809 |
| 274 | Ga0495638_0013519 | 3300046460 | Bacteria | 5552 |
| 275 | Ga0495638_0018636 | 3300046460 | Bacteria | 4606 |
| 276 | Ga0495638_0020735 | 3300046460 | Bacteria | 4339 |
| 277 | Ga0495638_0026947 | 3300046460 | Bacteria | 3723 |
| 278 | Ga0495638_0028116 | 3300046460 | Bacteria | 3633 |
| 279 | Ga0495638_0042819 | 3300046460 | Bacteria | 2859 |
| 280 | Ga0495638_0107860 | 3300046460 | Bacteria | 1657 |
| 281 | Ga0495638_0125996 | 3300046460 | Bacteria | 1509 |
| 282 | Ga0495638_0167434 | 3300046460 | Bacteria | 1263 |
| 283 | Ga0495653_0000332 | 3300046463 | Bacteria | 38593 |
| 284 | Ga0495653_0065292 | 3300046463 | Bacteria | 2739 |
| 285 | Ga0495653_0207711 | 3300046463 | Bacteria | 1324 |
| 286 | Ga0495650_0004569 | 3300046471 | Bacteria | 9429 |
| 287 | Ga0495650_0005455 | 3300046471 | Bacteria | 8253 |
| 288 | Ga0495650_0005554 | 3300046471 | Bacteria | 8140 |
| 289 | Ga0495650_0009190 | 3300046471 | Bacteria | 5657 |
| 290 | Ga0495650_0024099 | 3300046471 | Bacteria | 2880 |
| 291 | Ga0495650_0097524 | 3300046471 | Bacteria | 1108 |
| 292 | Ga0495650_0124923 | 3300046471 | Bacteria | 944 |
| 293 | Ga0495580_0076122 | 3300046472 | Bacteria | 2341 |
| 294 | Ga0495605_0003954 | 3300046474 | Bacteria | 8764 |
| 295 | Ga0495605_0004591 | 3300046474 | Bacteria | 8084 |
| 296 | Ga0495605_0004632 | 3300046474 | Bacteria | 8041 |
| 297 | Ga0495605_0008941 | 3300046474 | Bacteria | 5646 |
| 298 | Ga0495605_0012826 | 3300046474 | Bacteria | 4638 |
| 299 | Ga0495605_0014831 | 3300046474 | Bacteria | 4252 |
| 300 | Ga0495605_0014851 | 3300046474 | Bacteria | 4250 |
| 301 | Ga0495605_0074587 | 3300046474 | Bacteria | 1596 |
| 302 | Ga0495605_0088901 | 3300046474 | Bacteria | 1434 |
| 303 | Ga0495639_0000041 | 3300046475 | Bacteria | 55786 |
| 304 | Ga0495584_0003663 | 3300046491 | Bacteria | 8376 |
| 305 | Ga0495584_0003833 | 3300046491 | Bacteria | 8175 |
| 306 | Ga0495584_0003989 | 3300046491 | Bacteria | 7964 |
| 307 | Ga0495584_0006961 | 3300046491 | Bacteria | 5906 |
| 308 | Ga0495584_0019313 | 3300046491 | Bacteria | 3461 |
| 309 | Ga0495584_0036690 | 3300046491 | Bacteria | 2476 |
| 310 | Ga0495584_0075149 | 3300046491 | Bacteria | 1699 |
| 311 | Ga0495584_0086196 | 3300046491 | Bacteria | 1582 |
| 312 | Ga0495585_0003124 | 3300046492 | Bacteria | 11357 |
| 313 | Ga0495585_0003212 | 3300046492 | Bacteria | 11153 |
| 314 | Ga0495585_0003541 | 3300046492 | Bacteria | 10495 |
| 315 | Ga0495585_0007318 | 3300046492 | Bacteria | 6770 |
| 316 | Ga0495585_0008585 | 3300046492 | Bacteria | 6186 |
| 317 | Ga0495585_0015529 | 3300046492 | Bacteria | 4426 |
| 318 | Ga0495585_0018523 | 3300046492 | Bacteria | 4015 |
| 319 | Ga0495585_0026336 | 3300046492 | Bacteria | 3321 |
| 320 | Ga0495585_0030683 | 3300046492 | Bacteria | 3056 |
| 321 | Ga0495585_0042623 | 3300046492 | Bacteria | 2541 |
| 322 | Ga0495594_0002044 | 3300046499 | Bacteria | 10509 |
| 323 | Ga0495594_0095054 | 3300046499 | Bacteria | 1673 |
| 324 | Ga0495596_0000109 | 3300046500 | Bacteria | 57203 |
| 325 | Ga0495596_0010464 | 3300046500 | Bacteria | 4037 |
| 326 | Ga0495596_0026593 | 3300046500 | Bacteria | 2330 |
| 327 | Ga0495607_0000589 | 3300046501 | Bacteria | 35402 |
| 328 | Ga0495607_0000661 | 3300046501 | Bacteria | 33467 |
| 329 | Ga0495607_0002507 | 3300046501 | Bacteria | 14881 |
| 330 | Ga0495607_0006167 | 3300046501 | Bacteria | 8475 |
| 331 | Ga0495607_0008621 | 3300046501 | Bacteria | 6954 |
| 332 | Ga0495607_0015178 | 3300046501 | Bacteria | 5000 |
| 333 | Ga0495607_0015559 | 3300046501 | Bacteria | 4928 |
| 334 | Ga0495607_0016072 | 3300046501 | Bacteria | 4835 |
| 335 | Ga0495607_0025428 | 3300046501 | Bacteria | 3682 |
| 336 | Ga0495607_0041654 | 3300046501 | Bacteria | 2726 |
| 337 | Ga0495607_0050513 | 3300046501 | Bacteria | 2420 |
| 338 | Ga0495607_0071685 | 3300046501 | Bacteria | 1931 |
| 339 | Ga0495583_0002989 | 3300046506 | Bacteria | 13549 |
| 340 | Ga0495583_0008224 | 3300046506 | Bacteria | 6398 |
| 341 | Ga0495583_0011611 | 3300046506 | Bacteria | 5047 |
| 342 | Ga0495583_0023147 | 3300046506 | Bacteria | 3149 |
| 343 | Ga0495606_0001537 | 3300046507 | Bacteria | 30458 |
| 344 | Ga0495606_0004243 | 3300046507 | Bacteria | 14498 |
| 345 | Ga0495606_0004992 | 3300046507 | Bacteria | 12939 |
| 346 | Ga0495606_0008945 | 3300046507 | Bacteria | 8573 |
| 347 | Ga0495606_0009534 | 3300046507 | Bacteria | 8197 |
| 348 | Ga0495606_0010315 | 3300046507 | Bacteria | 7770 |
| 349 | Ga0495606_0017207 | 3300046507 | Bacteria | 5475 |
| 350 | Ga0495606_0049007 | 3300046507 | Bacteria | 2774 |
| 351 | Ga0495610_0001921 | 3300046512 | Bacteria | 17926 |
| 352 | Ga0495610_0004276 | 3300046512 | Bacteria | 10625 |
| 353 | Ga0495610_0009096 | 3300046512 | Bacteria | 6328 |
| 354 | Ga0495610_0011477 | 3300046512 | Bacteria | 5416 |
| 355 | Ga0495610_0016930 | 3300046512 | Bacteria | 4174 |
| 356 | Ga0495610_0022054 | 3300046512 | Bacteria | 3489 |
| 357 | Ga0495610_0022169 | 3300046512 | Bacteria | 3478 |
| 358 | Ga0495616_0000477 | 3300046513 | Bacteria | 30408 |
| 359 | Ga0495616_0003831 | 3300046513 | Bacteria | 9588 |
| 360 | Ga0495616_0005488 | 3300046513 | Bacteria | 7795 |
| 361 | Ga0495616_0006287 | 3300046513 | Bacteria | 7207 |
| 362 | Ga0495616_0028941 | 3300046513 | Bacteria | 2928 |
| 363 | Ga0495616_0039891 | 3300046513 | Bacteria | 2402 |
| 364 | Ga0495616_0055955 | 3300046513 | Bacteria | 1950 |
| 365 | Ga0495616_0088744 | 3300046513 | Bacteria | 1467 |
| 366 | Ga0495616_0104308 | 3300046513 | Bacteria | 1325 |
| 367 | Ga0495616_0136113 | 3300046513 | Bacteria | 1122 |
| 368 | Ga0495620_0000030 | 3300046515 | Bacteria | 122177 |
| 369 | Ga0495620_0001923 | 3300046515 | Bacteria | 12178 |
| 370 | Ga0495620_0002708 | 3300046515 | Bacteria | 10220 |
| 371 | Ga0495620_0004188 | 3300046515 | Bacteria | 8158 |
| 372 | Ga0495620_0005353 | 3300046515 | Bacteria | 7174 |
| 373 | Ga0495620_0027095 | 3300046515 | Bacteria | 2686 |
| 374 | Ga0495620_0097605 | 3300046515 | Bacteria | 1173 |
| 375 | Ga0495630_0007405 | 3300046517 | Bacteria | 7844 |
| 376 | Ga0495630_0018847 | 3300046517 | Bacteria | 5072 |
| 377 | Ga0495630_0207120 | 3300046517 | Bacteria | 1497 |
| 378 | Ga0495631_0000472 | 3300046518 | Bacteria | 27165 |
| 379 | Ga0495631_0004587 | 3300046518 | Bacteria | 7323 |
| 380 | Ga0495631_0008902 | 3300046518 | Bacteria | 5037 |
| 381 | Ga0495631_0009938 | 3300046518 | Bacteria | 4731 |
| 382 | Ga0495631_0033836 | 3300046518 | Bacteria | 2293 |
| 383 | Ga0495631_0036475 | 3300046518 | Bacteria | 2195 |
| 384 | Ga0495631_0056264 | 3300046518 | Bacteria | 1713 |
| 385 | Ga0495632_0000478 | 3300046519 | Bacteria | 37981 |
| 386 | Ga0495632_0000803 | 3300046519 | Bacteria | 27828 |
| 387 | Ga0495632_0000944 | 3300046519 | Bacteria | 25401 |
| 388 | Ga0495632_0003470 | 3300046519 | Bacteria | 11153 |
| 389 | Ga0495632_0005214 | 3300046519 | Bacteria | 8662 |
| 390 | Ga0495632_0006615 | 3300046519 | Bacteria | 7414 |
| 391 | Ga0495632_0006958 | 3300046519 | Bacteria | 7177 |
| 392 | Ga0495632_0008838 | 3300046519 | Bacteria | 6130 |
| 393 | Ga0495632_0010674 | 3300046519 | Bacteria | 5418 |
| 394 | Ga0495632_0011570 | 3300046519 | Bacteria | 5140 |
| 395 | Ga0495632_0012382 | 3300046519 | Bacteria | 4922 |
| 396 | Ga0495632_0013939 | 3300046519 | Bacteria | 4566 |
| 397 | Ga0495632_0015861 | 3300046519 | Bacteria | 4208 |
| 398 | Ga0495632_0027922 | 3300046519 | Bacteria | 2949 |
| 399 | Ga0495632_0055716 | 3300046519 | Bacteria | 1934 |
| 400 | Ga0495632_0097658 | 3300046519 | Bacteria | 1386 |
| 401 | Ga0495637_0002806 | 3300046520 | Bacteria | 9442 |
| 402 | Ga0495637_0002997 | 3300046520 | Bacteria | 9067 |
| 403 | Ga0495637_0003520 | 3300046520 | Bacteria | 8303 |
| 404 | Ga0495637_0004553 | 3300046520 | Bacteria | 7165 |
| 405 | Ga0495637_0004621 | 3300046520 | Bacteria | 7109 |
| 406 | Ga0495637_0005180 | 3300046520 | Bacteria | 6677 |
| 407 | Ga0495637_0008135 | 3300046520 | Bacteria | 5163 |
| 408 | Ga0495637_0011489 | 3300046520 | Bacteria | 4254 |
| 409 | Ga0495637_0026338 | 3300046520 | Bacteria | 2611 |
| 410 | Ga0495637_0027127 | 3300046520 | Bacteria | 2565 |
| 411 | Ga0495637_0029813 | 3300046520 | Bacteria | 2425 |
| 412 | Ga0495637_0040305 | 3300046520 | Bacteria | 2011 |
| 413 | Ga0495643_0000261 | 3300046522 | Bacteria | 77011 |
| 414 | Ga0495643_0000473 | 3300046522 | Bacteria | 51253 |
| 415 | Ga0495643_0006421 | 3300046522 | Bacteria | 7755 |
| 416 | Ga0495643_0009037 | 3300046522 | Bacteria | 6248 |
| 417 | Ga0495643_0011403 | 3300046522 | Bacteria | 5415 |
| 418 | Ga0495643_0011816 | 3300046522 | Bacteria | 5296 |
| 419 | Ga0495643_0016552 | 3300046522 | Bacteria | 4329 |
| 420 | Ga0495643_0025678 | 3300046522 | Bacteria | 3331 |
| 421 | Ga0495643_0034017 | 3300046522 | Bacteria | 2814 |
| 422 | Ga0495643_0042329 | 3300046522 | Bacteria | 2481 |
| 423 | Ga0495644_0000360 | 3300046523 | Bacteria | 20640 |
| 424 | Ga0495644_0010786 | 3300046523 | Bacteria | 3520 |
| 425 | Ga0495644_0023077 | 3300046523 | Bacteria | 2369 |
| 426 | Ga0495644_0028554 | 3300046523 | Bacteria | 2111 |
| 427 | Ga0495644_0051939 | 3300046523 | Bacteria | 1539 |
| 428 | Ga0495644_0087421 | 3300046523 | Bacteria | 1175 |
| 429 | Ga0495648_0000582 | 3300046524 | Bacteria | 39114 |
| 430 | Ga0495648_0009187 | 3300046524 | Bacteria | 7700 |
| 431 | Ga0495648_0012562 | 3300046524 | Bacteria | 6305 |
| 432 | Ga0495648_0036923 | 3300046524 | Bacteria | 3145 |
| 433 | Ga0495648_0048429 | 3300046524 | Bacteria | 2616 |
| 434 | Ga0495648_0051336 | 3300046524 | Bacteria | 2513 |
| 435 | Ga0495648_0054421 | 3300046524 | Bacteria | 2417 |
| 436 | Ga0495648_0085439 | 3300046524 | Bacteria | 1782 |
| 437 | Ga0495666_0009647 | 3300046526 | Bacteria | 4826 |
| 438 | Ga0495666_0064818 | 3300046526 | Bacteria | 1743 |
| 439 | Ga0495642_0000358 | 3300046528 | Bacteria | 24726 |
| 440 | Ga0495642_0001163 | 3300046528 | Bacteria | 12069 |
| 441 | Ga0495642_0001292 | 3300046528 | Bacteria | 11293 |
| 442 | Ga0495652_0319951 | 3300046529 | Bacteria | 1121 |
| 443 | Ga0495654_0000341 | 3300046530 | Bacteria | 40691 |
| 444 | Ga0495654_0000771 | 3300046530 | Bacteria | 24701 |
| 445 | Ga0495654_0001231 | 3300046530 | Bacteria | 18082 |
| 446 | Ga0495654_0004500 | 3300046530 | Bacteria | 8254 |
| 447 | Ga0495654_0018930 | 3300046530 | Bacteria | 3602 |
| 448 | Ga0495654_0022263 | 3300046530 | Bacteria | 3292 |
| 449 | Ga0495654_0025312 | 3300046530 | Bacteria | 3058 |
| 450 | Ga0495654_0029799 | 3300046530 | Bacteria | 2781 |
| 451 | Ga0495654_0033159 | 3300046530 | Bacteria | 2614 |
| 452 | Ga0495654_0040165 | 3300046530 | Bacteria | 2333 |
| 453 | Ga0495654_0040877 | 3300046530 | Bacteria | 2308 |
| 454 | Ga0495654_0061601 | 3300046530 | Bacteria | 1800 |
| 455 | Ga0495587_0001669 | 3300046536 | Bacteria | 14811 |
| 456 | Ga0495587_0110429 | 3300046536 | Bacteria | 1580 |
| 457 | Ga0495609_0003337 | 3300046538 | Bacteria | 9251 |
| 458 | Ga0495609_0003816 | 3300046538 | Bacteria | 8471 |
| 459 | Ga0495609_0005499 | 3300046538 | Bacteria | 6631 |
| 460 | Ga0495609_0009838 | 3300046538 | Bacteria | 4610 |
| 461 | Ga0495609_0016798 | 3300046538 | Bacteria | 3408 |
| 462 | Ga0495609_0025056 | 3300046538 | Bacteria | 2735 |
| 463 | Ga0495597_0002042 | 3300046542 | Bacteria | 13491 |
| 464 | Ga0495597_0002966 | 3300046542 | Bacteria | 10283 |
| 465 | Ga0495597_0004142 | 3300046542 | Bacteria | 8051 |
| 466 | Ga0495597_0004308 | 3300046542 | Bacteria | 7864 |
| 467 | Ga0495597_0004340 | 3300046542 | Bacteria | 7818 |
| 468 | Ga0495597_0005298 | 3300046542 | Bacteria | 6845 |
| 469 | Ga0495597_0008349 | 3300046542 | Bacteria | 5188 |
| 470 | Ga0495597_0036852 | 3300046542 | Bacteria | 2199 |
| 471 | Ga0495597_0049705 | 3300046542 | Bacteria | 1852 |
| 472 | Ga0495597_0050430 | 3300046542 | Bacteria | 1837 |
| 473 | Ga0495597_0092486 | 3300046542 | Bacteria | 1282 |
| 474 | Ga0495622_0001210 | 3300046557 | Bacteria | 13285 |
| 475 | Ga0495622_0003088 | 3300046557 | Bacteria | 7896 |
| 476 | Ga0495622_0004658 | 3300046557 | Bacteria | 6358 |
| 477 | Ga0495622_0023055 | 3300046557 | Bacteria | 2901 |
| 478 | Ga0495633_0004851 | 3300046558 | Bacteria | 8416 |
| 479 | Ga0495633_0005636 | 3300046558 | Bacteria | 7591 |
| 480 | Ga0495633_0017563 | 3300046558 | Bacteria | 3654 |
| 481 | Ga0495656_0004271 | 3300046615 | Bacteria | 4880 |
| 482 | Ga0495656_0016120 | 3300046615 | Bacteria | 2832 |
| 483 | Ga0495656_0073995 | 3300046615 | Bacteria | 1520 |
| 484 | Ga0495656_0098165 | 3300046615 | Bacteria | 1350 |
| 485 | Ga0495668_0000469 | 3300046616 | Bacteria | 51055 |
| 486 | Ga0495668_0006356 | 3300046616 | Bacteria | 7747 |
| 487 | Ga0495668_0027867 | 3300046616 | Bacteria | 3199 |
| 488 | Ga0495668_0068547 | 3300046616 | Bacteria | 1951 |
| 489 | Ga0495634_0005738 | 3300046642 | Bacteria | 9482 |
| 490 | Ga0495611_0000122 | 3300046648 | Bacteria | 55685 |
| 491 | Ga0495611_0006432 | 3300046648 | Bacteria | 5008 |
| 492 | Ga0495611_0071011 | 3300046648 | Bacteria | 1591 |
| 493 | Ga0495625_0003248 | 3300046660 | Bacteria | 16447 |
| 494 | Ga0495625_0004991 | 3300046660 | Bacteria | 12318 |
| 495 | Ga0495625_0005031 | 3300046660 | Bacteria | 12264 |
| 496 | Ga0495625_0012793 | 3300046660 | Bacteria | 6784 |
| 497 | Ga0495625_0025541 | 3300046660 | Bacteria | 4478 |
| 498 | Ga0495625_0028977 | 3300046660 | Bacteria | 4145 |
| 499 | Ga0495625_0031839 | 3300046660 | Bacteria | 3918 |
| 500 | Ga0495625_0053565 | 3300046660 | Bacteria | 2885 |
| 501 | Ga0495625_0235038 | 3300046660 | Bacteria | 1195 |
| 502 | Ga0495635_0000659 | 3300046663 | Bacteria | 22135 |
| 503 | Ga0495659_0000440 | 3300046664 | Bacteria | 15582 |
| 504 | Ga0495659_0004643 | 3300046664 | Bacteria | 4325 |
| 505 | Ga0495661_0000075 | 3300046665 | Bacteria | 119777 |
| 506 | Ga0495661_0009100 | 3300046665 | Bacteria | 6828 |
| 507 | Ga0495661_0013408 | 3300046665 | Bacteria | 5504 |
| 508 | Ga0495661_0014232 | 3300046665 | Bacteria | 5330 |
| 509 | Ga0495661_0014404 | 3300046665 | Bacteria | 5298 |
| 510 | Ga0495661_0035218 | 3300046665 | Bacteria | 3143 |
| 511 | Ga0495661_0042227 | 3300046665 | Bacteria | 2812 |
| 512 | Ga0495661_0071113 | 3300046665 | Bacteria | 2034 |
| 513 | Ga0495661_0079890 | 3300046665 | Bacteria | 1889 |
| 514 | Ga0495661_0096270 | 3300046665 | Bacteria | 1674 |
| 515 | Ga0495588_0008419 | 3300046674 | Bacteria | 4733 |
| 516 | Ga0495588_0249166 | 3300046674 | Bacteria | 936 |
| 517 | Ga0495657_0021982 | 3300046675 | Bacteria | 4573 |
| 518 | Ga0495599_0041578 | 3300046678 | Bacteria | 2886 |
| 519 | Ga0495623_0001287 | 3300046679 | Bacteria | 17038 |
| 520 | Ga0495623_0124142 | 3300046679 | Bacteria | 1551 |
| 521 | Ga0495646_0036319 | 3300046680 | Bacteria | 3052 |
| 522 | Ga0495669_0007234 | 3300046684 | Bacteria | 4649 |
| 523 | Ga0495613_0063217 | 3300046689 | Bacteria | 2708 |
| 524 | Ga0495613_0178347 | 3300046689 | Bacteria | 1505 |
| 525 | Ga0495624_0049557 | 3300046690 | Bacteria | 2663 |
| 526 | Ga0495670_0000195 | 3300046691 | Bacteria | 27168 |
| 527 | Ga0495670_0007836 | 3300046691 | Bacteria | 5253 |
| 528 | Ga0495670_0010345 | 3300046691 | Bacteria | 4582 |
| 529 | Ga0495670_0026418 | 3300046691 | Bacteria | 2874 |
| 530 | Ga0495670_0036704 | 3300046691 | Bacteria | 2442 |
| 531 | Ga0495670_0061673 | 3300046691 | Bacteria | 1885 |
| 532 | Ga0495671_0005410 | 3300046692 | Bacteria | 7474 |
| 533 | Ga0495671_0005679 | 3300046692 | Bacteria | 7277 |
| 534 | Ga0495671_0007529 | 3300046692 | Bacteria | 6200 |
| 535 | Ga0495671_0007721 | 3300046692 | Bacteria | 6102 |
| 536 | Ga0495671_0008154 | 3300046692 | Bacteria | 5909 |
| 537 | Ga0495671_0012174 | 3300046692 | Bacteria | 4702 |
| 538 | Ga0495671_0012258 | 3300046692 | Bacteria | 4687 |
| 539 | Ga0495671_0013719 | 3300046692 | Bacteria | 4378 |
| 540 | Ga0495671_0016552 | 3300046692 | Bacteria | 3934 |
| 541 | Ga0495671_0029659 | 3300046692 | Bacteria | 2807 |
| 542 | Ga0495671_0035393 | 3300046692 | Bacteria | 2535 |
| 543 | Ga0495671_0038444 | 3300046692 | Bacteria | 2418 |
| 544 | Ga0495671_0072293 | 3300046692 | Bacteria | 1693 |
| 545 | Ga0495671_0104689 | 3300046692 | Bacteria | 1382 |
| 546 | Ga0495649_0000027 | 3300046694 | Bacteria | 164157 |
| 547 | Ga0495649_0000272 | 3300046694 | Bacteria | 46077 |
| 548 | Ga0495649_0001688 | 3300046694 | Bacteria | 16360 |
| 549 | Ga0495649_0003387 | 3300046694 | Bacteria | 10779 |
| 550 | Ga0495649_0003495 | 3300046694 | Bacteria | 10581 |
| 551 | Ga0495649_0007796 | 3300046694 | Bacteria | 6493 |
| 552 | Ga0495649_0009176 | 3300046694 | Bacteria | 5896 |
| 553 | Ga0495649_0011615 | 3300046694 | Bacteria | 5159 |
| 554 | Ga0495649_0015285 | 3300046694 | Bacteria | 4369 |
| 555 | Ga0495649_0018011 | 3300046694 | Bacteria | 3979 |
| 556 | Ga0495649_0025509 | 3300046694 | Bacteria | 3292 |
| 557 | Ga0495649_0028536 | 3300046694 | Bacteria | 3092 |
| 558 | Ga0495649_0044729 | 3300046694 | Bacteria | 2416 |
| 559 | Ga0495649_0116354 | 3300046694 | Bacteria | 1415 |
| 560 | Ga0495649_0143808 | 3300046694 | Bacteria | 1254 |
| 561 | Ga0495589_0001433 | 3300046794 | Bacteria | 13759 |
| 562 | Ga0495589_0001754 | 3300046794 | Bacteria | 12349 |
| 563 | Ga0495589_0002505 | 3300046794 | Bacteria | 10252 |
| 564 | Ga0495589_0002971 | 3300046794 | Bacteria | 9342 |
| 565 | Ga0495589_0006384 | 3300046794 | Bacteria | 6227 |
| 566 | Ga0495589_0025583 | 3300046794 | Bacteria | 2995 |
| 567 | Ga0495589_0030914 | 3300046794 | Bacteria | 2696 |
| 568 | Ga0495589_0034885 | 3300046794 | Bacteria | 2523 |
| 569 | Ga0495589_0042145 | 3300046794 | Bacteria | 2275 |
| 570 | Ga0495589_0110103 | 3300046794 | Bacteria | 1329 |
| 571 | Ga0495589_0125493 | 3300046794 | Bacteria | 1234 |
| 572 | Ga0495660_0004178 | 3300046810 | Bacteria | 8776 |
| 573 | Ga0495660_0005423 | 3300046810 | Bacteria | 7635 |
| 574 | Ga0495660_0006442 | 3300046810 | Bacteria | 6943 |
| 575 | Ga0495660_0022014 | 3300046810 | Bacteria | 3643 |
| 576 | Ga0495660_0024654 | 3300046810 | Bacteria | 3425 |
| 577 | Ga0495660_0025478 | 3300046810 | Bacteria | 3359 |
| 578 | Ga0495660_0026948 | 3300046810 | Bacteria | 3253 |
| 579 | Ga0495660_0031469 | 3300046810 | Bacteria | 2982 |
| 580 | Ga0495660_0047064 | 3300046810 | Bacteria | 2363 |
| 581 | Ga0495660_0064203 | 3300046810 | Bacteria | 1963 |
| 582 | Ga0495660_0085462 | 3300046810 | Bacteria | 1648 |
| 583 | Ga0495660_0124782 | 3300046810 | Bacteria | 1298 |
| 584 | Ga0495660_0137679 | 3300046810 | Bacteria | 1218 |
| 585 | Ga0495581_0003940 | 3300047315 | Bacteria | 8546 |
| 586 | Ga0495604_0009635 | 3300047317 | Bacteria | 7638 |
| 587 | Ga0495636_0001575 | 3300047318 | Bacteria | 8677 |
| 588 | Ga0495674_0017518 | 3300047319 | Bacteria | 6668 |
| 589 | Ga0495672_0000764 | 3300047320 | Bacteria | 35016 |
| 590 | Ga0495672_0003175 | 3300047320 | Bacteria | 14289 |
| 591 | Ga0495672_0004334 | 3300047320 | Bacteria | 11682 |
| 592 | Ga0495672_0004737 | 3300047320 | Bacteria | 10986 |
| 593 | Ga0495672_0004941 | 3300047320 | Bacteria | 10702 |
| 594 | Ga0495672_0005359 | 3300047320 | Bacteria | 10198 |
| 595 | Ga0495672_0007280 | 3300047320 | Bacteria | 8348 |
| 596 | Ga0495672_0018008 | 3300047320 | Bacteria | 4704 |
| 597 | Ga0495672_0018360 | 3300047320 | Bacteria | 4646 |
| 598 | Ga0495672_0022247 | 3300047320 | Bacteria | 4124 |
| 599 | Ga0495672_0060166 | 3300047320 | Bacteria | 2195 |
| 600 | Ga0495672_0061123 | 3300047320 | Bacteria | 2172 |
| 601 | Ga0495672_0144150 | 3300047320 | Bacteria | 1241 |
| 602 | Ga0495676_0003901 | 3300047321 | Bacteria | 13558 |
| 603 | Ga0495676_0011447 | 3300047321 | Bacteria | 8008 |
| 604 | Ga0495680_0021320 | 3300047322 | Bacteria | 5425 |
| 605 | Ga0495680_0028783 | 3300047322 | Bacteria | 4553 |
| 606 | Ga0495683_0000412 | 3300047323 | Bacteria | 34264 |
| 607 | Ga0495683_0000655 | 3300047323 | Bacteria | 25656 |
| 608 | Ga0495683_0003037 | 3300047323 | Bacteria | 9871 |
| 609 | Ga0495683_0007263 | 3300047323 | Bacteria | 6009 |
| 610 | Ga0495683_0011550 | 3300047323 | Bacteria | 4644 |
| 611 | Ga0495683_0035628 | 3300047323 | Bacteria | 2529 |
| 612 | Ga0495683_0039432 | 3300047323 | Bacteria | 2387 |
| 613 | Ga0495683_0042071 | 3300047323 | Bacteria | 2304 |
| 614 | Ga0495683_0055708 | 3300047323 | Bacteria | 1968 |
| 615 | Ga0495683_0061799 | 3300047323 | Bacteria | 1854 |
| 616 | Ga0495683_0085579 | 3300047323 | Bacteria | 1532 |
| 617 | Ga0495683_0102099 | 3300047323 | Bacteria | 1378 |
| 618 | Ga0495687_003682 | 3300047443 | Bacteria | 10914 |
| 619 | Ga0495675_0050096 | 3300047444 | Bacteria | 2654 |
| 620 | Ga0495675_0330919 | 3300047444 | Bacteria | 899 |
| 621 | Ga0495677_0000252 | 3300047445 | Bacteria | 23464 |
| 622 | Ga0495679_001088 | 3300047446 | Bacteria | 16472 |
| 623 | Ga0495679_002995 | 3300047446 | Bacteria | 8318 |
| 624 | Ga0495679_003429 | 3300047446 | Bacteria | 7627 |
| 625 | Ga0495679_005175 | 3300047446 | Bacteria | 5838 |
| 626 | Ga0495679_020393 | 3300047446 | Bacteria | 2309 |
| 627 | Ga0495679_022774 | 3300047446 | Bacteria | 2138 |
| 628 | Ga0495679_050843 | 3300047446 | Bacteria | 1245 |
| 629 | Ga0495673_0000893 | 3300047469 | Bacteria | 27451 |
| 630 | Ga0495673_0000924 | 3300047469 | Bacteria | 26657 |
| 631 | Ga0495673_0003733 | 3300047469 | Bacteria | 9892 |
| 632 | Ga0495673_0004885 | 3300047469 | Bacteria | 8279 |
| 633 | Ga0495673_0005576 | 3300047469 | Bacteria | 7586 |
| 634 | Ga0495673_0006092 | 3300047469 | Bacteria | 7161 |
| 635 | Ga0495673_0006468 | 3300047469 | Bacteria | 6879 |
| 636 | Ga0495673_0010362 | 3300047469 | Bacteria | 5075 |
| 637 | Ga0495673_0037374 | 3300047469 | Bacteria | 2217 |
| 638 | Ga0495673_0048902 | 3300047469 | Bacteria | 1862 |
| 639 | Ga0495673_0053510 | 3300047469 | Bacteria | 1759 |
| 640 | Ga0495673_0067156 | 3300047469 | Bacteria | 1518 |
| 641 | Ga0495673_0092757 | 3300047469 | Bacteria | 1231 |
| 642 | Ga0495681_0000483 | 3300047470 | Bacteria | 30581 |
| 643 | Ga0495681_0001489 | 3300047470 | Bacteria | 17496 |
| 644 | Ga0495681_0001511 | 3300047470 | Bacteria | 17378 |
| 645 | Ga0495681_0004383 | 3300047470 | Bacteria | 9641 |
| 646 | Ga0495681_0005329 | 3300047470 | Bacteria | 8629 |
| 647 | Ga0495681_0006472 | 3300047470 | Bacteria | 7693 |
| 648 | Ga0495681_0006674 | 3300047470 | Bacteria | 7535 |
| 649 | Ga0495681_0011680 | 3300047470 | Bacteria | 5211 |
| 650 | Ga0495681_0016749 | 3300047470 | Bacteria | 4094 |
| 651 | Ga0495681_0029710 | 3300047470 | Bacteria | 2794 |
| 652 | Ga0495681_0075683 | 3300047470 | Bacteria | 1514 |
| 653 | Ga0495686_0007280 | 3300047472 | Bacteria | 8319 |
| 654 | Ga0495686_0007941 | 3300047472 | Bacteria | 7874 |
| 655 | Ga0495686_0010692 | 3300047472 | Bacteria | 6515 |
| 656 | Ga0495686_0011343 | 3300047472 | Bacteria | 6282 |
| 657 | Ga0495686_0063472 | 3300047472 | Bacteria | 2289 |
| 658 | Ga0495593_0002255 | 3300047673 | Bacteria | 11568 |
| 659 | Ga0495593_0008720 | 3300047673 | Bacteria | 5889 |
| 660 | Ga0495614_0088321 | 3300048089 | Bacteria | 1347 |
| 661 | Ga0495615_0051524 | 3300048090 | Bacteria | 1061 |
| 662 | Ga0495626_0000705 | 3300048091 | Bacteria | 31675 |
| 663 | Ga0495626_0000740 | 3300048091 | Bacteria | 30199 |
| 664 | Ga0495626_0000767 | 3300048091 | Bacteria | 29487 |
| 665 | Ga0495626_0001892 | 3300048091 | Bacteria | 15630 |
| 666 | Ga0495626_0002899 | 3300048091 | Bacteria | 11426 |
| 667 | Ga0495626_0018494 | 3300048091 | Bacteria | 3498 |
| 668 | Ga0495626_0022852 | 3300048091 | Bacteria | 3085 |
| 669 | Ga0495626_0030567 | 3300048091 | Bacteria | 2597 |
| 670 | Ga0495626_0033892 | 3300048091 | Bacteria | 2445 |
| 671 | Ga0495626_0034807 | 3300048091 | Bacteria | 2407 |
| 672 | Ga0495626_0036668 | 3300048091 | Bacteria | 2334 |
| 673 | Ga0495626_0092116 | 3300048091 | Bacteria | 1331 |
| 674 | Ga0496102_0000969 | 3300048905 | Bacteria | 27013 |
| 675 | Ga0496102_0449710 | 3300048905 | Bacteria | 1209 |
| 676 | Ga0496103_0002947 | 3300048906 | Bacteria | 10550 |
| 677 | Ga0496106_0056896 | 3300048909 | Bacteria | 2957 |
| 678 | Ga0496106_0085707 | 3300048909 | Bacteria | 2426 |
| 679 | Ga0496110_0007093 | 3300048913 | Bacteria | 8920 |
| 680 | Ga0496110_0094820 | 3300048913 | Bacteria | 2672 |
| 681 | Ga0496114_0017742 | 3300048917 | Bacteria | 5751 |
| 682 | Ga0496116_0000267 | 3300048919 | Bacteria | 91320 |
| 683 | Ga0496116_0000605 | 3300048919 | Bacteria | 47467 |
| 684 | Ga0496116_0006567 | 3300048919 | Bacteria | 10530 |
| 685 | Ga0496116_0008415 | 3300048919 | Bacteria | 8955 |
| 686 | Ga0496116_0010683 | 3300048919 | Bacteria | 7672 |
| 687 | Ga0496116_0014223 | 3300048919 | Bacteria | 6368 |
| 688 | Ga0496116_0018451 | 3300048919 | Bacteria | 5378 |
| 689 | Ga0496117_0000345 | 3300048920 | Bacteria | 82051 |
| 690 | Ga0496117_0001325 | 3300048920 | Bacteria | 36399 |
| 691 | Ga0496117_0001539 | 3300048920 | Bacteria | 32759 |
| 692 | Ga0496117_0007996 | 3300048920 | Bacteria | 10146 |
| 693 | Ga0496117_0009348 | 3300048920 | Bacteria | 9130 |
| 694 | Ga0496117_0011985 | 3300048920 | Bacteria | 7702 |
| 695 | Ga0496117_0025488 | 3300048920 | Bacteria | 4649 |
| 696 | Ga0496117_0026269 | 3300048920 | Bacteria | 4559 |
| 697 | Ga0496117_0031014 | 3300048920 | Bacteria | 4090 |
| 698 | Ga0496117_0050717 | 3300048920 | Bacteria | 2940 |
| 699 | Ga0496118_0000632 | 3300048921 | Bacteria | 57785 |
| 700 | Ga0496118_0003170 | 3300048921 | Bacteria | 21019 |
| 701 | Ga0496118_0013533 | 3300048921 | Bacteria | 7707 |
| 702 | Ga0496118_0015177 | 3300048921 | Bacteria | 7153 |
| 703 | Ga0496118_0022897 | 3300048921 | Bacteria | 5444 |
| 704 | Ga0496118_0025809 | 3300048921 | Bacteria | 5026 |
| 705 | Ga0496118_0026687 | 3300048921 | Bacteria | 4911 |
| 706 | Ga0496118_0030346 | 3300048921 | Bacteria | 4514 |
| 707 | Ga0496119_0039352 | 3300048922 | Bacteria | 3040 |
| 708 | Ga0496119_0045961 | 3300048922 | Bacteria | 2731 |
| 709 | Ga0496120_0070243 | 3300048923 | Bacteria | 1926 |
| 710 | Ga0496121_0000366 | 3300048924 | Bacteria | 92773 |
| 711 | Ga0496121_0028697 | 3300048924 | Bacteria | 5173 |
| 712 | Ga0496121_0031460 | 3300048924 | Bacteria | 4847 |
| 713 | Ga0496121_0061278 | 3300048924 | Bacteria | 3088 |
| 714 | Ga0496122_0000766 | 3300048925 | Bacteria | 62103 |
| 715 | Ga0496122_0001617 | 3300048925 | Bacteria | 35202 |
| 716 | Ga0496122_0008723 | 3300048925 | Bacteria | 10853 |
| 717 | Ga0496122_0031466 | 3300048925 | Bacteria | 4414 |
| 718 | Ga0496122_0070578 | 3300048925 | Bacteria | 2495 |
| 719 | Ga0496122_0083437 | 3300048925 | Bacteria | 2215 |
| 720 | Ga0496122_0089078 | 3300048925 | Bacteria | 2111 |
| 721 | Ga0496122_0098750 | 3300048925 | Bacteria | 1959 |
| 722 | Ga0496122_0215924 | 3300048925 | Bacteria | 1106 |
| 723 | Ga0496123_0000320 | 3300048926 | Bacteria | 91826 |
| 724 | Ga0496123_0006000 | 3300048926 | Bacteria | 11946 |
| 725 | Ga0496123_0014779 | 3300048926 | Bacteria | 6445 |
| 726 | Ga0496123_0074253 | 3300048926 | Bacteria | 2106 |
| 727 | Ga0496123_0115966 | 3300048926 | Bacteria | 1518 |
| 728 | Ga0496123_0120409 | 3300048926 | Bacteria | 1478 |
| 729 | Ga0496124_0001300 | 3300048927 | Bacteria | 37788 |
| 730 | Ga0496124_0004460 | 3300048927 | Bacteria | 16332 |
| 731 | Ga0496124_0014681 | 3300048927 | Bacteria | 7562 |
| 732 | Ga0496124_0031308 | 3300048927 | Bacteria | 4710 |
| 733 | Ga0496124_0046212 | 3300048927 | Bacteria | 3729 |
| 734 | Ga0496124_0098814 | 3300048927 | Bacteria | 2367 |
| 735 | Ga0496124_0162659 | 3300048927 | Bacteria | 1738 |
| 736 | Ga0496125_0000232 | 3300048928 | Bacteria | 114025 |
| 737 | Ga0496125_0017266 | 3300048928 | Bacteria | 6891 |
| 738 | Ga0496125_0029341 | 3300048928 | Bacteria | 4945 |
| 739 | Ga0496125_0031148 | 3300048928 | Bacteria | 4758 |
| 740 | Ga0496125_0114644 | 3300048928 | Bacteria | 1941 |
| 741 | Ga0496126_0012797 | 3300048929 | Bacteria | 8576 |
| 742 | Ga0496126_0290342 | 3300048929 | Bacteria | 1352 |
| 743 | Ga0496126_0342322 | 3300048929 | Bacteria | 1225 |
| 744 | Ga0495678_001735 | 3300049459 | Bacteria | 16245 |
| 745 | Ga0495678_002516 | 3300049459 | Bacteria | 12337 |
| 746 | Ga0495678_005072 | 3300049459 | Bacteria | 7396 |
| 747 | Ga0495678_006337 | 3300049459 | Bacteria | 6310 |
| 748 | Ga0495678_011263 | 3300049459 | Bacteria | 4292 |
| 749 | Ga0495678_012720 | 3300049459 | Bacteria | 3979 |
| 750 | Ga0495678_015410 | 3300049459 | Bacteria | 3517 |
| 751 | Ga0495678_018743 | 3300049459 | Bacteria | 3105 |
| 752 | Ga0495678_030721 | 3300049459 | Bacteria | 2245 |
| 753 | Ga0495678_031680 | 3300049459 | Bacteria | 2201 |
| 754 | Ga0495678_058720 | 3300049459 | Bacteria | 1452 |
| 755 | Ga0495678_061233 | 3300049459 | Bacteria | 1413 |
| 756 | Ga0495678_107526 | 3300049459 | Bacteria | 956 |
| 757 | Ga0495682_0000118 | 3300049460 | Bacteria | 69167 |
| 758 | Ga0495682_0002350 | 3300049460 | Bacteria | 8989 |
| 759 | Ga0495682_0003059 | 3300049460 | Bacteria | 7603 |
| 760 | Ga0495682_0003256 | 3300049460 | Bacteria | 7272 |
| 761 | Ga0495682_0003917 | 3300049460 | Bacteria | 6498 |
| 762 | Ga0495682_0010029 | 3300049460 | Bacteria | 3681 |
| 763 | Ga0495682_0045212 | 3300049460 | Bacteria | 1609 |
| 764 | Ga0495682_0048656 | 3300049460 | Bacteria | 1545 |
| 765 | Ga0495682_0061928 | 3300049460 | Bacteria | 1350 |
| 766 | Ga0501033_0267040 | 3300049570 | Bacteria | 1210 |
| 767 | Ga0501034_0000267 | 3300049571 | Bacteria | 94455 |
| 768 | Ga0501034_0195383 | 3300049571 | Bacteria | 1983 |
| 769 | Ga0501037_0417012 | 3300049573 | Bacteria | 919 |
| 770 | Ga0501039_0329813 | 3300049575 | Bacteria | 1199 |
| 771 | nmdc:mga03683_18451_c1 | 3300050489 | Bacteria | 2653 |
| 772 | nmdc:mga03683_21835_c1 | 3300050489 | Bacteria | 2474 |
| 773 | nmdc:mga03683_82140_c1 | 3300050489 | Bacteria | 1393 |
| 774 | nmdc:mga03n38_12275_c1 | 3300050490 | Bacteria | 3218 |
| 775 | nmdc:mga0yw44_156835_c1 | 3300050492 | Bacteria | 1488 |
| 776 | nmdc:mga0k408_69457_c1 | 3300050493 | Bacteria | 2056 |
| 777 | nmdc:mga06z11_32841_c1 | 3300050494 | Bacteria | 2534 |
| 778 | nmdc:mga07m45_15038_c1 | 3300050496 | Bacteria | 4133 |
| 779 | nmdc:mga07m45_9974_c1 | 3300050496 | Bacteria | 4945 |
| 780 | nmdc:mga08x19_135148_c1 | 3300050514 | Bacteria | 1662 |
| 781 | nmdc:mga08x19_46774_c1 | 3300050514 | Bacteria | 2768 |
| 782 | nmdc:mga08x19_92300_c1 | 3300050514 | Bacteria | 2000 |
| 783 | nmdc:mga0sz30_23085_c1 | 3300050516 | Bacteria | 2528 |
| 784 | Ga0500572_001017 | 3300053111 | Bacteria | 8449 |
| 785 | Ga0500618_002165 | 3300053125 | Bacteria | 7712 |
| 786 | Ga0500659_0002752 | 3300053135 | Bacteria | 10516 |
| 787 | Ga0500568_0025236 | 3300053139 | Bacteria | 2510 |
| 788 | Ga0500586_016067 | 3300053145 | Bacteria | 2263 |
| 789 | 2511267143 | 2511231006 | Bacteria | 6794709 |
| 790 | 2511271382 | 2511231007 | Bacteria | 6306603 |
| 791 | 2511292308 | 2511231010 | Bacteria | 6373152 |
| 792 | 2511295257 | 2511231011 | Bacteria | 6149768 |
| 793 | 2511335046 | 2511231017 | Bacteria | 6503007 |
| 794 | 2511338345 | 2511231018 | Bacteria | 6436256 |
| 795 | 2511345773 | 2511231019 | Bacteria | 6520662 |
| 796 | 2511351973 | 2511231020 | Bacteria | 6115223 |
| 797 | 2511359887 | 2511231021 | Bacteria | 7302637 |
| 798 | 2511370612 | 2511231023 | Bacteria | 6808468 |
| 799 | 2511411424 | 2511231031 | Bacteria | 6558529 |
| 800 | 2512324705 | 2512047018 | Bacteria | 6663241 |
| 801 | 2555672307 | 2554235341 | Bacteria | 6867980 |
| 802 | 2583794736 | 2582580891 | Bacteria | 6800976 |
| 803 | 2597860376 | 2597489887 | Bacteria | 6666321 |
| 804 | 2599358252 | 2599185160 | Bacteria | 6844013 |
| 805 | 2599364607 | 2599185161 | Bacteria | 6960462 |
| 806 | 2599370857 | 2599185162 | Bacteria | 6957254 |
| 807 | 2599376879 | 2599185163 | Bacteria | 6995158 |
| 808 | 2599383417 | 2599185164 | Bacteria | 6841688 |
| 809 | 2599389864 | 2599185165 | Bacteria | 6843250 |
| 810 | 2599396153 | 2599185166 | Bacteria | 6959206 |
| 811 | 2599407993 | 2599185168 | Bacteria | 6997636 |
| 812 | 2599465067 | 2599185181 | Bacteria | 6844519 |
| 813 | 2599471384 | 2599185182 | Bacteria | 6883168 |
| 814 | 2599486782 | 2599185185 | Bacteria | 6652270 |
| 815 | 2599494018 | 2599185186 | Bacteria | 6831633 |
| 816 | 2599807094 | 2599185257 | Bacteria | 6492581 |
| 817 | 2600217800 | 2599185356 | Bacteria | 6843884 |
| 818 | 2600367110 | 2600254931 | Bacteria | 6734225 |
| 819 | 2601777967 | 2600255313 | Bacteria | 6842543 |
| 820 | 2601800472 | 2600255318 | Bacteria | 6383414 |
| 821 | 2602012365 | 2600255389 | Bacteria | 5275336 |
| 822 | 2606078720 | 2603880185 | Bacteria | 6379190 |
| 823 | 2606125620 | 2603880199 | Bacteria | 6377649 |
| 824 | 2624482887 | 2623620443 | Bacteria | 6427864 |
| 825 | 2624494430 | 2623620446 | Bacteria | 6500345 |
| 826 | 2643844808 | 2643221565 | Bacteria | 6216018 |
| 827 | 2643957574 | 2643221589 | Bacteria | 6250934 |
| 828 | 2644025688 | 2643221602 | Bacteria | 6249926 |
| 829 | 2644189060 | 2643221633 | Bacteria | 6733554 |
| 830 | 2671100781 | 2667528171 | Bacteria | 6900659 |
| 831 | 2671773348 | 2671180172 | Bacteria | 6495783 |
| 832 | 2715759062 | 2713897149 | Bacteria | 6506249 |
| 833 | 2739316576 | 2738543025 | Bacteria | 6600348 |
| 834 | 2743739925 | 2740892503 | Bacteria | 6855563 |
| 835 | 2765583429 | 2765235841 | Bacteria | 6137024 |
| 836 | 2774137041 | 2773857673 | Bacteria | 6513460 |
| 837 | 2784262335 | 2784132063 | Bacteria | 6262788 |
| 838 | 2812366614 | 2811994881 | Bacteria | 6298475 |
| 839 | 2817489943 | 2816332298 | Bacteria | 6852809 |
| 840 | 2819659179 | 2818991456 | Bacteria | 6123676 |
| 841 | 2819706449 | 2818991464 | Bacteria | 6907494 |
| 842 | 2823422114 | 2823421272 | Bacteria | 5372474 |
| 843 | 2844666473 | 2844665904 | Bacteria | 6817974 |
| 844 | 2852661014 | 2852657418 | Bacteria | 6472974 |
| 845 | 2860343876 | 2860339153 | Bacteria | 6846989 |
| 846 | 2878034822 | 2878029506 | Bacteria | 6418441 |
| 847 | 2880235467 | 2880230671 | Bacteria | 6140320 |
| 848 | 2904522965 | 2904518522 | Bacteria | 6068986 |
| 849 | 2912964457 | 2912963787 | Bacteria | 5646108 |
| 850 | 2917076187 | 2917070673 | Bacteria | 6868303 |
| 851 | 2919067798 | 2919063839 | Bacteria | 6302690 |
| 852 | 2919506365 | 2919501602 | Bacteria | 5286340 |
| 853 | 2919701469 | 2919697872 | Bacteria | 6553725 |
| 854 | 2923159016 | 2923153595 | Bacteria | 6870622 |
| 855 | 2923520645 | 2923519811 | Bacteria | 6298479 |
| 856 | 2926067435 | 2926063275 | Bacteria | 5285848 |
| 857 | 2931397547 | 2931396565 | Bacteria | 7251677 |
| 858 | 2935359611 | 2935353572 | Unclassified | 6955622 |
| 859 | 2939641811 | 2939636861 | Bacteria | 6297853 |
| 860 | 2939651966 | 2939651529 | Bacteria | 5895393 |
| 861 | 2969309640 | 2969304461 | Bacteria | 6601805 |
| 862 | 2984287154 | 2984286254 | Bacteria | 6702062 |
| 863 | 3007318307 | 3007315729 | Bacteria | 5076637 |
| 864 | 3007398636 | 3007395558 | Bacteria | 6755444 |
| 865 | 3007619163 | 3007614139 | Bacteria | 6053559 |
| 866 | 3007808245 | 3007803356 | Bacteria | 5931491 |
| 867 | 637322726 | 637000220 | Bacteria | 7074893 |
| 868 | 8015693092 | 8015687852 | Bacteria | 6613826 |
| 869 | 8019781914 | 8019775933 | Bacteria | 6858656 |
| 870 | 8052496783 | 8052494512 | Bacteria | 5765634 |
| 871 | 8055776341 | 8055770955 | Bacteria | 6827675 |
| 872 | 8055882023 | 8055878733 | Bacteria | 5907058 |
| 873 | 8056179164 | 8056177738 | Bacteria | 6748268 |
| 874 | Ga0496115_0077793 | |||
| 875 | MRS2a_Contig_1751 | |||
| 876 | SwRhRL2b_contig_105308 | |||
| 877 | JGI25162J39368_1000136 | |||
| 878 | JGI25162J39368_1000155 | |||
| 879 | JGI25163J39215_1000507 | |||
| 880 | JGI25163J39215_1000670 | |||
| 881 | JGI25164J39214_1000121 | |||
| 882 | JGI25164J39214_1000258 | |||
| 883 | JGI25165J46597_1000222 | |||
| 884 | JGI25165J46597_1000240 | |||
| 885 | Ga0055536_1000059 | |||
| 886 | Ga0055530_10000096 | |||
| 887 | Ga0055530_10000898 | |||
| 888 | Ga0055540_1000084 | |||
| 889 | Ga0055540_1000650 | |||
| 890 | Ga0055531_10000266 | |||
| 891 | Ga0058692_1014283 | |||
| 892 | Ga0065714_10009327 | |||
| 893 | Ga0065714_10017536 | |||
| 894 | Ga0065714_10021149 | |||
| 895 | Ga0065714_10125523 | |||
| 896 | Ga0068869_100030387 | |||
| 897 | Ga0070674_100500037 | |||
| 898 | Ga0070659_100228593 | |||
| 899 | Ga0070665_100005810 | |||
| 900 | Ga0068857_100190118 | |||
| 901 | Ga0068854_100401334 | |||
| 902 | Ga0068852_100046773 | |||
| 903 | Ga0075368_10002639 | |||
| 904 | Ga0075364_10014525 | |||
| 905 | Ga0075364_10030360 | |||
| 906 | Ga0075364_10085184 | |||
| 907 | Ga0075432_10000232 | |||
| 908 | Ga0075362_10006013 | |||
| 909 | Ga0075362_10061595 | |||
| 910 | Ga0075362_10088168 | |||
| 911 | Ga0075367_10010373 | |||
| 912 | Ga0075369_10015597 | |||
| 913 | Ga0075366_10071302 | |||
| 914 | Ga0075370_10006145 | |||
| 915 | Ga0068865_100420039 | |||
| 916 | Ga0075436_100132420 | |||
| 917 | Ga0075436_100166259 | |||
| 918 | Ga0075436_100296306 | |||
| 919 | Ga0099823_1000027 | |||
| 920 | Ga0079104_1000116 | |||
| 921 | Ga0105251_10000214 | |||
| 922 | Ga0105251_10000972 | |||
| 923 | Ga0105251_10004871 | |||
| 924 | Ga0105251_10025484 | |||
| 925 | Ga0105251_10051051 | |||
| 926 | Ga0105251_10109055 | |||
| 927 | Ga0105251_10259741 | |||
| 928 | Ga0105244_10012065 | |||
| 929 | Ga0105244_10016510 | |||
| 930 | Ga0105244_10034937 | |||
| 931 | Ga0105244_10040774 | |||
| 932 | Ga0105244_10054174 | |||
| 933 | Ga0105250_10000130 | |||
| 934 | Ga0105250_10001047 | |||
| 935 | Ga0105250_10005902 | |||
| 936 | Ga0105250_10016882 | |||
| 937 | Ga0105250_10024700 | |||
| 938 | Ga0105250_10043106 | |||
| 939 | Ga0105250_10130398 | |||
| 940 | Ga0105240_10082882 | |||
| 941 | Ga0105243_10000115 | |||
| 942 | Ga0105243_10000363 | |||
| 943 | Ga0105243_10008823 | |||
| 944 | Ga0105243_10062776 | |||
| 945 | Ga0105243_10116894 | |||
| 946 | Ga0105237_10015544 | |||
| 947 | Ga0105249_10144978 | |||
| 948 | Ga0105239_10008302 | |||
| 949 | Ga0105246_10006648 | |||
| 950 | Ga0105246_10064594 | |||
| 951 | Ga0157345_1000036 | |||
| 952 | Ga0157373_10001343 | |||
| 953 | Ga0157373_10010768 | |||
| 954 | Ga0157373_10014057 | |||
| 955 | Ga0157371_10000282 | |||
| 956 | Ga0157371_10066050 | |||
| 957 | Ga0157370_10060384 | |||
| 958 | Ga0157369_10003099 | |||
| 959 | Ga0163162_10002655 | |||
| 960 | Ga0157372_10000654 | |||
| 961 | Ga0157375_10102162 | |||
| 962 | Ga0157375_10804341 | |||
| 963 | Ga0182008_10000852 | |||
| 964 | Ga0182008_10002337 | |||
| 965 | Ga0182008_10004259 | |||
| 966 | Ga0182008_10012538 | |||
| 967 | Ga0182008_10040048 | |||
| 968 | Ga0182006_1000547 | |||
| 969 | Ga0182006_1018500 | |||
| 970 | Ga0182006_1067183 | |||
| 971 | Ga0182007_10000290 | |||
| 972 | Ga0182005_1000454 | |||
| 973 | Ga0182005_1000471 | |||
| 974 | Ga0182005_1004003 | |||
| 975 | Ga0163161_10002713 | |||
| 976 | Ga0163161_10008413 | |||
| 977 | Ga0163161_10051431 | |||
| 978 | Ga0163161_10152119 | |||
| 979 | Ga0213872_10063428 | |||
| 980 | Ga0209760_100102 | |||
| 981 | Ga0209760_100190 | |||
| 982 | Ga0209563_100197 | |||
| 983 | Ga0207427_100056 | |||
| 984 | Ga0207427_100063 | |||
| 985 | Ga0209437_100065 | |||
| 986 | Ga0209437_100133 | |||
| 987 | Ga0209233_1000085 | |||
| 988 | Ga0209233_1000133 | |||
| 989 | Ga0209675_1011284 | |||
| 990 | Ga0209676_1000076 | |||
| 991 | Ga0209676_1000313 | |||
| 992 | Ga0209676_1002349 | |||
| 993 | Ga0209050_1000063 | |||
| 994 | Ga0209050_1000106 | |||
| 995 | Ga0209051_1000045 | |||
| 996 | Ga0209051_1000139 | |||
| 997 | Ga0209257_1000539 | |||
| 998 | Ga0209257_1020769 | |||
| 999 | Ga0207696_1000018 | |||
| 1000 | Ga0207696_1000047 | |||
| 1001 | Ga0207696_1000255 | |||
| 1002 | Ga0207696_1000797 | |||
| 1003 | Ga0207696_1001669 | |||
| 1004 | Ga0207696_1008741 | |||
| 1005 | Ga0207655_1000027 | |||
| 1006 | Ga0207655_1000039 | |||
| 1007 | Ga0207655_1001095 | |||
| 1008 | Ga0207655_1003266 | |||
| 1009 | Ga0207655_1003395 | |||
| 1010 | Ga0207655_1003706 | |||
| 1011 | Ga0207655_1008194 | |||
| 1012 | Ga0207655_1016822 | |||
| 1013 | Ga0207655_1037112 | |||
| 1014 | Ga0207655_1051174 | |||
| 1015 | Ga0207655_1101778 | |||
| 1016 | Ga0207713_1000049 | |||
| 1017 | Ga0207713_1000680 | |||
| 1018 | Ga0207713_1003337 | |||
| 1019 | Ga0207713_1005794 | |||
| 1020 | Ga0207713_1007310 | |||
| 1021 | Ga0207713_1012470 | |||
| 1022 | Ga0207713_1028694 | |||
| 1023 | Ga0207713_1031653 | |||
| 1024 | Ga0207713_1051690 | |||
| 1025 | Ga0207713_1054212 | |||
| 1026 | Ga0207713_1065762 | |||
| 1027 | Ga0207713_1076258 | |||
| 1028 | Ga0207695_10118248 | |||
| 1029 | Ga0207671_10018298 | |||
| 1030 | Ga0207681_10007962 | |||
| 1031 | Ga0207644_10011201 | |||
| 1032 | Ga0207706_10053735 | |||
| 1033 | Ga0207709_10000030 | |||
| 1034 | Ga0207709_10000127 | |||
| 1035 | Ga0207709_10017271 | |||
| 1036 | Ga0207689_10083386 | |||
| 1037 | Ga0207712_10028506 | |||
| 1038 | Ga0207678_10696421 | |||
| 1039 | Ga0207674_10072794 | |||
| 1040 | Ga0207698_10193959 | |||
| 1041 | Ga0209281_1000070 | |||
| 1042 | Ga0209389_1000118 | |||
| 1043 | Ga0209371_1000368 | |||
| 1044 | Ga0207428_10003112 | |||
| 1045 | Ga0207428_10049659 | |||
| 1046 | Ga0207428_10051963 | |||
| 1047 | Ga0207428_10101707 | |||
| 1048 | Ga0268266_10013293 | |||
| 1049 | Ga0268266_10058989 | |||
| 1050 | Ga0268256_1000313 | |||
| 1051 | Ga0307516_10061532 | |||
| 1052 | Ga0307510_10016569 | |||
| 1053 | Ga0436361_0310261 | |||
| 1054 | Ga0439436_0021433 | |||
| 1055 | Ga0439438_003723 | |||
| 1056 | Ga0439438_004040 | |||
| 1057 | Ga0439438_005559 | |||
| 1058 | Ga0439438_014195 | |||
| 1059 | Ga0439447_000895 | |||
| 1060 | Ga0439447_001873 | |||
| 1061 | Ga0439447_004201 | |||
| 1062 | Ga0439447_012666 | |||
| 1063 | Ga0439466_0004797 | |||
| 1064 | Ga0439466_0006688 | |||
| 1065 | Ga0439466_0021442 | |||
| 1066 | Ga0439466_0051433 | |||
| 1067 | Ga0439432_007880 | |||
| 1068 | Ga0439432_022580 | |||
| 1069 | Ga0439452_000136 | |||
| 1070 | Ga0439452_013071 | |||
| 1071 | Ga0439452_024353 | |||
| 1072 | Ga0439452_048243 | |||
| 1073 | Ga0439456_000013 | |||
| 1074 | Ga0439456_000877 | |||
| 1075 | Ga0439456_017538 | |||
| 1076 | Ga0439463_000178 | |||
| 1077 | Ga0450911_001222 | |||
| 1078 | Ga0450911_002928 | |||
| 1079 | Ga0450911_004864 | |||
| 1080 | Ga0450919_001594 | |||
| 1081 | Ga0450920_022723 | |||
| 1082 | Ga0450922_000237 | |||
| 1083 | Ga0450900_009647 | |||
| 1084 | Ga0450902_000077 | |||
| 1085 | Ga0450902_008772 | |||
| 1086 | Ga0450903_000941 | |||
| 1087 | Ga0450903_003183 | |||
| 1088 | Ga0450903_004221 | |||
| 1089 | Ga0450904_009078 | |||
| 1090 | Ga0450905_000204 | |||
| 1091 | Ga0450905_000844 | |||
| 1092 | Ga0450906_001422 | |||
| 1093 | Ga0450907_001925 | |||
| 1094 | Ga0450910_000932 | |||
| 1095 | Ga0450908_002978 | |||
| 1096 | Ga0450908_025936 | |||
| 1097 | Ga0439464_0003868 | |||
| 1098 | Ga0439460_0000687 | |||
| 1099 | Ga0450893_0002358 | |||
| 1100 | Ga0495617_001187 | |||
| 1101 | Ga0495617_004986 | |||
| 1102 | Ga0495617_010065 | |||
| 1103 | Ga0495617_015530 | |||
| 1104 | Ga0495617_016633 | |||
| 1105 | Ga0495617_017155 | |||
| 1106 | Ga0495617_017939 | |||
| 1107 | Ga0495617_019450 | |||
| 1108 | Ga0495617_023646 | |||
| 1109 | Ga0495617_036749 | |||
| 1110 | Ga0495617_077495 | |||
| 1111 | Ga0495617_110502 | |||
| 1112 | Ga0495627_000221 | |||
| 1113 | Ga0495627_000979 | |||
| 1114 | Ga0495627_001645 | |||
| 1115 | Ga0495627_001651 | |||
| 1116 | Ga0495627_009676 | |||
| 1117 | Ga0495627_009826 | |||
| 1118 | Ga0495627_015577 | |||
| 1119 | Ga0495627_017738 | |||
| 1120 | Ga0495627_027365 | |||
| 1121 | Ga0495603_0021559 | |||
| 1122 | Ga0495603_0088774 | |||
| 1123 | Ga0495603_0126988 | |||
| 1124 | Ga0495590_0001731 | |||
| 1125 | Ga0495590_0002333 | |||
| 1126 | Ga0495590_0004779 | |||
| 1127 | Ga0495590_0006417 | |||
| 1128 | Ga0495590_0010734 | |||
| 1129 | Ga0495590_0012103 | |||
| 1130 | Ga0495590_0018520 | |||
| 1131 | Ga0495591_000165 | |||
| 1132 | Ga0495591_000425 | |||
| 1133 | Ga0495591_000963 | |||
| 1134 | Ga0495591_002134 | |||
| 1135 | Ga0495591_003769 | |||
| 1136 | Ga0495591_007040 | |||
| 1137 | Ga0495591_008735 | |||
| 1138 | Ga0495591_012361 | |||
| 1139 | Ga0495591_015690 | |||
| 1140 | Ga0495591_019585 | |||
| 1141 | Ga0495591_025920 | |||
| 1142 | Ga0495629_0156908 | |||
| 1143 | Ga0495638_0001999 | |||
| 1144 | Ga0495638_0006143 | |||
| 1145 | Ga0495638_0007777 | |||
| 1146 | Ga0495638_0012518 | |||
| 1147 | Ga0495638_0013519 | |||
| 1148 | Ga0495638_0018636 | |||
| 1149 | Ga0495638_0020735 | |||
| 1150 | Ga0495638_0026947 | |||
| 1151 | Ga0495638_0028116 | |||
| 1152 | Ga0495638_0042819 | |||
| 1153 | Ga0495638_0107860 | |||
| 1154 | Ga0495638_0125996 | |||
| 1155 | Ga0495638_0167434 | |||
| 1156 | Ga0495653_0000332 | |||
| 1157 | Ga0495653_0065292 | |||
| 1158 | Ga0495653_0207711 | |||
| 1159 | Ga0495650_0004569 | |||
| 1160 | Ga0495650_0005455 | |||
| 1161 | Ga0495650_0005554 | |||
| 1162 | Ga0495650_0009190 | |||
| 1163 | Ga0495650_0024099 | |||
| 1164 | Ga0495650_0097524 | |||
| 1165 | Ga0495650_0124923 | |||
| 1166 | Ga0495580_0076122 | |||
| 1167 | Ga0495605_0003954 | |||
| 1168 | Ga0495605_0004591 | |||
| 1169 | Ga0495605_0004632 | |||
| 1170 | Ga0495605_0008941 | |||
| 1171 | Ga0495605_0012826 | |||
| 1172 | Ga0495605_0014831 | |||
| 1173 | Ga0495605_0014851 | |||
| 1174 | Ga0495605_0074587 | |||
| 1175 | Ga0495605_0088901 | |||
| 1176 | Ga0495639_0000041 | |||
| 1177 | Ga0495584_0003663 | |||
| 1178 | Ga0495584_0003833 | |||
| 1179 | Ga0495584_0003989 | |||
| 1180 | Ga0495584_0006961 | |||
| 1181 | Ga0495584_0019313 | |||
| 1182 | Ga0495584_0036690 | |||
| 1183 | Ga0495584_0075149 | |||
| 1184 | Ga0495584_0086196 | |||
| 1185 | Ga0495585_0003124 | |||
| 1186 | Ga0495585_0003212 | |||
| 1187 | Ga0495585_0003541 | |||
| 1188 | Ga0495585_0007318 | |||
| 1189 | Ga0495585_0008585 | |||
| 1190 | Ga0495585_0015529 | |||
| 1191 | Ga0495585_0018523 | |||
| 1192 | Ga0495585_0026336 | |||
| 1193 | Ga0495585_0030683 | |||
| 1194 | Ga0495585_0042623 | |||
| 1195 | Ga0495594_0002044 | |||
| 1196 | Ga0495594_0095054 | |||
| 1197 | Ga0495596_0000109 | |||
| 1198 | Ga0495596_0010464 | |||
| 1199 | Ga0495596_0026593 | |||
| 1200 | Ga0495607_0000589 | |||
| 1201 | Ga0495607_0000661 | |||
| 1202 | Ga0495607_0002507 | |||
| 1203 | Ga0495607_0006167 | |||
| 1204 | Ga0495607_0008621 | |||
| 1205 | Ga0495607_0015178 | |||
| 1206 | Ga0495607_0015559 | |||
| 1207 | Ga0495607_0016072 | |||
| 1208 | Ga0495607_0025428 | |||
| 1209 | Ga0495607_0041654 | |||
| 1210 | Ga0495607_0050513 | |||
| 1211 | Ga0495607_0071685 | |||
| 1212 | Ga0495583_0002989 | |||
| 1213 | Ga0495583_0008224 | |||
| 1214 | Ga0495583_0011611 | |||
| 1215 | Ga0495583_0023147 | |||
| 1216 | Ga0495606_0001537 | |||
| 1217 | Ga0495606_0004243 | |||
| 1218 | Ga0495606_0004992 | |||
| 1219 | Ga0495606_0008945 | |||
| 1220 | Ga0495606_0009534 | |||
| 1221 | Ga0495606_0010315 | |||
| 1222 | Ga0495606_0017207 | |||
| 1223 | Ga0495606_0049007 | |||
| 1224 | Ga0495610_0001921 | |||
| 1225 | Ga0495610_0004276 | |||
| 1226 | Ga0495610_0009096 | |||
| 1227 | Ga0495610_0011477 | |||
| 1228 | Ga0495610_0016930 | |||
| 1229 | Ga0495610_0022054 | |||
| 1230 | Ga0495610_0022169 | |||
| 1231 | Ga0495616_0000477 | |||
| 1232 | Ga0495616_0003831 | |||
| 1233 | Ga0495616_0005488 | |||
| 1234 | Ga0495616_0006287 | |||
| 1235 | Ga0495616_0028941 | |||
| 1236 | Ga0495616_0039891 | |||
| 1237 | Ga0495616_0055955 | |||
| 1238 | Ga0495616_0088744 | |||
| 1239 | Ga0495616_0104308 | |||
| 1240 | Ga0495616_0136113 | |||
| 1241 | Ga0495620_0000030 | |||
| 1242 | Ga0495620_0001923 | |||
| 1243 | Ga0495620_0002708 | |||
| 1244 | Ga0495620_0004188 | |||
| 1245 | Ga0495620_0005353 | |||
| 1246 | Ga0495620_0027095 | |||
| 1247 | Ga0495620_0097605 | |||
| 1248 | Ga0495630_0007405 | |||
| 1249 | Ga0495630_0018847 | |||
| 1250 | Ga0495630_0207120 | |||
| 1251 | Ga0495631_0000472 | |||
| 1252 | Ga0495631_0004587 | |||
| 1253 | Ga0495631_0008902 | |||
| 1254 | Ga0495631_0009938 | |||
| 1255 | Ga0495631_0033836 | |||
| 1256 | Ga0495631_0036475 | |||
| 1257 | Ga0495631_0056264 | |||
| 1258 | Ga0495632_0000478 | |||
| 1259 | Ga0495632_0000803 | |||
| 1260 | Ga0495632_0000944 | |||
| 1261 | Ga0495632_0003470 | |||
| 1262 | Ga0495632_0005214 | |||
| 1263 | Ga0495632_0006615 | |||
| 1264 | Ga0495632_0006958 | |||
| 1265 | Ga0495632_0008838 | |||
| 1266 | Ga0495632_0010674 | |||
| 1267 | Ga0495632_0011570 | |||
| 1268 | Ga0495632_0012382 | |||
| 1269 | Ga0495632_0013939 | |||
| 1270 | Ga0495632_0015861 | |||
| 1271 | Ga0495632_0027922 | |||
| 1272 | Ga0495632_0055716 | |||
| 1273 | Ga0495632_0097658 | |||
| 1274 | Ga0495637_0002806 | |||
| 1275 | Ga0495637_0002997 | |||
| 1276 | Ga0495637_0003520 | |||
| 1277 | Ga0495637_0004553 | |||
| 1278 | Ga0495637_0004621 | |||
| 1279 | Ga0495637_0005180 | |||
| 1280 | Ga0495637_0008135 | |||
| 1281 | Ga0495637_0011489 | |||
| 1282 | Ga0495637_0026338 | |||
| 1283 | Ga0495637_0027127 | |||
| 1284 | Ga0495637_0029813 | |||
| 1285 | Ga0495637_0040305 | |||
| 1286 | Ga0495643_0000261 | |||
| 1287 | Ga0495643_0000473 | |||
| 1288 | Ga0495643_0006421 | |||
| 1289 | Ga0495643_0009037 | |||
| 1290 | Ga0495643_0011403 | |||
| 1291 | Ga0495643_0011816 | |||
| 1292 | Ga0495643_0016552 | |||
| 1293 | Ga0495643_0025678 | |||
| 1294 | Ga0495643_0034017 | |||
| 1295 | Ga0495643_0042329 | |||
| 1296 | Ga0495644_0000360 | |||
| 1297 | Ga0495644_0010786 | |||
| 1298 | Ga0495644_0023077 | |||
| 1299 | Ga0495644_0028554 | |||
| 1300 | Ga0495644_0051939 | |||
| 1301 | Ga0495644_0087421 | |||
| 1302 | Ga0495648_0000582 | |||
| 1303 | Ga0495648_0009187 | |||
| 1304 | Ga0495648_0012562 | |||
| 1305 | Ga0495648_0036923 | |||
| 1306 | Ga0495648_0048429 | |||
| 1307 | Ga0495648_0051336 | |||
| 1308 | Ga0495648_0054421 | |||
| 1309 | Ga0495648_0085439 | |||
| 1310 | Ga0495666_0009647 | |||
| 1311 | Ga0495666_0064818 | |||
| 1312 | Ga0495642_0000358 | |||
| 1313 | Ga0495642_0001163 | |||
| 1314 | Ga0495642_0001292 | |||
| 1315 | Ga0495652_0319951 | |||
| 1316 | Ga0495654_0000341 | |||
| 1317 | Ga0495654_0000771 | |||
| 1318 | Ga0495654_0001231 | |||
| 1319 | Ga0495654_0004500 | |||
| 1320 | Ga0495654_0018930 | |||
| 1321 | Ga0495654_0022263 | |||
| 1322 | Ga0495654_0025312 | |||
| 1323 | Ga0495654_0029799 | |||
| 1324 | Ga0495654_0033159 | |||
| 1325 | Ga0495654_0040165 | |||
| 1326 | Ga0495654_0040877 | |||
| 1327 | Ga0495654_0061601 | |||
| 1328 | Ga0495587_0001669 | |||
| 1329 | Ga0495587_0110429 | |||
| 1330 | Ga0495609_0003337 | |||
| 1331 | Ga0495609_0003816 | |||
| 1332 | Ga0495609_0005499 | |||
| 1333 | Ga0495609_0009838 | |||
| 1334 | Ga0495609_0016798 | |||
| 1335 | Ga0495609_0025056 | |||
| 1336 | Ga0495597_0002042 | |||
| 1337 | Ga0495597_0002966 | |||
| 1338 | Ga0495597_0004142 | |||
| 1339 | Ga0495597_0004308 | |||
| 1340 | Ga0495597_0004340 | |||
| 1341 | Ga0495597_0005298 | |||
| 1342 | Ga0495597_0008349 | |||
| 1343 | Ga0495597_0036852 | |||
| 1344 | Ga0495597_0049705 | |||
| 1345 | Ga0495597_0050430 | |||
| 1346 | Ga0495597_0092486 | |||
| 1347 | Ga0495622_0001210 | |||
| 1348 | Ga0495622_0003088 | |||
| 1349 | Ga0495622_0004658 | |||
| 1350 | Ga0495622_0023055 | |||
| 1351 | Ga0495633_0004851 | |||
| 1352 | Ga0495633_0005636 | |||
| 1353 | Ga0495633_0017563 | |||
| 1354 | Ga0495656_0004271 | |||
| 1355 | Ga0495656_0016120 | |||
| 1356 | Ga0495656_0073995 | |||
| 1357 | Ga0495656_0098165 | |||
| 1358 | Ga0495668_0000469 | |||
| 1359 | Ga0495668_0006356 | |||
| 1360 | Ga0495668_0027867 | |||
| 1361 | Ga0495668_0068547 | |||
| 1362 | Ga0495634_0005738 | |||
| 1363 | Ga0495611_0000122 | |||
| 1364 | Ga0495611_0006432 | |||
| 1365 | Ga0495611_0071011 | |||
| 1366 | Ga0495625_0003248 | |||
| 1367 | Ga0495625_0004991 | |||
| 1368 | Ga0495625_0005031 | |||
| 1369 | Ga0495625_0012793 | |||
| 1370 | Ga0495625_0025541 | |||
| 1371 | Ga0495625_0028977 | |||
| 1372 | Ga0495625_0031839 | |||
| 1373 | Ga0495625_0053565 | |||
| 1374 | Ga0495625_0235038 | |||
| 1375 | Ga0495635_0000659 | |||
| 1376 | Ga0495659_0000440 | |||
| 1377 | Ga0495659_0004643 | |||
| 1378 | Ga0495661_0000075 | |||
| 1379 | Ga0495661_0009100 | |||
| 1380 | Ga0495661_0013408 | |||
| 1381 | Ga0495661_0014232 | |||
| 1382 | Ga0495661_0014404 | |||
| 1383 | Ga0495661_0035218 | |||
| 1384 | Ga0495661_0042227 | |||
| 1385 | Ga0495661_0071113 | |||
| 1386 | Ga0495661_0079890 | |||
| 1387 | Ga0495661_0096270 | |||
| 1388 | Ga0495588_0008419 | |||
| 1389 | Ga0495588_0249166 | |||
| 1390 | Ga0495657_0021982 | |||
| 1391 | Ga0495599_0041578 | |||
| 1392 | Ga0495623_0001287 | |||
| 1393 | Ga0495623_0124142 | |||
| 1394 | Ga0495646_0036319 | |||
| 1395 | Ga0495669_0007234 | |||
| 1396 | Ga0495613_0063217 | |||
| 1397 | Ga0495613_0178347 | |||
| 1398 | Ga0495624_0049557 | |||
| 1399 | Ga0495670_0000195 | |||
| 1400 | Ga0495670_0007836 | |||
| 1401 | Ga0495670_0010345 | |||
| 1402 | Ga0495670_0026418 | |||
| 1403 | Ga0495670_0036704 | |||
| 1404 | Ga0495670_0061673 | |||
| 1405 | Ga0495671_0005410 | |||
| 1406 | Ga0495671_0005679 | |||
| 1407 | Ga0495671_0007529 | |||
| 1408 | Ga0495671_0007721 | |||
| 1409 | Ga0495671_0008154 | |||
| 1410 | Ga0495671_0012174 | |||
| 1411 | Ga0495671_0012258 | |||
| 1412 | Ga0495671_0013719 | |||
| 1413 | Ga0495671_0016552 | |||
| 1414 | Ga0495671_0029659 | |||
| 1415 | Ga0495671_0035393 | |||
| 1416 | Ga0495671_0038444 | |||
| 1417 | Ga0495671_0072293 | |||
| 1418 | Ga0495671_0104689 | |||
| 1419 | Ga0495649_0000027 | |||
| 1420 | Ga0495649_0000272 | |||
| 1421 | Ga0495649_0001688 | |||
| 1422 | Ga0495649_0003387 | |||
| 1423 | Ga0495649_0003495 | |||
| 1424 | Ga0495649_0007796 | |||
| 1425 | Ga0495649_0009176 | |||
| 1426 | Ga0495649_0011615 | |||
| 1427 | Ga0495649_0015285 | |||
| 1428 | Ga0495649_0018011 | |||
| 1429 | Ga0495649_0025509 | |||
| 1430 | Ga0495649_0028536 | |||
| 1431 | Ga0495649_0044729 | |||
| 1432 | Ga0495649_0116354 | |||
| 1433 | Ga0495649_0143808 | |||
| 1434 | Ga0495589_0001433 | |||
| 1435 | Ga0495589_0001754 | |||
| 1436 | Ga0495589_0002505 | |||
| 1437 | Ga0495589_0002971 | |||
| 1438 | Ga0495589_0006384 | |||
| 1439 | Ga0495589_0025583 | |||
| 1440 | Ga0495589_0030914 | |||
| 1441 | Ga0495589_0034885 | |||
| 1442 | Ga0495589_0042145 | |||
| 1443 | Ga0495589_0110103 | |||
| 1444 | Ga0495589_0125493 | |||
| 1445 | Ga0495660_0004178 | |||
| 1446 | Ga0495660_0005423 | |||
| 1447 | Ga0495660_0006442 | |||
| 1448 | Ga0495660_0022014 | |||
| 1449 | Ga0495660_0024654 | |||
| 1450 | Ga0495660_0025478 | |||
| 1451 | Ga0495660_0026948 | |||
| 1452 | Ga0495660_0031469 | |||
| 1453 | Ga0495660_0047064 | |||
| 1454 | Ga0495660_0064203 | |||
| 1455 | Ga0495660_0085462 | |||
| 1456 | Ga0495660_0124782 | |||
| 1457 | Ga0495660_0137679 | |||
| 1458 | Ga0495581_0003940 | |||
| 1459 | Ga0495604_0009635 | |||
| 1460 | Ga0495636_0001575 | |||
| 1461 | Ga0495674_0017518 | |||
| 1462 | Ga0495672_0000764 | |||
| 1463 | Ga0495672_0003175 | |||
| 1464 | Ga0495672_0004334 | |||
| 1465 | Ga0495672_0004737 | |||
| 1466 | Ga0495672_0004941 | |||
| 1467 | Ga0495672_0005359 | |||
| 1468 | Ga0495672_0007280 | |||
| 1469 | Ga0495672_0018008 | |||
| 1470 | Ga0495672_0018360 | |||
| 1471 | Ga0495672_0022247 | |||
| 1472 | Ga0495672_0060166 | |||
| 1473 | Ga0495672_0061123 | |||
| 1474 | Ga0495672_0144150 | |||
| 1475 | Ga0495676_0003901 | |||
| 1476 | Ga0495676_0011447 | |||
| 1477 | Ga0495680_0021320 | |||
| 1478 | Ga0495680_0028783 | |||
| 1479 | Ga0495683_0000412 | |||
| 1480 | Ga0495683_0000655 | |||
| 1481 | Ga0495683_0003037 | |||
| 1482 | Ga0495683_0007263 | |||
| 1483 | Ga0495683_0011550 | |||
| 1484 | Ga0495683_0035628 | |||
| 1485 | Ga0495683_0039432 | |||
| 1486 | Ga0495683_0042071 | |||
| 1487 | Ga0495683_0055708 | |||
| 1488 | Ga0495683_0061799 | |||
| 1489 | Ga0495683_0085579 | |||
| 1490 | Ga0495683_0102099 | |||
| 1491 | Ga0495687_003682 | |||
| 1492 | Ga0495675_0050096 | |||
| 1493 | Ga0495675_0330919 | |||
| 1494 | Ga0495677_0000252 | |||
| 1495 | Ga0495679_001088 | |||
| 1496 | Ga0495679_002995 | |||
| 1497 | Ga0495679_003429 | |||
| 1498 | Ga0495679_005175 | |||
| 1499 | Ga0495679_020393 | |||
| 1500 | Ga0495679_022774 | |||
| 1501 | Ga0495679_050843 | |||
| 1502 | Ga0495673_0000893 | |||
| 1503 | Ga0495673_0000924 | |||
| 1504 | Ga0495673_0003733 | |||
| 1505 | Ga0495673_0004885 | |||
| 1506 | Ga0495673_0005576 | |||
| 1507 | Ga0495673_0006092 | |||
| 1508 | Ga0495673_0006468 | |||
| 1509 | Ga0495673_0010362 | |||
| 1510 | Ga0495673_0037374 | |||
| 1511 | Ga0495673_0048902 | |||
| 1512 | Ga0495673_0053510 | |||
| 1513 | Ga0495673_0067156 | |||
| 1514 | Ga0495673_0092757 | |||
| 1515 | Ga0495681_0000483 | |||
| 1516 | Ga0495681_0001489 | |||
| 1517 | Ga0495681_0001511 | |||
| 1518 | Ga0495681_0004383 | |||
| 1519 | Ga0495681_0005329 | |||
| 1520 | Ga0495681_0006472 | |||
| 1521 | Ga0495681_0006674 | |||
| 1522 | Ga0495681_0011680 | |||
| 1523 | Ga0495681_0016749 | |||
| 1524 | Ga0495681_0029710 | |||
| 1525 | Ga0495681_0075683 | |||
| 1526 | Ga0495686_0007280 | |||
| 1527 | Ga0495686_0007941 | |||
| 1528 | Ga0495686_0010692 | |||
| 1529 | Ga0495686_0011343 | |||
| 1530 | Ga0495686_0063472 | |||
| 1531 | Ga0495593_0002255 | |||
| 1532 | Ga0495593_0008720 | |||
| 1533 | Ga0495614_0088321 | |||
| 1534 | Ga0495615_0051524 | |||
| 1535 | Ga0495626_0000705 | |||
| 1536 | Ga0495626_0000740 | |||
| 1537 | Ga0495626_0000767 | |||
| 1538 | Ga0495626_0001892 | |||
| 1539 | Ga0495626_0002899 | |||
| 1540 | Ga0495626_0018494 | |||
| 1541 | Ga0495626_0022852 | |||
| 1542 | Ga0495626_0030567 | |||
| 1543 | Ga0495626_0033892 | |||
| 1544 | Ga0495626_0034807 | |||
| 1545 | Ga0495626_0036668 | |||
| 1546 | Ga0495626_0092116 | |||
| 1547 | Ga0496102_0000969 | |||
| 1548 | Ga0496102_0449710 | |||
| 1549 | Ga0496103_0002947 | |||
| 1550 | Ga0496106_0056896 | |||
| 1551 | Ga0496106_0085707 | |||
| 1552 | Ga0496110_0007093 | |||
| 1553 | Ga0496110_0094820 | |||
| 1554 | Ga0496114_0017742 | |||
| 1555 | Ga0496116_0000267 | |||
| 1556 | Ga0496116_0000605 | |||
| 1557 | Ga0496116_0006567 | |||
| 1558 | Ga0496116_0008415 | |||
| 1559 | Ga0496116_0010683 | |||
| 1560 | Ga0496116_0014223 | |||
| 1561 | Ga0496116_0018451 | |||
| 1562 | Ga0496117_0000345 | |||
| 1563 | Ga0496117_0001325 | |||
| 1564 | Ga0496117_0001539 | |||
| 1565 | Ga0496117_0007996 | |||
| 1566 | Ga0496117_0009348 | |||
| 1567 | Ga0496117_0011985 | |||
| 1568 | Ga0496117_0025488 | |||
| 1569 | Ga0496117_0026269 | |||
| 1570 | Ga0496117_0031014 | |||
| 1571 | Ga0496117_0050717 | |||
| 1572 | Ga0496118_0000632 | |||
| 1573 | Ga0496118_0003170 | |||
| 1574 | Ga0496118_0013533 | |||
| 1575 | Ga0496118_0015177 | |||
| 1576 | Ga0496118_0022897 | |||
| 1577 | Ga0496118_0025809 | |||
| 1578 | Ga0496118_0026687 | |||
| 1579 | Ga0496118_0030346 | |||
| 1580 | Ga0496119_0039352 | |||
| 1581 | Ga0496119_0045961 | |||
| 1582 | Ga0496120_0070243 | |||
| 1583 | Ga0496121_0000366 | |||
| 1584 | Ga0496121_0028697 | |||
| 1585 | Ga0496121_0031460 | |||
| 1586 | Ga0496121_0061278 | |||
| 1587 | Ga0496122_0000766 | |||
| 1588 | Ga0496122_0001617 | |||
| 1589 | Ga0496122_0008723 | |||
| 1590 | Ga0496122_0031466 | |||
| 1591 | Ga0496122_0070578 | |||
| 1592 | Ga0496122_0083437 | |||
| 1593 | Ga0496122_0089078 | |||
| 1594 | Ga0496122_0098750 | |||
| 1595 | Ga0496122_0215924 | |||
| 1596 | Ga0496123_0000320 | |||
| 1597 | Ga0496123_0006000 | |||
| 1598 | Ga0496123_0014779 | |||
| 1599 | Ga0496123_0074253 | |||
| 1600 | Ga0496123_0115966 | |||
| 1601 | Ga0496123_0120409 | |||
| 1602 | Ga0496124_0001300 | |||
| 1603 | Ga0496124_0004460 | |||
| 1604 | Ga0496124_0014681 | |||
| 1605 | Ga0496124_0031308 | |||
| 1606 | Ga0496124_0046212 | |||
| 1607 | Ga0496124_0098814 | |||
| 1608 | Ga0496124_0162659 | |||
| 1609 | Ga0496125_0000232 | |||
| 1610 | Ga0496125_0017266 | |||
| 1611 | Ga0496125_0029341 | |||
| 1612 | Ga0496125_0031148 | |||
| 1613 | Ga0496125_0114644 | |||
| 1614 | Ga0496126_0012797 | |||
| 1615 | Ga0496126_0290342 | |||
| 1616 | Ga0496126_0342322 | |||
| 1617 | Ga0495678_001735 | |||
| 1618 | Ga0495678_002516 | |||
| 1619 | Ga0495678_005072 | |||
| 1620 | Ga0495678_006337 | |||
| 1621 | Ga0495678_011263 | |||
| 1622 | Ga0495678_012720 | |||
| 1623 | Ga0495678_015410 | |||
| 1624 | Ga0495678_018743 | |||
| 1625 | Ga0495678_030721 | |||
| 1626 | Ga0495678_031680 | |||
| 1627 | Ga0495678_058720 | |||
| 1628 | Ga0495678_061233 | |||
| 1629 | Ga0495678_107526 | |||
| 1630 | Ga0495682_0000118 | |||
| 1631 | Ga0495682_0002350 | |||
| 1632 | Ga0495682_0003059 | |||
| 1633 | Ga0495682_0003256 | |||
| 1634 | Ga0495682_0003917 | |||
| 1635 | Ga0495682_0010029 | |||
| 1636 | Ga0495682_0045212 | |||
| 1637 | Ga0495682_0048656 | |||
| 1638 | Ga0495682_0061928 | |||
| 1639 | Ga0501033_0267040 | |||
| 1640 | Ga0501034_0000267 | |||
| 1641 | Ga0501034_0195383 | |||
| 1642 | Ga0501037_0417012 | |||
| 1643 | Ga0501039_0329813 | |||
| 1644 | nmdc:mga03683_18451_c1 | |||
| 1645 | nmdc:mga03683_21835_c1 | |||
| 1646 | nmdc:mga03683_82140_c1 | |||
| 1647 | nmdc:mga03n38_12275_c1 | |||
| 1648 | nmdc:mga0yw44_156835_c1 | |||
| 1649 | nmdc:mga0k408_69457_c1 | |||
| 1650 | nmdc:mga06z11_32841_c1 | |||
| 1651 | nmdc:mga07m45_15038_c1 | |||
| 1652 | nmdc:mga07m45_9974_c1 | |||
| 1653 | nmdc:mga08x19_135148_c1 | |||
| 1654 | nmdc:mga08x19_46774_c1 | |||
| 1655 | nmdc:mga08x19_92300_c1 | |||
| 1656 | nmdc:mga0sz30_23085_c1 | |||
| 1657 | Ga0500572_001017 | |||
| 1658 | Ga0500618_002165 | |||
| 1659 | Ga0500659_0002752 | |||
| 1660 | Ga0500568_0025236 | |||
| 1661 | Ga0500586_016067 | |||
| 1662 | 2511267143 | |||
| 1663 | 2511271382 | |||
| 1664 | 2511292308 | |||
| 1665 | 2511295257 | |||
| 1666 | 2511335046 | |||
| 1667 | 2511338345 | |||
| 1668 | 2511345773 | |||
| 1669 | 2511351973 | |||
| 1670 | 2511359887 | |||
| 1671 | 2511370612 | |||
| 1672 | 2511411424 | |||
| 1673 | 2512324705 | |||
| 1674 | 2555672307 | |||
| 1675 | 2583794736 | |||
| 1676 | 2597860376 | |||
| 1677 | 2599358252 | |||
| 1678 | 2599364607 | |||
| 1679 | 2599370857 | |||
| 1680 | 2599376879 | |||
| 1681 | 2599383417 | |||
| 1682 | 2599389864 | |||
| 1683 | 2599396153 | |||
| 1684 | 2599407993 | |||
| 1685 | 2599465067 | |||
| 1686 | 2599471384 | |||
| 1687 | 2599486782 | |||
| 1688 | 2599494018 | |||
| 1689 | 2599807094 | |||
| 1690 | 2600217800 | |||
| 1691 | 2600367110 | |||
| 1692 | 2601777967 | |||
| 1693 | 2601800472 | |||
| 1694 | 2602012365 | |||
| 1695 | 2606078720 | |||
| 1696 | 2606125620 | |||
| 1697 | 2624482887 | |||
| 1698 | 2624494430 | |||
| 1699 | 2643844808 | |||
| 1700 | 2643957574 | |||
| 1701 | 2644025688 | |||
| 1702 | 2644189060 | |||
| 1703 | 2671100781 | |||
| 1704 | 2671773348 | |||
| 1705 | 2715759062 | |||
| 1706 | 2739316576 | |||
| 1707 | 2743739925 | |||
| 1708 | 2765583429 | |||
| 1709 | 2774137041 | |||
| 1710 | 2784262335 | |||
| 1711 | 2812366614 | |||
| 1712 | 2817489943 | |||
| 1713 | 2819659179 | |||
| 1714 | 2819706449 | |||
| 1715 | 2823422114 | |||
| 1716 | 2844666473 | |||
| 1717 | 2852661014 | |||
| 1718 | 2860343876 | |||
| 1719 | 2878034822 | |||
| 1720 | 2880235467 | |||
| 1721 | 2904522965 | |||
| 1722 | 2912964457 | |||
| 1723 | 2917076187 | |||
| 1724 | 2919067798 | |||
| 1725 | 2919506365 | |||
| 1726 | 2919701469 | |||
| 1727 | 2923159016 | |||
| 1728 | 2923520645 | |||
| 1729 | 2926067435 | |||
| 1730 | 2931397547 | |||
| 1731 | 2935359611 | |||
| 1732 | 2939641811 | |||
| 1733 | 2939651966 | |||
| 1734 | 2969309640 | |||
| 1735 | 2984287154 | |||
| 1736 | 3007318307 | |||
| 1737 | 3007398636 | |||
| 1738 | 3007619163 | |||
| 1739 | 3007808245 | |||
| 1740 | 637322726 | |||
| 1741 | 8015693092 | |||
| 1742 | 8019781914 | |||
| 1743 | 8052496783 | |||
| 1744 | 8055776341 | |||
| 1745 | 8055882023 | |||
| 1746 | 8056179164 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hmq-assembly3.cif.gz_E | xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein | 0.8244 | 8 | 265 |
| 2g0w-assembly1.cif.gz_A | crystal structure of a putative sugar isomerase (lmo2234) from listeria monocytogenes at 1.70 a resolution | 0.8179 | 8 | 271 |
| 5hmq-assembly2.cif.gz_B | xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein | 0.8163 | 4 | 265 |
| 5hmq-assembly1.cif.gz_C | xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein | 0.8139 | 8 | 265 |
| 5hmq-assembly1.cif.gz_A | xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein | 0.8127 | 8 | 265 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2g0wB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8176 | 8 | 271 | 3.20.20.150 |
| 2q02C00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.7911 | 6 | 271 | 3.20.20.150 |
| 2q02C00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.775 | 6 | 271 | 3.20.20.150 |
| 2g0wB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.771 | 8 | 271 | 3.20.20.150 |
| 1i60A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.7657 | 8 | 272 | 3.20.20.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-J8UVP2-F1-model_v4 | deleted | 0.9915 | 23 | 245 |
|
| AF-I4MWP2-F1-model_v4 | Xylose isomerase-like protein | 0.9911 | 6 | 273 |
GO:0016853
|
| AF-U1ZQ94-F1-model_v4 | Xylose isomerase-like TIM barrel domain-containing protein | 0.9901 | 3 | 167 |
|
| AF-A0A4T0X9P4-F1-model_v4 | deleted | 0.9846 | 33 | 164 |
|
| AF-U1ZQ94-F1-model_v4 | Xylose isomerase-like TIM barrel domain-containing protein | 0.9841 | 3 | 167 |
|