F484269

General Info

Members Datasets Scaffolds Average Seq Length
873 443 1746 120

Family's Representative Sequence

Representative Sequence 3300049590|Ga0501074_0570194|Ga0501074_0570194_15_425
Length 136
Sequence MQSLHEKAMYDHIGLKVKDLDTAVRFYKAALEPLGHVLASQEASYAGLGPRGAPALWLYRDPPSSGVHVAFRASSRAAVDRFHAAGLAAGGRDNGKPGVRSDYSPAYYAAFLIDPDGNNVEAVCLERGCGMALASS

Samples

Sample ID Description Type Environment
1 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
63 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
91 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
92 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
93 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
94 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
95 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
96 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
97 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
98 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
99 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
100 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
105 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
106 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
107 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
108 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
109 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
114 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
115 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
116 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
117 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
118 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
134 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
135 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
136 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
137 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
138 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
139 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
142 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
143 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
144 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
145 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
146 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
147 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
148 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
149 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
150 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
156 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
158 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
161 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
218 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
219 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
220 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
225 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
230 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
231 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
232 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
233 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
234 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
235 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
236 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
237 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
238 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
239 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
240 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
241 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
242 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
243 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
244 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
245 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
246 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
247 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
248 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
249 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
250 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
251 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
252 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
253 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
254 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
255 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
256 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
257 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
259 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
260 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
261 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
262 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
263 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
264 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
265 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
266 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
267 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
268 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
269 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
270 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
271 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
272 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
273 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
274 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
275 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
276 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
277 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
278 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
279 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
280 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
281 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
282 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
283 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
284 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
285 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
286 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
287 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
288 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
289 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
290 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
291 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
292 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
293 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
294 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
295 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
296 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
297 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
298 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
299 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
300 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
301 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
302 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
303 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
304 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
305 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
306 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
307 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
308 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
309 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
310 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
311 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
312 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
313 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
322 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
323 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
324 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
327 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
328 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
329 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
330 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
331 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
332 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
333 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
334 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
335 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
336 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
337 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
338 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
351 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
352 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
353 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
354 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
355 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
356 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
357 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
358 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
359 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
360 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
361 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
362 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
363 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
364 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
365 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
366 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
367 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
368 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
369 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
370 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
371 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
372 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
373 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
374 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
375 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
376 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
377 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
381 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
382 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
383 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
384 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
385 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
386 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
387 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
388 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
389 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
390 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
391 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
392 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
393 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
394 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
395 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
396 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
397 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
398 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
399 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
400 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
401 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
402 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
403 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
404 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
405 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
406 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
407 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
408 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
409 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
410 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
411 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
412 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
413 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
414 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
415 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
416 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
417 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
418 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
419 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
420 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
421 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
422 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
423 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
424 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
425 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
426 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
427 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
428 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
429 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
430 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
431 2643221672 Variovorax sp. Root434 Isolate Unclassified
432 2643221683 Variovorax sp. Root473 Isolate Unclassified
433 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
434 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
435 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
436 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
437 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
438 2885198086 Variovorax sp. 679 Isolate Unclassified
439 2885211737 Variovorax sp. 553 Isolate Unclassified
440 2928070936 Variovorax gossypii 1167 Isolate Unclassified
441 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
442 2929520902 Variovorax beijingensis 502 Isolate Unclassified
443 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 0.11
Isolates 1.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.38
Nodule 0.69
Rhizoplane 2.75
Rhizosphere 77.09
Stem 0
Stem Tuber 0
Unclassified 0.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501074_0570194 3300049590 Bacteria 801
2 JGI24740J21852_10066190 3300001979 Bacteria 981
3 JGI25152J39213_1004368 3300002773 Bacteria 4473
4 JGI25150J39212_1001139 3300002774 Bacteria 7993
5 JGI25150J39212_1040201 3300002774 Bacteria 606
6 JGI25159J45721_1004679 3300002987 Bacteria 4473
7 JGI25159J45721_1008367 3300002987 Bacteria 2848
8 JGI25151J46595_10000186 3300003187 Bacteria 77356
9 JGI25151J46595_10014710 3300003187 Bacteria 3475
10 JGI25151J46595_10015765 3300003187 Bacteria 3318
11 JGI25151J46595_10025387 3300003187 Bacteria 2412
12 JGI25406J46586_10006010 3300003203 Bacteria 5613
13 JGI25153J46596_10009593 3300003215 Bacteria 4473
14 JGI25153J46596_10016109 3300003215 Bacteria 3013
15 JGI25153J46596_10050016 3300003215 Bacteria 1208
16 rootH1_10344455 3300003323 Bacteria 2695
17 JGI25160J50197_1006918 3300003354 Bacteria 4515
18 JGI25160J50197_1011692 3300003354 Bacteria 3091
19 JGI25160J50197_1026419 3300003354 Bacteria 1601
20 JGI25161J50226_1001836 3300003374 Bacteria 5946
21 JGI25161J50226_1005169 3300003374 Bacteria 2586
22 Ga0006562J51391_1035342 3300003578 Bacteria 1520
23 Ga0055526_1005930 3300003771 Bacteria 6816
24 Ga0055526_1009084 3300003771 Bacteria 4850
25 Ga0055537_1003864 3300003773 Bacteria 4473
26 Ga0055537_1007003 3300003773 Bacteria 2779
27 Ga0055524_1004119 3300003775 Bacteria 6816
28 Ga0055524_1004131 3300003775 Bacteria 6800
29 Ga0055536_1007403 3300003781 Bacteria 4925
30 Ga0055536_1028442 3300003781 Bacteria 1523
31 Ga0055534_1001253 3300003784 Bacteria 10465
32 Ga0055534_1003948 3300003784 Bacteria 4473
33 Ga0055528_1008304 3300003790 Bacteria 4473
34 Ga0055528_1015303 3300003790 Bacteria 2779
35 Ga0055530_10000777 3300003791 Bacteria 26621
36 Ga0055530_10015810 3300003791 Bacteria 2442
37 Ga0055540_1001252 3300003792 Bacteria 15535
38 Ga0055540_1001662 3300003792 Bacteria 12890
39 Ga0055540_1002289 3300003792 Bacteria 10317
40 Ga0055540_1005120 3300003792 Bacteria 5641
41 Ga0055540_1029782 3300003792 Bacteria 1274
42 Ga0055531_10002682 3300003794 Bacteria 11725
43 Ga0055531_10010859 3300003794 Bacteria 4471
44 Ga0055531_10022715 3300003794 Bacteria 2379
45 Ga0055543_1000748 3300004625 Bacteria 16355
46 Ga0055543_1009383 3300004625 Bacteria 2105
47 Ga0065165_1003702 3300005262 Bacteria 10364
48 Ga0065165_1027238 3300005262 Bacteria 1866
49 Ga0065712_10000815 3300005290 Bacteria 9682
50 Ga0065707_10198505 3300005295 Bacteria 1322
51 Ga0070676_10196109 3300005328 Bacteria 1321
52 Ga0070690_100140370 3300005330 Bacteria 1640
53 Ga0070670_100015066 3300005331 Bacteria 6635
54 Ga0068869_100000367 3300005334 Bacteria 24337
55 Ga0068869_100002624 3300005334 Bacteria 10850
56 Ga0068869_101859052 3300005334 Bacteria 539
57 Ga0070666_10315094 3300005335 Bacteria 1115
58 Ga0070666_10874700 3300005335 Bacteria 664
59 Ga0070680_100000888 3300005336 Bacteria 21150
60 Ga0070680_100039045 3300005336 Bacteria 3841
61 Ga0070680_100586920 3300005336 Bacteria 956
62 Ga0070682_100003096 3300005337 Bacteria 9215
63 Ga0070682_100089007 3300005337 Bacteria 2016
64 Ga0070682_100902227 3300005337 Bacteria 726
65 Ga0068868_100007192 3300005338 Bacteria 7910
66 Ga0068868_100043292 3300005338 Bacteria 3517
67 Ga0070660_100723443 3300005339 Bacteria 835
68 Ga0070689_100000189 3300005340 Bacteria 37342
69 Ga0070689_100016031 3300005340 Bacteria 5478
70 Ga0070689_100162277 3300005340 Bacteria 1807
71 Ga0070689_101758300 3300005340 Bacteria 565
72 Ga0070691_10002470 3300005341 Bacteria 8217
73 Ga0070691_10217911 3300005341 Bacteria 1010
74 Ga0070687_100000020 3300005343 Bacteria 53469
75 Ga0070687_100001992 3300005343 Bacteria 7475
76 Ga0070687_100627524 3300005343 Bacteria 742
77 Ga0070661_100014675 3300005344 Bacteria 5524
78 Ga0070692_10001522 3300005345 Bacteria 8494
79 Ga0070692_10320342 3300005345 Bacteria 953
80 Ga0070692_10403843 3300005345 Bacteria 863
81 Ga0070668_100021359 3300005347 Bacteria 4890
82 Ga0070668_100024317 3300005347 Bacteria 4588
83 Ga0070669_100008827 3300005353 Bacteria 7193
84 Ga0070669_100024538 3300005353 Bacteria 4323
85 Ga0070669_100523307 3300005353 Bacteria 986
86 Ga0070675_100001749 3300005354 Bacteria 16028
87 Ga0070675_100092376 3300005354 Bacteria 2537
88 Ga0070671_100051978 3300005355 Bacteria 3408
89 Ga0070671_100473250 3300005355 Unclassified 1076
90 Ga0070671_100748608 3300005355 Bacteria 849
91 Ga0070674_100108570 3300005356 Bacteria 2034
92 Ga0070673_100012093 3300005364 Bacteria 5914
93 Ga0070673_100076051 3300005364 Bacteria 2710
94 Ga0070673_100105998 3300005364 Bacteria 2323
95 Ga0070688_100029510 3300005365 Bacteria 3285
96 Ga0070688_100406951 3300005365 Bacteria 1008
97 Ga0070688_101481061 3300005365 Bacteria 552
98 Ga0070667_100085784 3300005367 Bacteria 2701
99 Ga0070667_100361354 3300005367 Bacteria 1316
100 Ga0070703_10013240 3300005406 Bacteria 2341
101 Ga0070714_100790188 3300005435 Bacteria 919
102 Ga0070713_101448700 3300005436 Bacteria 666
103 Ga0070701_10000644 3300005438 Bacteria 12188
104 Ga0070711_100471100 3300005439 Bacteria 1031
105 Ga0070705_100000022 3300005440 Bacteria 83218
106 Ga0070705_100138636 3300005440 Bacteria 1598
107 Ga0070700_100004618 3300005441 Bacteria 7210
108 Ga0070694_100000049 3300005444 Bacteria 54670
109 Ga0070694_100175562 3300005444 Bacteria 1581
110 Ga0070694_100633444 3300005444 Bacteria 864
111 Ga0070694_101302122 3300005444 Unclassified 611
112 Ga0070694_101482143 3300005444 Bacteria 574
113 Ga0070708_100327937 3300005445 Bacteria 1442
114 Ga0070708_100353964 3300005445 Bacteria 1384
115 Ga0070678_100086709 3300005456 Bacteria 2389
116 Ga0070678_100234185 3300005456 Bacteria 1532
117 Ga0070662_100003991 3300005457 Bacteria 9248
118 Ga0070662_100459500 3300005457 Bacteria 1058
119 Ga0070681_10080367 3300005458 Bacteria 3216
120 Ga0070681_10824231 3300005458 Bacteria 845
121 Ga0070681_10996537 3300005458 Bacteria 757
122 Ga0068867_100000219 3300005459 Bacteria 37722
123 Ga0068867_100024520 3300005459 Bacteria 4323
124 Ga0068867_100206792 3300005459 Bacteria 1574
125 Ga0070685_10006027 3300005466 Bacteria 6178
126 Ga0070706_100319884 3300005467 Bacteria 1447
127 Ga0070707_100259427 3300005468 Bacteria 1691
128 Ga0070707_100457302 3300005468 Unclassified 1237
129 Ga0070707_100586643 3300005468 Bacteria 1077
130 Ga0070707_102198907 3300005468 Bacteria 519
131 Ga0070698_100001312 3300005471 Bacteria 27694
132 Ga0070698_100037444 3300005471 Bacteria 5001
133 Ga0070698_100788624 3300005471 Bacteria 894
134 Ga0070698_101803459 3300005471 Bacteria 565
135 Ga0070699_100589565 3300005518 Bacteria 1013
136 Ga0070699_100731308 3300005518 Bacteria 905
137 Ga0070679_100003913 3300005530 Bacteria 13697
138 Ga0070679_100234977 3300005530 Bacteria 1792
139 Ga0070679_101118035 3300005530 Bacteria 733
140 Ga0070679_101782651 3300005530 Bacteria 564
141 Ga0070684_100002199 3300005535 Bacteria 14380
142 Ga0070684_102258685 3300005535 Bacteria 513
143 Ga0068853_100068966 3300005539 Bacteria 3075
144 Ga0068853_100111865 3300005539 Bacteria 2427
145 Ga0068853_100115992 3300005539 Bacteria 2384
146 Ga0068853_100158257 3300005539 Bacteria 2042
147 Ga0068853_100572022 3300005539 Bacteria 1072
148 Ga0068853_102463745 3300005539 Bacteria 504
149 Ga0070672_100007788 3300005543 Bacteria 7307
150 Ga0070686_100002753 3300005544 Bacteria 9679
151 Ga0070686_101154439 3300005544 Unclassified 642
152 Ga0070686_101754093 3300005544 Bacteria 528
153 Ga0070695_100000030 3300005545 Bacteria 53190
154 Ga0070695_100218975 3300005545 Bacteria 1371
155 Ga0070695_100453774 3300005545 Bacteria 983
156 Ga0070695_100821811 3300005545 Bacteria 746
157 Ga0070695_101065821 3300005545 Bacteria 660
158 Ga0070696_100000501 3300005546 Bacteria 24715
159 Ga0070696_100125474 3300005546 Bacteria 1862
160 Ga0070696_101729470 3300005546 Bacteria 539
161 Ga0070693_100000472 3300005547 Bacteria 18052
162 Ga0070693_100040391 3300005547 Bacteria 2619
163 Ga0070693_100417512 3300005547 Bacteria 934
164 Ga0070665_100019238 3300005548 Bacteria 6851
165 Ga0070665_100139506 3300005548 Bacteria 2428
166 Ga0070704_100000009 3300005549 Bacteria 67191
167 Ga0070704_100050701 3300005549 Bacteria 2919
168 Ga0070704_100294373 3300005549 Bacteria 1350
169 Ga0070704_100700560 3300005549 Bacteria 898
170 Ga0068855_100000709 3300005563 Bacteria 40793
171 Ga0068855_100901147 3300005563 Bacteria 934
172 Ga0070664_100004802 3300005564 Bacteria 10832
173 Ga0068857_100019280 3300005577 Bacteria 5989
174 Ga0068857_100019513 3300005577 Bacteria 5955
175 Ga0068857_100773360 3300005577 Bacteria 916
176 Ga0068854_100006372 3300005578 Bacteria 7505
177 Ga0068854_100610932 3300005578 Bacteria 932
178 Ga0068854_101414131 3300005578 Bacteria 629
179 Ga0068856_100015976 3300005614 Bacteria 7258
180 Ga0068856_101160463 3300005614 Bacteria 789
181 Ga0068856_101774551 3300005614 Bacteria 629
182 Ga0070702_100000009 3300005615 Bacteria 60314
183 Ga0070702_100022015 3300005615 Bacteria 3363
184 Ga0068859_100000354 3300005617 Bacteria 45757
185 Ga0068859_100006511 3300005617 Bacteria 11857
186 Ga0068859_100007079 3300005617 Bacteria 11385
187 Ga0068859_100170502 3300005617 Bacteria 2257
188 Ga0068859_100357555 3300005617 Bacteria 1555
189 Ga0068859_100653935 3300005617 Bacteria 1143
190 Ga0068864_100009838 3300005618 Bacteria 7884
191 Ga0068864_100121238 3300005618 Bacteria 2338
192 Ga0068864_100795148 3300005618 Bacteria 929
193 Ga0068866_10000182 3300005718 Bacteria 29433
194 Ga0068861_100000138 3300005719 Bacteria 36853
195 Ga0068861_100002277 3300005719 Bacteria 12453
196 Ga0068861_100012075 3300005719 Bacteria 6019
197 Ga0068863_100003828 3300005841 Bacteria 14874
198 Ga0068863_100046755 3300005841 Bacteria 4108
199 Ga0068858_100004544 3300005842 Bacteria 13592
200 Ga0068858_100014628 3300005842 Bacteria 7390
201 Ga0068858_100058917 3300005842 Bacteria 3550
202 Ga0068858_100119554 3300005842 Bacteria 2463
203 Ga0068860_100000285 3300005843 Bacteria 72246
204 Ga0068860_100528256 3300005843 Bacteria 1180
205 Ga0068862_100000821 3300005844 Bacteria 30739
206 Ga0068862_100007749 3300005844 Bacteria 8880
207 Ga0068862_100017700 3300005844 Bacteria 5932
208 Ga0068862_100159276 3300005844 Bacteria 2014
209 Ga0068862_102540343 3300005844 Bacteria 524
210 Ga0081540_1167164 3300005983 Bacteria 844
211 Ga0081539_10000007 3300005985 Bacteria 532790
212 Ga0075365_11187868 3300006038 Bacteria 537
213 Ga0075368_10095063 3300006042 Bacteria 1221
214 Ga0075363_100441016 3300006048 Bacteria 768
215 Ga0075432_10339025 3300006058 Bacteria 634
216 Ga0070715_10038767 3300006163 Bacteria 1980
217 Ga0070712_100211389 3300006175 Bacteria 1530
218 Ga0075362_10144376 3300006177 Bacteria 1139
219 Ga0075367_10057436 3300006178 Bacteria 2314
220 Ga0075366_10019688 3300006195 Bacteria 3909
221 Ga0097621_100000392 3300006237 Bacteria 30517
222 Ga0097621_100435465 3300006237 Bacteria 1179
223 Ga0075370_10000200 3300006353 Bacteria 21094
224 Ga0075370_10106149 3300006353 Bacteria 1628
225 Ga0068871_100001351 3300006358 Bacteria 16425
226 Ga0068871_100063977 3300006358 Bacteria 3010
227 Ga0075428_100000297 3300006844 Bacteria 48607
228 Ga0075428_100027105 3300006844 Bacteria 6344
229 Ga0075428_100029005 3300006844 Bacteria 6123
230 Ga0075428_100044431 3300006844 Bacteria 4883
231 Ga0075430_100016325 3300006846 Bacteria 6321
232 Ga0075430_100134902 3300006846 Bacteria 2057
233 Ga0075430_100236932 3300006846 Bacteria 1512
234 Ga0075430_100613998 3300006846 Bacteria 897
235 Ga0075431_100000023 3300006847 Bacteria 81036
236 Ga0075431_100003434 3300006847 Bacteria 15370
237 Ga0075431_100017257 3300006847 Bacteria 7335
238 Ga0075431_100071115 3300006847 Bacteria 3589
239 Ga0075431_100246290 3300006847 Bacteria 1817
240 Ga0075431_100315828 3300006847 Bacteria 1576
241 Ga0075431_100332489 3300006847 Bacteria 1530
242 Ga0075431_100401891 3300006847 Bacteria 1371
243 Ga0075433_10665514 3300006852 Bacteria 913
244 Ga0075433_10706834 3300006852 Bacteria 883
245 Ga0075433_11249820 3300006852 Bacteria 644
246 Ga0075434_100235392 3300006871 Bacteria 1851
247 Ga0075434_100414688 3300006871 Bacteria 1368
248 Ga0075429_100000233 3300006880 Bacteria 38047
249 Ga0075429_100001157 3300006880 Bacteria 21266
250 Ga0075429_100001322 3300006880 Bacteria 20223
251 Ga0075429_100009505 3300006880 Bacteria 8437
252 Ga0075429_100041492 3300006880 Bacteria 4008
253 Ga0075429_100312446 3300006880 Bacteria 1376
254 Ga0068865_100000052 3300006881 Bacteria 63932
255 Ga0075436_100077074 3300006914 Bacteria 2309
256 Ga0075436_100162282 3300006914 Bacteria 1575
257 Ga0075436_100229594 3300006914 Bacteria 1318
258 Ga0075436_101138360 3300006914 Bacteria 588
259 Ga0075436_101258703 3300006914 Bacteria 559
260 Ga0075436_101412660 3300006914 Bacteria 528
261 Ga0097620_100000354 3300006931 Bacteria 45757
262 Ga0097620_100006512 3300006931 Bacteria 11857
263 Ga0097620_100007080 3300006931 Bacteria 11385
264 Ga0097620_100170510 3300006931 Bacteria 2257
265 Ga0097620_100357597 3300006931 Bacteria 1555
266 Ga0097620_100653899 3300006931 Bacteria 1143
267 Ga0099824_1014217 3300006942 Bacteria 7986
268 Ga0099822_1009768 3300006943 Bacteria 12016
269 Ga0075435_100037087 3300007076 Bacteria 3880
270 Ga0075435_100057951 3300007076 Bacteria 3135
271 Ga0099795_10251240 3300007788 Bacteria 763
272 Ga0105251_10054543 3300009011 Bacteria 1898
273 Ga0105244_10090379 3300009036 Bacteria 1506
274 Ga0105240_10202508 3300009093 Bacteria 2325
275 Ga0111539_10002140 3300009094 Bacteria 26432
276 Ga0111539_10002965 3300009094 Bacteria 22506
277 Ga0111539_10018787 3300009094 Bacteria 8554
278 Ga0111539_10129689 3300009094 Bacteria 2953
279 Ga0111539_10130778 3300009094 Bacteria 2939
280 Ga0111539_10139501 3300009094 Bacteria 2839
281 Ga0111539_10615008 3300009094 Bacteria 1265
282 Ga0111539_10643112 3300009094 Bacteria 1235
283 Ga0111539_11545216 3300009094 Bacteria 770
284 Ga0105245_10000086 3300009098 Bacteria 93019
285 Ga0105245_10076892 3300009098 Bacteria 3042
286 Ga0105245_11466006 3300009098 Bacteria 733
287 Ga0105247_10357846 3300009101 Bacteria 1028
288 Ga0114129_10000702 3300009147 Bacteria 42161
289 Ga0114129_10007028 3300009147 Bacteria 16025
290 Ga0114129_10029543 3300009147 Bacteria 7763
291 Ga0114129_10080988 3300009147 Bacteria 4513
292 Ga0114129_10444044 3300009147 Bacteria 1702
293 Ga0114129_10696674 3300009147 Bacteria 1306
294 Ga0114129_10751009 3300009147 Bacteria 1249
295 Ga0114129_12275023 3300009147 Bacteria 651
296 Ga0105243_10000360 3300009148 Bacteria 48717
297 Ga0105243_10004657 3300009148 Bacteria 10800
298 Ga0105243_10057153 3300009148 Bacteria 3105
299 Ga0105243_10111035 3300009148 Bacteria 2294
300 Ga0105243_10249950 3300009148 Bacteria 1582
301 Ga0105243_11342678 3300009148 Bacteria 734
302 Ga0105243_11691393 3300009148 Bacteria 661
303 Ga0105241_10013525 3300009174 Bacteria 5980
304 Ga0105241_10096282 3300009174 Bacteria 2344
305 Ga0105242_10001022 3300009176 Bacteria 22000
306 Ga0105242_10042252 3300009176 Bacteria 3680
307 Ga0105242_10071473 3300009176 Bacteria 2880
308 Ga0105242_10894446 3300009176 Bacteria 887
309 Ga0105242_12878664 3300009176 Bacteria 532
310 Ga0105248_10006127 3300009177 Bacteria 13195
311 Ga0105248_10676614 3300009177 Bacteria 1164
312 Ga0105237_10592764 3300009545 Bacteria 1115
313 Ga0105238_10012654 3300009551 Bacteria 8515
314 Ga0105249_10001949 3300009553 Bacteria 17907
315 Ga0105249_10008029 3300009553 Bacteria 9197
316 Ga0105249_10039521 3300009553 Bacteria 4284
317 Ga0105249_10842925 3300009553 Bacteria 982
318 Ga0105249_11258783 3300009553 Bacteria 811
319 Ga0105239_10765907 3300010375 Bacteria 1105
320 Ga0105239_13393618 3300010375 Bacteria 518
321 Ga0105246_10061349 3300011119 Bacteria 2616
322 Ga0105246_10277113 3300011119 Bacteria 1344
323 Ga0157347_1005237 3300012502 Bacteria 1233
324 Ga0157339_1018539 3300012505 Bacteria 717
325 Ga0157371_10852489 3300013102 Bacteria 689
326 Ga0157370_10317372 3300013104 Bacteria 1438
327 Ga0157374_11792230 3300013296 Bacteria 639
328 Ga0157378_10000332 3300013297 Bacteria 46615
329 Ga0157378_10074507 3300013297 Bacteria 3055
330 Ga0157378_10138887 3300013297 Unclassified 2255
331 Ga0157378_10251993 3300013297 Bacteria 1690
332 Ga0157378_10334897 3300013297 Bacteria 1474
333 Ga0157378_10844525 3300013297 Bacteria 944
334 Ga0163162_10154008 3300013306 Bacteria 2418
335 Ga0163162_10203539 3300013306 Bacteria 2109
336 Ga0157375_10012915 3300013308 Bacteria 7419
337 Ga0157375_11441006 3300013308 Bacteria 812
338 Ga0163163_10068226 3300014325 Bacteria 3538
339 Ga0163163_10075378 3300014325 Bacteria 3367
340 Ga0157380_10200027 3300014326 Bacteria 1772
341 Ga0157380_10626205 3300014326 Bacteria 1069
342 Ga0157380_12381803 3300014326 Bacteria 594
343 Ga0157377_10037420 3300014745 Bacteria 2673
344 Ga0157377_10339785 3300014745 Bacteria 1004
345 Ga0157379_10174748 3300014968 Bacteria 1939
346 Ga0157379_10329255 3300014968 Bacteria 1395
347 Ga0157379_10567852 3300014968 Bacteria 1057
348 Ga0157376_10053003 3300014969 Bacteria 3376
349 Ga0163161_10000193 3300017792 Bacteria 56074
350 Ga0209436_103446 3300025208 Bacteria 4211
351 Ga0207425_1000295 3300025245 Bacteria 36319
352 Ga0207425_1006691 3300025245 Bacteria 3125
353 Ga0209129_1000007 3300025258 Bacteria 771325
354 Ga0209129_1002839 3300025258 Bacteria 8016
355 Ga0209129_1004098 3300025258 Bacteria 5933
356 Ga0209129_1035902 3300025258 Bacteria 804
357 Ga0209565_1000937 3300025263 Bacteria 15341
358 Ga0209565_1004131 3300025263 Bacteria 4515
359 Ga0209565_1004138 3300025263 Bacteria 4508
360 Ga0209673_1000133 3300025273 Bacteria 161740
361 Ga0209673_1000304 3300025273 Bacteria 91151
362 Ga0209130_1000070 3300025284 Bacteria 179057
363 Ga0209130_1000126 3300025284 Bacteria 123694
364 Ga0209130_1000326 3300025284 Bacteria 54842
365 Ga0209675_1000498 3300025291 Bacteria 29455
366 Ga0209675_1000516 3300025291 Bacteria 28507
367 Ga0209675_1011016 3300025291 Bacteria 3033
368 Ga0209676_1000122 3300025292 Bacteria 195510
369 Ga0209676_1000268 3300025292 Bacteria 108430
370 Ga0209676_1001242 3300025292 Bacteria 26866
371 Ga0209676_1001471 3300025292 Bacteria 21884
372 Ga0209025_1000111 3300025294 Bacteria 218982
373 Ga0209025_1000432 3300025294 Bacteria 82875
374 Ga0209025_1000480 3300025294 Bacteria 77443
375 Ga0209025_1005232 3300025294 Bacteria 10693
376 Ga0209564_1000524 3300025295 Bacteria 62668
377 Ga0209564_1000594 3300025295 Bacteria 56686
378 Ga0209758_1000025 3300025297 Bacteria 586687
379 Ga0209758_1001305 3300025297 Bacteria 30465
380 Ga0209758_1002137 3300025297 Bacteria 20841
381 Ga0209758_1109639 3300025297 Bacteria 767
382 Ga0209050_1000002 3300025298 Bacteria 1792849
383 Ga0209050_1001024 3300025298 Bacteria 34874
384 Ga0209256_1000050 3300025299 Bacteria 308622
385 Ga0209256_1000063 3300025299 Bacteria 252716
386 Ga0207426_1000001 3300025302 Bacteria 1341301
387 Ga0207426_1000028 3300025302 Bacteria 483955
388 Ga0207426_1000046 3300025302 Bacteria 422271
389 Ga0207426_1056346 3300025302 Bacteria 1148
390 Ga0209051_1000002 3300025303 Bacteria 1631846
391 Ga0209051_1000343 3300025303 Bacteria 69952
392 Ga0209051_1000618 3300025303 Bacteria 40891
393 Ga0209051_1010933 3300025303 Bacteria 4529
394 Ga0209051_1031937 3300025303 Bacteria 2017
395 Ga0209257_1000002 3300025304 Bacteria 1767052
396 Ga0209257_1000333 3300025304 Bacteria 98599
397 Ga0209257_1001964 3300025304 Bacteria 22160
398 Ga0209257_1010999 3300025304 Bacteria 4445
399 Ga0209257_1016193 3300025304 Bacteria 3036
400 Ga0207655_1091965 3300025728 Bacteria 1065
401 Ga0207653_10012222 3300025885 Bacteria 2681
402 Ga0207642_10000468 3300025899 Bacteria 12355
403 Ga0207688_10039885 3300025901 Bacteria 2608
404 Ga0207688_10422809 3300025901 Bacteria 828
405 Ga0207680_10171904 3300025903 Bacteria 1460
406 Ga0207685_10026196 3300025905 Bacteria 2024
407 Ga0207645_10327377 3300025907 Bacteria 1023
408 Ga0207643_10040270 3300025908 Bacteria 2630
409 Ga0207705_10289537 3300025909 Bacteria 1255
410 Ga0207684_10993282 3300025910 Bacteria 702
411 Ga0207654_10122196 3300025911 Bacteria 1637
412 Ga0207707_10706647 3300025912 Bacteria 846
413 Ga0207693_10096087 3300025915 Bacteria 2323
414 Ga0207660_10001415 3300025917 Bacteria 16105
415 Ga0207660_10563692 3300025917 Bacteria 927
416 Ga0207662_10000321 3300025918 Bacteria 21775
417 Ga0207662_10006890 3300025918 Bacteria 6158
418 Ga0207662_10333895 3300025918 Bacteria 1014
419 Ga0207662_10749414 3300025918 Bacteria 686
420 Ga0207649_10776863 3300025920 Bacteria 747
421 Ga0207652_10020457 3300025921 Bacteria 5449
422 Ga0207652_10201294 3300025921 Bacteria 1792
423 Ga0207646_10259782 3300025922 Bacteria 1570
424 Ga0207646_10446469 3300025922 Bacteria 1167
425 Ga0207646_11635759 3300025922 Bacteria 555
426 Ga0207646_11776669 3300025922 Unclassified 528
427 Ga0207681_10006525 3300025923 Bacteria 7158
428 Ga0207681_10490739 3300025923 Bacteria 1004
429 Ga0207694_10003297 3300025924 Bacteria 12840
430 Ga0207694_10259732 3300025924 Bacteria 1423
431 Ga0207694_11264429 3300025924 Bacteria 624
432 Ga0207650_10117443 3300025925 Bacteria 2067
433 Ga0207659_10004378 3300025926 Bacteria 8532
434 Ga0207659_11242382 3300025926 Bacteria 640
435 Ga0207687_10006332 3300025927 Bacteria 7824
436 Ga0207687_10026769 3300025927 Bacteria 3864
437 Ga0207700_11285738 3300025928 Bacteria 652
438 Ga0207644_10095970 3300025931 Bacteria 2218
439 Ga0207644_10679868 3300025931 Bacteria 858
440 Ga0207706_10117274 3300025933 Bacteria 2341
441 Ga0207706_10121753 3300025933 Bacteria 2294
442 Ga0207686_10000270 3300025934 Bacteria 38522
443 Ga0207686_10132819 3300025934 Bacteria 1709
444 Ga0207709_10000425 3300025935 Bacteria 40645
445 Ga0207709_10001288 3300025935 Bacteria 17893
446 Ga0207709_10014698 3300025935 Bacteria 4326
447 Ga0207709_10273485 3300025935 Bacteria 1244
448 Ga0207709_11130977 3300025935 Bacteria 644
449 Ga0207670_10002400 3300025936 Bacteria 9816
450 Ga0207670_10022262 3300025936 Bacteria 3925
451 Ga0207670_11399229 3300025936 Bacteria 594
452 Ga0207669_10008844 3300025937 Bacteria 4754
453 Ga0207704_10000797 3300025938 Bacteria 13935
454 Ga0207704_10302164 3300025938 Bacteria 1226
455 Ga0207704_11226878 3300025938 Bacteria 640
456 Ga0207665_10408695 3300025939 Bacteria 1035
457 Ga0207691_10029622 3300025940 Bacteria 5120
458 Ga0207711_10060547 3300025941 Bacteria 3263
459 Ga0207711_10759993 3300025941 Bacteria 903
460 Ga0207689_10000691 3300025942 Bacteria 32302
461 Ga0207689_10223061 3300025942 Bacteria 1557
462 Ga0207679_10548749 3300025945 Bacteria 1037
463 Ga0207679_10553632 3300025945 Bacteria 1032
464 Ga0207667_10002649 3300025949 Bacteria 22123
465 Ga0207667_10729112 3300025949 Bacteria 992
466 Ga0207651_10017321 3300025960 Bacteria 4254
467 Ga0207651_10171069 3300025960 Bacteria 1713
468 Ga0207651_10842780 3300025960 Bacteria 814
469 Ga0207651_12065328 3300025960 Bacteria 512
470 Ga0207712_10007497 3300025961 Bacteria 6887
471 Ga0207712_10027019 3300025961 Bacteria 3830
472 Ga0207712_10045740 3300025961 Bacteria 3032
473 Ga0207668_10002266 3300025972 Bacteria 11224
474 Ga0207668_10140769 3300025972 Bacteria 1855
475 Ga0207668_10774644 3300025972 Bacteria 848
476 Ga0207640_10155833 3300025981 Bacteria 1683
477 Ga0207640_10447266 3300025981 Bacteria 1064
478 Ga0207658_10063781 3300025986 Bacteria 2762
479 Ga0207658_10323307 3300025986 Bacteria 1336
480 Ga0207677_10006235 3300026023 Bacteria 6523
481 Ga0207677_11156331 3300026023 Bacteria 707
482 Ga0207703_10011257 3300026035 Bacteria 6959
483 Ga0207703_10020856 3300026035 Bacteria 5127
484 Ga0207639_10009520 3300026041 Bacteria 6707
485 Ga0207639_10058142 3300026041 Bacteria 2972
486 Ga0207639_10105065 3300026041 Bacteria 2291
487 Ga0207639_10108699 3300026041 Bacteria 2255
488 Ga0207639_10768672 3300026041 Bacteria 896
489 Ga0207639_11687155 3300026041 Bacteria 594
490 Ga0207639_12005976 3300026041 Bacteria 540
491 Ga0207678_10654021 3300026067 Bacteria 923
492 Ga0207708_10000182 3300026075 Bacteria 49271
493 Ga0207708_10077899 3300026075 Bacteria 2545
494 Ga0207708_10507107 3300026075 Bacteria 1012
495 Ga0207708_10801077 3300026075 Bacteria 811
496 Ga0207702_10007177 3300026078 Bacteria 9535
497 Ga0207702_10702571 3300026078 Bacteria 996
498 Ga0207641_10068585 3300026088 Bacteria 3041
499 Ga0207641_10643021 3300026088 Bacteria 1041
500 Ga0207648_10000335 3300026089 Bacteria 51594
501 Ga0207648_10024037 3300026089 Bacteria 5447
502 Ga0207648_10482256 3300026089 Bacteria 1133
503 Ga0207676_10032953 3300026095 Bacteria 3910
504 Ga0207676_10181122 3300026095 Bacteria 1845
505 Ga0207676_10738987 3300026095 Bacteria 956
506 Ga0207674_10028441 3300026116 Bacteria 5900
507 Ga0207674_10527877 3300026116 Bacteria 1140
508 Ga0207674_10887388 3300026116 Bacteria 860
509 Ga0207675_100000142 3300026118 Bacteria 61826
510 Ga0207675_100001323 3300026118 Bacteria 24831
511 Ga0207675_100028037 3300026118 Bacteria 5243
512 Ga0207683_10039230 3300026121 Bacteria 4131
513 Ga0207683_10511843 3300026121 Bacteria 1109
514 Ga0209589_1000015 3300027357 Bacteria 225913
515 Ga0209489_100015 3300027361 Bacteria 225913
516 Ga0209700_100025 3300027363 Bacteria 225913
517 Ga0209967_1019733 3300027364 Bacteria 981
518 Ga0209968_1055410 3300027526 Bacteria 693
519 Ga0209971_1074451 3300027682 Bacteria 825
520 Ga0209966_1085378 3300027695 Bacteria 703
521 Ga0209813_10264236 3300027866 Bacteria 658
522 Ga0207428_10001362 3300027907 Bacteria 25965
523 Ga0207428_10006800 3300027907 Bacteria 10488
524 Ga0207428_10099073 3300027907 Bacteria 2254
525 Ga0207428_10202744 3300027907 Bacteria 1492
526 Ga0268266_10065692 3300028379 Bacteria 3136
527 Ga0268266_10823025 3300028379 Bacteria 897
528 Ga0268266_12242856 3300028379 Bacteria 518
529 Ga0268265_10000934 3300028380 Bacteria 26899
530 Ga0268265_10002870 3300028380 Bacteria 12667
531 Ga0268265_10003566 3300028380 Bacteria 11121
532 Ga0268265_10382513 3300028380 Bacteria 1295
533 Ga0268265_10410080 3300028380 Bacteria 1255
534 Ga0268265_11862065 3300028380 Bacteria 608
535 Ga0268264_10000446 3300028381 Bacteria 56436
536 Ga0268264_10552709 3300028381 Bacteria 1129
537 Ga0268264_10598319 3300028381 Bacteria 1086
538 Ga0268264_12453646 3300028381 Bacteria 527
539 Ga0307515_10497397 3300028794 Bacteria 830
540 Ga0265316_10910654 3300031344 Bacteria 614
541 Ga0307408_100007266 3300031548 Bacteria 7326
542 Ga0307408_100084637 3300031548 Bacteria 2379
543 Ga0307408_101001178 3300031548 Bacteria 770
544 Ga0307408_102348740 3300031548 Bacteria 517
545 Ga0307516_10025336 3300031730 Bacteria 6042
546 Ga0307516_10934119 3300031730 Bacteria 536
547 Ga0307405_10301564 3300031731 Bacteria 1215
548 Ga0307405_11177955 3300031731 Bacteria 662
549 Ga0307406_10000864 3300031901 Bacteria 17063
550 Ga0307406_10102838 3300031901 Bacteria 1950
551 Ga0307412_10011951 3300031911 Bacteria 5044
552 Ga0307412_11552046 3300031911 Bacteria 603
553 Ga0307409_100598867 3300031995 Bacteria 1089
554 Ga0307409_101391232 3300031995 Bacteria 728
555 Ga0307409_101431766 3300031995 Bacteria 718
556 Ga0307409_101644150 3300031995 Bacteria 671
557 Ga0307416_100074967 3300032002 Bacteria 2829
558 Ga0307416_100463475 3300032002 Bacteria 1323
559 Ga0307416_101047192 3300032002 Bacteria 920
560 Ga0307416_101392562 3300032002 Bacteria 807
561 Ga0307416_103242876 3300032002 Bacteria 544
562 Ga0307411_10554270 3300032005 Bacteria 981
563 Ga0307411_10669711 3300032005 Bacteria 900
564 Ga0307415_100196605 3300032126 Bacteria 1596
565 Ga0307415_100601000 3300032126 Bacteria 979
566 Ga0307510_10465125 3300033180 Bacteria 706
567 Ga0373926_0000157 3300035083 Bacteria 14837
568 Ga0373940_0134852 3300035088 Bacteria 776
569 Ga0373944_0323882 3300035089 Bacteria 582
570 Ga0373949_0047119 3300035090 Bacteria 1076
571 Ga0373936_0085866 3300035113 Bacteria 1314
572 Ga0373939_0060192 3300035114 Bacteria 1206
573 Ga0373939_0206704 3300035114 Bacteria 745
574 Ga0373939_0492350 3300035114 Bacteria 522
575 Ga0373941_0037244 3300035115 Bacteria 1483
576 Ga0373945_0202334 3300035116 Bacteria 825
577 Ga0373956_0101854 3300035119 Bacteria 1333
578 Ga0373960_0199732 3300035121 Bacteria 706
579 Ga0373943_0262399 3300035170 Bacteria 973
580 Ga0373962_0002777 3300035242 Bacteria 4174
581 Ga0373931_0004707 3300035691 Bacteria 6249
582 Ga0373931_0344407 3300035691 Bacteria 931
583 Ga0373935_0176088 3300035692 Bacteria 1466
584 Ga0373935_0932350 3300035692 Bacteria 644
585 Ga0373927_0276097 3300035695 Bacteria 1105
586 Ga0373933_0433824 3300035724 Bacteria 859
587 Ga0373937_1243140 3300036401 Bacteria 693
588 Ga0373937_1591613 3300036401 Bacteria 601
589 Ga0373925_0027752 3300037068 Bacteria 4144
590 Ga0373925_0314085 3300037068 Bacteria 1267
591 Ga0373925_0627873 3300037068 Bacteria 885
592 Ga0395899_0606705 3300037312 Bacteria 696
593 Ga0395900_1558168 3300037418 Bacteria 572
594 Ga0395898_1373559 3300037466 Bacteria 634
595 Ga0436364_1056250 3300037853 Bacteria 3277
596 Ga0395901_1083647 3300038443 Bacteria 772
597 Ga0436365_0984935 3300039437 Bacteria 1563
598 Ga0436365_1258172 3300039437 Bacteria 747
599 Ga0439439_0106361 3300041406 Bacteria 775
600 Ga0439453_0034710 3300041408 Bacteria 969
601 Ga0439465_0261949 3300041413 Bacteria 641
602 Ga0451791_1242738 3300041451 Bacteria 780
603 Ga0451798_0391002 3300041458 Bacteria 861
604 Ga0451853_0286293 3300041512 Bacteria 761
605 Ga0439431_0221383 3300041997 Bacteria 556
606 Ga0450888_039674 3300042126 Bacteria 652
607 Ga0439434_0063850 3300042435 Bacteria 1154
608 Ga0451577_0375143 3300042876 Bacteria 1291
609 Ga0451577_0647980 3300042876 Bacteria 958
610 Ga0466972_0114099 3300044658 Bacteria 1276
611 Ga0466972_0359088 3300044658 Bacteria 682
612 Ga0466965_0026346 3300044683 Bacteria 2818
613 Ga0466965_0496351 3300044683 Bacteria 684
614 Ga0466964_0010808 3300044706 Bacteria 3447
615 Ga0451576_0040510 3300045051 Bacteria 4929
616 Ga0451576_0046981 3300045051 Bacteria 4541
617 Ga0451576_0064154 3300045051 Bacteria 3826
618 Ga0451576_0429688 3300045051 Bacteria 1386
619 Ga0451576_1096805 3300045051 Unclassified 833
620 Ga0451576_2063758 3300045051 Bacteria 587
621 Ga0466967_0007238 3300045976 Bacteria 7978
622 Ga0495627_006801 3300046453 Bacteria 4450
623 Ga0495638_0127269 3300046460 Bacteria 1500
624 Ga0495650_0289448 3300046471 Bacteria 550
625 Ga0495639_0092882 3300046475 Bacteria 1418
626 Ga0495585_0313774 3300046492 Bacteria 768
627 Ga0495610_0020716 3300046512 Bacteria 3643
628 Ga0495610_0049408 3300046512 Bacteria 2060
629 Ga0495610_0085333 3300046512 Bacteria 1441
630 Ga0495610_0309964 3300046512 Bacteria 606
631 Ga0495616_0030852 3300046513 Bacteria 2811
632 Ga0495620_0110834 3300046515 Bacteria 1088
633 Ga0495631_0000228 3300046518 Bacteria 38440
634 Ga0495637_0003270 3300046520 Bacteria 8620
635 Ga0495637_0017432 3300046520 Bacteria 3347
636 Ga0495648_0486764 3300046524 Bacteria 532
637 Ga0495654_0008482 3300046530 Bacteria 5672
638 Ga0495654_0198380 3300046530 Bacteria 860
639 Ga0495586_0001910 3300046535 Bacteria 11347
640 Ga0495621_0025662 3300046539 Bacteria 1982
641 Ga0495621_0034177 3300046539 Bacteria 1756
642 Ga0495633_0374170 3300046558 Bacteria 645
643 Ga0495668_0085111 3300046616 Bacteria 1734
644 Ga0495668_0299807 3300046616 Bacteria 881
645 Ga0495611_0034497 3300046648 Bacteria 2237
646 Ga0495625_0043979 3300046660 Bacteria 3235
647 Ga0495625_0158703 3300046660 Bacteria 1516
648 Ga0495659_0466040 3300046664 Bacteria 551
649 Ga0495661_0081910 3300046665 Bacteria 1859
650 Ga0495588_0033283 3300046674 Bacteria 2602
651 Ga0495588_0037595 3300046674 Bacteria 2460
652 Ga0495658_0067510 3300046683 Bacteria 2068
653 Ga0495658_0136418 3300046683 Bacteria 1497
654 Ga0495670_0017426 3300046691 Bacteria 3534
655 Ga0495670_0310459 3300046691 Bacteria 846
656 Ga0495671_0016975 3300046692 Bacteria 3878
657 Ga0495600_0896140 3300046809 Bacteria 524
658 Ga0495581_0344213 3300047315 Bacteria 870
659 Ga0495604_0911006 3300047317 Bacteria 549
660 Ga0495676_0016422 3300047321 Bacteria 6571
661 Ga0495676_0032519 3300047321 Bacteria 4402
662 Ga0495676_0954017 3300047321 Bacteria 548
663 Ga0495673_0053813 3300047469 Bacteria 1753
664 Ga0495686_0302814 3300047472 Bacteria 882
665 Ga0495593_0007756 3300047673 Bacteria 6256
666 Ga0495614_0004411 3300048089 Bacteria 6345
667 Ga0496100_0032873 3300048903 Bacteria 3240
668 Ga0496100_0426347 3300048903 Bacteria 1014
669 Ga0496101_0063210 3300048904 Bacteria 2694
670 Ga0496104_0007351 3300048907 Bacteria 9725
671 Ga0496105_0002518 3300048908 Bacteria 13288
672 Ga0496106_0108520 3300048909 Bacteria 2159
673 Ga0496107_0392174 3300048910 Bacteria 1033
674 Ga0496108_0000416 3300048911 Bacteria 34834
675 Ga0496109_0001317 3300048912 Bacteria 20486
676 Ga0496109_0144616 3300048912 Bacteria 2224
677 Ga0496110_0004470 3300048913 Bacteria 10838
678 Ga0496110_0289343 3300048913 Bacteria 1492
679 Ga0496111_0015024 3300048914 Bacteria 5303
680 Ga0496111_0672538 3300048914 Bacteria 754
681 Ga0496112_0007446 3300048915 Bacteria 9715
682 Ga0496113_0001503 3300048916 Bacteria 13056
683 Ga0496113_0513156 3300048916 Bacteria 962
684 Ga0496114_0109856 3300048917 Bacteria 2361
685 Ga0496115_0001063 3300048918 Bacteria 19879
686 Ga0496118_0047253 3300048921 Bacteria 3338
687 Ga0496118_0552753 3300048921 Bacteria 561
688 Ga0496121_0191741 3300048924 Bacteria 1464
689 Ga0496124_0146552 3300048927 Bacteria 1857
690 Ga0496125_0030971 3300048928 Bacteria 4776
691 Ga0496125_0142168 3300048928 Bacteria 1666
692 Ga0496125_0182201 3300048928 Bacteria 1398
693 Ga0496126_0146230 3300048929 Bacteria 2030
694 Ga0501290_038401 3300049513 Bacteria 709
695 Ga0501291_015509 3300049514 Bacteria 1152
696 Ga0501298_012971 3300049521 Bacteria 1468
697 Ga0501299_039254 3300049522 Bacteria 944
698 Ga0501299_043836 3300049522 Bacteria 905
699 Ga0501300_007930 3300049523 Bacteria 1557
700 Ga0501300_021066 3300049523 Bacteria 952
701 Ga0501301_004281 3300049524 Bacteria 1009
702 Ga0501303_015012 3300049526 Bacteria 770
703 Ga0501031_0552354 3300049568 Bacteria 742
704 Ga0501031_0584065 3300049568 Bacteria 719
705 Ga0501032_0131584 3300049569 Bacteria 1651
706 Ga0501033_0041065 3300049570 Bacteria 3453
707 Ga0501033_0214561 3300049570 Bacteria 1372
708 Ga0501033_0426682 3300049570 Bacteria 923
709 Ga0501033_0574894 3300049570 Bacteria 774
710 Ga0501034_0000730 3300049571 Bacteria 49754
711 Ga0501034_0086279 3300049571 Bacteria 3140
712 Ga0501036_0285435 3300049572 Bacteria 1381
713 Ga0501036_0385468 3300049572 Bacteria 1170
714 Ga0501037_1033453 3300049573 Bacteria 534
715 Ga0501038_0265701 3300049574 Bacteria 1354
716 Ga0501038_0798995 3300049574 Bacteria 701
717 Ga0501038_0839378 3300049574 Bacteria 681
718 Ga0501039_0228504 3300049575 Bacteria 1463
719 Ga0501042_0753860 3300049578 Bacteria 708
720 Ga0501043_0044068 3300049579 Bacteria 3507
721 Ga0501043_0146762 3300049579 Bacteria 1847
722 Ga0501043_0628128 3300049579 Bacteria 791
723 Ga0501047_0042513 3300049581 Bacteria 4391
724 Ga0501047_0134767 3300049581 Bacteria 2350
725 Ga0501047_0419993 3300049581 Bacteria 1169
726 Ga0501048_1020764 3300049582 Bacteria 595
727 Ga0501067_0340210 3300049583 Bacteria 836
728 Ga0501068_0001132 3300049584 Bacteria 14129
729 Ga0501070_0195616 3300049586 Bacteria 1661
730 Ga0501070_0235628 3300049586 Bacteria 1499
731 Ga0501070_0919083 3300049586 Bacteria 682
732 Ga0501071_0360181 3300049587 Bacteria 1108
733 Ga0501072_0479868 3300049588 Bacteria 984
734 Ga0501073_0014430 3300049589 Bacteria 5740
735 Ga0501073_0063886 3300049589 Bacteria 2567
736 Ga0501074_0500443 3300049590 Bacteria 861
737 Ga0501076_0898939 3300049592 Bacteria 730
738 Ga0501077_0640044 3300049593 Bacteria 683
739 Ga0501077_1081064 3300049593 Bacteria 516
740 Ga0501217_028643 3300049661 Bacteria 1358
741 Ga0501222_085773 3300049662 Bacteria 507
742 Ga0501228_009623 3300049666 Bacteria 947
743 Ga0501233_098885 3300049668 Bacteria 769
744 Ga0501235_110828 3300049669 Bacteria 679
745 Ga0501239_024681 3300049672 Bacteria 758
746 Ga0501243_063823 3300049675 Bacteria 688
747 Ga0501249_005412 3300049679 Bacteria 2610
748 Ga0501253_026319 3300049683 Bacteria 1071
749 Ga0501255_035596 3300049684 Bacteria 711
750 Ga0501257_074952 3300049686 Bacteria 868
751 Ga0501225_0050068 3300049705 Bacteria 1162
752 Ga0501234_037477 3300049707 Bacteria 789
753 Ga0501234_093641 3300049707 Bacteria 541
754 Ga0501079_1004698 3300049741 Bacteria 657
755 Ga0501079_1187223 3300049741 Bacteria 601
756 Ga0501080_0089685 3300049742 Bacteria 2856
757 Ga0501080_0111349 3300049742 Bacteria 2537
758 Ga0501083_0039536 3300049744 Bacteria 3204
759 Ga0501083_0057120 3300049744 Bacteria 2613
760 Ga0501268_021864 3300049765 Bacteria 1100
761 Ga0501273_024961 3300049770 Bacteria 827
762 Ga0501283_016634 3300049779 Bacteria 1143
763 Ga0501035_0099387 3300049822 Bacteria 2554
764 Ga0501035_0229301 3300049822 Bacteria 1583
765 Ga0501035_1571069 3300049822 Bacteria 500
766 Ga0501044_0020908 3300049823 Bacteria 6987
767 Ga0501044_0043051 3300049823 Bacteria 4692
768 Ga0501044_0078100 3300049823 Bacteria 3355
769 Ga0501045_0536489 3300049824 Bacteria 868
770 Ga0501045_0574202 3300049824 Bacteria 836
771 Ga0501226_010258 3300049853 Bacteria 1039
772 nmdc:mga03n38_295779_c1 3300050490 Bacteria 868
773 nmdc:mga03n38_307011_c1 3300050490 Bacteria 853
774 nmdc:mga0k408_52439_c1 3300050493 Bacteria 2364
775 nmdc:mga07m45_19644_c1 3300050496 Bacteria 3662
776 nmdc:mga07m45_7294_c1 3300050496 Bacteria 5641
777 nmdc:mga05p37_1249654_c1 3300050507 Bacteria 762
778 nmdc:mga05p37_1520_c1 3300050507 Bacteria 27010
779 nmdc:mga05p37_185_c1 3300050507 Bacteria 61269
780 nmdc:mga05p37_374128_c1 3300050507 Bacteria 1671
781 nmdc:mga05p37_63921_c1 3300050507 Bacteria 4529
782 nmdc:mga05p37_9043_c1 3300050507 Bacteria 11777
783 nmdc:mga09592_1601_c1 3300050508 Bacteria 18249
784 nmdc:mga09592_3010_c1 3300050508 Bacteria 13665
785 nmdc:mga09592_3996_c1 3300050508 Bacteria 11887
786 nmdc:mga09592_487_c1 3300050508 Bacteria 29737
787 nmdc:mga09592_73735_c1 3300050508 Bacteria 2900
788 nmdc:mga0qj67_37729_c1 3300050509 Bacteria 3788
789 nmdc:mga0qj67_415810_c1 3300050509 Unclassified 1084
790 nmdc:mga0qj67_54926_c2 3300050509 Bacteria 1255
791 nmdc:mga06r32_142565_c1 3300050510 Bacteria 2373
792 nmdc:mga06r32_1976653_c1 3300050510 Bacteria 517
793 nmdc:mga06r32_247202_c1 3300050510 Bacteria 1771
794 nmdc:mga06r32_26444_c1 3300050510 Bacteria 5410
795 nmdc:mga06r32_265728_c1 3300050510 Bacteria 1703
796 nmdc:mga06r32_699_c1 3300050510 Bacteria 29308
797 nmdc:mga06r32_77534_c1 3300050510 Bacteria 3229
798 nmdc:mga08y16_1050398_c1 3300050511 Bacteria 792
799 nmdc:mga08y16_2117_c1 3300050511 Bacteria 20347
800 nmdc:mga08y16_2380_c1 3300050511 Bacteria 19295
801 nmdc:mga08y16_334077_c1 3300050511 Bacteria 1558
802 nmdc:mga08y16_502_c1 3300050511 Bacteria 36044
803 nmdc:mga08y16_61819_c1 3300050511 Bacteria 3911
804 nmdc:mga0n895_228066_c1 3300050512 Bacteria 1891
805 nmdc:mga0n895_335547_c1 3300050512 Bacteria 1532
806 nmdc:mga0n895_762708_c1 3300050512 Bacteria 960
807 nmdc:mga0rr50_2784_c2 3300050513 Bacteria 3880
808 nmdc:mga0rr50_343494_c1 3300050513 Bacteria 1254
809 nmdc:mga08x19_1244921_c1 3300050514 Bacteria 527
810 nmdc:mga08x19_200250_c1 3300050514 Bacteria 1368
811 nmdc:mga08x19_251957_c1 3300050514 Bacteria 1219
812 nmdc:mga08x19_404938_c1 3300050514 Bacteria 957
813 nmdc:mga0a205_1103182_c1 3300050515 Bacteria 641
814 nmdc:mga0a205_177147_c1 3300050515 Bacteria 2027
815 Ga0500610_0000863 3300053079 Bacteria 9710
816 Ga0500610_0002219 3300053079 Bacteria 7031
817 Ga0495619_0341420 3300053085 Bacteria 1036
818 Ga0500643_004104 3300053087 Bacteria 6712
819 Ga0500651_0000097 3300053093 Bacteria 53876
820 Ga0500566_0221797 3300053094 Bacteria 939
821 Ga0500641_0210319 3300053096 Bacteria 828
822 Ga0500555_076491 3300053103 Bacteria 876
823 Ga0500569_022372 3300053109 Bacteria 1683
824 Ga0500571_000190 3300053110 Bacteria 22258
825 Ga0500572_277645 3300053111 Bacteria 542
826 Ga0500592_001100 3300053116 Bacteria 4411
827 Ga0500593_000202 3300053117 Bacteria 24296
828 Ga0500595_051415 3300053119 Bacteria 1276
829 Ga0500607_002610 3300053121 Bacteria 14302
830 Ga0500608_061882 3300053122 Bacteria 1788
831 Ga0500608_255247 3300053122 Bacteria 681
832 Ga0500617_100156 3300053124 Bacteria 1226
833 Ga0500642_0400374 3300053130 Bacteria 599
834 Ga0500658_0000521 3300053134 Bacteria 16260
835 Ga0500658_0000753 3300053134 Bacteria 13371
836 Ga0500559_0008548 3300053136 Bacteria 4480
837 Ga0500564_078987 3300053138 Bacteria 1476
838 Ga0500568_0002122 3300053139 Bacteria 11970
839 Ga0500574_000630 3300053141 Bacteria 4568
840 Ga0500588_0001478 3300053146 Bacteria 4479
841 Ga0500616_0207487 3300053153 Bacteria 863
842 Ga0500619_233122 3300053154 Bacteria 610
843 Ga0500627_0004369 3300053158 Bacteria 4530
844 Ga0500634_0040681 3300053161 Bacteria 2526
845 Ga0500634_0048954 3300053161 Bacteria 2280
846 Ga0500638_085098 3300053162 Bacteria 1497
847 Ga0500636_0037156 3300053177 Bacteria 2882
848 Ga0500645_073596 3300053730 Bacteria 979
849 Ga0500565_028227 3300053734 Bacteria 722
850 Ga0501084_0228889 3300054114 Bacteria 1569
851 Ga0501084_1520306 3300054114 Bacteria 560
852 Ga0500661_019643 3300055283 Bacteria 1203
853 Ga0501082_0101653 3300060353 Bacteria 2487
854 Ga0501082_0412693 3300060353 Bacteria 1179
855 Ga0501082_1028035 3300060353 Bacteria 720
856 Ga0501082_1994931 3300060353 Bacteria 506
857 2599623547 2599185214 Bacteria 8209958
858 2599671835 2599185226 Bacteria 8233575
859 2599681152 2599185227 Bacteria 8246414
860 2599693444 2599185229 Bacteria 8216126
861 2644401565 2643221672 Bacteria 6322190
862 2644468074 2643221683 Bacteria 5749203
863 2821447080 2821443989 Bacteria 7658172
864 2831266233 2831265667 Bacteria 7184833
865 2838057657 2838054893 Bacteria 7451788
866 2844539854 2844533157 Bacteria 7517899
867 2883359224 2883354860 Bacteria 5865246
868 2885204349 2885198086 Bacteria 7212419
869 2885218002 2885211737 Bacteria 7212420
870 2928071840 2928070936 Bacteria 8062541
871 2928084224 2928084124 Bacteria 7159212
872 2929527224 2929520902 Bacteria 6765052
873 2945986237 2945984333 Bacteria 7358892
874 Ga0501074_0570194
875 JGI24740J21852_10066190
876 JGI25152J39213_1004368
877 JGI25150J39212_1001139
878 JGI25150J39212_1040201
879 JGI25159J45721_1004679
880 JGI25159J45721_1008367
881 JGI25151J46595_10000186
882 JGI25151J46595_10014710
883 JGI25151J46595_10015765
884 JGI25151J46595_10025387
885 JGI25406J46586_10006010
886 JGI25153J46596_10009593
887 JGI25153J46596_10016109
888 JGI25153J46596_10050016
889 rootH1_10344455
890 JGI25160J50197_1006918
891 JGI25160J50197_1011692
892 JGI25160J50197_1026419
893 JGI25161J50226_1001836
894 JGI25161J50226_1005169
895 Ga0006562J51391_1035342
896 Ga0055526_1005930
897 Ga0055526_1009084
898 Ga0055537_1003864
899 Ga0055537_1007003
900 Ga0055524_1004119
901 Ga0055524_1004131
902 Ga0055536_1007403
903 Ga0055536_1028442
904 Ga0055534_1001253
905 Ga0055534_1003948
906 Ga0055528_1008304
907 Ga0055528_1015303
908 Ga0055530_10000777
909 Ga0055530_10015810
910 Ga0055540_1001252
911 Ga0055540_1001662
912 Ga0055540_1002289
913 Ga0055540_1005120
914 Ga0055540_1029782
915 Ga0055531_10002682
916 Ga0055531_10010859
917 Ga0055531_10022715
918 Ga0055543_1000748
919 Ga0055543_1009383
920 Ga0065165_1003702
921 Ga0065165_1027238
922 Ga0065712_10000815
923 Ga0065707_10198505
924 Ga0070676_10196109
925 Ga0070690_100140370
926 Ga0070670_100015066
927 Ga0068869_100000367
928 Ga0068869_100002624
929 Ga0068869_101859052
930 Ga0070666_10315094
931 Ga0070666_10874700
932 Ga0070680_100000888
933 Ga0070680_100039045
934 Ga0070680_100586920
935 Ga0070682_100003096
936 Ga0070682_100089007
937 Ga0070682_100902227
938 Ga0068868_100007192
939 Ga0068868_100043292
940 Ga0070660_100723443
941 Ga0070689_100000189
942 Ga0070689_100016031
943 Ga0070689_100162277
944 Ga0070689_101758300
945 Ga0070691_10002470
946 Ga0070691_10217911
947 Ga0070687_100000020
948 Ga0070687_100001992
949 Ga0070687_100627524
950 Ga0070661_100014675
951 Ga0070692_10001522
952 Ga0070692_10320342
953 Ga0070692_10403843
954 Ga0070668_100021359
955 Ga0070668_100024317
956 Ga0070669_100008827
957 Ga0070669_100024538
958 Ga0070669_100523307
959 Ga0070675_100001749
960 Ga0070675_100092376
961 Ga0070671_100051978
962 Ga0070671_100473250
963 Ga0070671_100748608
964 Ga0070674_100108570
965 Ga0070673_100012093
966 Ga0070673_100076051
967 Ga0070673_100105998
968 Ga0070688_100029510
969 Ga0070688_100406951
970 Ga0070688_101481061
971 Ga0070667_100085784
972 Ga0070667_100361354
973 Ga0070703_10013240
974 Ga0070714_100790188
975 Ga0070713_101448700
976 Ga0070701_10000644
977 Ga0070711_100471100
978 Ga0070705_100000022
979 Ga0070705_100138636
980 Ga0070700_100004618
981 Ga0070694_100000049
982 Ga0070694_100175562
983 Ga0070694_100633444
984 Ga0070694_101302122
985 Ga0070694_101482143
986 Ga0070708_100327937
987 Ga0070708_100353964
988 Ga0070678_100086709
989 Ga0070678_100234185
990 Ga0070662_100003991
991 Ga0070662_100459500
992 Ga0070681_10080367
993 Ga0070681_10824231
994 Ga0070681_10996537
995 Ga0068867_100000219
996 Ga0068867_100024520
997 Ga0068867_100206792
998 Ga0070685_10006027
999 Ga0070706_100319884
1000 Ga0070707_100259427
1001 Ga0070707_100457302
1002 Ga0070707_100586643
1003 Ga0070707_102198907
1004 Ga0070698_100001312
1005 Ga0070698_100037444
1006 Ga0070698_100788624
1007 Ga0070698_101803459
1008 Ga0070699_100589565
1009 Ga0070699_100731308
1010 Ga0070679_100003913
1011 Ga0070679_100234977
1012 Ga0070679_101118035
1013 Ga0070679_101782651
1014 Ga0070684_100002199
1015 Ga0070684_102258685
1016 Ga0068853_100068966
1017 Ga0068853_100111865
1018 Ga0068853_100115992
1019 Ga0068853_100158257
1020 Ga0068853_100572022
1021 Ga0068853_102463745
1022 Ga0070672_100007788
1023 Ga0070686_100002753
1024 Ga0070686_101154439
1025 Ga0070686_101754093
1026 Ga0070695_100000030
1027 Ga0070695_100218975
1028 Ga0070695_100453774
1029 Ga0070695_100821811
1030 Ga0070695_101065821
1031 Ga0070696_100000501
1032 Ga0070696_100125474
1033 Ga0070696_101729470
1034 Ga0070693_100000472
1035 Ga0070693_100040391
1036 Ga0070693_100417512
1037 Ga0070665_100019238
1038 Ga0070665_100139506
1039 Ga0070704_100000009
1040 Ga0070704_100050701
1041 Ga0070704_100294373
1042 Ga0070704_100700560
1043 Ga0068855_100000709
1044 Ga0068855_100901147
1045 Ga0070664_100004802
1046 Ga0068857_100019280
1047 Ga0068857_100019513
1048 Ga0068857_100773360
1049 Ga0068854_100006372
1050 Ga0068854_100610932
1051 Ga0068854_101414131
1052 Ga0068856_100015976
1053 Ga0068856_101160463
1054 Ga0068856_101774551
1055 Ga0070702_100000009
1056 Ga0070702_100022015
1057 Ga0068859_100000354
1058 Ga0068859_100006511
1059 Ga0068859_100007079
1060 Ga0068859_100170502
1061 Ga0068859_100357555
1062 Ga0068859_100653935
1063 Ga0068864_100009838
1064 Ga0068864_100121238
1065 Ga0068864_100795148
1066 Ga0068866_10000182
1067 Ga0068861_100000138
1068 Ga0068861_100002277
1069 Ga0068861_100012075
1070 Ga0068863_100003828
1071 Ga0068863_100046755
1072 Ga0068858_100004544
1073 Ga0068858_100014628
1074 Ga0068858_100058917
1075 Ga0068858_100119554
1076 Ga0068860_100000285
1077 Ga0068860_100528256
1078 Ga0068862_100000821
1079 Ga0068862_100007749
1080 Ga0068862_100017700
1081 Ga0068862_100159276
1082 Ga0068862_102540343
1083 Ga0081540_1167164
1084 Ga0081539_10000007
1085 Ga0075365_11187868
1086 Ga0075368_10095063
1087 Ga0075363_100441016
1088 Ga0075432_10339025
1089 Ga0070715_10038767
1090 Ga0070712_100211389
1091 Ga0075362_10144376
1092 Ga0075367_10057436
1093 Ga0075366_10019688
1094 Ga0097621_100000392
1095 Ga0097621_100435465
1096 Ga0075370_10000200
1097 Ga0075370_10106149
1098 Ga0068871_100001351
1099 Ga0068871_100063977
1100 Ga0075428_100000297
1101 Ga0075428_100027105
1102 Ga0075428_100029005
1103 Ga0075428_100044431
1104 Ga0075430_100016325
1105 Ga0075430_100134902
1106 Ga0075430_100236932
1107 Ga0075430_100613998
1108 Ga0075431_100000023
1109 Ga0075431_100003434
1110 Ga0075431_100017257
1111 Ga0075431_100071115
1112 Ga0075431_100246290
1113 Ga0075431_100315828
1114 Ga0075431_100332489
1115 Ga0075431_100401891
1116 Ga0075433_10665514
1117 Ga0075433_10706834
1118 Ga0075433_11249820
1119 Ga0075434_100235392
1120 Ga0075434_100414688
1121 Ga0075429_100000233
1122 Ga0075429_100001157
1123 Ga0075429_100001322
1124 Ga0075429_100009505
1125 Ga0075429_100041492
1126 Ga0075429_100312446
1127 Ga0068865_100000052
1128 Ga0075436_100077074
1129 Ga0075436_100162282
1130 Ga0075436_100229594
1131 Ga0075436_101138360
1132 Ga0075436_101258703
1133 Ga0075436_101412660
1134 Ga0097620_100000354
1135 Ga0097620_100006512
1136 Ga0097620_100007080
1137 Ga0097620_100170510
1138 Ga0097620_100357597
1139 Ga0097620_100653899
1140 Ga0099824_1014217
1141 Ga0099822_1009768
1142 Ga0075435_100037087
1143 Ga0075435_100057951
1144 Ga0099795_10251240
1145 Ga0105251_10054543
1146 Ga0105244_10090379
1147 Ga0105240_10202508
1148 Ga0111539_10002140
1149 Ga0111539_10002965
1150 Ga0111539_10018787
1151 Ga0111539_10129689
1152 Ga0111539_10130778
1153 Ga0111539_10139501
1154 Ga0111539_10615008
1155 Ga0111539_10643112
1156 Ga0111539_11545216
1157 Ga0105245_10000086
1158 Ga0105245_10076892
1159 Ga0105245_11466006
1160 Ga0105247_10357846
1161 Ga0114129_10000702
1162 Ga0114129_10007028
1163 Ga0114129_10029543
1164 Ga0114129_10080988
1165 Ga0114129_10444044
1166 Ga0114129_10696674
1167 Ga0114129_10751009
1168 Ga0114129_12275023
1169 Ga0105243_10000360
1170 Ga0105243_10004657
1171 Ga0105243_10057153
1172 Ga0105243_10111035
1173 Ga0105243_10249950
1174 Ga0105243_11342678
1175 Ga0105243_11691393
1176 Ga0105241_10013525
1177 Ga0105241_10096282
1178 Ga0105242_10001022
1179 Ga0105242_10042252
1180 Ga0105242_10071473
1181 Ga0105242_10894446
1182 Ga0105242_12878664
1183 Ga0105248_10006127
1184 Ga0105248_10676614
1185 Ga0105237_10592764
1186 Ga0105238_10012654
1187 Ga0105249_10001949
1188 Ga0105249_10008029
1189 Ga0105249_10039521
1190 Ga0105249_10842925
1191 Ga0105249_11258783
1192 Ga0105239_10765907
1193 Ga0105239_13393618
1194 Ga0105246_10061349
1195 Ga0105246_10277113
1196 Ga0157347_1005237
1197 Ga0157339_1018539
1198 Ga0157371_10852489
1199 Ga0157370_10317372
1200 Ga0157374_11792230
1201 Ga0157378_10000332
1202 Ga0157378_10074507
1203 Ga0157378_10138887
1204 Ga0157378_10251993
1205 Ga0157378_10334897
1206 Ga0157378_10844525
1207 Ga0163162_10154008
1208 Ga0163162_10203539
1209 Ga0157375_10012915
1210 Ga0157375_11441006
1211 Ga0163163_10068226
1212 Ga0163163_10075378
1213 Ga0157380_10200027
1214 Ga0157380_10626205
1215 Ga0157380_12381803
1216 Ga0157377_10037420
1217 Ga0157377_10339785
1218 Ga0157379_10174748
1219 Ga0157379_10329255
1220 Ga0157379_10567852
1221 Ga0157376_10053003
1222 Ga0163161_10000193
1223 Ga0209436_103446
1224 Ga0207425_1000295
1225 Ga0207425_1006691
1226 Ga0209129_1000007
1227 Ga0209129_1002839
1228 Ga0209129_1004098
1229 Ga0209129_1035902
1230 Ga0209565_1000937
1231 Ga0209565_1004131
1232 Ga0209565_1004138
1233 Ga0209673_1000133
1234 Ga0209673_1000304
1235 Ga0209130_1000070
1236 Ga0209130_1000126
1237 Ga0209130_1000326
1238 Ga0209675_1000498
1239 Ga0209675_1000516
1240 Ga0209675_1011016
1241 Ga0209676_1000122
1242 Ga0209676_1000268
1243 Ga0209676_1001242
1244 Ga0209676_1001471
1245 Ga0209025_1000111
1246 Ga0209025_1000432
1247 Ga0209025_1000480
1248 Ga0209025_1005232
1249 Ga0209564_1000524
1250 Ga0209564_1000594
1251 Ga0209758_1000025
1252 Ga0209758_1001305
1253 Ga0209758_1002137
1254 Ga0209758_1109639
1255 Ga0209050_1000002
1256 Ga0209050_1001024
1257 Ga0209256_1000050
1258 Ga0209256_1000063
1259 Ga0207426_1000001
1260 Ga0207426_1000028
1261 Ga0207426_1000046
1262 Ga0207426_1056346
1263 Ga0209051_1000002
1264 Ga0209051_1000343
1265 Ga0209051_1000618
1266 Ga0209051_1010933
1267 Ga0209051_1031937
1268 Ga0209257_1000002
1269 Ga0209257_1000333
1270 Ga0209257_1001964
1271 Ga0209257_1010999
1272 Ga0209257_1016193
1273 Ga0207655_1091965
1274 Ga0207653_10012222
1275 Ga0207642_10000468
1276 Ga0207688_10039885
1277 Ga0207688_10422809
1278 Ga0207680_10171904
1279 Ga0207685_10026196
1280 Ga0207645_10327377
1281 Ga0207643_10040270
1282 Ga0207705_10289537
1283 Ga0207684_10993282
1284 Ga0207654_10122196
1285 Ga0207707_10706647
1286 Ga0207693_10096087
1287 Ga0207660_10001415
1288 Ga0207660_10563692
1289 Ga0207662_10000321
1290 Ga0207662_10006890
1291 Ga0207662_10333895
1292 Ga0207662_10749414
1293 Ga0207649_10776863
1294 Ga0207652_10020457
1295 Ga0207652_10201294
1296 Ga0207646_10259782
1297 Ga0207646_10446469
1298 Ga0207646_11635759
1299 Ga0207646_11776669
1300 Ga0207681_10006525
1301 Ga0207681_10490739
1302 Ga0207694_10003297
1303 Ga0207694_10259732
1304 Ga0207694_11264429
1305 Ga0207650_10117443
1306 Ga0207659_10004378
1307 Ga0207659_11242382
1308 Ga0207687_10006332
1309 Ga0207687_10026769
1310 Ga0207700_11285738
1311 Ga0207644_10095970
1312 Ga0207644_10679868
1313 Ga0207706_10117274
1314 Ga0207706_10121753
1315 Ga0207686_10000270
1316 Ga0207686_10132819
1317 Ga0207709_10000425
1318 Ga0207709_10001288
1319 Ga0207709_10014698
1320 Ga0207709_10273485
1321 Ga0207709_11130977
1322 Ga0207670_10002400
1323 Ga0207670_10022262
1324 Ga0207670_11399229
1325 Ga0207669_10008844
1326 Ga0207704_10000797
1327 Ga0207704_10302164
1328 Ga0207704_11226878
1329 Ga0207665_10408695
1330 Ga0207691_10029622
1331 Ga0207711_10060547
1332 Ga0207711_10759993
1333 Ga0207689_10000691
1334 Ga0207689_10223061
1335 Ga0207679_10548749
1336 Ga0207679_10553632
1337 Ga0207667_10002649
1338 Ga0207667_10729112
1339 Ga0207651_10017321
1340 Ga0207651_10171069
1341 Ga0207651_10842780
1342 Ga0207651_12065328
1343 Ga0207712_10007497
1344 Ga0207712_10027019
1345 Ga0207712_10045740
1346 Ga0207668_10002266
1347 Ga0207668_10140769
1348 Ga0207668_10774644
1349 Ga0207640_10155833
1350 Ga0207640_10447266
1351 Ga0207658_10063781
1352 Ga0207658_10323307
1353 Ga0207677_10006235
1354 Ga0207677_11156331
1355 Ga0207703_10011257
1356 Ga0207703_10020856
1357 Ga0207639_10009520
1358 Ga0207639_10058142
1359 Ga0207639_10105065
1360 Ga0207639_10108699
1361 Ga0207639_10768672
1362 Ga0207639_11687155
1363 Ga0207639_12005976
1364 Ga0207678_10654021
1365 Ga0207708_10000182
1366 Ga0207708_10077899
1367 Ga0207708_10507107
1368 Ga0207708_10801077
1369 Ga0207702_10007177
1370 Ga0207702_10702571
1371 Ga0207641_10068585
1372 Ga0207641_10643021
1373 Ga0207648_10000335
1374 Ga0207648_10024037
1375 Ga0207648_10482256
1376 Ga0207676_10032953
1377 Ga0207676_10181122
1378 Ga0207676_10738987
1379 Ga0207674_10028441
1380 Ga0207674_10527877
1381 Ga0207674_10887388
1382 Ga0207675_100000142
1383 Ga0207675_100001323
1384 Ga0207675_100028037
1385 Ga0207683_10039230
1386 Ga0207683_10511843
1387 Ga0209589_1000015
1388 Ga0209489_100015
1389 Ga0209700_100025
1390 Ga0209967_1019733
1391 Ga0209968_1055410
1392 Ga0209971_1074451
1393 Ga0209966_1085378
1394 Ga0209813_10264236
1395 Ga0207428_10001362
1396 Ga0207428_10006800
1397 Ga0207428_10099073
1398 Ga0207428_10202744
1399 Ga0268266_10065692
1400 Ga0268266_10823025
1401 Ga0268266_12242856
1402 Ga0268265_10000934
1403 Ga0268265_10002870
1404 Ga0268265_10003566
1405 Ga0268265_10382513
1406 Ga0268265_10410080
1407 Ga0268265_11862065
1408 Ga0268264_10000446
1409 Ga0268264_10552709
1410 Ga0268264_10598319
1411 Ga0268264_12453646
1412 Ga0307515_10497397
1413 Ga0265316_10910654
1414 Ga0307408_100007266
1415 Ga0307408_100084637
1416 Ga0307408_101001178
1417 Ga0307408_102348740
1418 Ga0307516_10025336
1419 Ga0307516_10934119
1420 Ga0307405_10301564
1421 Ga0307405_11177955
1422 Ga0307406_10000864
1423 Ga0307406_10102838
1424 Ga0307412_10011951
1425 Ga0307412_11552046
1426 Ga0307409_100598867
1427 Ga0307409_101391232
1428 Ga0307409_101431766
1429 Ga0307409_101644150
1430 Ga0307416_100074967
1431 Ga0307416_100463475
1432 Ga0307416_101047192
1433 Ga0307416_101392562
1434 Ga0307416_103242876
1435 Ga0307411_10554270
1436 Ga0307411_10669711
1437 Ga0307415_100196605
1438 Ga0307415_100601000
1439 Ga0307510_10465125
1440 Ga0373926_0000157
1441 Ga0373940_0134852
1442 Ga0373944_0323882
1443 Ga0373949_0047119
1444 Ga0373936_0085866
1445 Ga0373939_0060192
1446 Ga0373939_0206704
1447 Ga0373939_0492350
1448 Ga0373941_0037244
1449 Ga0373945_0202334
1450 Ga0373956_0101854
1451 Ga0373960_0199732
1452 Ga0373943_0262399
1453 Ga0373962_0002777
1454 Ga0373931_0004707
1455 Ga0373931_0344407
1456 Ga0373935_0176088
1457 Ga0373935_0932350
1458 Ga0373927_0276097
1459 Ga0373933_0433824
1460 Ga0373937_1243140
1461 Ga0373937_1591613
1462 Ga0373925_0027752
1463 Ga0373925_0314085
1464 Ga0373925_0627873
1465 Ga0395899_0606705
1466 Ga0395900_1558168
1467 Ga0395898_1373559
1468 Ga0436364_1056250
1469 Ga0395901_1083647
1470 Ga0436365_0984935
1471 Ga0436365_1258172
1472 Ga0439439_0106361
1473 Ga0439453_0034710
1474 Ga0439465_0261949
1475 Ga0451791_1242738
1476 Ga0451798_0391002
1477 Ga0451853_0286293
1478 Ga0439431_0221383
1479 Ga0450888_039674
1480 Ga0439434_0063850
1481 Ga0451577_0375143
1482 Ga0451577_0647980
1483 Ga0466972_0114099
1484 Ga0466972_0359088
1485 Ga0466965_0026346
1486 Ga0466965_0496351
1487 Ga0466964_0010808
1488 Ga0451576_0040510
1489 Ga0451576_0046981
1490 Ga0451576_0064154
1491 Ga0451576_0429688
1492 Ga0451576_1096805
1493 Ga0451576_2063758
1494 Ga0466967_0007238
1495 Ga0495627_006801
1496 Ga0495638_0127269
1497 Ga0495650_0289448
1498 Ga0495639_0092882
1499 Ga0495585_0313774
1500 Ga0495610_0020716
1501 Ga0495610_0049408
1502 Ga0495610_0085333
1503 Ga0495610_0309964
1504 Ga0495616_0030852
1505 Ga0495620_0110834
1506 Ga0495631_0000228
1507 Ga0495637_0003270
1508 Ga0495637_0017432
1509 Ga0495648_0486764
1510 Ga0495654_0008482
1511 Ga0495654_0198380
1512 Ga0495586_0001910
1513 Ga0495621_0025662
1514 Ga0495621_0034177
1515 Ga0495633_0374170
1516 Ga0495668_0085111
1517 Ga0495668_0299807
1518 Ga0495611_0034497
1519 Ga0495625_0043979
1520 Ga0495625_0158703
1521 Ga0495659_0466040
1522 Ga0495661_0081910
1523 Ga0495588_0033283
1524 Ga0495588_0037595
1525 Ga0495658_0067510
1526 Ga0495658_0136418
1527 Ga0495670_0017426
1528 Ga0495670_0310459
1529 Ga0495671_0016975
1530 Ga0495600_0896140
1531 Ga0495581_0344213
1532 Ga0495604_0911006
1533 Ga0495676_0016422
1534 Ga0495676_0032519
1535 Ga0495676_0954017
1536 Ga0495673_0053813
1537 Ga0495686_0302814
1538 Ga0495593_0007756
1539 Ga0495614_0004411
1540 Ga0496100_0032873
1541 Ga0496100_0426347
1542 Ga0496101_0063210
1543 Ga0496104_0007351
1544 Ga0496105_0002518
1545 Ga0496106_0108520
1546 Ga0496107_0392174
1547 Ga0496108_0000416
1548 Ga0496109_0001317
1549 Ga0496109_0144616
1550 Ga0496110_0004470
1551 Ga0496110_0289343
1552 Ga0496111_0015024
1553 Ga0496111_0672538
1554 Ga0496112_0007446
1555 Ga0496113_0001503
1556 Ga0496113_0513156
1557 Ga0496114_0109856
1558 Ga0496115_0001063
1559 Ga0496118_0047253
1560 Ga0496118_0552753
1561 Ga0496121_0191741
1562 Ga0496124_0146552
1563 Ga0496125_0030971
1564 Ga0496125_0142168
1565 Ga0496125_0182201
1566 Ga0496126_0146230
1567 Ga0501290_038401
1568 Ga0501291_015509
1569 Ga0501298_012971
1570 Ga0501299_039254
1571 Ga0501299_043836
1572 Ga0501300_007930
1573 Ga0501300_021066
1574 Ga0501301_004281
1575 Ga0501303_015012
1576 Ga0501031_0552354
1577 Ga0501031_0584065
1578 Ga0501032_0131584
1579 Ga0501033_0041065
1580 Ga0501033_0214561
1581 Ga0501033_0426682
1582 Ga0501033_0574894
1583 Ga0501034_0000730
1584 Ga0501034_0086279
1585 Ga0501036_0285435
1586 Ga0501036_0385468
1587 Ga0501037_1033453
1588 Ga0501038_0265701
1589 Ga0501038_0798995
1590 Ga0501038_0839378
1591 Ga0501039_0228504
1592 Ga0501042_0753860
1593 Ga0501043_0044068
1594 Ga0501043_0146762
1595 Ga0501043_0628128
1596 Ga0501047_0042513
1597 Ga0501047_0134767
1598 Ga0501047_0419993
1599 Ga0501048_1020764
1600 Ga0501067_0340210
1601 Ga0501068_0001132
1602 Ga0501070_0195616
1603 Ga0501070_0235628
1604 Ga0501070_0919083
1605 Ga0501071_0360181
1606 Ga0501072_0479868
1607 Ga0501073_0014430
1608 Ga0501073_0063886
1609 Ga0501074_0500443
1610 Ga0501076_0898939
1611 Ga0501077_0640044
1612 Ga0501077_1081064
1613 Ga0501217_028643
1614 Ga0501222_085773
1615 Ga0501228_009623
1616 Ga0501233_098885
1617 Ga0501235_110828
1618 Ga0501239_024681
1619 Ga0501243_063823
1620 Ga0501249_005412
1621 Ga0501253_026319
1622 Ga0501255_035596
1623 Ga0501257_074952
1624 Ga0501225_0050068
1625 Ga0501234_037477
1626 Ga0501234_093641
1627 Ga0501079_1004698
1628 Ga0501079_1187223
1629 Ga0501080_0089685
1630 Ga0501080_0111349
1631 Ga0501083_0039536
1632 Ga0501083_0057120
1633 Ga0501268_021864
1634 Ga0501273_024961
1635 Ga0501283_016634
1636 Ga0501035_0099387
1637 Ga0501035_0229301
1638 Ga0501035_1571069
1639 Ga0501044_0020908
1640 Ga0501044_0043051
1641 Ga0501044_0078100
1642 Ga0501045_0536489
1643 Ga0501045_0574202
1644 Ga0501226_010258
1645 nmdc:mga03n38_295779_c1
1646 nmdc:mga03n38_307011_c1
1647 nmdc:mga0k408_52439_c1
1648 nmdc:mga07m45_19644_c1
1649 nmdc:mga07m45_7294_c1
1650 nmdc:mga05p37_1249654_c1
1651 nmdc:mga05p37_1520_c1
1652 nmdc:mga05p37_185_c1
1653 nmdc:mga05p37_374128_c1
1654 nmdc:mga05p37_63921_c1
1655 nmdc:mga05p37_9043_c1
1656 nmdc:mga09592_1601_c1
1657 nmdc:mga09592_3010_c1
1658 nmdc:mga09592_3996_c1
1659 nmdc:mga09592_487_c1
1660 nmdc:mga09592_73735_c1
1661 nmdc:mga0qj67_37729_c1
1662 nmdc:mga0qj67_415810_c1
1663 nmdc:mga0qj67_54926_c2
1664 nmdc:mga06r32_142565_c1
1665 nmdc:mga06r32_1976653_c1
1666 nmdc:mga06r32_247202_c1
1667 nmdc:mga06r32_26444_c1
1668 nmdc:mga06r32_265728_c1
1669 nmdc:mga06r32_699_c1
1670 nmdc:mga06r32_77534_c1
1671 nmdc:mga08y16_1050398_c1
1672 nmdc:mga08y16_2117_c1
1673 nmdc:mga08y16_2380_c1
1674 nmdc:mga08y16_334077_c1
1675 nmdc:mga08y16_502_c1
1676 nmdc:mga08y16_61819_c1
1677 nmdc:mga0n895_228066_c1
1678 nmdc:mga0n895_335547_c1
1679 nmdc:mga0n895_762708_c1
1680 nmdc:mga0rr50_2784_c2
1681 nmdc:mga0rr50_343494_c1
1682 nmdc:mga08x19_1244921_c1
1683 nmdc:mga08x19_200250_c1
1684 nmdc:mga08x19_251957_c1
1685 nmdc:mga08x19_404938_c1
1686 nmdc:mga0a205_1103182_c1
1687 nmdc:mga0a205_177147_c1
1688 Ga0500610_0000863
1689 Ga0500610_0002219
1690 Ga0495619_0341420
1691 Ga0500643_004104
1692 Ga0500651_0000097
1693 Ga0500566_0221797
1694 Ga0500641_0210319
1695 Ga0500555_076491
1696 Ga0500569_022372
1697 Ga0500571_000190
1698 Ga0500572_277645
1699 Ga0500592_001100
1700 Ga0500593_000202
1701 Ga0500595_051415
1702 Ga0500607_002610
1703 Ga0500608_061882
1704 Ga0500608_255247
1705 Ga0500617_100156
1706 Ga0500642_0400374
1707 Ga0500658_0000521
1708 Ga0500658_0000753
1709 Ga0500559_0008548
1710 Ga0500564_078987
1711 Ga0500568_0002122
1712 Ga0500574_000630
1713 Ga0500588_0001478
1714 Ga0500616_0207487
1715 Ga0500619_233122
1716 Ga0500627_0004369
1717 Ga0500634_0040681
1718 Ga0500634_0048954
1719 Ga0500638_085098
1720 Ga0500636_0037156
1721 Ga0500645_073596
1722 Ga0500565_028227
1723 Ga0501084_0228889
1724 Ga0501084_1520306
1725 Ga0500661_019643
1726 Ga0501082_0101653
1727 Ga0501082_0412693
1728 Ga0501082_1028035
1729 Ga0501082_1994931
1730 2599623547
1731 2599671835
1732 2599681152
1733 2599693444
1734 2644401565
1735 2644468074
1736 2821447080
1737 2831266233
1738 2838057657
1739 2844539854
1740 2883359224
1741 2885204349
1742 2885218002
1743 2928071840
1744 2928084224
1745 2929527224
1746 2945986237

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

10

122

0.86

PF18029

Glyoxalase_6

Glyoxalase-like domain

12

123

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.9163 1 118
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.9018 1 118
4qb5-assembly2.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8243 1 119
4qb5-assembly2.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.818 1 119
4qb5-assembly1.cif.gz_A crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8027 1 119
ID Description Score Start End Superfamily
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9163 1 118 3.10.180.10
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9018 1 118 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8484 60 119 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8072 61 117 3.30.720.110
4qb5A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7997 1 119 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2V1CTG9-F1-model_v4 VOC domain-containing protein 1 62 118
AF-A0A436RGB7-F1-model_v4 VOC family protein 0.9979 62 117
AF-A0A7Y2FQG5-F1-model_v4 VOC family protein 0.9953 60 118
AF-A0A4U9Z0D5-F1-model_v4 deleted 0.9937 62 117
AF-M5CMF1-F1-model_v4 deleted 0.992 61 118

Map