F484296

General Info

Members Datasets Scaffolds Average Seq Length
874 321 874 279

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10006792|Ga0265316_100067929
Length 294
Sequence MGFVTWATNPWGQSIPIHIAWFLIWVSVIAGLLFLIVHAIWLKYFAKPKEFVSDAPPQSVARIPKHVPRHSLVARMFHWIMAASMLTLLFTAFLPKVGVQFQWVTYHWIAGAVLTVSILFHVIHASFWLDFWSIWPDGTDLEDARRRVLRFFGRSAPPPRKFAKYPLENKLFHGVIILCGLSVIVTGVFMMFRVRTIFFPRNPYLFGDMTWGLMYVLHGLAGVGLIALVMMHVYFGLRPEKLPITKSMIFGWMDRDFYLQEHDPQRWVVETPSSSPPSVSTATRIEGRGLTDAG

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
130 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
131 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
132 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
133 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
203 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
208 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
209 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
210 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
211 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
216 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
217 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
218 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
219 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
220 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
221 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
222 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
223 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
224 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
225 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
226 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
227 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
228 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
235 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
236 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
240 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
241 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
242 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
243 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
244 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
245 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
246 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
247 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
248 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
249 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
250 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
251 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
252 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
253 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
254 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
255 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
259 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
260 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
263 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
264 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
265 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
266 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
267 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
268 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
269 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
270 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
271 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
272 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
273 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
296 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
297 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
298 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
299 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
300 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
301 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
302 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
303 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
304 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
305 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
306 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
308 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
309 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
310 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
311 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
312 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
313 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
314 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
315 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
316 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
317 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
318 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
319 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
321 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.03
Metatranscriptomes 2.97
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.52
Rhizosphere 96.34
Stem 0
Stem Tuber 0
Unclassified 1.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10002645 3300003203 Bacteria 8438
2 rootH2_10158235 3300003320 Bacteria 1683
3 Ga0058859_10571141 3300004798 Bacteria 1250
4 Ga0058863_11271652 3300004799 Bacteria 3659
5 Ga0058861_11276067 3300004800 Bacteria 1654
6 Ga0058862_11810453 3300004803 Bacteria 1784
7 Ga0058862_12808267 3300004803 Bacteria 1242
8 Ga0058862_12893689 3300004803 Unclassified 1183
9 Ga0065712_10032483 3300005290 Unclassified 1022
10 Ga0065715_10106597 3300005293 Bacteria 2815
11 Ga0065715_10202023 3300005293 Unclassified 1341
12 Ga0065707_10093911 3300005295 Bacteria 3564
13 Ga0065707_10141144 3300005295 Bacteria 1771
14 Ga0065707_10176281 3300005295 Bacteria 1440
15 Ga0070658_10015017 3300005327 Bacteria 6199
16 Ga0070658_10062010 3300005327 Bacteria 3047
17 Ga0070676_10006587 3300005328 Bacteria 6210
18 Ga0070676_10088917 3300005328 Bacteria 1888
19 Ga0070676_10219894 3300005328 Bacteria 1254
20 Ga0070683_100033133 3300005329 Bacteria 4709
21 Ga0070683_100184188 3300005329 Bacteria 1982
22 Ga0070690_100060729 3300005330 Bacteria 2433
23 Ga0070690_100075007 3300005330 Bacteria 2204
24 Ga0070690_100319347 3300005330 Bacteria 1118
25 Ga0068869_100002543 3300005334 Bacteria 11010
26 Ga0068869_100051719 3300005334 Unclassified 2980
27 Ga0070666_10081609 3300005335 Bacteria 2211
28 Ga0070680_100096347 3300005336 Bacteria 2453
29 Ga0070680_100174634 3300005336 Unclassified 1809
30 Ga0070682_100024660 3300005337 Bacteria 3581
31 Ga0068868_100007292 3300005338 Bacteria 7866
32 Ga0068868_100013904 3300005338 Bacteria 5918
33 Ga0068868_100029316 3300005338 Bacteria 4213
34 Ga0068868_100091197 3300005338 Bacteria 2455
35 Ga0070660_100007571 3300005339 Bacteria 7567
36 Ga0070660_100009135 3300005339 Bacteria 6958
37 Ga0070660_100113116 3300005339 Bacteria 2161
38 Ga0070689_100369176 3300005340 Bacteria 1207
39 Ga0070689_100591184 3300005340 Bacteria 960
40 Ga0070691_10136183 3300005341 Bacteria 1248
41 Ga0070687_100012491 3300005343 Bacteria 3753
42 Ga0070687_100125767 3300005343 Bacteria 1473
43 Ga0070661_100104396 3300005344 Bacteria 2111
44 Ga0070669_100069318 3300005353 Unclassified 2604
45 Ga0070669_100088909 3300005353 Unclassified 2313
46 Ga0070675_100000739 3300005354 Bacteria 22817
47 Ga0070675_100182597 3300005354 Bacteria 1814
48 Ga0070675_100685783 3300005354 Unclassified 932
49 Ga0070671_100190221 3300005355 Unclassified 1739
50 Ga0070671_100254728 3300005355 Unclassified 1491
51 Ga0070671_100288357 3300005355 Bacteria 1397
52 Ga0070671_100504202 3300005355 Unclassified 1041
53 Ga0070674_100030121 3300005356 Bacteria 3583
54 Ga0070674_100222104 3300005356 Bacteria 1470
55 Ga0070673_100060792 3300005364 Unclassified 2995
56 Ga0070673_100115554 3300005364 Unclassified 2231
57 Ga0070673_100223896 3300005364 Bacteria 1629
58 Ga0070659_100152039 3300005366 Unclassified 1888
59 Ga0070667_100022899 3300005367 Bacteria 5180
60 Ga0070667_100264587 3300005367 Unclassified 1541
61 Ga0070709_10001162 3300005434 Bacteria 14434
62 Ga0070709_10018121 3300005434 Bacteria 4049
63 Ga0070709_10052454 3300005434 Bacteria 2563
64 Ga0070709_10171128 3300005434 Bacteria 1518
65 Ga0070709_10330327 3300005434 Bacteria 1121
66 Ga0070714_100029132 3300005435 Bacteria 4588
67 Ga0070714_100182116 3300005435 Bacteria 1912
68 Ga0070714_100211414 3300005435 Unclassified 1778
69 Ga0070713_100000476 3300005436 Bacteria 25546
70 Ga0070713_100001852 3300005436 Bacteria 13636
71 Ga0070713_100002307 3300005436 Bacteria 12414
72 Ga0070713_100011617 3300005436 Bacteria 6423
73 Ga0070713_100014557 3300005436 Bacteria 5849
74 Ga0070713_100056670 3300005436 Bacteria 3260
75 Ga0070713_100056701 3300005436 Bacteria 3259
76 Ga0070713_100074091 3300005436 Unclassified 2883
77 Ga0070713_100198400 3300005436 Unclassified 1811
78 Ga0070710_10061053 3300005437 Bacteria 2146
79 Ga0070710_10136282 3300005437 Unclassified 1501
80 Ga0070710_10236652 3300005437 Unclassified 1168
81 Ga0070711_100000281 3300005439 Bacteria 26309
82 Ga0070711_100001229 3300005439 Bacteria 13841
83 Ga0070711_100020727 3300005439 Unclassified 4241
84 Ga0070711_100030637 3300005439 Unclassified 3564
85 Ga0070711_100033648 3300005439 Bacteria 3414
86 Ga0070711_100048775 3300005439 Bacteria 2897
87 Ga0070711_100172618 3300005439 Unclassified 1649
88 Ga0070708_100003651 3300005445 Bacteria 12067
89 Ga0070708_100006273 3300005445 Bacteria 9458
90 Ga0070708_100066556 3300005445 Bacteria 3234
91 Ga0070708_100107291 3300005445 Bacteria 2564
92 Ga0070708_100245908 3300005445 Viruses 1680
93 Ga0070663_100177850 3300005455 Bacteria 1648
94 Ga0070678_100340196 3300005456 Unclassified 1287
95 Ga0070662_100017281 3300005457 Bacteria 4860
96 Ga0070681_10001282 3300005458 Bacteria 21908
97 Ga0070681_10010428 3300005458 Bacteria 9177
98 Ga0070681_10036998 3300005458 Bacteria 4899
99 Ga0070681_10157001 3300005458 Bacteria 2199
100 Ga0070681_10393319 3300005458 Unclassified 1297
101 Ga0068867_100060541 3300005459 Bacteria 2809
102 Ga0068867_100224802 3300005459 Bacteria 1514
103 Ga0068867_100285494 3300005459 Unclassified 1355
104 Ga0070685_10009573 3300005466 Bacteria 5012
105 Ga0070685_10116179 3300005466 Bacteria 1656
106 Ga0070706_100000336 3300005467 Bacteria 56986
107 Ga0070706_100002094 3300005467 Bacteria 20343
108 Ga0070706_100011620 3300005467 Bacteria 8181
109 Ga0070706_100175853 3300005467 Unclassified 1999
110 Ga0070707_100019771 3300005468 Bacteria 6347
111 Ga0070707_100021052 3300005468 Bacteria 6159
112 Ga0070707_100222816 3300005468 Unclassified 1836
113 Ga0070698_100005969 3300005471 Bacteria 13277
114 Ga0070698_100029720 3300005471 Bacteria 5672
115 Ga0070698_100256401 3300005471 Bacteria 1681
116 Ga0070698_100256521 3300005471 Unclassified 1681
117 Ga0070698_100270311 3300005471 Unclassified 1631
118 Ga0070698_100343820 3300005471 Bacteria 1423
119 Ga0070699_100005358 3300005518 Bacteria 11246
120 Ga0070699_100007587 3300005518 Bacteria 9431
121 Ga0070699_100148811 3300005518 Bacteria 2070
122 Ga0070699_100151824 3300005518 Bacteria 2049
123 Ga0070679_100021290 3300005530 Bacteria 6328
124 Ga0070679_100045647 3300005530 Unclassified 4366
125 Ga0070679_100120107 3300005530 Bacteria 2613
126 Ga0070679_100585457 3300005530 Unclassified 1059
127 Ga0070684_100031772 3300005535 Bacteria 4497
128 Ga0070684_100051325 3300005535 Bacteria 3583
129 Ga0070684_100052651 3300005535 Bacteria 3541
130 Ga0070684_100339810 3300005535 Unclassified 1380
131 Ga0070697_100002395 3300005536 Bacteria 14440
132 Ga0070697_100014445 3300005536 Bacteria 6201
133 Ga0070697_100016125 3300005536 Bacteria 5875
134 Ga0070697_100177312 3300005536 Bacteria 1805
135 Ga0070697_100261749 3300005536 Unclassified 1481
136 Ga0068853_100198663 3300005539 Unclassified 1824
137 Ga0068853_100218901 3300005539 Unclassified 1738
138 Ga0070672_100009432 3300005543 Bacteria 6727
139 Ga0070695_100050386 3300005545 Unclassified 2668
140 Ga0070695_100254949 3300005545 Bacteria 1279
141 Ga0070696_100151488 3300005546 Bacteria 1702
142 Ga0070696_100176927 3300005546 Unclassified 1581
143 Ga0070693_100029239 3300005547 Bacteria 3004
144 Ga0070693_100078116 3300005547 Bacteria 1966
145 Ga0070693_100194275 3300005547 Unclassified 1314
146 Ga0070693_100227770 3300005547 Bacteria 1225
147 Ga0070665_100029410 3300005548 Bacteria 5530
148 Ga0070665_100057610 3300005548 Bacteria 3895
149 Ga0070665_100206334 3300005548 Bacteria 1966
150 Ga0068855_100000234 3300005563 Bacteria 70713
151 Ga0068855_100000432 3300005563 Bacteria 51912
152 Ga0068855_100001150 3300005563 Bacteria 32765
153 Ga0068855_100013501 3300005563 Bacteria 9847
154 Ga0068855_100210802 3300005563 Bacteria 2183
155 Ga0068855_100285841 3300005563 Bacteria 1830
156 Ga0070664_100000726 3300005564 Bacteria 25332
157 Ga0070664_100008247 3300005564 Bacteria 8423
158 Ga0070664_100031470 3300005564 Bacteria 4433
159 Ga0070664_100764576 3300005564 Unclassified 902
160 Ga0068857_100000096 3300005577 Bacteria 51376
161 Ga0068857_100004869 3300005577 Bacteria 11390
162 Ga0068857_100005406 3300005577 Bacteria 10892
163 Ga0068857_100211098 3300005577 Bacteria 1772
164 Ga0068854_100009756 3300005578 Bacteria 6207
165 Ga0068854_100140582 3300005578 Unclassified 1852
166 Ga0068854_100262646 3300005578 Unclassified 1383
167 Ga0068856_100000062 3300005614 Bacteria 100769
168 Ga0068856_100000179 3300005614 Bacteria 66149
169 Ga0068856_100000854 3300005614 Bacteria 32765
170 Ga0068856_100041098 3300005614 Bacteria 4543
171 Ga0068856_100086315 3300005614 Bacteria 3118
172 Ga0068856_100101664 3300005614 Bacteria 2867
173 Ga0068856_100125292 3300005614 Bacteria 2572
174 Ga0068856_100168389 3300005614 Bacteria 2202
175 Ga0068856_100184126 3300005614 Unclassified 2102
176 Ga0068856_100202497 3300005614 Bacteria 1999
177 Ga0070702_100153082 3300005615 Bacteria 1482
178 Ga0068852_100016336 3300005616 Bacteria 5784
179 Ga0068852_100036794 3300005616 Bacteria 4100
180 Ga0068852_100052877 3300005616 Bacteria 3493
181 Ga0068852_100220903 3300005616 Bacteria 1802
182 Ga0068859_100090622 3300005617 Unclassified 3108
183 Ga0068859_100091350 3300005617 Bacteria 3095
184 Ga0068859_100099523 3300005617 Unclassified 2963
185 Ga0068859_100108684 3300005617 Bacteria 2835
186 Ga0068859_100123873 3300005617 Bacteria 2652
187 Ga0068859_100244765 3300005617 Bacteria 1883
188 Ga0068864_100000129 3300005618 Bacteria 73206
189 Ga0068864_100012733 3300005618 Bacteria 6954
190 Ga0068864_100312002 3300005618 Unclassified 1475
191 Ga0068866_10026910 3300005718 Bacteria 2722
192 Ga0068866_10067783 3300005718 Bacteria 1874
193 Ga0068861_100237621 3300005719 Bacteria 1548
194 Ga0068870_10000348 3300005840 Bacteria 17317
195 Ga0068870_10130633 3300005840 Bacteria 1458
196 Ga0068863_100008178 3300005841 Bacteria 10216
197 Ga0068863_100033688 3300005841 Bacteria 4880
198 Ga0068858_100001351 3300005842 Bacteria 25297
199 Ga0068858_100002990 3300005842 Bacteria 16951
200 Ga0068858_100010263 3300005842 Bacteria 8883
201 Ga0068858_100010506 3300005842 Bacteria 8771
202 Ga0068858_100014019 3300005842 Bacteria 7563
203 Ga0068858_100022353 3300005842 Bacteria 5904
204 Ga0068858_100059537 3300005842 Bacteria 3530
205 Ga0068858_100077143 3300005842 Bacteria 3095
206 Ga0068858_100122376 3300005842 Unclassified 2434
207 Ga0068858_100844542 3300005842 Unclassified 894
208 Ga0068860_100019110 3300005843 Bacteria 6653
209 Ga0068860_100022312 3300005843 Bacteria 6126
210 Ga0068860_100075164 3300005843 Bacteria 3213
211 Ga0068860_100096300 3300005843 Bacteria 2821
212 Ga0068860_100131638 3300005843 Bacteria 2401
213 Ga0068860_100160120 3300005843 Bacteria 2170
214 Ga0068862_100006825 3300005844 Bacteria 9465
215 Ga0068862_100056072 3300005844 Bacteria 3375
216 Ga0081538_10004787 3300005981 Bacteria 12368
217 Ga0081540_1024169 3300005983 Bacteria 3532
218 Ga0081539_10002905 3300005985 Bacteria 22664
219 Ga0070717_10032853 3300006028 Bacteria 4183
220 Ga0070717_10247204 3300006028 Unclassified 1575
221 Ga0070717_10354068 3300006028 Unclassified 1313
222 Ga0070715_10000763 3300006163 Bacteria 8715
223 Ga0070715_10132775 3300006163 Unclassified 1200
224 Ga0070716_100010159 3300006173 Unclassified 4714
225 Ga0070716_100023487 3300006173 Bacteria 3271
226 Ga0070716_100221598 3300006173 Bacteria 1271
227 Ga0070716_100254285 3300006173 Bacteria 1199
228 Ga0070712_100000468 3300006175 Bacteria 23267
229 Ga0070712_100001119 3300006175 Bacteria 16162
230 Ga0070712_100002849 3300006175 Bacteria 10703
231 Ga0070712_100003144 3300006175 Bacteria 10172
232 Ga0070712_100008180 3300006175 Bacteria 6569
233 Ga0070712_100008773 3300006175 Bacteria 6364
234 Ga0070712_100028949 3300006175 Bacteria 3710
235 Ga0070712_100564588 3300006175 Unclassified 960
236 Ga0097621_100000148 3300006237 Bacteria 42932
237 Ga0097621_100000980 3300006237 Bacteria 20023
238 Ga0097621_100004631 3300006237 Bacteria 9599
239 Ga0097621_100009420 3300006237 Bacteria 7087
240 Ga0097621_100115625 3300006237 Bacteria 2271
241 Ga0097621_100266673 3300006237 Bacteria 1504
242 Ga0097621_100277933 3300006237 Unclassified 1473
243 Ga0068871_100000049 3300006358 Bacteria 65954
244 Ga0068871_100000465 3300006358 Bacteria 27859
245 Ga0068871_100013790 3300006358 Bacteria 6009
246 Ga0068871_100030112 3300006358 Unclassified 4271
247 Ga0068871_100031575 3300006358 Bacteria 4178
248 Ga0068871_100140356 3300006358 Bacteria 2054
249 Ga0068871_100231032 3300006358 Bacteria 1605
250 Ga0075428_100000023 3300006844 Bacteria 127355
251 Ga0075428_100001864 3300006844 Bacteria 22582
252 Ga0075430_100001987 3300006846 Bacteria 16844
253 Ga0075430_100291878 3300006846 Bacteria 1349
254 Ga0075431_100002526 3300006847 Bacteria 17651
255 Ga0075431_100399986 3300006847 Bacteria 1375
256 Ga0075433_10012263 3300006852 Bacteria 6912
257 Ga0075433_10013715 3300006852 Bacteria 6600
258 Ga0075434_100051841 3300006871 Unclassified 4077
259 Ga0075434_100261955 3300006871 Bacteria 1748
260 Ga0075434_100321623 3300006871 Unclassified 1567
261 Ga0075429_100001764 3300006880 Bacteria 17910
262 Ga0075429_100061268 3300006880 Bacteria 3278
263 Ga0075429_100102080 3300006880 Bacteria 2504
264 Ga0068865_100075093 3300006881 Unclassified 2409
265 Ga0068865_100077749 3300006881 Unclassified 2372
266 Ga0068865_100093951 3300006881 Bacteria 2182
267 Ga0068865_100199277 3300006881 Bacteria 1553
268 Ga0075436_100230607 3300006914 Bacteria 1315
269 Ga0097620_100090624 3300006931 Unclassified 3108
270 Ga0097620_100091355 3300006931 Bacteria 3095
271 Ga0097620_100099524 3300006931 Unclassified 2963
272 Ga0097620_100108683 3300006931 Bacteria 2835
273 Ga0097620_100123888 3300006931 Bacteria 2652
274 Ga0097620_100244732 3300006931 Bacteria 1883
275 Ga0075435_100047786 3300007076 Bacteria 3437
276 Ga0075435_100077191 3300007076 Unclassified 2731
277 Ga0099794_10000004 3300007265 Bacteria 134462
278 Ga0099794_10063610 3300007265 Unclassified 1796
279 Ga0105240_10000378 3300009093 Bacteria 83713
280 Ga0105240_10014149 3300009093 Bacteria 10900
281 Ga0105240_10096117 3300009093 Bacteria 3611
282 Ga0105240_10111346 3300009093 Bacteria 3312
283 Ga0105240_10206710 3300009093 Bacteria 2297
284 Ga0105240_10361382 3300009093 Bacteria 1644
285 Ga0105240_10551647 3300009093 Bacteria 1275
286 Ga0111539_10000001 3300009094 Bacteria 1035431
287 Ga0111539_10015323 3300009094 Bacteria 9549
288 Ga0111539_10040991 3300009094 Bacteria 5570
289 Ga0111539_10163892 3300009094 Bacteria 2600
290 Ga0105245_10012860 3300009098 Bacteria 7293
291 Ga0105245_10014526 3300009098 Bacteria 6857
292 Ga0105245_10098891 3300009098 Unclassified 2696
293 Ga0105245_10115053 3300009098 Bacteria 2506
294 Ga0105245_10124984 3300009098 Bacteria 2407
295 Ga0105245_10162821 3300009098 Bacteria 2118
296 Ga0105245_10335104 3300009098 Unclassified 1494
297 Ga0105247_10049958 3300009101 Unclassified 2573
298 Ga0105247_10068712 3300009101 Bacteria 2209
299 Ga0105247_10193098 3300009101 Bacteria 1364
300 Ga0105247_10237369 3300009101 Unclassified 1241
301 Ga0114129_10030545 3300009147 Bacteria 7624
302 Ga0114129_10035231 3300009147 Bacteria 7071
303 Ga0114129_10041222 3300009147 Bacteria 6507
304 Ga0114129_10543115 3300009147 Bacteria 1512
305 Ga0105243_10073335 3300009148 Unclassified 2773
306 Ga0105243_10202473 3300009148 Bacteria 1742
307 Ga0105241_10007930 3300009174 Bacteria 7807
308 Ga0105241_10083824 3300009174 Bacteria 2501
309 Ga0105241_10189512 3300009174 Bacteria 1711
310 Ga0105242_10058932 3300009176 Bacteria 3150
311 Ga0105242_10060759 3300009176 Unclassified 3106
312 Ga0105242_10070983 3300009176 Bacteria 2889
313 Ga0105242_10149562 3300009176 Bacteria 2035
314 Ga0105242_10235268 3300009176 Unclassified 1644
315 Ga0105242_10236136 3300009176 Unclassified 1641
316 Ga0105242_10340332 3300009176 Bacteria 1382
317 Ga0105242_10442034 3300009176 Bacteria 1224
318 Ga0105242_10584148 3300009176 Unclassified 1076
319 Ga0105248_10002269 3300009177 Bacteria 21276
320 Ga0105248_10007399 3300009177 Bacteria 12048
321 Ga0105248_10038890 3300009177 Bacteria 5326
322 Ga0105248_10040731 3300009177 Bacteria 5207
323 Ga0105248_10132247 3300009177 Bacteria 2815
324 Ga0105248_10279095 3300009177 Unclassified 1881
325 Ga0105248_10384894 3300009177 Bacteria 1579
326 Ga0105237_10017405 3300009545 Bacteria 7451
327 Ga0105237_10067340 3300009545 Bacteria 3574
328 Ga0105237_10093606 3300009545 Bacteria 2994
329 Ga0105237_10158974 3300009545 Bacteria 2257
330 Ga0105237_10309965 3300009545 Bacteria 1581
331 Ga0105238_10000609 3300009551 Bacteria 37550
332 Ga0105238_10004737 3300009551 Bacteria 13456
333 Ga0105238_10013340 3300009551 Bacteria 8289
334 Ga0105238_10024029 3300009551 Bacteria 6215
335 Ga0105238_10025730 3300009551 Bacteria 6000
336 Ga0105238_10173179 3300009551 Bacteria 2135
337 Ga0105238_10178013 3300009551 Bacteria 2103
338 Ga0105249_10006270 3300009553 Bacteria 10329
339 Ga0105249_10016331 3300009553 Bacteria 6586
340 Ga0105249_10444304 3300009553 Bacteria 1335
341 Ga0105249_10550283 3300009553 Unclassified 1204
342 Ga0099796_10000427 3300010159 Bacteria 6985
343 Ga0099796_10081935 3300010159 Bacteria 1185
344 Ga0105239_10039316 3300010375 Bacteria 5183
345 Ga0105239_10469679 3300010375 Bacteria 1428
346 Ga0105239_10819542 3300010375 Unclassified 1067
347 Ga0105246_10016519 3300011119 Bacteria 4674
348 Ga0157373_10011663 3300013100 Bacteria 6453
349 Ga0157373_10091841 3300013100 Bacteria 2138
350 Ga0157373_10176975 3300013100 Unclassified 1502
351 Ga0157371_10024243 3300013102 Bacteria 4433
352 Ga0157371_10054599 3300013102 Bacteria 2837
353 Ga0157371_10089236 3300013102 Bacteria 2183
354 Ga0157370_10005013 3300013104 Bacteria 14968
355 Ga0157370_10168118 3300013104 Bacteria 2039
356 Ga0157370_10184107 3300013104 Bacteria 1940
357 Ga0157369_10000159 3300013105 Bacteria 95759
358 Ga0157369_10018776 3300013105 Bacteria 7751
359 Ga0157369_10095136 3300013105 Bacteria 3179
360 Ga0157369_10200402 3300013105 Bacteria 2095
361 Ga0157374_10000062 3300013296 Bacteria 112028
362 Ga0157374_10000338 3300013296 Bacteria 43326
363 Ga0157374_10000454 3300013296 Bacteria 37339
364 Ga0157374_10016801 3300013296 Bacteria 6439
365 Ga0157374_10021505 3300013296 Bacteria 5742
366 Ga0157374_10033555 3300013296 Unclassified 4683
367 Ga0157374_10084221 3300013296 Bacteria 3022
368 Ga0157374_10194908 3300013296 Bacteria 1982
369 Ga0157378_10000009 3300013297 Bacteria 161557
370 Ga0157378_10000899 3300013297 Bacteria 27398
371 Ga0157378_10005749 3300013297 Bacteria 10860
372 Ga0157378_10082890 3300013297 Bacteria 2901
373 Ga0157378_10085504 3300013297 Bacteria 2857
374 Ga0157378_10123896 3300013297 Bacteria 2385
375 Ga0157378_10210633 3300013297 Bacteria 1843
376 Ga0157378_10284000 3300013297 Bacteria 1596
377 Ga0157378_10335073 3300013297 Unclassified 1474
378 Ga0157378_10388862 3300013297 Bacteria 1371
379 Ga0163162_10005742 3300013306 Bacteria 12001
380 Ga0163162_10046149 3300013306 Bacteria 4367
381 Ga0163162_10130609 3300013306 Bacteria 2620
382 Ga0163162_10212687 3300013306 Bacteria 2064
383 Ga0163162_10444852 3300013306 Bacteria 1428
384 Ga0157372_10000540 3300013307 Bacteria 41649
385 Ga0157372_10000845 3300013307 Bacteria 33235
386 Ga0157372_10001184 3300013307 Bacteria 28212
387 Ga0157372_10019861 3300013307 Bacteria 7240
388 Ga0157372_10305829 3300013307 Bacteria 1850
389 Ga0157372_10627000 3300013307 Unclassified 1253
390 Ga0157375_10277462 3300013308 Bacteria 1839
391 Ga0157375_10484537 3300013308 Unclassified 1402
392 Ga0163163_10001395 3300014325 Bacteria 20392
393 Ga0163163_10002052 3300014325 Bacteria 16997
394 Ga0163163_10189496 3300014325 Bacteria 2105
395 Ga0163163_10230261 3300014325 Bacteria 1902
396 Ga0163163_10258435 3300014325 Bacteria 1792
397 Ga0163163_10411143 3300014325 Unclassified 1412
398 Ga0157380_10338964 3300014326 Unclassified 1401
399 Ga0157377_10024546 3300014745 Bacteria 3205
400 Ga0157379_10004208 3300014968 Bacteria 12288
401 Ga0157379_10009128 3300014968 Bacteria 8635
402 Ga0157379_10012421 3300014968 Bacteria 7437
403 Ga0157379_10013451 3300014968 Bacteria 7169
404 Ga0157379_10019460 3300014968 Bacteria 5996
405 Ga0157379_10051201 3300014968 Bacteria 3688
406 Ga0157379_10092968 3300014968 Bacteria 2706
407 Ga0157376_10007509 3300014969 Bacteria 7790
408 Ga0157376_10013169 3300014969 Bacteria 6163
409 Ga0157376_10038471 3300014969 Unclassified 3893
410 Ga0157376_10069513 3300014969 Unclassified 2985
411 Ga0157376_10085139 3300014969 Unclassified 2723
412 Ga0157376_10400085 3300014969 Bacteria 1328
413 Ga0163161_10167644 3300017792 Bacteria 1678
414 Ga0197907_10419767 3300020069 Bacteria 3168
415 Ga0206356_10660814 3300020070 Bacteria 1417
416 Ga0206356_10693455 3300020070 Unclassified 1177
417 Ga0206356_10844687 3300020070 Unclassified 1127
418 Ga0206356_11376450 3300020070 Bacteria 1407
419 Ga0206349_1194817 3300020075 Bacteria 1848
420 Ga0206350_11158639 3300020080 Bacteria 3968
421 Ga0154015_1324747 3300020610 Unclassified 1174
422 Ga0213875_10037145 3300021388 Bacteria 2296
423 Ga0213875_10134125 3300021388 Bacteria 1158
424 Ga0224712_10001197 3300022467 Bacteria 5834
425 Ga0224712_10006852 3300022467 Bacteria 3281
426 Ga0224712_10044238 3300022467 Unclassified 1697
427 Ga0224570_100214 3300022730 Unclassified 4146
428 Ga0224569_100615 3300022732 Bacteria 3071
429 Ga0224571_100223 3300022734 Bacteria 2788
430 Ga0224572_1001725 3300024225 Unclassified 3332
431 Ga0228598_1000044 3300024227 Bacteria 17465
432 Ga0228598_1000070 3300024227 Bacteria 15225
433 Ga0228598_1001333 3300024227 Bacteria 5436
434 Ga0207697_10001180 3300025315 Bacteria 14351
435 Ga0207697_10052573 3300025315 Bacteria 1686
436 Ga0207653_10016643 3300025885 Bacteria 2310
437 Ga0207682_10015653 3300025893 Bacteria 2954
438 Ga0207682_10088430 3300025893 Bacteria 1339
439 Ga0207692_10013451 3300025898 Bacteria 3551
440 Ga0207692_10091051 3300025898 Unclassified 1654
441 Ga0207710_10018239 3300025900 Bacteria 2983
442 Ga0207710_10056137 3300025900 Bacteria 1777
443 Ga0207688_10062886 3300025901 Unclassified 2093
444 Ga0207680_10024840 3300025903 Unclassified 3295
445 Ga0207680_10034965 3300025903 Bacteria 2880
446 Ga0207680_10208864 3300025903 Bacteria 1334
447 Ga0207647_10004807 3300025904 Bacteria 9999
448 Ga0207647_10016923 3300025904 Unclassified 4965
449 Ga0207685_10001682 3300025905 Bacteria 4771
450 Ga0207685_10067157 3300025905 Bacteria 1441
451 Ga0207699_10012408 3300025906 Unclassified 4335
452 Ga0207699_10047766 3300025906 Bacteria 2511
453 Ga0207699_10172588 3300025906 Bacteria 1448
454 Ga0207699_10191628 3300025906 Bacteria 1380
455 Ga0207699_10242932 3300025906 Unclassified 1238
456 Ga0207645_10003579 3300025907 Bacteria 11750
457 Ga0207645_10004591 3300025907 Bacteria 10183
458 Ga0207645_10172978 3300025907 Bacteria 1416
459 Ga0207643_10001054 3300025908 Bacteria 16318
460 Ga0207705_10002624 3300025909 Bacteria 13787
461 Ga0207705_10234245 3300025909 Bacteria 1397
462 Ga0207684_10000320 3300025910 Bacteria 68296
463 Ga0207684_10004878 3300025910 Bacteria 12535
464 Ga0207684_10078135 3300025910 Bacteria 2815
465 Ga0207654_10020250 3300025911 Bacteria 3524
466 Ga0207707_10001452 3300025912 Bacteria 21916
467 Ga0207707_10004494 3300025912 Bacteria 12268
468 Ga0207707_10018296 3300025912 Bacteria 6108
469 Ga0207707_10060733 3300025912 Bacteria 3288
470 Ga0207707_10269601 3300025912 Unclassified 1475
471 Ga0207695_10008636 3300025913 Bacteria 12718
472 Ga0207695_10008675 3300025913 Bacteria 12685
473 Ga0207695_10013009 3300025913 Bacteria 9941
474 Ga0207695_10114494 3300025913 Bacteria 2672
475 Ga0207695_10284783 3300025913 Bacteria 1546
476 Ga0207671_10167045 3300025914 Bacteria 1707
477 Ga0207693_10000008 3300025915 Bacteria 171049
478 Ga0207693_10001167 3300025915 Bacteria 23425
479 Ga0207693_10002431 3300025915 Bacteria 16175
480 Ga0207693_10007049 3300025915 Bacteria 9275
481 Ga0207693_10009953 3300025915 Bacteria 7729
482 Ga0207693_10015202 3300025915 Bacteria 6177
483 Ga0207693_10026238 3300025915 Bacteria 4612
484 Ga0207663_10000111 3300025916 Bacteria 39513
485 Ga0207663_10010876 3300025916 Bacteria 4860
486 Ga0207663_10047053 3300025916 Bacteria 2661
487 Ga0207663_10056451 3300025916 Unclassified 2469
488 Ga0207660_10016931 3300025917 Bacteria 4837
489 Ga0207660_10099890 3300025917 Bacteria 2166
490 Ga0207662_10009381 3300025918 Bacteria 5382
491 Ga0207662_10201167 3300025918 Bacteria 1289
492 Ga0207657_10000386 3300025919 Bacteria 46458
493 Ga0207657_10002009 3300025919 Bacteria 21997
494 Ga0207657_10005757 3300025919 Bacteria 12926
495 Ga0207649_10015374 3300025920 Bacteria 4300
496 Ga0207652_10005785 3300025921 Bacteria 10032
497 Ga0207652_10023725 3300025921 Bacteria 5085
498 Ga0207652_10050957 3300025921 Bacteria 3548
499 Ga0207652_10297020 3300025921 Unclassified 1458
500 Ga0207646_10073817 3300025922 Bacteria 3047
501 Ga0207646_10337240 3300025922 Bacteria 1362
502 Ga0207646_10410762 3300025922 Bacteria 1222
503 Ga0207681_10100408 3300025923 Unclassified 2085
504 Ga0207681_10534918 3300025923 Unclassified 963
505 Ga0207694_10003298 3300025924 Bacteria 12840
506 Ga0207694_10004655 3300025924 Bacteria 10681
507 Ga0207694_10005997 3300025924 Bacteria 9303
508 Ga0207694_10036165 3300025924 Bacteria 3789
509 Ga0207694_10036471 3300025924 Unclassified 3774
510 Ga0207694_10224683 3300025924 Bacteria 1532
511 Ga0207650_10067229 3300025925 Bacteria 2689
512 Ga0207659_10000642 3300025926 Bacteria 20752
513 Ga0207659_10002882 3300025926 Bacteria 10236
514 Ga0207659_10490221 3300025926 Unclassified 1039
515 Ga0207687_10030526 3300025927 Unclassified 3635
516 Ga0207687_10045413 3300025927 Bacteria 3036
517 Ga0207687_10066038 3300025927 Bacteria 2570
518 Ga0207687_10077756 3300025927 Unclassified 2387
519 Ga0207687_10111801 3300025927 Bacteria 2029
520 Ga0207687_10301170 3300025927 Unclassified 1291
521 Ga0207687_10467384 3300025927 Unclassified 1048
522 Ga0207700_10000107 3300025928 Bacteria 49976
523 Ga0207700_10006279 3300025928 Bacteria 7172
524 Ga0207700_10019351 3300025928 Unclassified 4597
525 Ga0207700_10063979 3300025928 Bacteria 2800
526 Ga0207700_10068309 3300025928 Bacteria 2724
527 Ga0207700_10180330 3300025928 Unclassified 1768
528 Ga0207700_10204560 3300025928 Unclassified 1665
529 Ga0207700_10426237 3300025928 Bacteria 1166
530 Ga0207664_10054162 3300025929 Bacteria 3178
531 Ga0207664_10176543 3300025929 Unclassified 1832
532 Ga0207664_10187705 3300025929 Unclassified 1778
533 Ga0207664_10302520 3300025929 Bacteria 1407
534 Ga0207644_10030295 3300025931 Bacteria 3762
535 Ga0207644_10067598 3300025931 Bacteria 2605
536 Ga0207644_10389640 3300025931 Bacteria 1137
537 Ga0207690_10070683 3300025932 Bacteria 2405
538 Ga0207706_10000641 3300025933 Bacteria 37090
539 Ga0207706_10092392 3300025933 Bacteria 2661
540 Ga0207686_10067254 3300025934 Bacteria 2292
541 Ga0207686_10092920 3300025934 Bacteria 1996
542 Ga0207709_10205382 3300025935 Bacteria 1410
543 Ga0207670_10182863 3300025936 Bacteria 1580
544 Ga0207670_10294140 3300025936 Unclassified 1269
545 Ga0207669_10059837 3300025937 Bacteria 2332
546 Ga0207669_10171747 3300025937 Bacteria 1544
547 Ga0207704_10012937 3300025938 Unclassified 4158
548 Ga0207704_10034810 3300025938 Bacteria 2878
549 Ga0207665_10016930 3300025939 Unclassified 4785
550 Ga0207665_10039155 3300025939 Bacteria 3159
551 Ga0207665_10076197 3300025939 Bacteria 2299
552 Ga0207665_10113248 3300025939 Bacteria 1908
553 Ga0207691_10182599 3300025940 Bacteria 1833
554 Ga0207691_10286296 3300025940 Bacteria 1417
555 Ga0207691_10424416 3300025940 Bacteria 1133
556 Ga0207711_10044184 3300025941 Bacteria 3803
557 Ga0207711_10056241 3300025941 Bacteria 3380
558 Ga0207711_10066415 3300025941 Bacteria 3119
559 Ga0207711_10096175 3300025941 Bacteria 2613
560 Ga0207711_10168820 3300025941 Bacteria 1984
561 Ga0207689_10003694 3300025942 Bacteria 13950
562 Ga0207689_10004152 3300025942 Bacteria 13168
563 Ga0207689_10025571 3300025942 Bacteria 4947
564 Ga0207689_10046783 3300025942 Unclassified 3574
565 Ga0207689_10098810 3300025942 Unclassified 2398
566 Ga0207689_10146344 3300025942 Bacteria 1946
567 Ga0207661_10040859 3300025944 Bacteria 3649
568 Ga0207679_10166851 3300025945 Bacteria 1809
569 Ga0207667_10000087 3300025949 Bacteria 149828
570 Ga0207667_10000465 3300025949 Bacteria 54509
571 Ga0207667_10001399 3300025949 Bacteria 30243
572 Ga0207667_10007820 3300025949 Bacteria 12776
573 Ga0207667_10012244 3300025949 Bacteria 9905
574 Ga0207667_10055236 3300025949 Bacteria 4175
575 Ga0207651_10137640 3300025960 Bacteria 1881
576 Ga0207651_10158464 3300025960 Bacteria 1771
577 Ga0207651_10265793 3300025960 Bacteria 1410
578 Ga0207651_10493219 3300025960 Unclassified 1057
579 Ga0207712_10044134 3300025961 Bacteria 3079
580 Ga0207712_10052395 3300025961 Unclassified 2858
581 Ga0207712_10088737 3300025961 Bacteria 2272
582 Ga0207640_10034171 3300025981 Bacteria 3170
583 Ga0207640_10054643 3300025981 Bacteria 2612
584 Ga0207640_10105632 3300025981 Bacteria 1985
585 Ga0207640_10135407 3300025981 Bacteria 1787
586 Ga0207658_10054958 3300025986 Unclassified 2948
587 Ga0207677_10011911 3300026023 Bacteria 4978
588 Ga0207677_10022193 3300026023 Bacteria 3896
589 Ga0207677_10022255 3300026023 Unclassified 3892
590 Ga0207677_10319207 3300026023 Bacteria 1290
591 Ga0207677_10444773 3300026023 Bacteria 1109
592 Ga0207703_10003748 3300026035 Bacteria 12650
593 Ga0207703_10004875 3300026035 Bacteria 10911
594 Ga0207703_10009661 3300026035 Bacteria 7573
595 Ga0207703_10023202 3300026035 Bacteria 4873
596 Ga0207703_10032794 3300026035 Bacteria 4113
597 Ga0207703_10041828 3300026035 Bacteria 3674
598 Ga0207703_10056180 3300026035 Bacteria 3205
599 Ga0207703_10121586 3300026035 Bacteria 2242
600 Ga0207639_10040615 3300026041 Unclassified 3473
601 Ga0207639_10061531 3300026041 Bacteria 2900
602 Ga0207639_10088557 3300026041 Bacteria 2471
603 Ga0207639_10460422 3300026041 Unclassified 1156
604 Ga0207678_10008144 3300026067 Bacteria 9241
605 Ga0207678_10535645 3300026067 Unclassified 1023
606 Ga0207702_10000458 3300026078 Bacteria 46107
607 Ga0207702_10001096 3300026078 Bacteria 27672
608 Ga0207702_10019362 3300026078 Bacteria 5633
609 Ga0207702_10019664 3300026078 Bacteria 5590
610 Ga0207702_10112427 3300026078 Bacteria 2424
611 Ga0207702_10157820 3300026078 Bacteria 2069
612 Ga0207702_10220425 3300026078 Bacteria 1768
613 Ga0207641_10009846 3300026088 Bacteria 7870
614 Ga0207641_10013325 3300026088 Bacteria 6743
615 Ga0207641_10032728 3300026088 Bacteria 4318
616 Ga0207648_10017102 3300026089 Bacteria 6609
617 Ga0207648_10027431 3300026089 Bacteria 5055
618 Ga0207648_10091877 3300026089 Unclassified 2654
619 Ga0207648_10227243 3300026089 Unclassified 1660
620 Ga0207676_10091286 3300026095 Bacteria 2502
621 Ga0207676_10480687 3300026095 Bacteria 1176
622 Ga0207674_10003692 3300026116 Bacteria 18684
623 Ga0207674_10005293 3300026116 Bacteria 15350
624 Ga0207674_10007441 3300026116 Bacteria 12762
625 Ga0207674_10021941 3300026116 Bacteria 6867
626 Ga0207674_10198554 3300026116 Bacteria 1955
627 Ga0207675_100342874 3300026118 Unclassified 1463
628 Ga0207675_100343394 3300026118 Unclassified 1462
629 Ga0207683_10016513 3300026121 Bacteria 6284
630 Ga0207698_10055113 3300026142 Bacteria 3062
631 Ga0207698_10153336 3300026142 Bacteria 2003
632 Ga0207698_10236936 3300026142 Unclassified 1660
633 Ga0207698_10311178 3300026142 Unclassified 1471
634 Ga0207698_10485964 3300026142 Unclassified 1199
635 Ga0210002_1011021 3300027617 Bacteria 1394
636 Ga0209588_1000001 3300027671 Bacteria 705877
637 Ga0209588_1007857 3300027671 Bacteria 3152
638 Ga0209998_10032123 3300027717 Unclassified 1166
639 Ga0207428_10000002 3300027907 Bacteria 854851
640 Ga0207428_10007903 3300027907 Bacteria 9668
641 Ga0207428_10352895 3300027907 Bacteria 1082
642 Ga0265354_1000756 3300028016 Bacteria 5272
643 Ga0265356_1000296 3300028017 Bacteria 9318
644 Ga0268266_10010487 3300028379 Bacteria 8098
645 Ga0268266_10046251 3300028379 Bacteria 3726
646 Ga0268266_10159561 3300028379 Bacteria 2039
647 Ga0268266_10786697 3300028379 Bacteria 919
648 Ga0268265_10015036 3300028380 Bacteria 5286
649 Ga0268265_10039405 3300028380 Unclassified 3483
650 Ga0268264_10014069 3300028381 Bacteria 6577
651 Ga0268264_10015954 3300028381 Bacteria 6154
652 Ga0268264_10057936 3300028381 Unclassified 3242
653 Ga0268264_10143586 3300028381 Bacteria 2132
654 Ga0268264_10156666 3300028381 Bacteria 2047
655 Ga0268264_10218100 3300028381 Bacteria 1755
656 Ga0268264_10743142 3300028381 Unclassified 977
657 Ga0265319_1032510 3300028563 Bacteria 1808
658 Ga0265318_10005107 3300028577 Bacteria 6214
659 Ga0265338_10013466 3300028800 Bacteria 9232
660 Ga0265338_10037839 3300028800 Unclassified 4582
661 Ga0265338_10212034 3300028800 Bacteria 1453
662 Ga0265338_10270358 3300028800 Unclassified 1246
663 Ga0265324_10057812 3300029957 Unclassified 1327
664 Ga0265762_1000130 3300030760 Bacteria 11334
665 Ga0265762_1026117 3300030760 Unclassified 1092
666 Ga0265762_1028232 3300030760 Bacteria 1056
667 Ga0265770_1000180 3300030878 Bacteria 8227
668 Ga0265765_1000179 3300030879 Bacteria 4180
669 Ga0265760_10001544 3300031090 Bacteria 6793
670 Ga0265760_10010701 3300031090 Bacteria 2619
671 Ga0265760_10011422 3300031090 Bacteria 2537
672 Ga0265330_10000186 3300031235 Bacteria 48099
673 Ga0265330_10000338 3300031235 Bacteria 33586
674 Ga0265330_10038099 3300031235 Bacteria 2138
675 Ga0265332_10005345 3300031238 Bacteria 5933
676 Ga0265328_10003777 3300031239 Bacteria 6659
677 Ga0265325_10000138 3300031241 Bacteria 50464
678 Ga0265325_10002006 3300031241 Bacteria 13980
679 Ga0265325_10073825 3300031241 Bacteria 1707
680 Ga0265340_10002941 3300031247 Bacteria 9703
681 Ga0265339_10001543 3300031249 Bacteria 17020
682 Ga0265339_10004329 3300031249 Bacteria 9702
683 Ga0265331_10012844 3300031250 Bacteria 4520
684 Ga0265331_10090161 3300031250 Bacteria 1418
685 Ga0265316_10000510 3300031344 Bacteria 43837
686 Ga0265316_10000713 3300031344 Bacteria 36680
687 Ga0265316_10005655 3300031344 Bacteria 12097
688 Ga0265316_10006792 3300031344 Bacteria 10883
689 Ga0265316_10014330 3300031344 Bacteria 6984
690 Ga0265316_10019254 3300031344 Bacteria 5842
691 Ga0265316_10082732 3300031344 Bacteria 2459
692 Ga0265313_10002720 3300031595 Bacteria 14969
693 Ga0265313_10003181 3300031595 Bacteria 13530
694 Ga0265313_10006745 3300031595 Bacteria 8030
695 Ga0265314_10000187 3300031711 Bacteria 92142
696 Ga0265314_10000509 3300031711 Bacteria 50279
697 Ga0265314_10022657 3300031711 Bacteria 4809
698 Ga0265314_10033167 3300031711 Bacteria 3790
699 Ga0265314_10150276 3300031711 Unclassified 1429
700 Ga0265342_10000101 3300031712 Bacteria 94267
701 Ga0265342_10006543 3300031712 Bacteria 8667
702 Ga0265342_10039255 3300031712 Unclassified 2878
703 Ga0265342_10045773 3300031712 Unclassified 2632
704 Ga0316212_1001140 3300033547 Bacteria 3548
705 Ga0316212_1009626 3300033547 Bacteria 1387
706 Ga0373929_0024780 3300035085 Bacteria 1242
707 Ga0373936_0003520 3300035113 Bacteria 5889
708 Ga0373957_0070807 3300035120 Bacteria 1364
709 Ga0373957_0072836 3300035120 Unclassified 1346
710 Ga0373943_0043030 3300035170 Bacteria 2192
711 Ga0373942_0031264 3300035207 Bacteria 1407
712 Ga0373931_0048317 3300035691 Bacteria 2255
713 Ga0373931_0152562 3300035691 Unclassified 1348
714 Ga0373931_0236943 3300035691 Bacteria 1105
715 Ga0373935_0061927 3300035692 Bacteria 2396
716 Ga0373927_0064853 3300035695 Unclassified 2362
717 Ga0373927_0093605 3300035695 Bacteria 1952
718 Ga0373927_0134761 3300035695 Bacteria 1614
719 Ga0373933_0421205 3300035724 Bacteria 872
720 Ga0373947_0003055 3300035725 Bacteria 9956
721 Ga0373947_0024378 3300035725 Bacteria 3525
722 Ga0373937_0010129 3300036401 Bacteria 8223
723 Ga0373937_0071265 3300036401 Bacteria 3205
724 Ga0373925_0011956 3300037068 Bacteria 6282
725 Ga0373925_0037190 3300037068 Bacteria 3593
726 Ga0436364_0703870 3300037853 Bacteria 4877
727 Ga0436364_1014577 3300037853 Bacteria 3723
728 Ga0436365_1220175 3300039437 Bacteria 3205
729 Ga0436360_1131923 3300039438 Bacteria 1450
730 Ga0436363_1455988 3300039450 Bacteria 2122
731 Ga0439446_0048630 3300042156 Bacteria 1263
732 Ga0439434_0111942 3300042435 Bacteria 885
733 Ga0439464_0019508 3300042439 Bacteria 1851
734 Ga0451577_0128481 3300042876 Unclassified 2272
735 Ga0453683_0002798 3300044673 Bacteria 13268
736 Ga0453683_0006940 3300044673 Bacteria 7721
737 Ga0453684_0022220 3300044712 Bacteria 9427
738 Ga0451576_0039470 3300045051 Bacteria 4997
739 Ga0451576_0319520 3300045051 Unclassified 1624
740 Ga0495592_0354559 3300046454 Unclassified 940
741 Ga0495580_0002181 3300046472 Bacteria 17133
742 Ga0495580_0010201 3300046472 Bacteria 7333
743 Ga0495580_0017341 3300046472 Bacteria 5386
744 Ga0495580_0018437 3300046472 Bacteria 5195
745 Ga0495580_0019663 3300046472 Bacteria 5015
746 Ga0495580_0038512 3300046472 Bacteria 3424
747 Ga0495580_0065487 3300046472 Bacteria 2545
748 Ga0495582_0012347 3300046473 Bacteria 4705
749 Ga0495639_0113809 3300046475 Unclassified 1286
750 Ga0495664_0053165 3300046477 Unclassified 2409
751 Ga0495608_0103142 3300046511 Unclassified 1838
752 Ga0495628_0110112 3300046516 Unclassified 2119
753 Ga0495630_0004015 3300046517 Bacteria 10297
754 Ga0495630_0032428 3300046517 Bacteria 3893
755 Ga0495630_0168703 3300046517 Unclassified 1667
756 Ga0495665_0202636 3300046531 Unclassified 1028
757 Ga0495621_0060175 3300046539 Unclassified 1377
758 Ga0495597_0139863 3300046542 Bacteria 999
759 Ga0495645_0002510 3300046543 Bacteria 12456
760 Ga0495645_0030542 3300046543 Bacteria 3924
761 Ga0495667_0129956 3300046559 Unclassified 1625
762 Ga0495635_0076315 3300046663 Bacteria 2297
763 Ga0495635_0094796 3300046663 Bacteria 2041
764 Ga0495657_0102308 3300046675 Unclassified 1823
765 Ga0495599_0080445 3300046678 Bacteria 2035
766 Ga0495599_0151616 3300046678 Bacteria 1435
767 Ga0495658_0206709 3300046683 Unclassified 1225
768 Ga0495658_0444369 3300046683 Unclassified 828
769 Ga0495613_0246119 3300046689 Unclassified 1249
770 Ga0495624_0229335 3300046690 Unclassified 1125
771 Ga0495600_0174794 3300046809 Unclassified 1385
772 Ga0495636_0166160 3300047318 Unclassified 996
773 Ga0495674_0007648 3300047319 Bacteria 10321
774 Ga0495674_0032047 3300047319 Bacteria 4771
775 Ga0495674_0304201 3300047319 Bacteria 1302
776 Ga0495684_0008283 3300047471 Bacteria 8051
777 Ga0495593_0054240 3300047673 Unclassified 2114
778 Ga0495602_0323491 3300048088 Bacteria 1121
779 Ga0496100_0006702 3300048903 Bacteria 6303
780 Ga0496100_0144936 3300048903 Bacteria 1688
781 Ga0496102_0031150 3300048905 Bacteria 4782
782 Ga0496102_0050682 3300048905 Unclassified 3781
783 Ga0496103_0001075 3300048906 Bacteria 19076
784 Ga0496103_0152184 3300048906 Bacteria 1482
785 Ga0496103_0196537 3300048906 Unclassified 1297
786 Ga0496104_0007903 3300048907 Bacteria 9429
787 Ga0496104_0091868 3300048907 Bacteria 2902
788 Ga0496105_0005363 3300048908 Bacteria 9720
789 Ga0496105_0040070 3300048908 Bacteria 3862
790 Ga0496105_0073262 3300048908 Bacteria 2830
791 Ga0496106_0105462 3300048909 Bacteria 2190
792 Ga0496107_0100740 3300048910 Bacteria 2118
793 Ga0496109_0368569 3300048912 Unclassified 1357
794 Ga0496112_0001729 3300048915 Bacteria 17084
795 Ga0496112_0060610 3300048915 Unclassified 3729
796 Ga0496113_0225172 3300048916 Bacteria 1495
797 Ga0496114_0149725 3300048917 Bacteria 2024
798 Ga0496115_0002823 3300048918 Bacteria 12490
799 Ga0496115_0006852 3300048918 Bacteria 8364
800 Ga0496115_0438646 3300048918 Unclassified 1056
801 Ga0501036_0016900 3300049572 Bacteria 6095
802 Ga0501036_0175404 3300049572 Bacteria 1805
803 Ga0501038_0068476 3300049574 Bacteria 3017
804 Ga0501038_0214355 3300049574 Unclassified 1539
805 Ga0501039_0102403 3300049575 Bacteria 2235
806 Ga0501040_0008123 3300049576 Bacteria 6818
807 Ga0501040_0018969 3300049576 Bacteria 4573
808 Ga0501040_0089386 3300049576 Bacteria 2140
809 Ga0501041_0005268 3300049577 Bacteria 7559
810 Ga0501041_0010096 3300049577 Bacteria 5563
811 Ga0501041_0036996 3300049577 Bacteria 2957
812 Ga0501042_0021495 3300049578 Bacteria 4498
813 Ga0501046_0052948 3300049580 Bacteria 3198
814 Ga0501048_0020750 3300049582 Bacteria 4815
815 Ga0501048_0104931 3300049582 Bacteria 1994
816 Ga0501068_0158399 3300049584 Bacteria 1426
817 Ga0501071_0036063 3300049587 Bacteria 3526
818 Ga0501071_0045159 3300049587 Bacteria 3162
819 Ga0501072_0210034 3300049588 Bacteria 1551
820 Ga0501072_0213540 3300049588 Unclassified 1538
821 Ga0501074_0106929 3300049590 Bacteria 2003
822 Ga0501075_0018459 3300049591 Bacteria 5050
823 Ga0501075_0021421 3300049591 Bacteria 4712
824 Ga0501076_0029062 3300049592 Bacteria 4297
825 Ga0501076_0063116 3300049592 Bacteria 2951
826 Ga0501077_0033490 3300049593 Bacteria 3270
827 Ga0501077_0047521 3300049593 Bacteria 2727
828 Ga0501077_0301674 3300049593 Unclassified 1020
829 Ga0501079_0012290 3300049741 Bacteria 6533
830 Ga0501079_0016615 3300049741 Bacteria 5621
831 Ga0501079_0113463 3300049741 Bacteria 2106
832 Ga0501080_0050666 3300049742 Bacteria 3864
833 Ga0501080_0091948 3300049742 Bacteria 2818
834 Ga0501081_0004305 3300049743 Bacteria 9123
835 Ga0501083_0300733 3300049744 Bacteria 1043
836 Ga0501035_0546233 3300049822 Bacteria 949
837 Ga0501045_0056312 3300049824 Bacteria 2875
838 nmdc:mga05p37_171860_c1 3300050507 Bacteria 2643
839 nmdc:mga05p37_47597_c1 3300050507 Bacteria 5273
840 nmdc:mga05p37_559415_c1 3300050507 Bacteria 1300
841 nmdc:mga05p37_7197_c1 3300050507 Bacteria 13125
842 nmdc:mga09592_123251_c1 3300050508 Bacteria 2227
843 nmdc:mga09592_33724_c1 3300050508 Bacteria 4276
844 nmdc:mga09592_4883_c1 3300050508 Bacteria 10856
845 nmdc:mga0qj67_269670_c1 3300050509 Bacteria 1380
846 nmdc:mga0qj67_8621_c1 3300050509 Bacteria 7566
847 nmdc:mga06r32_1387_c1 3300050510 Bacteria 21887
848 nmdc:mga06r32_243651_c1 3300050510 Bacteria 1785
849 nmdc:mga08y16_1110727_c1 3300050511 Unclassified 765
850 nmdc:mga08y16_122205_c1 3300050511 Unclassified 2710
851 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
852 nmdc:mga08y16_69678_c1 3300050511 Bacteria 3666
853 nmdc:mga0n895_100643_c1 3300050512 Unclassified 2899
854 nmdc:mga0n895_124865_c1 3300050512 Bacteria 2597
855 nmdc:mga0n895_19099_c1 3300050512 Bacteria 6363
856 nmdc:mga0n895_356757_c1 3300050512 Unclassified 1481
857 nmdc:mga0n895_379390_c1 3300050512 Bacteria 1431
858 nmdc:mga0n895_586130_c1 3300050512 Bacteria 1119
859 nmdc:mga0rr50_107149_c1 3300050513 Bacteria 2206
860 nmdc:mga0rr50_126767_c1 3300050513 Bacteria 2039
861 nmdc:mga0rr50_423943_c1 3300050513 Unclassified 1126
862 nmdc:mga0rr50_65112_c1 3300050513 Bacteria 2760
863 nmdc:mga0a205_132888_c1 3300050515 Bacteria 2389
864 nmdc:mga0a205_518313_c1 3300050515 Bacteria 1049
865 nmdc:mga0a205_7765_c1 3300050515 Bacteria 9738
866 Ga0501084_0027810 3300054114 Bacteria 4726
867 Ga0501084_0294060 3300054114 Bacteria 1371
868 Ga0590071_005999 3300059421 Bacteria 2906
869 Ga0590077_002674 3300059426 Bacteria 3766
870 Ga0587128_011851 3300059630 Bacteria 1200
871 Ga0501082_0011799 3300060353 Bacteria 7512
872 Ga0501082_0165990 3300060353 Bacteria 1919
873 Ga0530510_0001309 3300061734 Bacteria 16633
874 Ga0530510_0100901 3300061734 Bacteria 2110

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042156 Ga0439446_0048630 Ga0439446_0048630_626_1243 202
2 3300005471 Ga0070698_100029720 Ga0070698_1000297203 232
3 3300050511 nmdc:mga08y16_1110727_c1 nmdc:mga08y16_1110727_c1_19_732 232
4 3300046516 Ga0495628_0110112 Ga0495628_0110112_1358_2083 234
5 3300046543 Ga0495645_0030542 Ga0495645_0030542_2670_3395 234
6 3300010159 Ga0099796_10081935 Ga0099796_100819352 236
7 3300026067 Ga0207678_10535645 Ga0207678_105356451 236
8 3300005434 Ga0070709_10330327 Ga0070709_103303272 237
9 3300037068 Ga0373925_0011956 Ga0373925_0011956_5527_6255 239
10 3300046542 Ga0495597_0139863 Ga0495597_0139863_152_883 239
11 3300048918 Ga0496115_0438646 Ga0496115_0438646_304_1032 239
12 3300009098 Ga0105245_10162821 Ga0105245_101628213 245
13 3300009101 Ga0105247_10068712 Ga0105247_100687124 245
14 3300009176 Ga0105242_10058932 Ga0105242_100589323 245
15 3300009177 Ga0105248_10007399 Ga0105248_1000739911 245
16 3300013306 Ga0163162_10212687 Ga0163162_102126872 245
17 3300014325 Ga0163163_10002052 Ga0163163_100020522 245
18 3300014968 Ga0157379_10009128 Ga0157379_100091285 245
19 3300014969 Ga0157376_10007509 Ga0157376_100075098 245
20 3300005617 Ga0068859_100244765 Ga0068859_1002447652 246
21 3300006931 Ga0097620_100244732 Ga0097620_1002447322 246
22 3300009093 Ga0105240_10111346 Ga0105240_101113463 246
23 3300009176 Ga0105242_10149562 Ga0105242_101495623 246
24 3300009545 Ga0105237_10067340 Ga0105237_100673406 246
25 3300009551 Ga0105238_10004737 Ga0105238_100047372 246
26 3300014969 Ga0157376_10400085 Ga0157376_104000853 246
27 3300025942 Ga0207689_10146344 Ga0207689_101463442 246
28 3300042435 Ga0439434_0111942 Ga0439434_0111942_17_772 246
29 3300009098 Ga0105245_10098891 Ga0105245_100988912 247
30 3300046663 Ga0495635_0094796 Ga0495635_0094796_920_1666 248
31 3300035691 Ga0373931_0236943 Ga0373931_0236943_291_1049 249
32 3300035725 Ga0373947_0003055 Ga0373947_0003055_2618_3373 250
33 3300046683 Ga0495658_0444369 Ga0495658_0444369_13_792 252
34 3300007265 Ga0099794_10000004 Ga0099794_100000043 253
35 3300036401 Ga0373937_0071265 Ga0373937_0071265_474_1253 253
36 3300049572 Ga0501036_0175404 Ga0501036_0175404_980_1795 253
37 3300049574 Ga0501038_0214355 Ga0501038_0214355_161_976 253
38 3300049576 Ga0501040_0089386 Ga0501040_0089386_938_1753 253
39 3300049577 Ga0501041_0036996 Ga0501041_0036996_743_1558 253
40 3300049587 Ga0501071_0045159 Ga0501071_0045159_1414_2229 253
41 3300049591 Ga0501075_0021421 Ga0501075_0021421_3231_4046 253
42 3300049592 Ga0501076_0029062 Ga0501076_0029062_3157_3972 253
43 3300049593 Ga0501077_0047521 Ga0501077_0047521_96_911 253
44 3300049741 Ga0501079_0016615 Ga0501079_0016615_4184_4999 253
45 3300049742 Ga0501080_0091948 Ga0501080_0091948_475_1290 253
46 3300049743 Ga0501081_0004305 Ga0501081_0004305_4064_4879 253
47 3300054114 Ga0501084_0027810 Ga0501084_0027810_165_980 253
48 3300035120 Ga0373957_0072836 Ga0373957_0072836_29_811 257
49 3300035695 Ga0373927_0064853 Ga0373927_0064853_376_1158 257
50 3300035724 Ga0373933_0421205 Ga0373933_0421205_32_814 257
51 3300036401 Ga0373937_0010129 Ga0373937_0010129_1986_2768 257
52 3300046472 Ga0495580_0017341 Ga0495580_0017341_3964_4746 257
53 3300046559 Ga0495667_0129956 Ga0495667_0129956_359_1141 257
54 3300047471 Ga0495684_0008283 Ga0495684_0008283_4234_5016 257
55 3300048088 Ga0495602_0323491 Ga0495602_0323491_142_924 257
56 3300028379 Ga0268266_10159561 Ga0268266_101595612 258
57 3300047319 Ga0495674_0304201 Ga0495674_0304201_245_1036 258
58 3300035695 Ga0373927_0134761 Ga0373927_0134761_154_954 261
59 3300046454 Ga0495592_0354559 Ga0495592_0354559_48_854 261
60 3300009094 Ga0111539_10040991 Ga0111539_100409914 263
61 3300046678 Ga0495599_0151616 Ga0495599_0151616_182_982 263
62 3300050512 nmdc:mga0n895_586130_c1 nmdc:mga0n895_586130_c1_78_878 263
63 3300050513 nmdc:mga0rr50_65112_c1 nmdc:mga0rr50_65112_c1_1915_2715 263
64 3300045051 Ga0451576_0319520 Ga0451576_0319520_656_1468 265
65 3300028563 Ga0265319_1032510 Ga0265319_10325102 267
66 3300028800 Ga0265338_10037839 Ga0265338_100378394 267
67 3300049593 Ga0501077_0301674 Ga0501077_0301674_183_1001 267
68 3300005335 Ga0070666_10081609 Ga0070666_100816092 268
69 3300005367 Ga0070667_100022899 Ga0070667_1000228993 268
70 3300005439 Ga0070711_100048775 Ga0070711_1000487751 268
71 3300005842 Ga0068858_100022353 Ga0068858_1000223532 268
72 3300005843 Ga0068860_100019110 Ga0068860_1000191105 268
73 3300006237 Ga0097621_100009420 Ga0097621_10000942012 268
74 3300006358 Ga0068871_100030112 Ga0068871_1000301122 268
75 3300025903 Ga0207680_10034965 Ga0207680_100349654 268
76 3300025906 Ga0207699_10012408 Ga0207699_100124083 268
77 3300025927 Ga0207687_10030526 Ga0207687_100305263 268
78 3300025934 Ga0207686_10067254 Ga0207686_100672542 268
79 3300025941 Ga0207711_10096175 Ga0207711_100961755 268
80 3300025986 Ga0207658_10054958 Ga0207658_100549582 268
81 3300026023 Ga0207677_10022255 Ga0207677_100222552 268
82 3300026035 Ga0207703_10041828 Ga0207703_100418286 268
83 3300026095 Ga0207676_10091286 Ga0207676_100912862 268
84 3300028381 Ga0268264_10014069 Ga0268264_100140695 268
85 3300031241 Ga0265325_10073825 Ga0265325_100738252 268
86 3300005329 Ga0070683_100184188 Ga0070683_1001841882 269
87 3300005356 Ga0070674_100222104 Ga0070674_1002221042 269
88 3300005535 Ga0070684_100052651 Ga0070684_1000526513 269
89 3300005548 Ga0070665_100206334 Ga0070665_1002063342 269
90 3300005563 Ga0068855_100285841 Ga0068855_1002858412 269
91 3300005564 Ga0070664_100031470 Ga0070664_1000314707 269
92 3300006358 Ga0068871_100231032 Ga0068871_1002310322 269
93 3300006881 Ga0068865_100199277 Ga0068865_1001992773 269
94 3300009093 Ga0105240_10551647 Ga0105240_105516472 269
95 3300025913 Ga0207695_10284783 Ga0207695_102847832 269
96 3300025924 Ga0207694_10004655 Ga0207694_100046558 269
97 3300025934 Ga0207686_10092920 Ga0207686_100929202 269
98 3300025937 Ga0207669_10171747 Ga0207669_101717472 269
99 3300025944 Ga0207661_10040859 Ga0207661_100408593 269
100 3300025945 Ga0207679_10166851 Ga0207679_101668512 269
101 3300031344 Ga0265316_10082732 Ga0265316_100827322 269
102 3300004803 Ga0058862_12893689 Ga0058862_128936891 270
103 3300013102 Ga0157371_10089236 Ga0157371_100892362 270
104 3300013296 Ga0157374_10000454 Ga0157374_1000045416 270
105 3300013297 Ga0157378_10000899 Ga0157378_1000089914 270
106 3300013307 Ga0157372_10000845 Ga0157372_100008458 270
107 3300014325 Ga0163163_10189496 Ga0163163_101894962 270
108 3300014969 Ga0157376_10013169 Ga0157376_100131693 270
109 3300035691 Ga0373931_0152562 Ga0373931_0152562_172_993 270
110 3300039438 Ga0436360_1131923 Ga0436360_1131923_321_1163 270
111 3300048912 Ga0496109_0368569 Ga0496109_0368569_134_955 270
112 3300005327 Ga0070658_10062010 Ga0070658_100620104 271
113 3300005339 Ga0070660_100007571 Ga0070660_1000075719 271
114 3300005355 Ga0070671_100190221 Ga0070671_1001902212 271
115 3300005367 Ga0070667_100264587 Ga0070667_1002645872 271
116 3300005547 Ga0070693_100194275 Ga0070693_1001942752 271
117 3300005548 Ga0070665_100057610 Ga0070665_1000576103 271
118 3300005563 Ga0068855_100210802 Ga0068855_1002108022 271
119 3300005577 Ga0068857_100004869 Ga0068857_1000048693 271
120 3300005578 Ga0068854_100262646 Ga0068854_1002626462 271
121 3300005614 Ga0068856_100101664 Ga0068856_1001016642 271
122 3300005614 Ga0068856_100202497 Ga0068856_1002024973 271
123 3300005617 Ga0068859_100108684 Ga0068859_1001086843 271
124 3300005618 Ga0068864_100312002 Ga0068864_1003120022 271
125 3300005841 Ga0068863_100033688 Ga0068863_1000336885 271
126 3300005842 Ga0068858_100010263 Ga0068858_1000102632 271
127 3300006237 Ga0097621_100266673 Ga0097621_1002666732 271
128 3300006237 Ga0097621_100277933 Ga0097621_1002779332 271
129 3300006358 Ga0068871_100140356 Ga0068871_1001403562 271
130 3300006931 Ga0097620_100108683 Ga0097620_1001086833 271
131 3300009093 Ga0105240_10361382 Ga0105240_103613822 271
132 3300009098 Ga0105245_10012860 Ga0105245_100128607 271
133 3300009098 Ga0105245_10335104 Ga0105245_103351042 271
134 3300009101 Ga0105247_10049958 Ga0105247_100499584 271
135 3300009147 Ga0114129_10041222 Ga0114129_100412225 271
136 3300009148 Ga0105243_10073335 Ga0105243_100733352 271
137 3300009176 Ga0105242_10060759 Ga0105242_100607594 271
138 3300009176 Ga0105242_10442034 Ga0105242_104420342 271
139 3300009176 Ga0105242_10584148 Ga0105242_105841482 271
140 3300009177 Ga0105248_10040731 Ga0105248_100407312 271
141 3300009551 Ga0105238_10173179 Ga0105238_101731792 271
142 3300009551 Ga0105238_10178013 Ga0105238_101780132 271
143 3300013100 Ga0157373_10176975 Ga0157373_101769752 271
144 3300013105 Ga0157369_10095136 Ga0157369_100951364 271
145 3300013296 Ga0157374_10194908 Ga0157374_101949082 271
146 3300013297 Ga0157378_10284000 Ga0157378_102840002 271
147 3300013297 Ga0157378_10335073 Ga0157378_103350732 271
148 3300013306 Ga0163162_10130609 Ga0163162_101306091 271
149 3300013307 Ga0157372_10627000 Ga0157372_106270002 271
150 3300014325 Ga0163163_10001395 Ga0163163_100013953 271
151 3300014325 Ga0163163_10258435 Ga0163163_102584352 271
152 3300020069 Ga0197907_10419767 Ga0197907_104197673 271
153 3300020070 Ga0206356_11376450 Ga0206356_113764502 271
154 3300020610 Ga0154015_1324747 Ga0154015_13247472 271
155 3300022467 Ga0224712_10006852 Ga0224712_100068522 271
156 3300025900 Ga0207710_10018239 Ga0207710_100182393 271
157 3300025903 Ga0207680_10208864 Ga0207680_102088642 271
158 3300025909 Ga0207705_10234245 Ga0207705_102342452 271
159 3300025912 Ga0207707_10269601 Ga0207707_102696012 271
160 3300025913 Ga0207695_10008675 Ga0207695_100086752 271
161 3300025919 Ga0207657_10000386 Ga0207657_1000038620 271
162 3300025924 Ga0207694_10005997 Ga0207694_100059973 271
163 3300025924 Ga0207694_10224683 Ga0207694_102246832 271
164 3300025927 Ga0207687_10045413 Ga0207687_100454133 271
165 3300025931 Ga0207644_10067598 Ga0207644_100675982 271
166 3300025935 Ga0207709_10205382 Ga0207709_102053822 271
167 3300025941 Ga0207711_10044184 Ga0207711_100441842 271
168 3300025949 Ga0207667_10007820 Ga0207667_1000782016 271
169 3300026023 Ga0207677_10011911 Ga0207677_100119112 271
170 3300026035 Ga0207703_10023202 Ga0207703_100232022 271
171 3300026041 Ga0207639_10460422 Ga0207639_104604222 271
172 3300026078 Ga0207702_10019362 Ga0207702_100193622 271
173 3300026078 Ga0207702_10220425 Ga0207702_102204252 271
174 3300026088 Ga0207641_10032728 Ga0207641_100327285 271
175 3300026089 Ga0207648_10227243 Ga0207648_102272433 271
176 3300026116 Ga0207674_10007441 Ga0207674_100074418 271
177 3300026142 Ga0207698_10153336 Ga0207698_101533363 271
178 3300026142 Ga0207698_10485964 Ga0207698_104859642 271
179 3300028379 Ga0268266_10010487 Ga0268266_100104873 271
180 3300031344 Ga0265316_10005655 Ga0265316_100056555 271
181 3300050507 nmdc:mga05p37_7197_c1 nmdc:mga05p37_7197_c1_1036_1860 271
182 3300050515 nmdc:mga0a205_132888_c1 nmdc:mga0a205_132888_c1_90_914 271
183 3300005293 Ga0065715_10202023 Ga0065715_102020231 272
184 3300005295 Ga0065707_10141144 Ga0065707_101411441 272
185 3300005328 Ga0070676_10006587 Ga0070676_100065876 272
186 3300005330 Ga0070690_100319347 Ga0070690_1003193471 272
187 3300005340 Ga0070689_100591184 Ga0070689_1005911841 272
188 3300005344 Ga0070661_100104396 Ga0070661_1001043961 272
189 3300005353 Ga0070669_100069318 Ga0070669_1000693183 272
190 3300005354 Ga0070675_100182597 Ga0070675_1001825972 272
191 3300005354 Ga0070675_100685783 Ga0070675_1006857831 272
192 3300005355 Ga0070671_100288357 Ga0070671_1002883572 272
193 3300005355 Ga0070671_100504202 Ga0070671_1005042021 272
194 3300005364 Ga0070673_100115554 Ga0070673_1001155543 272
195 3300005543 Ga0070672_100009432 Ga0070672_1000094321 272
196 3300005564 Ga0070664_100008247 Ga0070664_1000082477 272
197 3300005617 Ga0068859_100090622 Ga0068859_1000906223 272
198 3300005840 Ga0068870_10000348 Ga0068870_100003485 272
199 3300005842 Ga0068858_100122376 Ga0068858_1001223763 272
200 3300005843 Ga0068860_100022312 Ga0068860_1000223122 272
201 3300005844 Ga0068862_100006825 Ga0068862_1000068254 272
202 3300006852 Ga0075433_10012263 Ga0075433_100122632 272
203 3300006871 Ga0075434_100321623 Ga0075434_1003216232 272
204 3300006931 Ga0097620_100090624 Ga0097620_1000906243 272
205 3300007076 Ga0075435_100047786 Ga0075435_1000477862 272
206 3300009094 Ga0111539_10015323 Ga0111539_100153237 272
207 3300009553 Ga0105249_10016331 Ga0105249_100163313 272
208 3300011119 Ga0105246_10016519 Ga0105246_100165192 272
209 3300013306 Ga0163162_10005742 Ga0163162_100057427 272
210 3300013308 Ga0157375_10484537 Ga0157375_104845372 272
211 3300014326 Ga0157380_10338964 Ga0157380_103389641 272
212 3300014968 Ga0157379_10019460 Ga0157379_100194603 272
213 3300017792 Ga0163161_10167644 Ga0163161_101676442 272
214 3300025315 Ga0207697_10001180 Ga0207697_100011802 272
215 3300025893 Ga0207682_10015653 Ga0207682_100156533 272
216 3300025901 Ga0207688_10062886 Ga0207688_100628862 272
217 3300025903 Ga0207680_10024840 Ga0207680_100248402 272
218 3300025907 Ga0207645_10004591 Ga0207645_100045915 272
219 3300025908 Ga0207643_10001054 Ga0207643_100010547 272
220 3300025918 Ga0207662_10009381 Ga0207662_100093813 272
221 3300025923 Ga0207681_10100408 Ga0207681_101004082 272
222 3300025926 Ga0207659_10002882 Ga0207659_100028826 272
223 3300025926 Ga0207659_10490221 Ga0207659_104902211 272
224 3300025927 Ga0207687_10301170 Ga0207687_103011702 272
225 3300025931 Ga0207644_10389640 Ga0207644_103896402 272
226 3300025932 Ga0207690_10070683 Ga0207690_100706832 272
227 3300025936 Ga0207670_10182863 Ga0207670_101828632 272
228 3300025936 Ga0207670_10294140 Ga0207670_102941402 272
229 3300025942 Ga0207689_10004152 Ga0207689_100041529 272
230 3300025960 Ga0207651_10265793 Ga0207651_102657931 272
231 3300025960 Ga0207651_10493219 Ga0207651_104932192 272
232 3300025961 Ga0207712_10052395 Ga0207712_100523951 272
233 3300026023 Ga0207677_10022193 Ga0207677_100221933 272
234 3300026088 Ga0207641_10009846 Ga0207641_100098462 272
235 3300027617 Ga0210002_1011021 Ga0210002_10110211 272
236 3300027717 Ga0209998_10032123 Ga0209998_100321232 272
237 3300027907 Ga0207428_10007903 Ga0207428_100079037 272
238 3300028380 Ga0268265_10039405 Ga0268265_100394053 272
239 3300028381 Ga0268264_10057936 Ga0268264_100579363 272
240 3300050508 nmdc:mga09592_33724_c1 nmdc:mga09592_33724_c1_818_1651 272
241 3300050511 nmdc:mga08y16_122205_c1 nmdc:mga08y16_122205_c1_1403_2236 272
242 3300050512 nmdc:mga0n895_356757_c1 nmdc:mga0n895_356757_c1_245_1078 272
243 3300050513 nmdc:mga0rr50_423943_c1 nmdc:mga0rr50_423943_c1_92_925 272
244 3300050515 nmdc:mga0a205_7765_c1 nmdc:mga0a205_7765_c1_3312_4145 272
245 3300005364 Ga0070673_100060792 Ga0070673_1000607924 273
246 3300006844 Ga0075428_100001864 Ga0075428_10000186415 273
247 3300006846 Ga0075430_100001987 Ga0075430_10000198713 273
248 3300006847 Ga0075431_100002526 Ga0075431_1000025263 273
249 3300006880 Ga0075429_100001764 Ga0075429_10000176413 273
250 3300009093 Ga0105240_10096117 Ga0105240_100961172 273
251 3300009553 Ga0105249_10444304 Ga0105249_104443042 273
252 3300025893 Ga0207682_10088430 Ga0207682_100884302 273
253 3300025940 Ga0207691_10286296 Ga0207691_102862961 273
254 3300025960 Ga0207651_10158464 Ga0207651_101584643 273
255 3300025961 Ga0207712_10044134 Ga0207712_100441344 273
256 3300031344 Ga0265316_10019254 Ga0265316_100192543 273
257 3300039450 Ga0436363_1455988 Ga0436363_1455988_30_863 273
258 3300046472 Ga0495580_0065487 Ga0495580_0065487_788_1612 273
259 3300046475 Ga0495639_0113809 Ga0495639_0113809_405_1241 273
260 3300046531 Ga0495665_0202636 Ga0495665_0202636_39_863 273
261 3300049572 Ga0501036_0016900 Ga0501036_0016900_4857_5693 273
262 3300049576 Ga0501040_0008123 Ga0501040_0008123_324_1160 273
263 3300049577 Ga0501041_0005268 Ga0501041_0005268_6232_7068 273
264 3300049582 Ga0501048_0020750 Ga0501048_0020750_2561_3397 273
265 3300049584 Ga0501068_0158399 Ga0501068_0158399_314_1150 273
266 3300049587 Ga0501071_0036063 Ga0501071_0036063_25_861 273
267 3300049588 Ga0501072_0210034 Ga0501072_0210034_513_1349 273
268 3300049590 Ga0501074_0106929 Ga0501074_0106929_304_1140 273
269 3300049592 Ga0501076_0063116 Ga0501076_0063116_552_1388 273
270 3300049593 Ga0501077_0033490 Ga0501077_0033490_2102_2938 273
271 3300049741 Ga0501079_0012290 Ga0501079_0012290_2378_3214 273
272 3300049742 Ga0501080_0050666 Ga0501080_0050666_2713_3549 273
273 3300049822 Ga0501035_0546233 Ga0501035_0546233_62_898 273
274 3300049824 Ga0501045_0056312 Ga0501045_0056312_904_1740 273
275 3300050508 nmdc:mga09592_4883_c1 nmdc:mga09592_4883_c1_3875_4711 273
276 3300050509 nmdc:mga0qj67_8621_c1 nmdc:mga0qj67_8621_c1_5084_5920 273
277 3300050510 nmdc:mga06r32_1387_c1 nmdc:mga06r32_1387_c1_8122_8958 273
278 3300050512 nmdc:mga0n895_19099_c1 nmdc:mga0n895_19099_c1_166_1029 273
279 3300054114 Ga0501084_0294060 Ga0501084_0294060_190_1026 273
280 3300060353 Ga0501082_0011799 Ga0501082_0011799_3378_4214 273
281 3300061734 Ga0530510_0100901 Ga0530510_0100901_1206_2042 273
282 3300005290 Ga0065712_10032483 Ga0065712_100324831 274
283 3300005295 Ga0065707_10093911 Ga0065707_100939112 274
284 3300005336 Ga0070680_100174634 Ga0070680_1001746341 274
285 3300005343 Ga0070687_100125767 Ga0070687_1001257672 274
286 3300005354 Ga0070675_100000739 Ga0070675_1000007395 274
287 3300005356 Ga0070674_100030121 Ga0070674_1000301212 274
288 3300005445 Ga0070708_100003651 Ga0070708_1000036515 274
289 3300005459 Ga0068867_100285494 Ga0068867_1002854941 274
290 3300005467 Ga0070706_100011620 Ga0070706_1000116205 274
291 3300005468 Ga0070707_100019771 Ga0070707_1000197714 274
292 3300005471 Ga0070698_100005969 Ga0070698_10000596910 274
293 3300005518 Ga0070699_100005358 Ga0070699_1000053583 274
294 3300005536 Ga0070697_100016125 Ga0070697_1000161256 274
295 3300005719 Ga0068861_100237621 Ga0068861_1002376213 274
296 3300005842 Ga0068858_100001351 Ga0068858_1000013515 274
297 3300005842 Ga0068858_100059537 Ga0068858_1000595374 274
298 3300006844 Ga0075428_100000023 Ga0075428_10000002333 274
299 3300006846 Ga0075430_100291878 Ga0075430_1002918782 274
300 3300006880 Ga0075429_100061268 Ga0075429_1000612684 274
301 3300006880 Ga0075429_100102080 Ga0075429_1001020803 274
302 3300009094 Ga0111539_10000001 Ga0111539_10000001706 274
303 3300009094 Ga0111539_10163892 Ga0111539_101638922 274
304 3300009101 Ga0105247_10193098 Ga0105247_101930982 274
305 3300009101 Ga0105247_10237369 Ga0105247_102373692 274
306 3300009147 Ga0114129_10030545 Ga0114129_100305458 274
307 3300009176 Ga0105242_10236136 Ga0105242_102361362 274
308 3300009176 Ga0105242_10340332 Ga0105242_103403323 274
309 3300009177 Ga0105248_10038890 Ga0105248_100388904 274
310 3300009177 Ga0105248_10132247 Ga0105248_101322471 274
311 3300009177 Ga0105248_10384894 Ga0105248_103848942 274
312 3300009553 Ga0105249_10550283 Ga0105249_105502832 274
313 3300013306 Ga0163162_10046149 Ga0163162_100461493 274
314 3300013308 Ga0157375_10277462 Ga0157375_102774622 274
315 3300014325 Ga0163163_10411143 Ga0163163_104111431 274
316 3300014745 Ga0157377_10024546 Ga0157377_100245462 274
317 3300014968 Ga0157379_10012421 Ga0157379_100124212 274
318 3300014968 Ga0157379_10013451 Ga0157379_100134513 274
319 3300025315 Ga0207697_10052573 Ga0207697_100525732 274
320 3300025900 Ga0207710_10056137 Ga0207710_100561372 274
321 3300025918 Ga0207662_10201167 Ga0207662_102011672 274
322 3300025923 Ga0207681_10534918 Ga0207681_105349181 274
323 3300025926 Ga0207659_10000642 Ga0207659_100006425 274
324 3300025937 Ga0207669_10059837 Ga0207669_100598372 274
325 3300025940 Ga0207691_10182599 Ga0207691_101825993 274
326 3300025941 Ga0207711_10168820 Ga0207711_101688203 274
327 3300025942 Ga0207689_10098810 Ga0207689_100988102 274
328 3300025960 Ga0207651_10137640 Ga0207651_101376402 274
329 3300026035 Ga0207703_10009661 Ga0207703_100096616 274
330 3300026035 Ga0207703_10032794 Ga0207703_100327943 274
331 3300026095 Ga0207676_10480687 Ga0207676_104806872 274
332 3300027907 Ga0207428_10000002 Ga0207428_10000002719 274
333 3300027907 Ga0207428_10352895 Ga0207428_103528951 274
334 3300028379 Ga0268266_10786697 Ga0268266_107866971 274
335 3300028381 Ga0268264_10218100 Ga0268264_102181002 274
336 3300031711 Ga0265314_10033167 Ga0265314_100331673 274
337 3300035120 Ga0373957_0070807 Ga0373957_0070807_34_882 274
338 3300046539 Ga0495621_0060175 Ga0495621_0060175_139_978 274
339 3300047318 Ga0495636_0166160 Ga0495636_0166160_130_969 274
340 3300049574 Ga0501038_0068476 Ga0501038_0068476_170_1009 274
341 3300049575 Ga0501039_0102403 Ga0501039_0102403_551_1390 274
342 3300049576 Ga0501040_0018969 Ga0501040_0018969_3220_4059 274
343 3300049577 Ga0501041_0010096 Ga0501041_0010096_3358_4197 274
344 3300049578 Ga0501042_0021495 Ga0501042_0021495_1302_2141 274
345 3300049580 Ga0501046_0052948 Ga0501046_0052948_1716_2555 274
346 3300049582 Ga0501048_0104931 Ga0501048_0104931_209_1048 274
347 3300049588 Ga0501072_0213540 Ga0501072_0213540_669_1508 274
348 3300049591 Ga0501075_0018459 Ga0501075_0018459_2023_2862 274
349 3300049741 Ga0501079_0113463 Ga0501079_0113463_1007_1846 274
350 3300050508 nmdc:mga09592_123251_c1 nmdc:mga09592_123251_c1_409_1248 274
351 3300050509 nmdc:mga0qj67_269670_c1 nmdc:mga0qj67_269670_c1_178_1017 274
352 3300050510 nmdc:mga06r32_243651_c1 nmdc:mga06r32_243651_c1_49_888 274
353 3300050511 nmdc:mga08y16_3_c1 nmdc:mga08y16_3_c1_790083_790922 274
354 3300050511 nmdc:mga08y16_69678_c1 nmdc:mga08y16_69678_c1_2519_3358 274
355 3300060353 Ga0501082_0165990 Ga0501082_0165990_376_1215 274
356 3300061734 Ga0530510_0001309 Ga0530510_0001309_11802_12641 274
357 3300025906 Ga0207699_10047766 Ga0207699_100477663 275
358 3300025907 Ga0207645_10172978 Ga0207645_101729781 275
359 3300025939 Ga0207665_10076197 Ga0207665_100761972 275
360 3300027671 Ga0209588_1000001 Ga0209588_1000001297 275
361 3300028381 Ga0268264_10743142 Ga0268264_107431422 275
362 3300031090 Ga0265760_10011422 Ga0265760_100114222 275
363 3300031250 Ga0265331_10012844 Ga0265331_100128446 275
364 3300031344 Ga0265316_10014330 Ga0265316_100143306 275
365 3300031595 Ga0265313_10003181 Ga0265313_1000318112 275
366 3300031711 Ga0265314_10150276 Ga0265314_101502762 275
367 3300059421 Ga0590071_005999 Ga0590071_005999_1574_2422 275
368 3300059426 Ga0590077_002674 Ga0590077_002674_1095_1943 275
369 3300005434 Ga0070709_10052454 Ga0070709_100524542 276
370 3300005434 Ga0070709_10171128 Ga0070709_101711282 276
371 3300005436 Ga0070713_100056670 Ga0070713_1000566703 276
372 3300005439 Ga0070711_100001229 Ga0070711_10000122911 276
373 3300005445 Ga0070708_100006273 Ga0070708_1000062737 276
374 3300005445 Ga0070708_100066556 Ga0070708_1000665563 276
375 3300005445 Ga0070708_100107291 Ga0070708_1001072912 276
376 3300005467 Ga0070706_100002094 Ga0070706_1000020945 276
377 3300005467 Ga0070706_100175853 Ga0070706_1001758532 276
378 3300005471 Ga0070698_100343820 Ga0070698_1003438202 276
379 3300005518 Ga0070699_100007587 Ga0070699_1000075873 276
380 3300005518 Ga0070699_100148811 Ga0070699_1001488112 276
381 3300005536 Ga0070697_100002395 Ga0070697_1000023954 276
382 3300005614 Ga0068856_100125292 Ga0068856_1001252923 276
383 3300006173 Ga0070716_100254285 Ga0070716_1002542852 276
384 3300006175 Ga0070712_100000468 Ga0070712_10000046819 276
385 3300006237 Ga0097621_100004631 Ga0097621_1000046317 276
386 3300006358 Ga0068871_100013790 Ga0068871_1000137903 276
387 3300009098 Ga0105245_10124984 Ga0105245_101249842 276
388 3300009174 Ga0105241_10007930 Ga0105241_100079306 276
389 3300009174 Ga0105241_10189512 Ga0105241_101895122 276
390 3300009551 Ga0105238_10024029 Ga0105238_100240293 276
391 3300013296 Ga0157374_10021505 Ga0157374_100215053 276
392 3300013297 Ga0157378_10082890 Ga0157378_100828903 276
393 3300013297 Ga0157378_10210633 Ga0157378_102106332 276
394 3300014968 Ga0157379_10004208 Ga0157379_100042084 276
395 3300014969 Ga0157376_10085139 Ga0157376_100851393 276
396 3300025905 Ga0207685_10067157 Ga0207685_100671572 276
397 3300025906 Ga0207699_10172588 Ga0207699_101725882 276
398 3300025906 Ga0207699_10191628 Ga0207699_101916282 276
399 3300025910 Ga0207684_10004878 Ga0207684_100048783 276
400 3300025915 Ga0207693_10001167 Ga0207693_1000116719 276
401 3300025916 Ga0207663_10010876 Ga0207663_100108763 276
402 3300025924 Ga0207694_10036471 Ga0207694_100364713 276
403 3300025928 Ga0207700_10426237 Ga0207700_104262372 276
404 3300025939 Ga0207665_10039155 Ga0207665_100391553 276
405 3300026078 Ga0207702_10112427 Ga0207702_101124273 276
406 3300035170 Ga0373943_0043030 Ga0373943_0043030_798_1637 276
407 3300035692 Ga0373935_0061927 Ga0373935_0061927_719_1558 276
408 3300035695 Ga0373927_0093605 Ga0373927_0093605_97_936 276
409 3300035725 Ga0373947_0024378 Ga0373947_0024378_1426_2265 276
410 3300037068 Ga0373925_0037190 Ga0373925_0037190_2682_3521 276
411 3300046472 Ga0495580_0018437 Ga0495580_0018437_1807_2652 276
412 3300046517 Ga0495630_0032428 Ga0495630_0032428_2152_2991 276
413 3300046663 Ga0495635_0076315 Ga0495635_0076315_1447_2286 276
414 3300046809 Ga0495600_0174794 Ga0495600_0174794_339_1181 276
415 3300048903 Ga0496100_0006702 Ga0496100_0006702_1721_2566 276
416 3300048906 Ga0496103_0001075 Ga0496103_0001075_6856_7701 276
417 3300048907 Ga0496104_0007903 Ga0496104_0007903_7795_8640 276
418 3300048908 Ga0496105_0040070 Ga0496105_0040070_516_1361 276
419 3300048915 Ga0496112_0060610 Ga0496112_0060610_2181_3026 276
420 3300048917 Ga0496114_0149725 Ga0496114_0149725_866_1711 276
421 3300048918 Ga0496115_0002823 Ga0496115_0002823_6614_7459 276
422 3300005467 Ga0070706_100000336 Ga0070706_10000033622 277
423 3300005468 Ga0070707_100021052 Ga0070707_1000210523 277
424 3300005471 Ga0070698_100256521 Ga0070698_1002565213 277
425 3300005536 Ga0070697_100014445 Ga0070697_1000144453 277
426 3300005536 Ga0070697_100261749 Ga0070697_1002617491 277
427 3300005545 Ga0070695_100254949 Ga0070695_1002549491 277
428 3300025910 Ga0207684_10000320 Ga0207684_1000032032 277
429 3300046511 Ga0495608_0103142 Ga0495608_0103142_668_1510 277
430 3300003320 rootH2_10158235 rootH2_101582352 278
431 3300005436 Ga0070713_100011617 Ga0070713_1000116174 278
432 3300005436 Ga0070713_100074091 Ga0070713_1000740914 278
433 3300005471 Ga0070698_100256401 Ga0070698_1002564012 278
434 3300006028 Ga0070717_10247204 Ga0070717_102472042 278
435 3300006871 Ga0075434_100051841 Ga0075434_1000518413 278
436 3300006914 Ga0075436_100230607 Ga0075436_1002306072 278
437 3300007076 Ga0075435_100077191 Ga0075435_1000771913 278
438 3300009147 Ga0114129_10543115 Ga0114129_105431152 278
439 3300013297 Ga0157378_10085504 Ga0157378_100855042 278
440 3300021388 Ga0213875_10134125 Ga0213875_101341252 278
441 3300025906 Ga0207699_10242932 Ga0207699_102429322 278
442 3300025922 Ga0207646_10337240 Ga0207646_103372402 278
443 3300025927 Ga0207687_10077756 Ga0207687_100777563 278
444 3300025928 Ga0207700_10063979 Ga0207700_100639793 278
445 3300025928 Ga0207700_10204560 Ga0207700_102045602 278
446 3300030760 Ga0265762_1026117 Ga0265762_10261172 278
447 3300031235 Ga0265330_10000186 Ga0265330_1000018630 278
448 3300031241 Ga0265325_10000138 Ga0265325_1000013831 278
449 3300031249 Ga0265339_10001543 Ga0265339_1000154310 278
450 3300031344 Ga0265316_10000510 Ga0265316_100005106 278
451 3300031595 Ga0265313_10006745 Ga0265313_100067455 278
452 3300031712 Ga0265342_10006543 Ga0265342_100065439 278
453 3300037853 Ga0436364_0703870 Ga0436364_0703870_509_1354 278
454 3300039437 Ga0436365_1220175 Ga0436365_1220175_1908_2753 278
455 3300046472 Ga0495580_0019663 Ga0495580_0019663_4152_4997 278
456 3300050507 nmdc:mga05p37_559415_c1 nmdc:mga05p37_559415_c1_277_1131 278
457 3300050512 nmdc:mga0n895_100643_c1 nmdc:mga0n895_100643_c1_654_1499 278
458 3300050513 nmdc:mga0rr50_126767_c1 nmdc:mga0rr50_126767_c1_1038_1883 278
459 3300004803 Ga0058862_12808267 Ga0058862_128082672 279
460 3300005435 Ga0070714_100029132 Ga0070714_1000291323 279
461 3300005435 Ga0070714_100182116 Ga0070714_1001821162 279
462 3300005436 Ga0070713_100000476 Ga0070713_10000047611 279
463 3300005436 Ga0070713_100056701 Ga0070713_1000567014 279
464 3300005437 Ga0070710_10136282 Ga0070710_101362822 279
465 3300005439 Ga0070711_100000281 Ga0070711_1000002815 279
466 3300005439 Ga0070711_100033648 Ga0070711_1000336483 279
467 3300006028 Ga0070717_10032853 Ga0070717_100328533 279
468 3300006028 Ga0070717_10354068 Ga0070717_103540681 279
469 3300006163 Ga0070715_10000763 Ga0070715_100007633 279
470 3300006173 Ga0070716_100010159 Ga0070716_1000101593 279
471 3300006175 Ga0070712_100002849 Ga0070712_1000028495 279
472 3300006175 Ga0070712_100003144 Ga0070712_1000031443 279
473 3300013104 Ga0157370_10168118 Ga0157370_101681182 279
474 3300020070 Ga0206356_10844687 Ga0206356_108446872 279
475 3300021388 Ga0213875_10037145 Ga0213875_100371454 279
476 3300025905 Ga0207685_10001682 Ga0207685_100016823 279
477 3300025915 Ga0207693_10000008 Ga0207693_1000000824 279
478 3300025915 Ga0207693_10007049 Ga0207693_100070493 279
479 3300025916 Ga0207663_10000111 Ga0207663_100001114 279
480 3300025928 Ga0207700_10000107 Ga0207700_1000010719 279
481 3300025929 Ga0207664_10054162 Ga0207664_100541622 279
482 3300025929 Ga0207664_10176543 Ga0207664_101765432 279
483 3300025939 Ga0207665_10016930 Ga0207665_100169303 279
484 3300031235 Ga0265330_10038099 Ga0265330_100380992 279
485 3300031712 Ga0265342_10039255 Ga0265342_100392552 279
486 3300031712 Ga0265342_10045773 Ga0265342_100457734 279
487 3300035113 Ga0373936_0003520 Ga0373936_0003520_2821_3669 279
488 3300037853 Ga0436364_1014577 Ga0436364_1014577_509_1357 279
489 3300046472 Ga0495580_0002181 Ga0495580_0002181_1521_2372 279
490 3300046472 Ga0495580_0010201 Ga0495580_0010201_1188_2036 279
491 3300046473 Ga0495582_0012347 Ga0495582_0012347_2042_2890 279
492 3300046477 Ga0495664_0053165 Ga0495664_0053165_23_871 279
493 3300046517 Ga0495630_0004015 Ga0495630_0004015_475_1344 279
494 3300046517 Ga0495630_0168703 Ga0495630_0168703_628_1476 279
495 3300046675 Ga0495657_0102308 Ga0495657_0102308_647_1495 279
496 3300046678 Ga0495599_0080445 Ga0495599_0080445_995_1843 279
497 3300046683 Ga0495658_0206709 Ga0495658_0206709_143_991 279
498 3300046689 Ga0495613_0246119 Ga0495613_0246119_247_1095 279
499 3300046690 Ga0495624_0229335 Ga0495624_0229335_200_1048 279
500 3300047319 Ga0495674_0007648 Ga0495674_0007648_5515_6363 279
501 3300047319 Ga0495674_0032047 Ga0495674_0032047_3862_4731 279
502 3300047673 Ga0495593_0054240 Ga0495593_0054240_255_1103 279
503 3300048918 Ga0496115_0006852 Ga0496115_0006852_5040_5888 279
504 3300059630 Ga0587128_011851 Ga0587128_011851_196_1047 279
505 3300004798 Ga0058859_10571141 Ga0058859_105711412 280
506 3300004799 Ga0058863_11271652 Ga0058863_112716523 280
507 3300004800 Ga0058861_11276067 Ga0058861_112760672 280
508 3300004803 Ga0058862_11810453 Ga0058862_118104532 280
509 3300005327 Ga0070658_10015017 Ga0070658_100150172 280
510 3300005328 Ga0070676_10088917 Ga0070676_100889171 280
511 3300005329 Ga0070683_100033133 Ga0070683_1000331335 280
512 3300005330 Ga0070690_100060729 Ga0070690_1000607292 280
513 3300005330 Ga0070690_100075007 Ga0070690_1000750072 280
514 3300005334 Ga0068869_100002543 Ga0068869_1000025433 280
515 3300005334 Ga0068869_100051719 Ga0068869_1000517193 280
516 3300005336 Ga0070680_100096347 Ga0070680_1000963473 280
517 3300005337 Ga0070682_100024660 Ga0070682_1000246603 280
518 3300005338 Ga0068868_100007292 Ga0068868_1000072926 280
519 3300005338 Ga0068868_100013904 Ga0068868_1000139044 280
520 3300005338 Ga0068868_100029316 Ga0068868_1000293163 280
521 3300005338 Ga0068868_100091197 Ga0068868_1000911973 280
522 3300005339 Ga0070660_100009135 Ga0070660_1000091353 280
523 3300005339 Ga0070660_100113116 Ga0070660_1001131162 280
524 3300005340 Ga0070689_100369176 Ga0070689_1003691762 280
525 3300005341 Ga0070691_10136183 Ga0070691_101361831 280
526 3300005343 Ga0070687_100012491 Ga0070687_1000124914 280
527 3300005353 Ga0070669_100088909 Ga0070669_1000889093 280
528 3300005355 Ga0070671_100254728 Ga0070671_1002547281 280
529 3300005364 Ga0070673_100223896 Ga0070673_1002238962 280
530 3300005366 Ga0070659_100152039 Ga0070659_1001520392 280
531 3300005434 Ga0070709_10018121 Ga0070709_100181213 280
532 3300005435 Ga0070714_100211414 Ga0070714_1002114142 280
533 3300005436 Ga0070713_100001852 Ga0070713_1000018529 280
534 3300005436 Ga0070713_100198400 Ga0070713_1001984002 280
535 3300005439 Ga0070711_100020727 Ga0070711_1000207273 280
536 3300005455 Ga0070663_100177850 Ga0070663_1001778501 280
537 3300005456 Ga0070678_100340196 Ga0070678_1003401962 280
538 3300005457 Ga0070662_100017281 Ga0070662_1000172817 280
539 3300005458 Ga0070681_10001282 Ga0070681_100012825 280
540 3300005458 Ga0070681_10010428 Ga0070681_100104285 280
541 3300005458 Ga0070681_10036998 Ga0070681_100369983 280
542 3300005458 Ga0070681_10157001 Ga0070681_101570012 280
543 3300005458 Ga0070681_10393319 Ga0070681_103933191 280
544 3300005459 Ga0068867_100060541 Ga0068867_1000605413 280
545 3300005459 Ga0068867_100224802 Ga0068867_1002248023 280
546 3300005466 Ga0070685_10009573 Ga0070685_100095732 280
547 3300005466 Ga0070685_10116179 Ga0070685_101161792 280
548 3300005530 Ga0070679_100021290 Ga0070679_1000212907 280
549 3300005530 Ga0070679_100045647 Ga0070679_1000456473 280
550 3300005530 Ga0070679_100120107 Ga0070679_1001201072 280
551 3300005530 Ga0070679_100585457 Ga0070679_1005854571 280
552 3300005535 Ga0070684_100031772 Ga0070684_1000317727 280
553 3300005535 Ga0070684_100051325 Ga0070684_1000513252 280
554 3300005535 Ga0070684_100339810 Ga0070684_1003398102 280
555 3300005539 Ga0068853_100198663 Ga0068853_1001986633 280
556 3300005539 Ga0068853_100218901 Ga0068853_1002189011 280
557 3300005546 Ga0070696_100151488 Ga0070696_1001514882 280
558 3300005547 Ga0070693_100029239 Ga0070693_1000292391 280
559 3300005547 Ga0070693_100078116 Ga0070693_1000781162 280
560 3300005547 Ga0070693_100227770 Ga0070693_1002277701 280
561 3300005548 Ga0070665_100029410 Ga0070665_1000294105 280
562 3300005563 Ga0068855_100000234 Ga0068855_10000023427 280
563 3300005563 Ga0068855_100000432 Ga0068855_10000043245 280
564 3300005563 Ga0068855_100001150 Ga0068855_10000115023 280
565 3300005563 Ga0068855_100013501 Ga0068855_1000135019 280
566 3300005564 Ga0070664_100000726 Ga0070664_1000007267 280
567 3300005564 Ga0070664_100764576 Ga0070664_1007645761 280
568 3300005577 Ga0068857_100000096 Ga0068857_10000009636 280
569 3300005577 Ga0068857_100005406 Ga0068857_1000054068 280
570 3300005577 Ga0068857_100211098 Ga0068857_1002110982 280
571 3300005578 Ga0068854_100009756 Ga0068854_1000097566 280
572 3300005578 Ga0068854_100140582 Ga0068854_1001405821 280
573 3300005614 Ga0068856_100000062 Ga0068856_10000006215 280
574 3300005614 Ga0068856_100000179 Ga0068856_10000017931 280
575 3300005614 Ga0068856_100000854 Ga0068856_1000008541 280
576 3300005614 Ga0068856_100041098 Ga0068856_1000410983 280
577 3300005614 Ga0068856_100086315 Ga0068856_1000863152 280
578 3300005614 Ga0068856_100168389 Ga0068856_1001683892 280
579 3300005614 Ga0068856_100184126 Ga0068856_1001841263 280
580 3300005615 Ga0070702_100153082 Ga0070702_1001530821 280
581 3300005616 Ga0068852_100016336 Ga0068852_1000163365 280
582 3300005616 Ga0068852_100036794 Ga0068852_1000367943 280
583 3300005616 Ga0068852_100052877 Ga0068852_1000528772 280
584 3300005616 Ga0068852_100220903 Ga0068852_1002209032 280
585 3300005617 Ga0068859_100091350 Ga0068859_1000913504 280
586 3300005617 Ga0068859_100099523 Ga0068859_1000995233 280
587 3300005617 Ga0068859_100123873 Ga0068859_1001238733 280
588 3300005618 Ga0068864_100000129 Ga0068864_10000012939 280
589 3300005618 Ga0068864_100012733 Ga0068864_1000127335 280
590 3300005718 Ga0068866_10026910 Ga0068866_100269101 280
591 3300005718 Ga0068866_10067783 Ga0068866_100677833 280
592 3300005840 Ga0068870_10130633 Ga0068870_101306332 280
593 3300005841 Ga0068863_100008178 Ga0068863_1000081785 280
594 3300005842 Ga0068858_100002990 Ga0068858_1000029909 280
595 3300005842 Ga0068858_100010506 Ga0068858_10001050611 280
596 3300005842 Ga0068858_100014019 Ga0068858_1000140191 280
597 3300005842 Ga0068858_100077143 Ga0068858_1000771434 280
598 3300005842 Ga0068858_100844542 Ga0068858_1008445421 280
599 3300005843 Ga0068860_100075164 Ga0068860_1000751642 280
600 3300005843 Ga0068860_100096300 Ga0068860_1000963002 280
601 3300005843 Ga0068860_100131638 Ga0068860_1001316383 280
602 3300005843 Ga0068860_100160120 Ga0068860_1001601203 280
603 3300005844 Ga0068862_100056072 Ga0068862_1000560723 280
604 3300005983 Ga0081540_1024169 Ga0081540_10241693 280
605 3300006163 Ga0070715_10132775 Ga0070715_101327752 280
606 3300006175 Ga0070712_100008773 Ga0070712_1000087737 280
607 3300006175 Ga0070712_100028949 Ga0070712_1000289493 280
608 3300006175 Ga0070712_100564588 Ga0070712_1005645881 280
609 3300006237 Ga0097621_100000148 Ga0097621_1000001483 280
610 3300006237 Ga0097621_100000980 Ga0097621_10000098013 280
611 3300006237 Ga0097621_100115625 Ga0097621_1001156253 280
612 3300006358 Ga0068871_100000049 Ga0068871_10000004937 280
613 3300006358 Ga0068871_100000465 Ga0068871_10000046518 280
614 3300006358 Ga0068871_100031575 Ga0068871_1000315752 280
615 3300006871 Ga0075434_100261955 Ga0075434_1002619552 280
616 3300006881 Ga0068865_100075093 Ga0068865_1000750932 280
617 3300006881 Ga0068865_100077749 Ga0068865_1000777493 280
618 3300006881 Ga0068865_100093951 Ga0068865_1000939512 280
619 3300006931 Ga0097620_100091355 Ga0097620_1000913554 280
620 3300006931 Ga0097620_100099524 Ga0097620_1000995243 280
621 3300006931 Ga0097620_100123888 Ga0097620_1001238882 280
622 3300009093 Ga0105240_10000378 Ga0105240_1000037854 280
623 3300009093 Ga0105240_10014149 Ga0105240_100141493 280
624 3300009093 Ga0105240_10206710 Ga0105240_102067103 280
625 3300009098 Ga0105245_10014526 Ga0105245_100145263 280
626 3300009098 Ga0105245_10115053 Ga0105245_101150532 280
627 3300009148 Ga0105243_10202473 Ga0105243_102024732 280
628 3300009174 Ga0105241_10083824 Ga0105241_100838243 280
629 3300009176 Ga0105242_10070983 Ga0105242_100709833 280
630 3300009176 Ga0105242_10235268 Ga0105242_102352683 280
631 3300009177 Ga0105248_10279095 Ga0105248_102790952 280
632 3300009545 Ga0105237_10017405 Ga0105237_100174053 280
633 3300009545 Ga0105237_10093606 Ga0105237_100936063 280
634 3300009545 Ga0105237_10158974 Ga0105237_101589742 280
635 3300009545 Ga0105237_10309965 Ga0105237_103099652 280
636 3300009551 Ga0105238_10000609 Ga0105238_1000060916 280
637 3300009551 Ga0105238_10013340 Ga0105238_100133405 280
638 3300009551 Ga0105238_10025730 Ga0105238_100257302 280
639 3300009553 Ga0105249_10006270 Ga0105249_100062707 280
640 3300010375 Ga0105239_10039316 Ga0105239_100393164 280
641 3300010375 Ga0105239_10469679 Ga0105239_104696792 280
642 3300010375 Ga0105239_10819542 Ga0105239_108195422 280
643 3300013100 Ga0157373_10011663 Ga0157373_100116632 280
644 3300013100 Ga0157373_10091841 Ga0157373_100918413 280
645 3300013102 Ga0157371_10024243 Ga0157371_100242433 280
646 3300013102 Ga0157371_10054599 Ga0157371_100545992 280
647 3300013104 Ga0157370_10005013 Ga0157370_1000501312 280
648 3300013104 Ga0157370_10184107 Ga0157370_101841072 280
649 3300013105 Ga0157369_10000159 Ga0157369_1000015959 280
650 3300013105 Ga0157369_10018776 Ga0157369_100187768 280
651 3300013105 Ga0157369_10200402 Ga0157369_102004022 280
652 3300013296 Ga0157374_10000062 Ga0157374_1000006257 280
653 3300013296 Ga0157374_10000338 Ga0157374_1000033815 280
654 3300013296 Ga0157374_10016801 Ga0157374_100168015 280
655 3300013296 Ga0157374_10033555 Ga0157374_100335552 280
656 3300013296 Ga0157374_10084221 Ga0157374_100842214 280
657 3300013297 Ga0157378_10000009 Ga0157378_1000000947 280
658 3300013297 Ga0157378_10005749 Ga0157378_100057497 280
659 3300013297 Ga0157378_10123896 Ga0157378_101238963 280
660 3300013297 Ga0157378_10388862 Ga0157378_103888622 280
661 3300013306 Ga0163162_10444852 Ga0163162_104448522 280
662 3300013307 Ga0157372_10000540 Ga0157372_1000054032 280
663 3300013307 Ga0157372_10001184 Ga0157372_100011848 280
664 3300013307 Ga0157372_10019861 Ga0157372_100198616 280
665 3300013307 Ga0157372_10305829 Ga0157372_103058292 280
666 3300014325 Ga0163163_10230261 Ga0163163_102302612 280
667 3300014968 Ga0157379_10051201 Ga0157379_100512013 280
668 3300014968 Ga0157379_10092968 Ga0157379_100929683 280
669 3300014969 Ga0157376_10038471 Ga0157376_100384713 280
670 3300014969 Ga0157376_10069513 Ga0157376_100695133 280
671 3300020070 Ga0206356_10660814 Ga0206356_106608142 280
672 3300020070 Ga0206356_10693455 Ga0206356_106934552 280
673 3300020075 Ga0206349_1194817 Ga0206349_11948172 280
674 3300020080 Ga0206350_11158639 Ga0206350_111586393 280
675 3300022467 Ga0224712_10001197 Ga0224712_100011973 280
676 3300022467 Ga0224712_10044238 Ga0224712_100442382 280
677 3300025904 Ga0207647_10004807 Ga0207647_100048077 280
678 3300025904 Ga0207647_10016923 Ga0207647_100169233 280
679 3300025907 Ga0207645_10003579 Ga0207645_1000357912 280
680 3300025909 Ga0207705_10002624 Ga0207705_100026242 280
681 3300025911 Ga0207654_10020250 Ga0207654_100202502 280
682 3300025912 Ga0207707_10001452 Ga0207707_1000145219 280
683 3300025912 Ga0207707_10004494 Ga0207707_100044943 280
684 3300025912 Ga0207707_10018296 Ga0207707_100182964 280
685 3300025912 Ga0207707_10060733 Ga0207707_100607333 280
686 3300025913 Ga0207695_10008636 Ga0207695_100086364 280
687 3300025913 Ga0207695_10013009 Ga0207695_100130092 280
688 3300025913 Ga0207695_10114494 Ga0207695_101144944 280
689 3300025914 Ga0207671_10167045 Ga0207671_101670452 280
690 3300025915 Ga0207693_10015202 Ga0207693_100152024 280
691 3300025915 Ga0207693_10026238 Ga0207693_100262383 280
692 3300025917 Ga0207660_10016931 Ga0207660_100169316 280
693 3300025917 Ga0207660_10099890 Ga0207660_100998902 280
694 3300025919 Ga0207657_10002009 Ga0207657_100020097 280
695 3300025919 Ga0207657_10005757 Ga0207657_100057573 280
696 3300025920 Ga0207649_10015374 Ga0207649_100153743 280
697 3300025921 Ga0207652_10005785 Ga0207652_100057853 280
698 3300025921 Ga0207652_10023725 Ga0207652_100237254 280
699 3300025921 Ga0207652_10050957 Ga0207652_100509573 280
700 3300025921 Ga0207652_10297020 Ga0207652_102970202 280
701 3300025924 Ga0207694_10003298 Ga0207694_100032985 280
702 3300025924 Ga0207694_10036165 Ga0207694_100361652 280
703 3300025925 Ga0207650_10067229 Ga0207650_100672291 280
704 3300025927 Ga0207687_10066038 Ga0207687_100660382 280
705 3300025927 Ga0207687_10111801 Ga0207687_101118012 280
706 3300025927 Ga0207687_10467384 Ga0207687_104673842 280
707 3300025928 Ga0207700_10068309 Ga0207700_100683093 280
708 3300025928 Ga0207700_10180330 Ga0207700_101803302 280
709 3300025929 Ga0207664_10187705 Ga0207664_101877052 280
710 3300025929 Ga0207664_10302520 Ga0207664_103025202 280
711 3300025931 Ga0207644_10030295 Ga0207644_100302953 280
712 3300025933 Ga0207706_10000641 Ga0207706_1000064120 280
713 3300025933 Ga0207706_10092392 Ga0207706_100923923 280
714 3300025938 Ga0207704_10012937 Ga0207704_100129373 280
715 3300025938 Ga0207704_10034810 Ga0207704_100348102 280
716 3300025940 Ga0207691_10424416 Ga0207691_104244162 280
717 3300025941 Ga0207711_10056241 Ga0207711_100562414 280
718 3300025942 Ga0207689_10003694 Ga0207689_100036943 280
719 3300025942 Ga0207689_10025571 Ga0207689_100255714 280
720 3300025942 Ga0207689_10046783 Ga0207689_100467832 280
721 3300025949 Ga0207667_10000087 Ga0207667_10000087114 280
722 3300025949 Ga0207667_10000465 Ga0207667_1000046519 280
723 3300025949 Ga0207667_10001399 Ga0207667_1000139934 280
724 3300025949 Ga0207667_10012244 Ga0207667_100122446 280
725 3300025949 Ga0207667_10055236 Ga0207667_100552363 280
726 3300025961 Ga0207712_10088737 Ga0207712_100887372 280
727 3300025981 Ga0207640_10034171 Ga0207640_100341713 280
728 3300025981 Ga0207640_10054643 Ga0207640_100546432 280
729 3300025981 Ga0207640_10105632 Ga0207640_101056322 280
730 3300025981 Ga0207640_10135407 Ga0207640_101354072 280
731 3300026023 Ga0207677_10444773 Ga0207677_104447732 280
732 3300026035 Ga0207703_10003748 Ga0207703_100037487 280
733 3300026035 Ga0207703_10004875 Ga0207703_100048758 280
734 3300026035 Ga0207703_10056180 Ga0207703_100561802 280
735 3300026041 Ga0207639_10040615 Ga0207639_100406153 280
736 3300026041 Ga0207639_10061531 Ga0207639_100615312 280
737 3300026041 Ga0207639_10088557 Ga0207639_100885572 280
738 3300026067 Ga0207678_10008144 Ga0207678_100081446 280
739 3300026078 Ga0207702_10000458 Ga0207702_1000045827 280
740 3300026078 Ga0207702_10001096 Ga0207702_100010968 280
741 3300026078 Ga0207702_10019664 Ga0207702_100196644 280
742 3300026078 Ga0207702_10157820 Ga0207702_101578202 280
743 3300026088 Ga0207641_10013325 Ga0207641_100133254 280
744 3300026089 Ga0207648_10017102 Ga0207648_100171024 280
745 3300026089 Ga0207648_10027431 Ga0207648_100274315 280
746 3300026089 Ga0207648_10091877 Ga0207648_100918772 280
747 3300026116 Ga0207674_10003692 Ga0207674_100036924 280
748 3300026116 Ga0207674_10005293 Ga0207674_100052934 280
749 3300026116 Ga0207674_10021941 Ga0207674_100219412 280
750 3300026116 Ga0207674_10198554 Ga0207674_101985543 280
751 3300026118 Ga0207675_100343394 Ga0207675_1003433942 280
752 3300026121 Ga0207683_10016513 Ga0207683_100165131 280
753 3300026142 Ga0207698_10055113 Ga0207698_100551133 280
754 3300026142 Ga0207698_10236936 Ga0207698_102369362 280
755 3300026142 Ga0207698_10311178 Ga0207698_103111782 280
756 3300028379 Ga0268266_10046251 Ga0268266_100462512 280
757 3300028380 Ga0268265_10015036 Ga0268265_100150362 280
758 3300028381 Ga0268264_10015954 Ga0268264_100159542 280
759 3300028381 Ga0268264_10143586 Ga0268264_101435862 280
760 3300028381 Ga0268264_10156666 Ga0268264_101566662 280
761 3300028577 Ga0265318_10005107 Ga0265318_100051074 280
762 3300028800 Ga0265338_10013466 Ga0265338_100134666 280
763 3300028800 Ga0265338_10212034 Ga0265338_102120342 280
764 3300028800 Ga0265338_10270358 Ga0265338_102703582 280
765 3300029957 Ga0265324_10057812 Ga0265324_100578122 280
766 3300031235 Ga0265330_10000338 Ga0265330_1000033817 280
767 3300031238 Ga0265332_10005345 Ga0265332_100053452 280
768 3300031239 Ga0265328_10003777 Ga0265328_100037772 280
769 3300031241 Ga0265325_10002006 Ga0265325_100020063 280
770 3300031247 Ga0265340_10002941 Ga0265340_100029415 280
771 3300031249 Ga0265339_10004329 Ga0265339_100043293 280
772 3300031344 Ga0265316_10000713 Ga0265316_1000071313 280
773 3300031595 Ga0265313_10002720 Ga0265313_100027203 280
774 3300031711 Ga0265314_10000187 Ga0265314_1000018773 280
775 3300031711 Ga0265314_10022657 Ga0265314_100226573 280
776 3300031712 Ga0265342_10000101 Ga0265342_1000010183 280
777 3300035085 Ga0373929_0024780 Ga0373929_0024780_32_883 280
778 3300035207 Ga0373942_0031264 Ga0373942_0031264_472_1323 280
779 3300035691 Ga0373931_0048317 Ga0373931_0048317_1249_2103 280
780 3300045051 Ga0451576_0039470 Ga0451576_0039470_3337_4188 280
781 3300046472 Ga0495580_0038512 Ga0495580_0038512_1746_2597 280
782 3300046543 Ga0495645_0002510 Ga0495645_0002510_10534_11397 280
783 3300048903 Ga0496100_0144936 Ga0496100_0144936_813_1667 280
784 3300048905 Ga0496102_0031150 Ga0496102_0031150_3603_4457 280
785 3300048905 Ga0496102_0050682 Ga0496102_0050682_2496_3347 280
786 3300048906 Ga0496103_0152184 Ga0496103_0152184_347_1201 280
787 3300048906 Ga0496103_0196537 Ga0496103_0196537_429_1280 280
788 3300048907 Ga0496104_0091868 Ga0496104_0091868_1354_2205 280
789 3300048908 Ga0496105_0005363 Ga0496105_0005363_5074_5928 280
790 3300048908 Ga0496105_0073262 Ga0496105_0073262_763_1614 280
791 3300048909 Ga0496106_0105462 Ga0496106_0105462_1083_1937 280
792 3300048910 Ga0496107_0100740 Ga0496107_0100740_234_1088 280
793 3300048915 Ga0496112_0001729 Ga0496112_0001729_10031_10882 280
794 3300048916 Ga0496113_0225172 Ga0496113_0225172_360_1211 280
795 3300049744 Ga0501083_0300733 Ga0501083_0300733_174_1025 280
796 3300050512 nmdc:mga0n895_124865_c1 nmdc:mga0n895_124865_c1_1293_2147 280
797 3300050513 nmdc:mga0rr50_107149_c1 nmdc:mga0rr50_107149_c1_1331_2185 280
798 3300005434 Ga0070709_10001162 Ga0070709_100011624 281
799 3300005436 Ga0070713_100002307 Ga0070713_1000023072 281
800 3300005439 Ga0070711_100030637 Ga0070711_1000306373 281
801 3300005445 Ga0070708_100245908 Ga0070708_1002459082 281
802 3300005536 Ga0070697_100177312 Ga0070697_1001773121 281
803 3300005981 Ga0081538_10004787 Ga0081538_100047878 281
804 3300006173 Ga0070716_100023487 Ga0070716_1000234874 281
805 3300006175 Ga0070712_100001119 Ga0070712_10000111914 281
806 3300025910 Ga0207684_10078135 Ga0207684_100781351 281
807 3300025915 Ga0207693_10002431 Ga0207693_100024317 281
808 3300025916 Ga0207663_10056451 Ga0207663_100564512 281
809 3300025928 Ga0207700_10006279 Ga0207700_100062795 281
810 3300044673 Ga0453683_0002798 Ga0453683_0002798_7425_8282 281
811 3300005295 Ga0065707_10176281 Ga0065707_101762812 283
812 3300005436 Ga0070713_100014557 Ga0070713_1000145573 283
813 3300005437 Ga0070710_10061053 Ga0070710_100610531 283
814 3300005437 Ga0070710_10236652 Ga0070710_102366521 283
815 3300005439 Ga0070711_100172618 Ga0070711_1001726182 283
816 3300005518 Ga0070699_100151824 Ga0070699_1001518242 283
817 3300006173 Ga0070716_100221598 Ga0070716_1002215982 283
818 3300006175 Ga0070712_100008180 Ga0070712_1000081804 283
819 3300007265 Ga0099794_10063610 Ga0099794_100636102 283
820 3300010159 Ga0099796_10000427 Ga0099796_100004274 283
821 3300022730 Ga0224570_100214 Ga0224570_1002143 283
822 3300022732 Ga0224569_100615 Ga0224569_1006154 283
823 3300022734 Ga0224571_100223 Ga0224571_1002234 283
824 3300024225 Ga0224572_1001725 Ga0224572_10017251 283
825 3300024227 Ga0228598_1000044 Ga0228598_10000448 283
826 3300024227 Ga0228598_1001333 Ga0228598_10013332 283
827 3300025898 Ga0207692_10013451 Ga0207692_100134513 283
828 3300025898 Ga0207692_10091051 Ga0207692_100910511 283
829 3300025915 Ga0207693_10009953 Ga0207693_100099535 283
830 3300025916 Ga0207663_10047053 Ga0207663_100470533 283
831 3300025922 Ga0207646_10410762 Ga0207646_104107622 283
832 3300025928 Ga0207700_10019351 Ga0207700_100193516 283
833 3300027671 Ga0209588_1007857 Ga0209588_10078574 283
834 3300028016 Ga0265354_1000756 Ga0265354_10007563 283
835 3300028017 Ga0265356_1000296 Ga0265356_10002965 283
836 3300030760 Ga0265762_1000130 Ga0265762_100013013 283
837 3300030878 Ga0265770_1000180 Ga0265770_10001807 283
838 3300030879 Ga0265765_1000179 Ga0265765_10001793 283
839 3300031090 Ga0265760_10001544 Ga0265760_100015444 283
840 3300031090 Ga0265760_10010701 Ga0265760_100107014 283
841 3300031250 Ga0265331_10090161 Ga0265331_100901611 283
842 3300033547 Ga0316212_1001140 Ga0316212_10011402 283
843 3300033547 Ga0316212_1009626 Ga0316212_10096262 283
844 3300042876 Ga0451577_0128481 Ga0451577_0128481_567_1439 283
845 3300044673 Ga0453683_0006940 Ga0453683_0006940_3699_4571 283
846 3300044712 Ga0453684_0022220 Ga0453684_0022220_2082_2954 283
847 3300005546 Ga0070696_100176927 Ga0070696_1001769272 284
848 3300024227 Ga0228598_1000070 Ga0228598_10000703 284
849 3300030760 Ga0265762_1028232 Ga0265762_10282322 284
850 3300031711 Ga0265314_10000509 Ga0265314_100005099 284
851 3300050512 nmdc:mga0n895_379390_c1 nmdc:mga0n895_379390_c1_114_977 284
852 3300050515 nmdc:mga0a205_518313_c1 nmdc:mga0a205_518313_c1_78_941 284
853 3300003203 JGI25406J46586_10002645 JGI25406J46586_100026455 285
854 3300005293 Ga0065715_10106597 Ga0065715_101065972 285
855 3300005328 Ga0070676_10219894 Ga0070676_102198942 285
856 3300005468 Ga0070707_100222816 Ga0070707_1002228162 285
857 3300005471 Ga0070698_100270311 Ga0070698_1002703111 285
858 3300005545 Ga0070695_100050386 Ga0070695_1000503862 285
859 3300005985 Ga0081539_10002905 Ga0081539_100029056 285
860 3300006847 Ga0075431_100399986 Ga0075431_1003999862 285
861 3300006852 Ga0075433_10013715 Ga0075433_100137153 285
862 3300009147 Ga0114129_10035231 Ga0114129_100352315 285
863 3300009177 Ga0105248_10002269 Ga0105248_1000226917 285
864 3300025885 Ga0207653_10016643 Ga0207653_100166432 285
865 3300025922 Ga0207646_10073817 Ga0207646_100738172 285
866 3300025939 Ga0207665_10113248 Ga0207665_101132482 285
867 3300025941 Ga0207711_10066415 Ga0207711_100664153 285
868 3300026023 Ga0207677_10319207 Ga0207677_103192072 285
869 3300026035 Ga0207703_10121586 Ga0207703_101215863 285
870 3300026118 Ga0207675_100342874 Ga0207675_1003428742 285
871 3300031344 Ga0265316_10006792 Ga0265316_100067929 285
872 3300042439 Ga0439464_0019508 Ga0439464_0019508_851_1717 285
873 3300050507 nmdc:mga05p37_171860_c1 nmdc:mga05p37_171860_c1_1066_1932 285
874 3300050507 nmdc:mga05p37_47597_c1 nmdc:mga05p37_47597_c1_2405_3268 285

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01292

Ni_hydr_CYTB

Prokaryotic cytochrome b561

69

251

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kqf-assembly1.cif.gz_C formate dehydrogenase n from e. coli 0.7196 64 285
1kqf-assembly1.cif.gz_C formate dehydrogenase n from e. coli 0.7105 64 285
6g94-assembly1.cif.gz_B structure of e. coli hydrogenase-1 c19g variant in complex with cytochrome b 0.5707 75 235
4gd3-assembly1.cif.gz_A structure of e. coli hydrogenase-1 in complex with cytochrome b 0.559 48 238
6g94-assembly1.cif.gz_B structure of e. coli hydrogenase-1 c19g variant in complex with cytochrome b 0.5495 75 235
ID Description Score Start End Superfamily
1kqgC00 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.723 64 285 1.20.950.20
1kqgC00 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.7139 64 285 1.20.950.20
af_P77409_60_261_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.7069 66 254 1.20.950.20
af_P0AEL0_1_211_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.6973 65 282 1.20.950.20
af_P0AEL0_1_211_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.6768 65 282 1.20.950.20
ID Description Score Start End GO Terms
AF-A0A2V9QGW4-F1-model_v4 Cytochrome B 0.9594 1 268 GO:0005886
GO:0009055
GO:0020037
GO:0022904
GO:0046872
AF-A0A7X2TZ38-F1-model_v4 Cytochrome b/b6 domain-containing protein 0.948 1 268 GO:0005886
GO:0009055
GO:0020037
GO:0022904
GO:0046872
AF-A0A6B1BTH4-F1-model_v4 Cytochrome b/b6 domain-containing protein 0.9316 64 267 GO:0005886
GO:0009055
GO:0020037
GO:0022904
AF-A0A7X2TZ38-F1-model_v4 Cytochrome b/b6 domain-containing protein 0.9246 1 268 GO:0005886
GO:0009055
GO:0020037
GO:0022904
GO:0046872
AF-A0A2E9VAC3-F1-model_v4 Cytochrome B 0.9228 1 268 GO:0005886
GO:0009055
GO:0020037
GO:0022904
GO:0046872

Feature Viewer

pLDDT pTM Quality
87.23 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map