F484296
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 874 | 321 | 874 | 279 |
Family's Representative Sequence
| Representative Sequence | 3300031344|Ga0265316_10006792|Ga0265316_100067929 |
| Length | 294 |
| Sequence | MGFVTWATNPWGQSIPIHIAWFLIWVSVIAGLLFLIVHAIWLKYFAKPKEFVSDAPPQSVARIPKHVPRHSLVARMFHWIMAASMLTLLFTAFLPKVGVQFQWVTYHWIAGAVLTVSILFHVIHASFWLDFWSIWPDGTDLEDARRRVLRFFGRSAPPPRKFAKYPLENKLFHGVIILCGLSVIVTGVFMMFRVRTIFFPRNPYLFGDMTWGLMYVLHGLAGVGLIALVMMHVYFGLRPEKLPITKSMIFGWMDRDFYLQEHDPQRWVVETPSSSPPSVSTATRIEGRGLTDAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 4 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 128 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 130 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 131 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 132 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 133 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 134 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 202 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 203 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 208 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 209 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 211 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 218 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 219 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 220 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 223 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 226 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 227 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 228 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 230 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 235 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 236 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 237 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 240 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 241 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 242 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 243 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 244 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 245 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 246 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 247 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 248 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 249 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 250 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 277 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 278 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 279 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 280 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 281 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 282 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 284 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 285 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 286 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 287 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 318 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 319 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.03 |
| Metatranscriptomes | 2.97 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.52 |
| Rhizosphere | 96.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10002645 | 3300003203 | Bacteria | 8438 |
| 2 | rootH2_10158235 | 3300003320 | Bacteria | 1683 |
| 3 | Ga0058859_10571141 | 3300004798 | Bacteria | 1250 |
| 4 | Ga0058863_11271652 | 3300004799 | Bacteria | 3659 |
| 5 | Ga0058861_11276067 | 3300004800 | Bacteria | 1654 |
| 6 | Ga0058862_11810453 | 3300004803 | Bacteria | 1784 |
| 7 | Ga0058862_12808267 | 3300004803 | Bacteria | 1242 |
| 8 | Ga0058862_12893689 | 3300004803 | Unclassified | 1183 |
| 9 | Ga0065712_10032483 | 3300005290 | Unclassified | 1022 |
| 10 | Ga0065715_10106597 | 3300005293 | Bacteria | 2815 |
| 11 | Ga0065715_10202023 | 3300005293 | Unclassified | 1341 |
| 12 | Ga0065707_10093911 | 3300005295 | Bacteria | 3564 |
| 13 | Ga0065707_10141144 | 3300005295 | Bacteria | 1771 |
| 14 | Ga0065707_10176281 | 3300005295 | Bacteria | 1440 |
| 15 | Ga0070658_10015017 | 3300005327 | Bacteria | 6199 |
| 16 | Ga0070658_10062010 | 3300005327 | Bacteria | 3047 |
| 17 | Ga0070676_10006587 | 3300005328 | Bacteria | 6210 |
| 18 | Ga0070676_10088917 | 3300005328 | Bacteria | 1888 |
| 19 | Ga0070676_10219894 | 3300005328 | Bacteria | 1254 |
| 20 | Ga0070683_100033133 | 3300005329 | Bacteria | 4709 |
| 21 | Ga0070683_100184188 | 3300005329 | Bacteria | 1982 |
| 22 | Ga0070690_100060729 | 3300005330 | Bacteria | 2433 |
| 23 | Ga0070690_100075007 | 3300005330 | Bacteria | 2204 |
| 24 | Ga0070690_100319347 | 3300005330 | Bacteria | 1118 |
| 25 | Ga0068869_100002543 | 3300005334 | Bacteria | 11010 |
| 26 | Ga0068869_100051719 | 3300005334 | Unclassified | 2980 |
| 27 | Ga0070666_10081609 | 3300005335 | Bacteria | 2211 |
| 28 | Ga0070680_100096347 | 3300005336 | Bacteria | 2453 |
| 29 | Ga0070680_100174634 | 3300005336 | Unclassified | 1809 |
| 30 | Ga0070682_100024660 | 3300005337 | Bacteria | 3581 |
| 31 | Ga0068868_100007292 | 3300005338 | Bacteria | 7866 |
| 32 | Ga0068868_100013904 | 3300005338 | Bacteria | 5918 |
| 33 | Ga0068868_100029316 | 3300005338 | Bacteria | 4213 |
| 34 | Ga0068868_100091197 | 3300005338 | Bacteria | 2455 |
| 35 | Ga0070660_100007571 | 3300005339 | Bacteria | 7567 |
| 36 | Ga0070660_100009135 | 3300005339 | Bacteria | 6958 |
| 37 | Ga0070660_100113116 | 3300005339 | Bacteria | 2161 |
| 38 | Ga0070689_100369176 | 3300005340 | Bacteria | 1207 |
| 39 | Ga0070689_100591184 | 3300005340 | Bacteria | 960 |
| 40 | Ga0070691_10136183 | 3300005341 | Bacteria | 1248 |
| 41 | Ga0070687_100012491 | 3300005343 | Bacteria | 3753 |
| 42 | Ga0070687_100125767 | 3300005343 | Bacteria | 1473 |
| 43 | Ga0070661_100104396 | 3300005344 | Bacteria | 2111 |
| 44 | Ga0070669_100069318 | 3300005353 | Unclassified | 2604 |
| 45 | Ga0070669_100088909 | 3300005353 | Unclassified | 2313 |
| 46 | Ga0070675_100000739 | 3300005354 | Bacteria | 22817 |
| 47 | Ga0070675_100182597 | 3300005354 | Bacteria | 1814 |
| 48 | Ga0070675_100685783 | 3300005354 | Unclassified | 932 |
| 49 | Ga0070671_100190221 | 3300005355 | Unclassified | 1739 |
| 50 | Ga0070671_100254728 | 3300005355 | Unclassified | 1491 |
| 51 | Ga0070671_100288357 | 3300005355 | Bacteria | 1397 |
| 52 | Ga0070671_100504202 | 3300005355 | Unclassified | 1041 |
| 53 | Ga0070674_100030121 | 3300005356 | Bacteria | 3583 |
| 54 | Ga0070674_100222104 | 3300005356 | Bacteria | 1470 |
| 55 | Ga0070673_100060792 | 3300005364 | Unclassified | 2995 |
| 56 | Ga0070673_100115554 | 3300005364 | Unclassified | 2231 |
| 57 | Ga0070673_100223896 | 3300005364 | Bacteria | 1629 |
| 58 | Ga0070659_100152039 | 3300005366 | Unclassified | 1888 |
| 59 | Ga0070667_100022899 | 3300005367 | Bacteria | 5180 |
| 60 | Ga0070667_100264587 | 3300005367 | Unclassified | 1541 |
| 61 | Ga0070709_10001162 | 3300005434 | Bacteria | 14434 |
| 62 | Ga0070709_10018121 | 3300005434 | Bacteria | 4049 |
| 63 | Ga0070709_10052454 | 3300005434 | Bacteria | 2563 |
| 64 | Ga0070709_10171128 | 3300005434 | Bacteria | 1518 |
| 65 | Ga0070709_10330327 | 3300005434 | Bacteria | 1121 |
| 66 | Ga0070714_100029132 | 3300005435 | Bacteria | 4588 |
| 67 | Ga0070714_100182116 | 3300005435 | Bacteria | 1912 |
| 68 | Ga0070714_100211414 | 3300005435 | Unclassified | 1778 |
| 69 | Ga0070713_100000476 | 3300005436 | Bacteria | 25546 |
| 70 | Ga0070713_100001852 | 3300005436 | Bacteria | 13636 |
| 71 | Ga0070713_100002307 | 3300005436 | Bacteria | 12414 |
| 72 | Ga0070713_100011617 | 3300005436 | Bacteria | 6423 |
| 73 | Ga0070713_100014557 | 3300005436 | Bacteria | 5849 |
| 74 | Ga0070713_100056670 | 3300005436 | Bacteria | 3260 |
| 75 | Ga0070713_100056701 | 3300005436 | Bacteria | 3259 |
| 76 | Ga0070713_100074091 | 3300005436 | Unclassified | 2883 |
| 77 | Ga0070713_100198400 | 3300005436 | Unclassified | 1811 |
| 78 | Ga0070710_10061053 | 3300005437 | Bacteria | 2146 |
| 79 | Ga0070710_10136282 | 3300005437 | Unclassified | 1501 |
| 80 | Ga0070710_10236652 | 3300005437 | Unclassified | 1168 |
| 81 | Ga0070711_100000281 | 3300005439 | Bacteria | 26309 |
| 82 | Ga0070711_100001229 | 3300005439 | Bacteria | 13841 |
| 83 | Ga0070711_100020727 | 3300005439 | Unclassified | 4241 |
| 84 | Ga0070711_100030637 | 3300005439 | Unclassified | 3564 |
| 85 | Ga0070711_100033648 | 3300005439 | Bacteria | 3414 |
| 86 | Ga0070711_100048775 | 3300005439 | Bacteria | 2897 |
| 87 | Ga0070711_100172618 | 3300005439 | Unclassified | 1649 |
| 88 | Ga0070708_100003651 | 3300005445 | Bacteria | 12067 |
| 89 | Ga0070708_100006273 | 3300005445 | Bacteria | 9458 |
| 90 | Ga0070708_100066556 | 3300005445 | Bacteria | 3234 |
| 91 | Ga0070708_100107291 | 3300005445 | Bacteria | 2564 |
| 92 | Ga0070708_100245908 | 3300005445 | Viruses | 1680 |
| 93 | Ga0070663_100177850 | 3300005455 | Bacteria | 1648 |
| 94 | Ga0070678_100340196 | 3300005456 | Unclassified | 1287 |
| 95 | Ga0070662_100017281 | 3300005457 | Bacteria | 4860 |
| 96 | Ga0070681_10001282 | 3300005458 | Bacteria | 21908 |
| 97 | Ga0070681_10010428 | 3300005458 | Bacteria | 9177 |
| 98 | Ga0070681_10036998 | 3300005458 | Bacteria | 4899 |
| 99 | Ga0070681_10157001 | 3300005458 | Bacteria | 2199 |
| 100 | Ga0070681_10393319 | 3300005458 | Unclassified | 1297 |
| 101 | Ga0068867_100060541 | 3300005459 | Bacteria | 2809 |
| 102 | Ga0068867_100224802 | 3300005459 | Bacteria | 1514 |
| 103 | Ga0068867_100285494 | 3300005459 | Unclassified | 1355 |
| 104 | Ga0070685_10009573 | 3300005466 | Bacteria | 5012 |
| 105 | Ga0070685_10116179 | 3300005466 | Bacteria | 1656 |
| 106 | Ga0070706_100000336 | 3300005467 | Bacteria | 56986 |
| 107 | Ga0070706_100002094 | 3300005467 | Bacteria | 20343 |
| 108 | Ga0070706_100011620 | 3300005467 | Bacteria | 8181 |
| 109 | Ga0070706_100175853 | 3300005467 | Unclassified | 1999 |
| 110 | Ga0070707_100019771 | 3300005468 | Bacteria | 6347 |
| 111 | Ga0070707_100021052 | 3300005468 | Bacteria | 6159 |
| 112 | Ga0070707_100222816 | 3300005468 | Unclassified | 1836 |
| 113 | Ga0070698_100005969 | 3300005471 | Bacteria | 13277 |
| 114 | Ga0070698_100029720 | 3300005471 | Bacteria | 5672 |
| 115 | Ga0070698_100256401 | 3300005471 | Bacteria | 1681 |
| 116 | Ga0070698_100256521 | 3300005471 | Unclassified | 1681 |
| 117 | Ga0070698_100270311 | 3300005471 | Unclassified | 1631 |
| 118 | Ga0070698_100343820 | 3300005471 | Bacteria | 1423 |
| 119 | Ga0070699_100005358 | 3300005518 | Bacteria | 11246 |
| 120 | Ga0070699_100007587 | 3300005518 | Bacteria | 9431 |
| 121 | Ga0070699_100148811 | 3300005518 | Bacteria | 2070 |
| 122 | Ga0070699_100151824 | 3300005518 | Bacteria | 2049 |
| 123 | Ga0070679_100021290 | 3300005530 | Bacteria | 6328 |
| 124 | Ga0070679_100045647 | 3300005530 | Unclassified | 4366 |
| 125 | Ga0070679_100120107 | 3300005530 | Bacteria | 2613 |
| 126 | Ga0070679_100585457 | 3300005530 | Unclassified | 1059 |
| 127 | Ga0070684_100031772 | 3300005535 | Bacteria | 4497 |
| 128 | Ga0070684_100051325 | 3300005535 | Bacteria | 3583 |
| 129 | Ga0070684_100052651 | 3300005535 | Bacteria | 3541 |
| 130 | Ga0070684_100339810 | 3300005535 | Unclassified | 1380 |
| 131 | Ga0070697_100002395 | 3300005536 | Bacteria | 14440 |
| 132 | Ga0070697_100014445 | 3300005536 | Bacteria | 6201 |
| 133 | Ga0070697_100016125 | 3300005536 | Bacteria | 5875 |
| 134 | Ga0070697_100177312 | 3300005536 | Bacteria | 1805 |
| 135 | Ga0070697_100261749 | 3300005536 | Unclassified | 1481 |
| 136 | Ga0068853_100198663 | 3300005539 | Unclassified | 1824 |
| 137 | Ga0068853_100218901 | 3300005539 | Unclassified | 1738 |
| 138 | Ga0070672_100009432 | 3300005543 | Bacteria | 6727 |
| 139 | Ga0070695_100050386 | 3300005545 | Unclassified | 2668 |
| 140 | Ga0070695_100254949 | 3300005545 | Bacteria | 1279 |
| 141 | Ga0070696_100151488 | 3300005546 | Bacteria | 1702 |
| 142 | Ga0070696_100176927 | 3300005546 | Unclassified | 1581 |
| 143 | Ga0070693_100029239 | 3300005547 | Bacteria | 3004 |
| 144 | Ga0070693_100078116 | 3300005547 | Bacteria | 1966 |
| 145 | Ga0070693_100194275 | 3300005547 | Unclassified | 1314 |
| 146 | Ga0070693_100227770 | 3300005547 | Bacteria | 1225 |
| 147 | Ga0070665_100029410 | 3300005548 | Bacteria | 5530 |
| 148 | Ga0070665_100057610 | 3300005548 | Bacteria | 3895 |
| 149 | Ga0070665_100206334 | 3300005548 | Bacteria | 1966 |
| 150 | Ga0068855_100000234 | 3300005563 | Bacteria | 70713 |
| 151 | Ga0068855_100000432 | 3300005563 | Bacteria | 51912 |
| 152 | Ga0068855_100001150 | 3300005563 | Bacteria | 32765 |
| 153 | Ga0068855_100013501 | 3300005563 | Bacteria | 9847 |
| 154 | Ga0068855_100210802 | 3300005563 | Bacteria | 2183 |
| 155 | Ga0068855_100285841 | 3300005563 | Bacteria | 1830 |
| 156 | Ga0070664_100000726 | 3300005564 | Bacteria | 25332 |
| 157 | Ga0070664_100008247 | 3300005564 | Bacteria | 8423 |
| 158 | Ga0070664_100031470 | 3300005564 | Bacteria | 4433 |
| 159 | Ga0070664_100764576 | 3300005564 | Unclassified | 902 |
| 160 | Ga0068857_100000096 | 3300005577 | Bacteria | 51376 |
| 161 | Ga0068857_100004869 | 3300005577 | Bacteria | 11390 |
| 162 | Ga0068857_100005406 | 3300005577 | Bacteria | 10892 |
| 163 | Ga0068857_100211098 | 3300005577 | Bacteria | 1772 |
| 164 | Ga0068854_100009756 | 3300005578 | Bacteria | 6207 |
| 165 | Ga0068854_100140582 | 3300005578 | Unclassified | 1852 |
| 166 | Ga0068854_100262646 | 3300005578 | Unclassified | 1383 |
| 167 | Ga0068856_100000062 | 3300005614 | Bacteria | 100769 |
| 168 | Ga0068856_100000179 | 3300005614 | Bacteria | 66149 |
| 169 | Ga0068856_100000854 | 3300005614 | Bacteria | 32765 |
| 170 | Ga0068856_100041098 | 3300005614 | Bacteria | 4543 |
| 171 | Ga0068856_100086315 | 3300005614 | Bacteria | 3118 |
| 172 | Ga0068856_100101664 | 3300005614 | Bacteria | 2867 |
| 173 | Ga0068856_100125292 | 3300005614 | Bacteria | 2572 |
| 174 | Ga0068856_100168389 | 3300005614 | Bacteria | 2202 |
| 175 | Ga0068856_100184126 | 3300005614 | Unclassified | 2102 |
| 176 | Ga0068856_100202497 | 3300005614 | Bacteria | 1999 |
| 177 | Ga0070702_100153082 | 3300005615 | Bacteria | 1482 |
| 178 | Ga0068852_100016336 | 3300005616 | Bacteria | 5784 |
| 179 | Ga0068852_100036794 | 3300005616 | Bacteria | 4100 |
| 180 | Ga0068852_100052877 | 3300005616 | Bacteria | 3493 |
| 181 | Ga0068852_100220903 | 3300005616 | Bacteria | 1802 |
| 182 | Ga0068859_100090622 | 3300005617 | Unclassified | 3108 |
| 183 | Ga0068859_100091350 | 3300005617 | Bacteria | 3095 |
| 184 | Ga0068859_100099523 | 3300005617 | Unclassified | 2963 |
| 185 | Ga0068859_100108684 | 3300005617 | Bacteria | 2835 |
| 186 | Ga0068859_100123873 | 3300005617 | Bacteria | 2652 |
| 187 | Ga0068859_100244765 | 3300005617 | Bacteria | 1883 |
| 188 | Ga0068864_100000129 | 3300005618 | Bacteria | 73206 |
| 189 | Ga0068864_100012733 | 3300005618 | Bacteria | 6954 |
| 190 | Ga0068864_100312002 | 3300005618 | Unclassified | 1475 |
| 191 | Ga0068866_10026910 | 3300005718 | Bacteria | 2722 |
| 192 | Ga0068866_10067783 | 3300005718 | Bacteria | 1874 |
| 193 | Ga0068861_100237621 | 3300005719 | Bacteria | 1548 |
| 194 | Ga0068870_10000348 | 3300005840 | Bacteria | 17317 |
| 195 | Ga0068870_10130633 | 3300005840 | Bacteria | 1458 |
| 196 | Ga0068863_100008178 | 3300005841 | Bacteria | 10216 |
| 197 | Ga0068863_100033688 | 3300005841 | Bacteria | 4880 |
| 198 | Ga0068858_100001351 | 3300005842 | Bacteria | 25297 |
| 199 | Ga0068858_100002990 | 3300005842 | Bacteria | 16951 |
| 200 | Ga0068858_100010263 | 3300005842 | Bacteria | 8883 |
| 201 | Ga0068858_100010506 | 3300005842 | Bacteria | 8771 |
| 202 | Ga0068858_100014019 | 3300005842 | Bacteria | 7563 |
| 203 | Ga0068858_100022353 | 3300005842 | Bacteria | 5904 |
| 204 | Ga0068858_100059537 | 3300005842 | Bacteria | 3530 |
| 205 | Ga0068858_100077143 | 3300005842 | Bacteria | 3095 |
| 206 | Ga0068858_100122376 | 3300005842 | Unclassified | 2434 |
| 207 | Ga0068858_100844542 | 3300005842 | Unclassified | 894 |
| 208 | Ga0068860_100019110 | 3300005843 | Bacteria | 6653 |
| 209 | Ga0068860_100022312 | 3300005843 | Bacteria | 6126 |
| 210 | Ga0068860_100075164 | 3300005843 | Bacteria | 3213 |
| 211 | Ga0068860_100096300 | 3300005843 | Bacteria | 2821 |
| 212 | Ga0068860_100131638 | 3300005843 | Bacteria | 2401 |
| 213 | Ga0068860_100160120 | 3300005843 | Bacteria | 2170 |
| 214 | Ga0068862_100006825 | 3300005844 | Bacteria | 9465 |
| 215 | Ga0068862_100056072 | 3300005844 | Bacteria | 3375 |
| 216 | Ga0081538_10004787 | 3300005981 | Bacteria | 12368 |
| 217 | Ga0081540_1024169 | 3300005983 | Bacteria | 3532 |
| 218 | Ga0081539_10002905 | 3300005985 | Bacteria | 22664 |
| 219 | Ga0070717_10032853 | 3300006028 | Bacteria | 4183 |
| 220 | Ga0070717_10247204 | 3300006028 | Unclassified | 1575 |
| 221 | Ga0070717_10354068 | 3300006028 | Unclassified | 1313 |
| 222 | Ga0070715_10000763 | 3300006163 | Bacteria | 8715 |
| 223 | Ga0070715_10132775 | 3300006163 | Unclassified | 1200 |
| 224 | Ga0070716_100010159 | 3300006173 | Unclassified | 4714 |
| 225 | Ga0070716_100023487 | 3300006173 | Bacteria | 3271 |
| 226 | Ga0070716_100221598 | 3300006173 | Bacteria | 1271 |
| 227 | Ga0070716_100254285 | 3300006173 | Bacteria | 1199 |
| 228 | Ga0070712_100000468 | 3300006175 | Bacteria | 23267 |
| 229 | Ga0070712_100001119 | 3300006175 | Bacteria | 16162 |
| 230 | Ga0070712_100002849 | 3300006175 | Bacteria | 10703 |
| 231 | Ga0070712_100003144 | 3300006175 | Bacteria | 10172 |
| 232 | Ga0070712_100008180 | 3300006175 | Bacteria | 6569 |
| 233 | Ga0070712_100008773 | 3300006175 | Bacteria | 6364 |
| 234 | Ga0070712_100028949 | 3300006175 | Bacteria | 3710 |
| 235 | Ga0070712_100564588 | 3300006175 | Unclassified | 960 |
| 236 | Ga0097621_100000148 | 3300006237 | Bacteria | 42932 |
| 237 | Ga0097621_100000980 | 3300006237 | Bacteria | 20023 |
| 238 | Ga0097621_100004631 | 3300006237 | Bacteria | 9599 |
| 239 | Ga0097621_100009420 | 3300006237 | Bacteria | 7087 |
| 240 | Ga0097621_100115625 | 3300006237 | Bacteria | 2271 |
| 241 | Ga0097621_100266673 | 3300006237 | Bacteria | 1504 |
| 242 | Ga0097621_100277933 | 3300006237 | Unclassified | 1473 |
| 243 | Ga0068871_100000049 | 3300006358 | Bacteria | 65954 |
| 244 | Ga0068871_100000465 | 3300006358 | Bacteria | 27859 |
| 245 | Ga0068871_100013790 | 3300006358 | Bacteria | 6009 |
| 246 | Ga0068871_100030112 | 3300006358 | Unclassified | 4271 |
| 247 | Ga0068871_100031575 | 3300006358 | Bacteria | 4178 |
| 248 | Ga0068871_100140356 | 3300006358 | Bacteria | 2054 |
| 249 | Ga0068871_100231032 | 3300006358 | Bacteria | 1605 |
| 250 | Ga0075428_100000023 | 3300006844 | Bacteria | 127355 |
| 251 | Ga0075428_100001864 | 3300006844 | Bacteria | 22582 |
| 252 | Ga0075430_100001987 | 3300006846 | Bacteria | 16844 |
| 253 | Ga0075430_100291878 | 3300006846 | Bacteria | 1349 |
| 254 | Ga0075431_100002526 | 3300006847 | Bacteria | 17651 |
| 255 | Ga0075431_100399986 | 3300006847 | Bacteria | 1375 |
| 256 | Ga0075433_10012263 | 3300006852 | Bacteria | 6912 |
| 257 | Ga0075433_10013715 | 3300006852 | Bacteria | 6600 |
| 258 | Ga0075434_100051841 | 3300006871 | Unclassified | 4077 |
| 259 | Ga0075434_100261955 | 3300006871 | Bacteria | 1748 |
| 260 | Ga0075434_100321623 | 3300006871 | Unclassified | 1567 |
| 261 | Ga0075429_100001764 | 3300006880 | Bacteria | 17910 |
| 262 | Ga0075429_100061268 | 3300006880 | Bacteria | 3278 |
| 263 | Ga0075429_100102080 | 3300006880 | Bacteria | 2504 |
| 264 | Ga0068865_100075093 | 3300006881 | Unclassified | 2409 |
| 265 | Ga0068865_100077749 | 3300006881 | Unclassified | 2372 |
| 266 | Ga0068865_100093951 | 3300006881 | Bacteria | 2182 |
| 267 | Ga0068865_100199277 | 3300006881 | Bacteria | 1553 |
| 268 | Ga0075436_100230607 | 3300006914 | Bacteria | 1315 |
| 269 | Ga0097620_100090624 | 3300006931 | Unclassified | 3108 |
| 270 | Ga0097620_100091355 | 3300006931 | Bacteria | 3095 |
| 271 | Ga0097620_100099524 | 3300006931 | Unclassified | 2963 |
| 272 | Ga0097620_100108683 | 3300006931 | Bacteria | 2835 |
| 273 | Ga0097620_100123888 | 3300006931 | Bacteria | 2652 |
| 274 | Ga0097620_100244732 | 3300006931 | Bacteria | 1883 |
| 275 | Ga0075435_100047786 | 3300007076 | Bacteria | 3437 |
| 276 | Ga0075435_100077191 | 3300007076 | Unclassified | 2731 |
| 277 | Ga0099794_10000004 | 3300007265 | Bacteria | 134462 |
| 278 | Ga0099794_10063610 | 3300007265 | Unclassified | 1796 |
| 279 | Ga0105240_10000378 | 3300009093 | Bacteria | 83713 |
| 280 | Ga0105240_10014149 | 3300009093 | Bacteria | 10900 |
| 281 | Ga0105240_10096117 | 3300009093 | Bacteria | 3611 |
| 282 | Ga0105240_10111346 | 3300009093 | Bacteria | 3312 |
| 283 | Ga0105240_10206710 | 3300009093 | Bacteria | 2297 |
| 284 | Ga0105240_10361382 | 3300009093 | Bacteria | 1644 |
| 285 | Ga0105240_10551647 | 3300009093 | Bacteria | 1275 |
| 286 | Ga0111539_10000001 | 3300009094 | Bacteria | 1035431 |
| 287 | Ga0111539_10015323 | 3300009094 | Bacteria | 9549 |
| 288 | Ga0111539_10040991 | 3300009094 | Bacteria | 5570 |
| 289 | Ga0111539_10163892 | 3300009094 | Bacteria | 2600 |
| 290 | Ga0105245_10012860 | 3300009098 | Bacteria | 7293 |
| 291 | Ga0105245_10014526 | 3300009098 | Bacteria | 6857 |
| 292 | Ga0105245_10098891 | 3300009098 | Unclassified | 2696 |
| 293 | Ga0105245_10115053 | 3300009098 | Bacteria | 2506 |
| 294 | Ga0105245_10124984 | 3300009098 | Bacteria | 2407 |
| 295 | Ga0105245_10162821 | 3300009098 | Bacteria | 2118 |
| 296 | Ga0105245_10335104 | 3300009098 | Unclassified | 1494 |
| 297 | Ga0105247_10049958 | 3300009101 | Unclassified | 2573 |
| 298 | Ga0105247_10068712 | 3300009101 | Bacteria | 2209 |
| 299 | Ga0105247_10193098 | 3300009101 | Bacteria | 1364 |
| 300 | Ga0105247_10237369 | 3300009101 | Unclassified | 1241 |
| 301 | Ga0114129_10030545 | 3300009147 | Bacteria | 7624 |
| 302 | Ga0114129_10035231 | 3300009147 | Bacteria | 7071 |
| 303 | Ga0114129_10041222 | 3300009147 | Bacteria | 6507 |
| 304 | Ga0114129_10543115 | 3300009147 | Bacteria | 1512 |
| 305 | Ga0105243_10073335 | 3300009148 | Unclassified | 2773 |
| 306 | Ga0105243_10202473 | 3300009148 | Bacteria | 1742 |
| 307 | Ga0105241_10007930 | 3300009174 | Bacteria | 7807 |
| 308 | Ga0105241_10083824 | 3300009174 | Bacteria | 2501 |
| 309 | Ga0105241_10189512 | 3300009174 | Bacteria | 1711 |
| 310 | Ga0105242_10058932 | 3300009176 | Bacteria | 3150 |
| 311 | Ga0105242_10060759 | 3300009176 | Unclassified | 3106 |
| 312 | Ga0105242_10070983 | 3300009176 | Bacteria | 2889 |
| 313 | Ga0105242_10149562 | 3300009176 | Bacteria | 2035 |
| 314 | Ga0105242_10235268 | 3300009176 | Unclassified | 1644 |
| 315 | Ga0105242_10236136 | 3300009176 | Unclassified | 1641 |
| 316 | Ga0105242_10340332 | 3300009176 | Bacteria | 1382 |
| 317 | Ga0105242_10442034 | 3300009176 | Bacteria | 1224 |
| 318 | Ga0105242_10584148 | 3300009176 | Unclassified | 1076 |
| 319 | Ga0105248_10002269 | 3300009177 | Bacteria | 21276 |
| 320 | Ga0105248_10007399 | 3300009177 | Bacteria | 12048 |
| 321 | Ga0105248_10038890 | 3300009177 | Bacteria | 5326 |
| 322 | Ga0105248_10040731 | 3300009177 | Bacteria | 5207 |
| 323 | Ga0105248_10132247 | 3300009177 | Bacteria | 2815 |
| 324 | Ga0105248_10279095 | 3300009177 | Unclassified | 1881 |
| 325 | Ga0105248_10384894 | 3300009177 | Bacteria | 1579 |
| 326 | Ga0105237_10017405 | 3300009545 | Bacteria | 7451 |
| 327 | Ga0105237_10067340 | 3300009545 | Bacteria | 3574 |
| 328 | Ga0105237_10093606 | 3300009545 | Bacteria | 2994 |
| 329 | Ga0105237_10158974 | 3300009545 | Bacteria | 2257 |
| 330 | Ga0105237_10309965 | 3300009545 | Bacteria | 1581 |
| 331 | Ga0105238_10000609 | 3300009551 | Bacteria | 37550 |
| 332 | Ga0105238_10004737 | 3300009551 | Bacteria | 13456 |
| 333 | Ga0105238_10013340 | 3300009551 | Bacteria | 8289 |
| 334 | Ga0105238_10024029 | 3300009551 | Bacteria | 6215 |
| 335 | Ga0105238_10025730 | 3300009551 | Bacteria | 6000 |
| 336 | Ga0105238_10173179 | 3300009551 | Bacteria | 2135 |
| 337 | Ga0105238_10178013 | 3300009551 | Bacteria | 2103 |
| 338 | Ga0105249_10006270 | 3300009553 | Bacteria | 10329 |
| 339 | Ga0105249_10016331 | 3300009553 | Bacteria | 6586 |
| 340 | Ga0105249_10444304 | 3300009553 | Bacteria | 1335 |
| 341 | Ga0105249_10550283 | 3300009553 | Unclassified | 1204 |
| 342 | Ga0099796_10000427 | 3300010159 | Bacteria | 6985 |
| 343 | Ga0099796_10081935 | 3300010159 | Bacteria | 1185 |
| 344 | Ga0105239_10039316 | 3300010375 | Bacteria | 5183 |
| 345 | Ga0105239_10469679 | 3300010375 | Bacteria | 1428 |
| 346 | Ga0105239_10819542 | 3300010375 | Unclassified | 1067 |
| 347 | Ga0105246_10016519 | 3300011119 | Bacteria | 4674 |
| 348 | Ga0157373_10011663 | 3300013100 | Bacteria | 6453 |
| 349 | Ga0157373_10091841 | 3300013100 | Bacteria | 2138 |
| 350 | Ga0157373_10176975 | 3300013100 | Unclassified | 1502 |
| 351 | Ga0157371_10024243 | 3300013102 | Bacteria | 4433 |
| 352 | Ga0157371_10054599 | 3300013102 | Bacteria | 2837 |
| 353 | Ga0157371_10089236 | 3300013102 | Bacteria | 2183 |
| 354 | Ga0157370_10005013 | 3300013104 | Bacteria | 14968 |
| 355 | Ga0157370_10168118 | 3300013104 | Bacteria | 2039 |
| 356 | Ga0157370_10184107 | 3300013104 | Bacteria | 1940 |
| 357 | Ga0157369_10000159 | 3300013105 | Bacteria | 95759 |
| 358 | Ga0157369_10018776 | 3300013105 | Bacteria | 7751 |
| 359 | Ga0157369_10095136 | 3300013105 | Bacteria | 3179 |
| 360 | Ga0157369_10200402 | 3300013105 | Bacteria | 2095 |
| 361 | Ga0157374_10000062 | 3300013296 | Bacteria | 112028 |
| 362 | Ga0157374_10000338 | 3300013296 | Bacteria | 43326 |
| 363 | Ga0157374_10000454 | 3300013296 | Bacteria | 37339 |
| 364 | Ga0157374_10016801 | 3300013296 | Bacteria | 6439 |
| 365 | Ga0157374_10021505 | 3300013296 | Bacteria | 5742 |
| 366 | Ga0157374_10033555 | 3300013296 | Unclassified | 4683 |
| 367 | Ga0157374_10084221 | 3300013296 | Bacteria | 3022 |
| 368 | Ga0157374_10194908 | 3300013296 | Bacteria | 1982 |
| 369 | Ga0157378_10000009 | 3300013297 | Bacteria | 161557 |
| 370 | Ga0157378_10000899 | 3300013297 | Bacteria | 27398 |
| 371 | Ga0157378_10005749 | 3300013297 | Bacteria | 10860 |
| 372 | Ga0157378_10082890 | 3300013297 | Bacteria | 2901 |
| 373 | Ga0157378_10085504 | 3300013297 | Bacteria | 2857 |
| 374 | Ga0157378_10123896 | 3300013297 | Bacteria | 2385 |
| 375 | Ga0157378_10210633 | 3300013297 | Bacteria | 1843 |
| 376 | Ga0157378_10284000 | 3300013297 | Bacteria | 1596 |
| 377 | Ga0157378_10335073 | 3300013297 | Unclassified | 1474 |
| 378 | Ga0157378_10388862 | 3300013297 | Bacteria | 1371 |
| 379 | Ga0163162_10005742 | 3300013306 | Bacteria | 12001 |
| 380 | Ga0163162_10046149 | 3300013306 | Bacteria | 4367 |
| 381 | Ga0163162_10130609 | 3300013306 | Bacteria | 2620 |
| 382 | Ga0163162_10212687 | 3300013306 | Bacteria | 2064 |
| 383 | Ga0163162_10444852 | 3300013306 | Bacteria | 1428 |
| 384 | Ga0157372_10000540 | 3300013307 | Bacteria | 41649 |
| 385 | Ga0157372_10000845 | 3300013307 | Bacteria | 33235 |
| 386 | Ga0157372_10001184 | 3300013307 | Bacteria | 28212 |
| 387 | Ga0157372_10019861 | 3300013307 | Bacteria | 7240 |
| 388 | Ga0157372_10305829 | 3300013307 | Bacteria | 1850 |
| 389 | Ga0157372_10627000 | 3300013307 | Unclassified | 1253 |
| 390 | Ga0157375_10277462 | 3300013308 | Bacteria | 1839 |
| 391 | Ga0157375_10484537 | 3300013308 | Unclassified | 1402 |
| 392 | Ga0163163_10001395 | 3300014325 | Bacteria | 20392 |
| 393 | Ga0163163_10002052 | 3300014325 | Bacteria | 16997 |
| 394 | Ga0163163_10189496 | 3300014325 | Bacteria | 2105 |
| 395 | Ga0163163_10230261 | 3300014325 | Bacteria | 1902 |
| 396 | Ga0163163_10258435 | 3300014325 | Bacteria | 1792 |
| 397 | Ga0163163_10411143 | 3300014325 | Unclassified | 1412 |
| 398 | Ga0157380_10338964 | 3300014326 | Unclassified | 1401 |
| 399 | Ga0157377_10024546 | 3300014745 | Bacteria | 3205 |
| 400 | Ga0157379_10004208 | 3300014968 | Bacteria | 12288 |
| 401 | Ga0157379_10009128 | 3300014968 | Bacteria | 8635 |
| 402 | Ga0157379_10012421 | 3300014968 | Bacteria | 7437 |
| 403 | Ga0157379_10013451 | 3300014968 | Bacteria | 7169 |
| 404 | Ga0157379_10019460 | 3300014968 | Bacteria | 5996 |
| 405 | Ga0157379_10051201 | 3300014968 | Bacteria | 3688 |
| 406 | Ga0157379_10092968 | 3300014968 | Bacteria | 2706 |
| 407 | Ga0157376_10007509 | 3300014969 | Bacteria | 7790 |
| 408 | Ga0157376_10013169 | 3300014969 | Bacteria | 6163 |
| 409 | Ga0157376_10038471 | 3300014969 | Unclassified | 3893 |
| 410 | Ga0157376_10069513 | 3300014969 | Unclassified | 2985 |
| 411 | Ga0157376_10085139 | 3300014969 | Unclassified | 2723 |
| 412 | Ga0157376_10400085 | 3300014969 | Bacteria | 1328 |
| 413 | Ga0163161_10167644 | 3300017792 | Bacteria | 1678 |
| 414 | Ga0197907_10419767 | 3300020069 | Bacteria | 3168 |
| 415 | Ga0206356_10660814 | 3300020070 | Bacteria | 1417 |
| 416 | Ga0206356_10693455 | 3300020070 | Unclassified | 1177 |
| 417 | Ga0206356_10844687 | 3300020070 | Unclassified | 1127 |
| 418 | Ga0206356_11376450 | 3300020070 | Bacteria | 1407 |
| 419 | Ga0206349_1194817 | 3300020075 | Bacteria | 1848 |
| 420 | Ga0206350_11158639 | 3300020080 | Bacteria | 3968 |
| 421 | Ga0154015_1324747 | 3300020610 | Unclassified | 1174 |
| 422 | Ga0213875_10037145 | 3300021388 | Bacteria | 2296 |
| 423 | Ga0213875_10134125 | 3300021388 | Bacteria | 1158 |
| 424 | Ga0224712_10001197 | 3300022467 | Bacteria | 5834 |
| 425 | Ga0224712_10006852 | 3300022467 | Bacteria | 3281 |
| 426 | Ga0224712_10044238 | 3300022467 | Unclassified | 1697 |
| 427 | Ga0224570_100214 | 3300022730 | Unclassified | 4146 |
| 428 | Ga0224569_100615 | 3300022732 | Bacteria | 3071 |
| 429 | Ga0224571_100223 | 3300022734 | Bacteria | 2788 |
| 430 | Ga0224572_1001725 | 3300024225 | Unclassified | 3332 |
| 431 | Ga0228598_1000044 | 3300024227 | Bacteria | 17465 |
| 432 | Ga0228598_1000070 | 3300024227 | Bacteria | 15225 |
| 433 | Ga0228598_1001333 | 3300024227 | Bacteria | 5436 |
| 434 | Ga0207697_10001180 | 3300025315 | Bacteria | 14351 |
| 435 | Ga0207697_10052573 | 3300025315 | Bacteria | 1686 |
| 436 | Ga0207653_10016643 | 3300025885 | Bacteria | 2310 |
| 437 | Ga0207682_10015653 | 3300025893 | Bacteria | 2954 |
| 438 | Ga0207682_10088430 | 3300025893 | Bacteria | 1339 |
| 439 | Ga0207692_10013451 | 3300025898 | Bacteria | 3551 |
| 440 | Ga0207692_10091051 | 3300025898 | Unclassified | 1654 |
| 441 | Ga0207710_10018239 | 3300025900 | Bacteria | 2983 |
| 442 | Ga0207710_10056137 | 3300025900 | Bacteria | 1777 |
| 443 | Ga0207688_10062886 | 3300025901 | Unclassified | 2093 |
| 444 | Ga0207680_10024840 | 3300025903 | Unclassified | 3295 |
| 445 | Ga0207680_10034965 | 3300025903 | Bacteria | 2880 |
| 446 | Ga0207680_10208864 | 3300025903 | Bacteria | 1334 |
| 447 | Ga0207647_10004807 | 3300025904 | Bacteria | 9999 |
| 448 | Ga0207647_10016923 | 3300025904 | Unclassified | 4965 |
| 449 | Ga0207685_10001682 | 3300025905 | Bacteria | 4771 |
| 450 | Ga0207685_10067157 | 3300025905 | Bacteria | 1441 |
| 451 | Ga0207699_10012408 | 3300025906 | Unclassified | 4335 |
| 452 | Ga0207699_10047766 | 3300025906 | Bacteria | 2511 |
| 453 | Ga0207699_10172588 | 3300025906 | Bacteria | 1448 |
| 454 | Ga0207699_10191628 | 3300025906 | Bacteria | 1380 |
| 455 | Ga0207699_10242932 | 3300025906 | Unclassified | 1238 |
| 456 | Ga0207645_10003579 | 3300025907 | Bacteria | 11750 |
| 457 | Ga0207645_10004591 | 3300025907 | Bacteria | 10183 |
| 458 | Ga0207645_10172978 | 3300025907 | Bacteria | 1416 |
| 459 | Ga0207643_10001054 | 3300025908 | Bacteria | 16318 |
| 460 | Ga0207705_10002624 | 3300025909 | Bacteria | 13787 |
| 461 | Ga0207705_10234245 | 3300025909 | Bacteria | 1397 |
| 462 | Ga0207684_10000320 | 3300025910 | Bacteria | 68296 |
| 463 | Ga0207684_10004878 | 3300025910 | Bacteria | 12535 |
| 464 | Ga0207684_10078135 | 3300025910 | Bacteria | 2815 |
| 465 | Ga0207654_10020250 | 3300025911 | Bacteria | 3524 |
| 466 | Ga0207707_10001452 | 3300025912 | Bacteria | 21916 |
| 467 | Ga0207707_10004494 | 3300025912 | Bacteria | 12268 |
| 468 | Ga0207707_10018296 | 3300025912 | Bacteria | 6108 |
| 469 | Ga0207707_10060733 | 3300025912 | Bacteria | 3288 |
| 470 | Ga0207707_10269601 | 3300025912 | Unclassified | 1475 |
| 471 | Ga0207695_10008636 | 3300025913 | Bacteria | 12718 |
| 472 | Ga0207695_10008675 | 3300025913 | Bacteria | 12685 |
| 473 | Ga0207695_10013009 | 3300025913 | Bacteria | 9941 |
| 474 | Ga0207695_10114494 | 3300025913 | Bacteria | 2672 |
| 475 | Ga0207695_10284783 | 3300025913 | Bacteria | 1546 |
| 476 | Ga0207671_10167045 | 3300025914 | Bacteria | 1707 |
| 477 | Ga0207693_10000008 | 3300025915 | Bacteria | 171049 |
| 478 | Ga0207693_10001167 | 3300025915 | Bacteria | 23425 |
| 479 | Ga0207693_10002431 | 3300025915 | Bacteria | 16175 |
| 480 | Ga0207693_10007049 | 3300025915 | Bacteria | 9275 |
| 481 | Ga0207693_10009953 | 3300025915 | Bacteria | 7729 |
| 482 | Ga0207693_10015202 | 3300025915 | Bacteria | 6177 |
| 483 | Ga0207693_10026238 | 3300025915 | Bacteria | 4612 |
| 484 | Ga0207663_10000111 | 3300025916 | Bacteria | 39513 |
| 485 | Ga0207663_10010876 | 3300025916 | Bacteria | 4860 |
| 486 | Ga0207663_10047053 | 3300025916 | Bacteria | 2661 |
| 487 | Ga0207663_10056451 | 3300025916 | Unclassified | 2469 |
| 488 | Ga0207660_10016931 | 3300025917 | Bacteria | 4837 |
| 489 | Ga0207660_10099890 | 3300025917 | Bacteria | 2166 |
| 490 | Ga0207662_10009381 | 3300025918 | Bacteria | 5382 |
| 491 | Ga0207662_10201167 | 3300025918 | Bacteria | 1289 |
| 492 | Ga0207657_10000386 | 3300025919 | Bacteria | 46458 |
| 493 | Ga0207657_10002009 | 3300025919 | Bacteria | 21997 |
| 494 | Ga0207657_10005757 | 3300025919 | Bacteria | 12926 |
| 495 | Ga0207649_10015374 | 3300025920 | Bacteria | 4300 |
| 496 | Ga0207652_10005785 | 3300025921 | Bacteria | 10032 |
| 497 | Ga0207652_10023725 | 3300025921 | Bacteria | 5085 |
| 498 | Ga0207652_10050957 | 3300025921 | Bacteria | 3548 |
| 499 | Ga0207652_10297020 | 3300025921 | Unclassified | 1458 |
| 500 | Ga0207646_10073817 | 3300025922 | Bacteria | 3047 |
| 501 | Ga0207646_10337240 | 3300025922 | Bacteria | 1362 |
| 502 | Ga0207646_10410762 | 3300025922 | Bacteria | 1222 |
| 503 | Ga0207681_10100408 | 3300025923 | Unclassified | 2085 |
| 504 | Ga0207681_10534918 | 3300025923 | Unclassified | 963 |
| 505 | Ga0207694_10003298 | 3300025924 | Bacteria | 12840 |
| 506 | Ga0207694_10004655 | 3300025924 | Bacteria | 10681 |
| 507 | Ga0207694_10005997 | 3300025924 | Bacteria | 9303 |
| 508 | Ga0207694_10036165 | 3300025924 | Bacteria | 3789 |
| 509 | Ga0207694_10036471 | 3300025924 | Unclassified | 3774 |
| 510 | Ga0207694_10224683 | 3300025924 | Bacteria | 1532 |
| 511 | Ga0207650_10067229 | 3300025925 | Bacteria | 2689 |
| 512 | Ga0207659_10000642 | 3300025926 | Bacteria | 20752 |
| 513 | Ga0207659_10002882 | 3300025926 | Bacteria | 10236 |
| 514 | Ga0207659_10490221 | 3300025926 | Unclassified | 1039 |
| 515 | Ga0207687_10030526 | 3300025927 | Unclassified | 3635 |
| 516 | Ga0207687_10045413 | 3300025927 | Bacteria | 3036 |
| 517 | Ga0207687_10066038 | 3300025927 | Bacteria | 2570 |
| 518 | Ga0207687_10077756 | 3300025927 | Unclassified | 2387 |
| 519 | Ga0207687_10111801 | 3300025927 | Bacteria | 2029 |
| 520 | Ga0207687_10301170 | 3300025927 | Unclassified | 1291 |
| 521 | Ga0207687_10467384 | 3300025927 | Unclassified | 1048 |
| 522 | Ga0207700_10000107 | 3300025928 | Bacteria | 49976 |
| 523 | Ga0207700_10006279 | 3300025928 | Bacteria | 7172 |
| 524 | Ga0207700_10019351 | 3300025928 | Unclassified | 4597 |
| 525 | Ga0207700_10063979 | 3300025928 | Bacteria | 2800 |
| 526 | Ga0207700_10068309 | 3300025928 | Bacteria | 2724 |
| 527 | Ga0207700_10180330 | 3300025928 | Unclassified | 1768 |
| 528 | Ga0207700_10204560 | 3300025928 | Unclassified | 1665 |
| 529 | Ga0207700_10426237 | 3300025928 | Bacteria | 1166 |
| 530 | Ga0207664_10054162 | 3300025929 | Bacteria | 3178 |
| 531 | Ga0207664_10176543 | 3300025929 | Unclassified | 1832 |
| 532 | Ga0207664_10187705 | 3300025929 | Unclassified | 1778 |
| 533 | Ga0207664_10302520 | 3300025929 | Bacteria | 1407 |
| 534 | Ga0207644_10030295 | 3300025931 | Bacteria | 3762 |
| 535 | Ga0207644_10067598 | 3300025931 | Bacteria | 2605 |
| 536 | Ga0207644_10389640 | 3300025931 | Bacteria | 1137 |
| 537 | Ga0207690_10070683 | 3300025932 | Bacteria | 2405 |
| 538 | Ga0207706_10000641 | 3300025933 | Bacteria | 37090 |
| 539 | Ga0207706_10092392 | 3300025933 | Bacteria | 2661 |
| 540 | Ga0207686_10067254 | 3300025934 | Bacteria | 2292 |
| 541 | Ga0207686_10092920 | 3300025934 | Bacteria | 1996 |
| 542 | Ga0207709_10205382 | 3300025935 | Bacteria | 1410 |
| 543 | Ga0207670_10182863 | 3300025936 | Bacteria | 1580 |
| 544 | Ga0207670_10294140 | 3300025936 | Unclassified | 1269 |
| 545 | Ga0207669_10059837 | 3300025937 | Bacteria | 2332 |
| 546 | Ga0207669_10171747 | 3300025937 | Bacteria | 1544 |
| 547 | Ga0207704_10012937 | 3300025938 | Unclassified | 4158 |
| 548 | Ga0207704_10034810 | 3300025938 | Bacteria | 2878 |
| 549 | Ga0207665_10016930 | 3300025939 | Unclassified | 4785 |
| 550 | Ga0207665_10039155 | 3300025939 | Bacteria | 3159 |
| 551 | Ga0207665_10076197 | 3300025939 | Bacteria | 2299 |
| 552 | Ga0207665_10113248 | 3300025939 | Bacteria | 1908 |
| 553 | Ga0207691_10182599 | 3300025940 | Bacteria | 1833 |
| 554 | Ga0207691_10286296 | 3300025940 | Bacteria | 1417 |
| 555 | Ga0207691_10424416 | 3300025940 | Bacteria | 1133 |
| 556 | Ga0207711_10044184 | 3300025941 | Bacteria | 3803 |
| 557 | Ga0207711_10056241 | 3300025941 | Bacteria | 3380 |
| 558 | Ga0207711_10066415 | 3300025941 | Bacteria | 3119 |
| 559 | Ga0207711_10096175 | 3300025941 | Bacteria | 2613 |
| 560 | Ga0207711_10168820 | 3300025941 | Bacteria | 1984 |
| 561 | Ga0207689_10003694 | 3300025942 | Bacteria | 13950 |
| 562 | Ga0207689_10004152 | 3300025942 | Bacteria | 13168 |
| 563 | Ga0207689_10025571 | 3300025942 | Bacteria | 4947 |
| 564 | Ga0207689_10046783 | 3300025942 | Unclassified | 3574 |
| 565 | Ga0207689_10098810 | 3300025942 | Unclassified | 2398 |
| 566 | Ga0207689_10146344 | 3300025942 | Bacteria | 1946 |
| 567 | Ga0207661_10040859 | 3300025944 | Bacteria | 3649 |
| 568 | Ga0207679_10166851 | 3300025945 | Bacteria | 1809 |
| 569 | Ga0207667_10000087 | 3300025949 | Bacteria | 149828 |
| 570 | Ga0207667_10000465 | 3300025949 | Bacteria | 54509 |
| 571 | Ga0207667_10001399 | 3300025949 | Bacteria | 30243 |
| 572 | Ga0207667_10007820 | 3300025949 | Bacteria | 12776 |
| 573 | Ga0207667_10012244 | 3300025949 | Bacteria | 9905 |
| 574 | Ga0207667_10055236 | 3300025949 | Bacteria | 4175 |
| 575 | Ga0207651_10137640 | 3300025960 | Bacteria | 1881 |
| 576 | Ga0207651_10158464 | 3300025960 | Bacteria | 1771 |
| 577 | Ga0207651_10265793 | 3300025960 | Bacteria | 1410 |
| 578 | Ga0207651_10493219 | 3300025960 | Unclassified | 1057 |
| 579 | Ga0207712_10044134 | 3300025961 | Bacteria | 3079 |
| 580 | Ga0207712_10052395 | 3300025961 | Unclassified | 2858 |
| 581 | Ga0207712_10088737 | 3300025961 | Bacteria | 2272 |
| 582 | Ga0207640_10034171 | 3300025981 | Bacteria | 3170 |
| 583 | Ga0207640_10054643 | 3300025981 | Bacteria | 2612 |
| 584 | Ga0207640_10105632 | 3300025981 | Bacteria | 1985 |
| 585 | Ga0207640_10135407 | 3300025981 | Bacteria | 1787 |
| 586 | Ga0207658_10054958 | 3300025986 | Unclassified | 2948 |
| 587 | Ga0207677_10011911 | 3300026023 | Bacteria | 4978 |
| 588 | Ga0207677_10022193 | 3300026023 | Bacteria | 3896 |
| 589 | Ga0207677_10022255 | 3300026023 | Unclassified | 3892 |
| 590 | Ga0207677_10319207 | 3300026023 | Bacteria | 1290 |
| 591 | Ga0207677_10444773 | 3300026023 | Bacteria | 1109 |
| 592 | Ga0207703_10003748 | 3300026035 | Bacteria | 12650 |
| 593 | Ga0207703_10004875 | 3300026035 | Bacteria | 10911 |
| 594 | Ga0207703_10009661 | 3300026035 | Bacteria | 7573 |
| 595 | Ga0207703_10023202 | 3300026035 | Bacteria | 4873 |
| 596 | Ga0207703_10032794 | 3300026035 | Bacteria | 4113 |
| 597 | Ga0207703_10041828 | 3300026035 | Bacteria | 3674 |
| 598 | Ga0207703_10056180 | 3300026035 | Bacteria | 3205 |
| 599 | Ga0207703_10121586 | 3300026035 | Bacteria | 2242 |
| 600 | Ga0207639_10040615 | 3300026041 | Unclassified | 3473 |
| 601 | Ga0207639_10061531 | 3300026041 | Bacteria | 2900 |
| 602 | Ga0207639_10088557 | 3300026041 | Bacteria | 2471 |
| 603 | Ga0207639_10460422 | 3300026041 | Unclassified | 1156 |
| 604 | Ga0207678_10008144 | 3300026067 | Bacteria | 9241 |
| 605 | Ga0207678_10535645 | 3300026067 | Unclassified | 1023 |
| 606 | Ga0207702_10000458 | 3300026078 | Bacteria | 46107 |
| 607 | Ga0207702_10001096 | 3300026078 | Bacteria | 27672 |
| 608 | Ga0207702_10019362 | 3300026078 | Bacteria | 5633 |
| 609 | Ga0207702_10019664 | 3300026078 | Bacteria | 5590 |
| 610 | Ga0207702_10112427 | 3300026078 | Bacteria | 2424 |
| 611 | Ga0207702_10157820 | 3300026078 | Bacteria | 2069 |
| 612 | Ga0207702_10220425 | 3300026078 | Bacteria | 1768 |
| 613 | Ga0207641_10009846 | 3300026088 | Bacteria | 7870 |
| 614 | Ga0207641_10013325 | 3300026088 | Bacteria | 6743 |
| 615 | Ga0207641_10032728 | 3300026088 | Bacteria | 4318 |
| 616 | Ga0207648_10017102 | 3300026089 | Bacteria | 6609 |
| 617 | Ga0207648_10027431 | 3300026089 | Bacteria | 5055 |
| 618 | Ga0207648_10091877 | 3300026089 | Unclassified | 2654 |
| 619 | Ga0207648_10227243 | 3300026089 | Unclassified | 1660 |
| 620 | Ga0207676_10091286 | 3300026095 | Bacteria | 2502 |
| 621 | Ga0207676_10480687 | 3300026095 | Bacteria | 1176 |
| 622 | Ga0207674_10003692 | 3300026116 | Bacteria | 18684 |
| 623 | Ga0207674_10005293 | 3300026116 | Bacteria | 15350 |
| 624 | Ga0207674_10007441 | 3300026116 | Bacteria | 12762 |
| 625 | Ga0207674_10021941 | 3300026116 | Bacteria | 6867 |
| 626 | Ga0207674_10198554 | 3300026116 | Bacteria | 1955 |
| 627 | Ga0207675_100342874 | 3300026118 | Unclassified | 1463 |
| 628 | Ga0207675_100343394 | 3300026118 | Unclassified | 1462 |
| 629 | Ga0207683_10016513 | 3300026121 | Bacteria | 6284 |
| 630 | Ga0207698_10055113 | 3300026142 | Bacteria | 3062 |
| 631 | Ga0207698_10153336 | 3300026142 | Bacteria | 2003 |
| 632 | Ga0207698_10236936 | 3300026142 | Unclassified | 1660 |
| 633 | Ga0207698_10311178 | 3300026142 | Unclassified | 1471 |
| 634 | Ga0207698_10485964 | 3300026142 | Unclassified | 1199 |
| 635 | Ga0210002_1011021 | 3300027617 | Bacteria | 1394 |
| 636 | Ga0209588_1000001 | 3300027671 | Bacteria | 705877 |
| 637 | Ga0209588_1007857 | 3300027671 | Bacteria | 3152 |
| 638 | Ga0209998_10032123 | 3300027717 | Unclassified | 1166 |
| 639 | Ga0207428_10000002 | 3300027907 | Bacteria | 854851 |
| 640 | Ga0207428_10007903 | 3300027907 | Bacteria | 9668 |
| 641 | Ga0207428_10352895 | 3300027907 | Bacteria | 1082 |
| 642 | Ga0265354_1000756 | 3300028016 | Bacteria | 5272 |
| 643 | Ga0265356_1000296 | 3300028017 | Bacteria | 9318 |
| 644 | Ga0268266_10010487 | 3300028379 | Bacteria | 8098 |
| 645 | Ga0268266_10046251 | 3300028379 | Bacteria | 3726 |
| 646 | Ga0268266_10159561 | 3300028379 | Bacteria | 2039 |
| 647 | Ga0268266_10786697 | 3300028379 | Bacteria | 919 |
| 648 | Ga0268265_10015036 | 3300028380 | Bacteria | 5286 |
| 649 | Ga0268265_10039405 | 3300028380 | Unclassified | 3483 |
| 650 | Ga0268264_10014069 | 3300028381 | Bacteria | 6577 |
| 651 | Ga0268264_10015954 | 3300028381 | Bacteria | 6154 |
| 652 | Ga0268264_10057936 | 3300028381 | Unclassified | 3242 |
| 653 | Ga0268264_10143586 | 3300028381 | Bacteria | 2132 |
| 654 | Ga0268264_10156666 | 3300028381 | Bacteria | 2047 |
| 655 | Ga0268264_10218100 | 3300028381 | Bacteria | 1755 |
| 656 | Ga0268264_10743142 | 3300028381 | Unclassified | 977 |
| 657 | Ga0265319_1032510 | 3300028563 | Bacteria | 1808 |
| 658 | Ga0265318_10005107 | 3300028577 | Bacteria | 6214 |
| 659 | Ga0265338_10013466 | 3300028800 | Bacteria | 9232 |
| 660 | Ga0265338_10037839 | 3300028800 | Unclassified | 4582 |
| 661 | Ga0265338_10212034 | 3300028800 | Bacteria | 1453 |
| 662 | Ga0265338_10270358 | 3300028800 | Unclassified | 1246 |
| 663 | Ga0265324_10057812 | 3300029957 | Unclassified | 1327 |
| 664 | Ga0265762_1000130 | 3300030760 | Bacteria | 11334 |
| 665 | Ga0265762_1026117 | 3300030760 | Unclassified | 1092 |
| 666 | Ga0265762_1028232 | 3300030760 | Bacteria | 1056 |
| 667 | Ga0265770_1000180 | 3300030878 | Bacteria | 8227 |
| 668 | Ga0265765_1000179 | 3300030879 | Bacteria | 4180 |
| 669 | Ga0265760_10001544 | 3300031090 | Bacteria | 6793 |
| 670 | Ga0265760_10010701 | 3300031090 | Bacteria | 2619 |
| 671 | Ga0265760_10011422 | 3300031090 | Bacteria | 2537 |
| 672 | Ga0265330_10000186 | 3300031235 | Bacteria | 48099 |
| 673 | Ga0265330_10000338 | 3300031235 | Bacteria | 33586 |
| 674 | Ga0265330_10038099 | 3300031235 | Bacteria | 2138 |
| 675 | Ga0265332_10005345 | 3300031238 | Bacteria | 5933 |
| 676 | Ga0265328_10003777 | 3300031239 | Bacteria | 6659 |
| 677 | Ga0265325_10000138 | 3300031241 | Bacteria | 50464 |
| 678 | Ga0265325_10002006 | 3300031241 | Bacteria | 13980 |
| 679 | Ga0265325_10073825 | 3300031241 | Bacteria | 1707 |
| 680 | Ga0265340_10002941 | 3300031247 | Bacteria | 9703 |
| 681 | Ga0265339_10001543 | 3300031249 | Bacteria | 17020 |
| 682 | Ga0265339_10004329 | 3300031249 | Bacteria | 9702 |
| 683 | Ga0265331_10012844 | 3300031250 | Bacteria | 4520 |
| 684 | Ga0265331_10090161 | 3300031250 | Bacteria | 1418 |
| 685 | Ga0265316_10000510 | 3300031344 | Bacteria | 43837 |
| 686 | Ga0265316_10000713 | 3300031344 | Bacteria | 36680 |
| 687 | Ga0265316_10005655 | 3300031344 | Bacteria | 12097 |
| 688 | Ga0265316_10006792 | 3300031344 | Bacteria | 10883 |
| 689 | Ga0265316_10014330 | 3300031344 | Bacteria | 6984 |
| 690 | Ga0265316_10019254 | 3300031344 | Bacteria | 5842 |
| 691 | Ga0265316_10082732 | 3300031344 | Bacteria | 2459 |
| 692 | Ga0265313_10002720 | 3300031595 | Bacteria | 14969 |
| 693 | Ga0265313_10003181 | 3300031595 | Bacteria | 13530 |
| 694 | Ga0265313_10006745 | 3300031595 | Bacteria | 8030 |
| 695 | Ga0265314_10000187 | 3300031711 | Bacteria | 92142 |
| 696 | Ga0265314_10000509 | 3300031711 | Bacteria | 50279 |
| 697 | Ga0265314_10022657 | 3300031711 | Bacteria | 4809 |
| 698 | Ga0265314_10033167 | 3300031711 | Bacteria | 3790 |
| 699 | Ga0265314_10150276 | 3300031711 | Unclassified | 1429 |
| 700 | Ga0265342_10000101 | 3300031712 | Bacteria | 94267 |
| 701 | Ga0265342_10006543 | 3300031712 | Bacteria | 8667 |
| 702 | Ga0265342_10039255 | 3300031712 | Unclassified | 2878 |
| 703 | Ga0265342_10045773 | 3300031712 | Unclassified | 2632 |
| 704 | Ga0316212_1001140 | 3300033547 | Bacteria | 3548 |
| 705 | Ga0316212_1009626 | 3300033547 | Bacteria | 1387 |
| 706 | Ga0373929_0024780 | 3300035085 | Bacteria | 1242 |
| 707 | Ga0373936_0003520 | 3300035113 | Bacteria | 5889 |
| 708 | Ga0373957_0070807 | 3300035120 | Bacteria | 1364 |
| 709 | Ga0373957_0072836 | 3300035120 | Unclassified | 1346 |
| 710 | Ga0373943_0043030 | 3300035170 | Bacteria | 2192 |
| 711 | Ga0373942_0031264 | 3300035207 | Bacteria | 1407 |
| 712 | Ga0373931_0048317 | 3300035691 | Bacteria | 2255 |
| 713 | Ga0373931_0152562 | 3300035691 | Unclassified | 1348 |
| 714 | Ga0373931_0236943 | 3300035691 | Bacteria | 1105 |
| 715 | Ga0373935_0061927 | 3300035692 | Bacteria | 2396 |
| 716 | Ga0373927_0064853 | 3300035695 | Unclassified | 2362 |
| 717 | Ga0373927_0093605 | 3300035695 | Bacteria | 1952 |
| 718 | Ga0373927_0134761 | 3300035695 | Bacteria | 1614 |
| 719 | Ga0373933_0421205 | 3300035724 | Bacteria | 872 |
| 720 | Ga0373947_0003055 | 3300035725 | Bacteria | 9956 |
| 721 | Ga0373947_0024378 | 3300035725 | Bacteria | 3525 |
| 722 | Ga0373937_0010129 | 3300036401 | Bacteria | 8223 |
| 723 | Ga0373937_0071265 | 3300036401 | Bacteria | 3205 |
| 724 | Ga0373925_0011956 | 3300037068 | Bacteria | 6282 |
| 725 | Ga0373925_0037190 | 3300037068 | Bacteria | 3593 |
| 726 | Ga0436364_0703870 | 3300037853 | Bacteria | 4877 |
| 727 | Ga0436364_1014577 | 3300037853 | Bacteria | 3723 |
| 728 | Ga0436365_1220175 | 3300039437 | Bacteria | 3205 |
| 729 | Ga0436360_1131923 | 3300039438 | Bacteria | 1450 |
| 730 | Ga0436363_1455988 | 3300039450 | Bacteria | 2122 |
| 731 | Ga0439446_0048630 | 3300042156 | Bacteria | 1263 |
| 732 | Ga0439434_0111942 | 3300042435 | Bacteria | 885 |
| 733 | Ga0439464_0019508 | 3300042439 | Bacteria | 1851 |
| 734 | Ga0451577_0128481 | 3300042876 | Unclassified | 2272 |
| 735 | Ga0453683_0002798 | 3300044673 | Bacteria | 13268 |
| 736 | Ga0453683_0006940 | 3300044673 | Bacteria | 7721 |
| 737 | Ga0453684_0022220 | 3300044712 | Bacteria | 9427 |
| 738 | Ga0451576_0039470 | 3300045051 | Bacteria | 4997 |
| 739 | Ga0451576_0319520 | 3300045051 | Unclassified | 1624 |
| 740 | Ga0495592_0354559 | 3300046454 | Unclassified | 940 |
| 741 | Ga0495580_0002181 | 3300046472 | Bacteria | 17133 |
| 742 | Ga0495580_0010201 | 3300046472 | Bacteria | 7333 |
| 743 | Ga0495580_0017341 | 3300046472 | Bacteria | 5386 |
| 744 | Ga0495580_0018437 | 3300046472 | Bacteria | 5195 |
| 745 | Ga0495580_0019663 | 3300046472 | Bacteria | 5015 |
| 746 | Ga0495580_0038512 | 3300046472 | Bacteria | 3424 |
| 747 | Ga0495580_0065487 | 3300046472 | Bacteria | 2545 |
| 748 | Ga0495582_0012347 | 3300046473 | Bacteria | 4705 |
| 749 | Ga0495639_0113809 | 3300046475 | Unclassified | 1286 |
| 750 | Ga0495664_0053165 | 3300046477 | Unclassified | 2409 |
| 751 | Ga0495608_0103142 | 3300046511 | Unclassified | 1838 |
| 752 | Ga0495628_0110112 | 3300046516 | Unclassified | 2119 |
| 753 | Ga0495630_0004015 | 3300046517 | Bacteria | 10297 |
| 754 | Ga0495630_0032428 | 3300046517 | Bacteria | 3893 |
| 755 | Ga0495630_0168703 | 3300046517 | Unclassified | 1667 |
| 756 | Ga0495665_0202636 | 3300046531 | Unclassified | 1028 |
| 757 | Ga0495621_0060175 | 3300046539 | Unclassified | 1377 |
| 758 | Ga0495597_0139863 | 3300046542 | Bacteria | 999 |
| 759 | Ga0495645_0002510 | 3300046543 | Bacteria | 12456 |
| 760 | Ga0495645_0030542 | 3300046543 | Bacteria | 3924 |
| 761 | Ga0495667_0129956 | 3300046559 | Unclassified | 1625 |
| 762 | Ga0495635_0076315 | 3300046663 | Bacteria | 2297 |
| 763 | Ga0495635_0094796 | 3300046663 | Bacteria | 2041 |
| 764 | Ga0495657_0102308 | 3300046675 | Unclassified | 1823 |
| 765 | Ga0495599_0080445 | 3300046678 | Bacteria | 2035 |
| 766 | Ga0495599_0151616 | 3300046678 | Bacteria | 1435 |
| 767 | Ga0495658_0206709 | 3300046683 | Unclassified | 1225 |
| 768 | Ga0495658_0444369 | 3300046683 | Unclassified | 828 |
| 769 | Ga0495613_0246119 | 3300046689 | Unclassified | 1249 |
| 770 | Ga0495624_0229335 | 3300046690 | Unclassified | 1125 |
| 771 | Ga0495600_0174794 | 3300046809 | Unclassified | 1385 |
| 772 | Ga0495636_0166160 | 3300047318 | Unclassified | 996 |
| 773 | Ga0495674_0007648 | 3300047319 | Bacteria | 10321 |
| 774 | Ga0495674_0032047 | 3300047319 | Bacteria | 4771 |
| 775 | Ga0495674_0304201 | 3300047319 | Bacteria | 1302 |
| 776 | Ga0495684_0008283 | 3300047471 | Bacteria | 8051 |
| 777 | Ga0495593_0054240 | 3300047673 | Unclassified | 2114 |
| 778 | Ga0495602_0323491 | 3300048088 | Bacteria | 1121 |
| 779 | Ga0496100_0006702 | 3300048903 | Bacteria | 6303 |
| 780 | Ga0496100_0144936 | 3300048903 | Bacteria | 1688 |
| 781 | Ga0496102_0031150 | 3300048905 | Bacteria | 4782 |
| 782 | Ga0496102_0050682 | 3300048905 | Unclassified | 3781 |
| 783 | Ga0496103_0001075 | 3300048906 | Bacteria | 19076 |
| 784 | Ga0496103_0152184 | 3300048906 | Bacteria | 1482 |
| 785 | Ga0496103_0196537 | 3300048906 | Unclassified | 1297 |
| 786 | Ga0496104_0007903 | 3300048907 | Bacteria | 9429 |
| 787 | Ga0496104_0091868 | 3300048907 | Bacteria | 2902 |
| 788 | Ga0496105_0005363 | 3300048908 | Bacteria | 9720 |
| 789 | Ga0496105_0040070 | 3300048908 | Bacteria | 3862 |
| 790 | Ga0496105_0073262 | 3300048908 | Bacteria | 2830 |
| 791 | Ga0496106_0105462 | 3300048909 | Bacteria | 2190 |
| 792 | Ga0496107_0100740 | 3300048910 | Bacteria | 2118 |
| 793 | Ga0496109_0368569 | 3300048912 | Unclassified | 1357 |
| 794 | Ga0496112_0001729 | 3300048915 | Bacteria | 17084 |
| 795 | Ga0496112_0060610 | 3300048915 | Unclassified | 3729 |
| 796 | Ga0496113_0225172 | 3300048916 | Bacteria | 1495 |
| 797 | Ga0496114_0149725 | 3300048917 | Bacteria | 2024 |
| 798 | Ga0496115_0002823 | 3300048918 | Bacteria | 12490 |
| 799 | Ga0496115_0006852 | 3300048918 | Bacteria | 8364 |
| 800 | Ga0496115_0438646 | 3300048918 | Unclassified | 1056 |
| 801 | Ga0501036_0016900 | 3300049572 | Bacteria | 6095 |
| 802 | Ga0501036_0175404 | 3300049572 | Bacteria | 1805 |
| 803 | Ga0501038_0068476 | 3300049574 | Bacteria | 3017 |
| 804 | Ga0501038_0214355 | 3300049574 | Unclassified | 1539 |
| 805 | Ga0501039_0102403 | 3300049575 | Bacteria | 2235 |
| 806 | Ga0501040_0008123 | 3300049576 | Bacteria | 6818 |
| 807 | Ga0501040_0018969 | 3300049576 | Bacteria | 4573 |
| 808 | Ga0501040_0089386 | 3300049576 | Bacteria | 2140 |
| 809 | Ga0501041_0005268 | 3300049577 | Bacteria | 7559 |
| 810 | Ga0501041_0010096 | 3300049577 | Bacteria | 5563 |
| 811 | Ga0501041_0036996 | 3300049577 | Bacteria | 2957 |
| 812 | Ga0501042_0021495 | 3300049578 | Bacteria | 4498 |
| 813 | Ga0501046_0052948 | 3300049580 | Bacteria | 3198 |
| 814 | Ga0501048_0020750 | 3300049582 | Bacteria | 4815 |
| 815 | Ga0501048_0104931 | 3300049582 | Bacteria | 1994 |
| 816 | Ga0501068_0158399 | 3300049584 | Bacteria | 1426 |
| 817 | Ga0501071_0036063 | 3300049587 | Bacteria | 3526 |
| 818 | Ga0501071_0045159 | 3300049587 | Bacteria | 3162 |
| 819 | Ga0501072_0210034 | 3300049588 | Bacteria | 1551 |
| 820 | Ga0501072_0213540 | 3300049588 | Unclassified | 1538 |
| 821 | Ga0501074_0106929 | 3300049590 | Bacteria | 2003 |
| 822 | Ga0501075_0018459 | 3300049591 | Bacteria | 5050 |
| 823 | Ga0501075_0021421 | 3300049591 | Bacteria | 4712 |
| 824 | Ga0501076_0029062 | 3300049592 | Bacteria | 4297 |
| 825 | Ga0501076_0063116 | 3300049592 | Bacteria | 2951 |
| 826 | Ga0501077_0033490 | 3300049593 | Bacteria | 3270 |
| 827 | Ga0501077_0047521 | 3300049593 | Bacteria | 2727 |
| 828 | Ga0501077_0301674 | 3300049593 | Unclassified | 1020 |
| 829 | Ga0501079_0012290 | 3300049741 | Bacteria | 6533 |
| 830 | Ga0501079_0016615 | 3300049741 | Bacteria | 5621 |
| 831 | Ga0501079_0113463 | 3300049741 | Bacteria | 2106 |
| 832 | Ga0501080_0050666 | 3300049742 | Bacteria | 3864 |
| 833 | Ga0501080_0091948 | 3300049742 | Bacteria | 2818 |
| 834 | Ga0501081_0004305 | 3300049743 | Bacteria | 9123 |
| 835 | Ga0501083_0300733 | 3300049744 | Bacteria | 1043 |
| 836 | Ga0501035_0546233 | 3300049822 | Bacteria | 949 |
| 837 | Ga0501045_0056312 | 3300049824 | Bacteria | 2875 |
| 838 | nmdc:mga05p37_171860_c1 | 3300050507 | Bacteria | 2643 |
| 839 | nmdc:mga05p37_47597_c1 | 3300050507 | Bacteria | 5273 |
| 840 | nmdc:mga05p37_559415_c1 | 3300050507 | Bacteria | 1300 |
| 841 | nmdc:mga05p37_7197_c1 | 3300050507 | Bacteria | 13125 |
| 842 | nmdc:mga09592_123251_c1 | 3300050508 | Bacteria | 2227 |
| 843 | nmdc:mga09592_33724_c1 | 3300050508 | Bacteria | 4276 |
| 844 | nmdc:mga09592_4883_c1 | 3300050508 | Bacteria | 10856 |
| 845 | nmdc:mga0qj67_269670_c1 | 3300050509 | Bacteria | 1380 |
| 846 | nmdc:mga0qj67_8621_c1 | 3300050509 | Bacteria | 7566 |
| 847 | nmdc:mga06r32_1387_c1 | 3300050510 | Bacteria | 21887 |
| 848 | nmdc:mga06r32_243651_c1 | 3300050510 | Bacteria | 1785 |
| 849 | nmdc:mga08y16_1110727_c1 | 3300050511 | Unclassified | 765 |
| 850 | nmdc:mga08y16_122205_c1 | 3300050511 | Unclassified | 2710 |
| 851 | nmdc:mga08y16_3_c1 | 3300050511 | Bacteria | 936907 |
| 852 | nmdc:mga08y16_69678_c1 | 3300050511 | Bacteria | 3666 |
| 853 | nmdc:mga0n895_100643_c1 | 3300050512 | Unclassified | 2899 |
| 854 | nmdc:mga0n895_124865_c1 | 3300050512 | Bacteria | 2597 |
| 855 | nmdc:mga0n895_19099_c1 | 3300050512 | Bacteria | 6363 |
| 856 | nmdc:mga0n895_356757_c1 | 3300050512 | Unclassified | 1481 |
| 857 | nmdc:mga0n895_379390_c1 | 3300050512 | Bacteria | 1431 |
| 858 | nmdc:mga0n895_586130_c1 | 3300050512 | Bacteria | 1119 |
| 859 | nmdc:mga0rr50_107149_c1 | 3300050513 | Bacteria | 2206 |
| 860 | nmdc:mga0rr50_126767_c1 | 3300050513 | Bacteria | 2039 |
| 861 | nmdc:mga0rr50_423943_c1 | 3300050513 | Unclassified | 1126 |
| 862 | nmdc:mga0rr50_65112_c1 | 3300050513 | Bacteria | 2760 |
| 863 | nmdc:mga0a205_132888_c1 | 3300050515 | Bacteria | 2389 |
| 864 | nmdc:mga0a205_518313_c1 | 3300050515 | Bacteria | 1049 |
| 865 | nmdc:mga0a205_7765_c1 | 3300050515 | Bacteria | 9738 |
| 866 | Ga0501084_0027810 | 3300054114 | Bacteria | 4726 |
| 867 | Ga0501084_0294060 | 3300054114 | Bacteria | 1371 |
| 868 | Ga0590071_005999 | 3300059421 | Bacteria | 2906 |
| 869 | Ga0590077_002674 | 3300059426 | Bacteria | 3766 |
| 870 | Ga0587128_011851 | 3300059630 | Bacteria | 1200 |
| 871 | Ga0501082_0011799 | 3300060353 | Bacteria | 7512 |
| 872 | Ga0501082_0165990 | 3300060353 | Bacteria | 1919 |
| 873 | Ga0530510_0001309 | 3300061734 | Bacteria | 16633 |
| 874 | Ga0530510_0100901 | 3300061734 | Bacteria | 2110 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042156 | Ga0439446_0048630 | Ga0439446_0048630_626_1243 | 202 |
| 2 | 3300005471 | Ga0070698_100029720 | Ga0070698_1000297203 | 232 |
| 3 | 3300050511 | nmdc:mga08y16_1110727_c1 | nmdc:mga08y16_1110727_c1_19_732 | 232 |
| 4 | 3300046516 | Ga0495628_0110112 | Ga0495628_0110112_1358_2083 | 234 |
| 5 | 3300046543 | Ga0495645_0030542 | Ga0495645_0030542_2670_3395 | 234 |
| 6 | 3300010159 | Ga0099796_10081935 | Ga0099796_100819352 | 236 |
| 7 | 3300026067 | Ga0207678_10535645 | Ga0207678_105356451 | 236 |
| 8 | 3300005434 | Ga0070709_10330327 | Ga0070709_103303272 | 237 |
| 9 | 3300037068 | Ga0373925_0011956 | Ga0373925_0011956_5527_6255 | 239 |
| 10 | 3300046542 | Ga0495597_0139863 | Ga0495597_0139863_152_883 | 239 |
| 11 | 3300048918 | Ga0496115_0438646 | Ga0496115_0438646_304_1032 | 239 |
| 12 | 3300009098 | Ga0105245_10162821 | Ga0105245_101628213 | 245 |
| 13 | 3300009101 | Ga0105247_10068712 | Ga0105247_100687124 | 245 |
| 14 | 3300009176 | Ga0105242_10058932 | Ga0105242_100589323 | 245 |
| 15 | 3300009177 | Ga0105248_10007399 | Ga0105248_1000739911 | 245 |
| 16 | 3300013306 | Ga0163162_10212687 | Ga0163162_102126872 | 245 |
| 17 | 3300014325 | Ga0163163_10002052 | Ga0163163_100020522 | 245 |
| 18 | 3300014968 | Ga0157379_10009128 | Ga0157379_100091285 | 245 |
| 19 | 3300014969 | Ga0157376_10007509 | Ga0157376_100075098 | 245 |
| 20 | 3300005617 | Ga0068859_100244765 | Ga0068859_1002447652 | 246 |
| 21 | 3300006931 | Ga0097620_100244732 | Ga0097620_1002447322 | 246 |
| 22 | 3300009093 | Ga0105240_10111346 | Ga0105240_101113463 | 246 |
| 23 | 3300009176 | Ga0105242_10149562 | Ga0105242_101495623 | 246 |
| 24 | 3300009545 | Ga0105237_10067340 | Ga0105237_100673406 | 246 |
| 25 | 3300009551 | Ga0105238_10004737 | Ga0105238_100047372 | 246 |
| 26 | 3300014969 | Ga0157376_10400085 | Ga0157376_104000853 | 246 |
| 27 | 3300025942 | Ga0207689_10146344 | Ga0207689_101463442 | 246 |
| 28 | 3300042435 | Ga0439434_0111942 | Ga0439434_0111942_17_772 | 246 |
| 29 | 3300009098 | Ga0105245_10098891 | Ga0105245_100988912 | 247 |
| 30 | 3300046663 | Ga0495635_0094796 | Ga0495635_0094796_920_1666 | 248 |
| 31 | 3300035691 | Ga0373931_0236943 | Ga0373931_0236943_291_1049 | 249 |
| 32 | 3300035725 | Ga0373947_0003055 | Ga0373947_0003055_2618_3373 | 250 |
| 33 | 3300046683 | Ga0495658_0444369 | Ga0495658_0444369_13_792 | 252 |
| 34 | 3300007265 | Ga0099794_10000004 | Ga0099794_100000043 | 253 |
| 35 | 3300036401 | Ga0373937_0071265 | Ga0373937_0071265_474_1253 | 253 |
| 36 | 3300049572 | Ga0501036_0175404 | Ga0501036_0175404_980_1795 | 253 |
| 37 | 3300049574 | Ga0501038_0214355 | Ga0501038_0214355_161_976 | 253 |
| 38 | 3300049576 | Ga0501040_0089386 | Ga0501040_0089386_938_1753 | 253 |
| 39 | 3300049577 | Ga0501041_0036996 | Ga0501041_0036996_743_1558 | 253 |
| 40 | 3300049587 | Ga0501071_0045159 | Ga0501071_0045159_1414_2229 | 253 |
| 41 | 3300049591 | Ga0501075_0021421 | Ga0501075_0021421_3231_4046 | 253 |
| 42 | 3300049592 | Ga0501076_0029062 | Ga0501076_0029062_3157_3972 | 253 |
| 43 | 3300049593 | Ga0501077_0047521 | Ga0501077_0047521_96_911 | 253 |
| 44 | 3300049741 | Ga0501079_0016615 | Ga0501079_0016615_4184_4999 | 253 |
| 45 | 3300049742 | Ga0501080_0091948 | Ga0501080_0091948_475_1290 | 253 |
| 46 | 3300049743 | Ga0501081_0004305 | Ga0501081_0004305_4064_4879 | 253 |
| 47 | 3300054114 | Ga0501084_0027810 | Ga0501084_0027810_165_980 | 253 |
| 48 | 3300035120 | Ga0373957_0072836 | Ga0373957_0072836_29_811 | 257 |
| 49 | 3300035695 | Ga0373927_0064853 | Ga0373927_0064853_376_1158 | 257 |
| 50 | 3300035724 | Ga0373933_0421205 | Ga0373933_0421205_32_814 | 257 |
| 51 | 3300036401 | Ga0373937_0010129 | Ga0373937_0010129_1986_2768 | 257 |
| 52 | 3300046472 | Ga0495580_0017341 | Ga0495580_0017341_3964_4746 | 257 |
| 53 | 3300046559 | Ga0495667_0129956 | Ga0495667_0129956_359_1141 | 257 |
| 54 | 3300047471 | Ga0495684_0008283 | Ga0495684_0008283_4234_5016 | 257 |
| 55 | 3300048088 | Ga0495602_0323491 | Ga0495602_0323491_142_924 | 257 |
| 56 | 3300028379 | Ga0268266_10159561 | Ga0268266_101595612 | 258 |
| 57 | 3300047319 | Ga0495674_0304201 | Ga0495674_0304201_245_1036 | 258 |
| 58 | 3300035695 | Ga0373927_0134761 | Ga0373927_0134761_154_954 | 261 |
| 59 | 3300046454 | Ga0495592_0354559 | Ga0495592_0354559_48_854 | 261 |
| 60 | 3300009094 | Ga0111539_10040991 | Ga0111539_100409914 | 263 |
| 61 | 3300046678 | Ga0495599_0151616 | Ga0495599_0151616_182_982 | 263 |
| 62 | 3300050512 | nmdc:mga0n895_586130_c1 | nmdc:mga0n895_586130_c1_78_878 | 263 |
| 63 | 3300050513 | nmdc:mga0rr50_65112_c1 | nmdc:mga0rr50_65112_c1_1915_2715 | 263 |
| 64 | 3300045051 | Ga0451576_0319520 | Ga0451576_0319520_656_1468 | 265 |
| 65 | 3300028563 | Ga0265319_1032510 | Ga0265319_10325102 | 267 |
| 66 | 3300028800 | Ga0265338_10037839 | Ga0265338_100378394 | 267 |
| 67 | 3300049593 | Ga0501077_0301674 | Ga0501077_0301674_183_1001 | 267 |
| 68 | 3300005335 | Ga0070666_10081609 | Ga0070666_100816092 | 268 |
| 69 | 3300005367 | Ga0070667_100022899 | Ga0070667_1000228993 | 268 |
| 70 | 3300005439 | Ga0070711_100048775 | Ga0070711_1000487751 | 268 |
| 71 | 3300005842 | Ga0068858_100022353 | Ga0068858_1000223532 | 268 |
| 72 | 3300005843 | Ga0068860_100019110 | Ga0068860_1000191105 | 268 |
| 73 | 3300006237 | Ga0097621_100009420 | Ga0097621_10000942012 | 268 |
| 74 | 3300006358 | Ga0068871_100030112 | Ga0068871_1000301122 | 268 |
| 75 | 3300025903 | Ga0207680_10034965 | Ga0207680_100349654 | 268 |
| 76 | 3300025906 | Ga0207699_10012408 | Ga0207699_100124083 | 268 |
| 77 | 3300025927 | Ga0207687_10030526 | Ga0207687_100305263 | 268 |
| 78 | 3300025934 | Ga0207686_10067254 | Ga0207686_100672542 | 268 |
| 79 | 3300025941 | Ga0207711_10096175 | Ga0207711_100961755 | 268 |
| 80 | 3300025986 | Ga0207658_10054958 | Ga0207658_100549582 | 268 |
| 81 | 3300026023 | Ga0207677_10022255 | Ga0207677_100222552 | 268 |
| 82 | 3300026035 | Ga0207703_10041828 | Ga0207703_100418286 | 268 |
| 83 | 3300026095 | Ga0207676_10091286 | Ga0207676_100912862 | 268 |
| 84 | 3300028381 | Ga0268264_10014069 | Ga0268264_100140695 | 268 |
| 85 | 3300031241 | Ga0265325_10073825 | Ga0265325_100738252 | 268 |
| 86 | 3300005329 | Ga0070683_100184188 | Ga0070683_1001841882 | 269 |
| 87 | 3300005356 | Ga0070674_100222104 | Ga0070674_1002221042 | 269 |
| 88 | 3300005535 | Ga0070684_100052651 | Ga0070684_1000526513 | 269 |
| 89 | 3300005548 | Ga0070665_100206334 | Ga0070665_1002063342 | 269 |
| 90 | 3300005563 | Ga0068855_100285841 | Ga0068855_1002858412 | 269 |
| 91 | 3300005564 | Ga0070664_100031470 | Ga0070664_1000314707 | 269 |
| 92 | 3300006358 | Ga0068871_100231032 | Ga0068871_1002310322 | 269 |
| 93 | 3300006881 | Ga0068865_100199277 | Ga0068865_1001992773 | 269 |
| 94 | 3300009093 | Ga0105240_10551647 | Ga0105240_105516472 | 269 |
| 95 | 3300025913 | Ga0207695_10284783 | Ga0207695_102847832 | 269 |
| 96 | 3300025924 | Ga0207694_10004655 | Ga0207694_100046558 | 269 |
| 97 | 3300025934 | Ga0207686_10092920 | Ga0207686_100929202 | 269 |
| 98 | 3300025937 | Ga0207669_10171747 | Ga0207669_101717472 | 269 |
| 99 | 3300025944 | Ga0207661_10040859 | Ga0207661_100408593 | 269 |
| 100 | 3300025945 | Ga0207679_10166851 | Ga0207679_101668512 | 269 |
| 101 | 3300031344 | Ga0265316_10082732 | Ga0265316_100827322 | 269 |
| 102 | 3300004803 | Ga0058862_12893689 | Ga0058862_128936891 | 270 |
| 103 | 3300013102 | Ga0157371_10089236 | Ga0157371_100892362 | 270 |
| 104 | 3300013296 | Ga0157374_10000454 | Ga0157374_1000045416 | 270 |
| 105 | 3300013297 | Ga0157378_10000899 | Ga0157378_1000089914 | 270 |
| 106 | 3300013307 | Ga0157372_10000845 | Ga0157372_100008458 | 270 |
| 107 | 3300014325 | Ga0163163_10189496 | Ga0163163_101894962 | 270 |
| 108 | 3300014969 | Ga0157376_10013169 | Ga0157376_100131693 | 270 |
| 109 | 3300035691 | Ga0373931_0152562 | Ga0373931_0152562_172_993 | 270 |
| 110 | 3300039438 | Ga0436360_1131923 | Ga0436360_1131923_321_1163 | 270 |
| 111 | 3300048912 | Ga0496109_0368569 | Ga0496109_0368569_134_955 | 270 |
| 112 | 3300005327 | Ga0070658_10062010 | Ga0070658_100620104 | 271 |
| 113 | 3300005339 | Ga0070660_100007571 | Ga0070660_1000075719 | 271 |
| 114 | 3300005355 | Ga0070671_100190221 | Ga0070671_1001902212 | 271 |
| 115 | 3300005367 | Ga0070667_100264587 | Ga0070667_1002645872 | 271 |
| 116 | 3300005547 | Ga0070693_100194275 | Ga0070693_1001942752 | 271 |
| 117 | 3300005548 | Ga0070665_100057610 | Ga0070665_1000576103 | 271 |
| 118 | 3300005563 | Ga0068855_100210802 | Ga0068855_1002108022 | 271 |
| 119 | 3300005577 | Ga0068857_100004869 | Ga0068857_1000048693 | 271 |
| 120 | 3300005578 | Ga0068854_100262646 | Ga0068854_1002626462 | 271 |
| 121 | 3300005614 | Ga0068856_100101664 | Ga0068856_1001016642 | 271 |
| 122 | 3300005614 | Ga0068856_100202497 | Ga0068856_1002024973 | 271 |
| 123 | 3300005617 | Ga0068859_100108684 | Ga0068859_1001086843 | 271 |
| 124 | 3300005618 | Ga0068864_100312002 | Ga0068864_1003120022 | 271 |
| 125 | 3300005841 | Ga0068863_100033688 | Ga0068863_1000336885 | 271 |
| 126 | 3300005842 | Ga0068858_100010263 | Ga0068858_1000102632 | 271 |
| 127 | 3300006237 | Ga0097621_100266673 | Ga0097621_1002666732 | 271 |
| 128 | 3300006237 | Ga0097621_100277933 | Ga0097621_1002779332 | 271 |
| 129 | 3300006358 | Ga0068871_100140356 | Ga0068871_1001403562 | 271 |
| 130 | 3300006931 | Ga0097620_100108683 | Ga0097620_1001086833 | 271 |
| 131 | 3300009093 | Ga0105240_10361382 | Ga0105240_103613822 | 271 |
| 132 | 3300009098 | Ga0105245_10012860 | Ga0105245_100128607 | 271 |
| 133 | 3300009098 | Ga0105245_10335104 | Ga0105245_103351042 | 271 |
| 134 | 3300009101 | Ga0105247_10049958 | Ga0105247_100499584 | 271 |
| 135 | 3300009147 | Ga0114129_10041222 | Ga0114129_100412225 | 271 |
| 136 | 3300009148 | Ga0105243_10073335 | Ga0105243_100733352 | 271 |
| 137 | 3300009176 | Ga0105242_10060759 | Ga0105242_100607594 | 271 |
| 138 | 3300009176 | Ga0105242_10442034 | Ga0105242_104420342 | 271 |
| 139 | 3300009176 | Ga0105242_10584148 | Ga0105242_105841482 | 271 |
| 140 | 3300009177 | Ga0105248_10040731 | Ga0105248_100407312 | 271 |
| 141 | 3300009551 | Ga0105238_10173179 | Ga0105238_101731792 | 271 |
| 142 | 3300009551 | Ga0105238_10178013 | Ga0105238_101780132 | 271 |
| 143 | 3300013100 | Ga0157373_10176975 | Ga0157373_101769752 | 271 |
| 144 | 3300013105 | Ga0157369_10095136 | Ga0157369_100951364 | 271 |
| 145 | 3300013296 | Ga0157374_10194908 | Ga0157374_101949082 | 271 |
| 146 | 3300013297 | Ga0157378_10284000 | Ga0157378_102840002 | 271 |
| 147 | 3300013297 | Ga0157378_10335073 | Ga0157378_103350732 | 271 |
| 148 | 3300013306 | Ga0163162_10130609 | Ga0163162_101306091 | 271 |
| 149 | 3300013307 | Ga0157372_10627000 | Ga0157372_106270002 | 271 |
| 150 | 3300014325 | Ga0163163_10001395 | Ga0163163_100013953 | 271 |
| 151 | 3300014325 | Ga0163163_10258435 | Ga0163163_102584352 | 271 |
| 152 | 3300020069 | Ga0197907_10419767 | Ga0197907_104197673 | 271 |
| 153 | 3300020070 | Ga0206356_11376450 | Ga0206356_113764502 | 271 |
| 154 | 3300020610 | Ga0154015_1324747 | Ga0154015_13247472 | 271 |
| 155 | 3300022467 | Ga0224712_10006852 | Ga0224712_100068522 | 271 |
| 156 | 3300025900 | Ga0207710_10018239 | Ga0207710_100182393 | 271 |
| 157 | 3300025903 | Ga0207680_10208864 | Ga0207680_102088642 | 271 |
| 158 | 3300025909 | Ga0207705_10234245 | Ga0207705_102342452 | 271 |
| 159 | 3300025912 | Ga0207707_10269601 | Ga0207707_102696012 | 271 |
| 160 | 3300025913 | Ga0207695_10008675 | Ga0207695_100086752 | 271 |
| 161 | 3300025919 | Ga0207657_10000386 | Ga0207657_1000038620 | 271 |
| 162 | 3300025924 | Ga0207694_10005997 | Ga0207694_100059973 | 271 |
| 163 | 3300025924 | Ga0207694_10224683 | Ga0207694_102246832 | 271 |
| 164 | 3300025927 | Ga0207687_10045413 | Ga0207687_100454133 | 271 |
| 165 | 3300025931 | Ga0207644_10067598 | Ga0207644_100675982 | 271 |
| 166 | 3300025935 | Ga0207709_10205382 | Ga0207709_102053822 | 271 |
| 167 | 3300025941 | Ga0207711_10044184 | Ga0207711_100441842 | 271 |
| 168 | 3300025949 | Ga0207667_10007820 | Ga0207667_1000782016 | 271 |
| 169 | 3300026023 | Ga0207677_10011911 | Ga0207677_100119112 | 271 |
| 170 | 3300026035 | Ga0207703_10023202 | Ga0207703_100232022 | 271 |
| 171 | 3300026041 | Ga0207639_10460422 | Ga0207639_104604222 | 271 |
| 172 | 3300026078 | Ga0207702_10019362 | Ga0207702_100193622 | 271 |
| 173 | 3300026078 | Ga0207702_10220425 | Ga0207702_102204252 | 271 |
| 174 | 3300026088 | Ga0207641_10032728 | Ga0207641_100327285 | 271 |
| 175 | 3300026089 | Ga0207648_10227243 | Ga0207648_102272433 | 271 |
| 176 | 3300026116 | Ga0207674_10007441 | Ga0207674_100074418 | 271 |
| 177 | 3300026142 | Ga0207698_10153336 | Ga0207698_101533363 | 271 |
| 178 | 3300026142 | Ga0207698_10485964 | Ga0207698_104859642 | 271 |
| 179 | 3300028379 | Ga0268266_10010487 | Ga0268266_100104873 | 271 |
| 180 | 3300031344 | Ga0265316_10005655 | Ga0265316_100056555 | 271 |
| 181 | 3300050507 | nmdc:mga05p37_7197_c1 | nmdc:mga05p37_7197_c1_1036_1860 | 271 |
| 182 | 3300050515 | nmdc:mga0a205_132888_c1 | nmdc:mga0a205_132888_c1_90_914 | 271 |
| 183 | 3300005293 | Ga0065715_10202023 | Ga0065715_102020231 | 272 |
| 184 | 3300005295 | Ga0065707_10141144 | Ga0065707_101411441 | 272 |
| 185 | 3300005328 | Ga0070676_10006587 | Ga0070676_100065876 | 272 |
| 186 | 3300005330 | Ga0070690_100319347 | Ga0070690_1003193471 | 272 |
| 187 | 3300005340 | Ga0070689_100591184 | Ga0070689_1005911841 | 272 |
| 188 | 3300005344 | Ga0070661_100104396 | Ga0070661_1001043961 | 272 |
| 189 | 3300005353 | Ga0070669_100069318 | Ga0070669_1000693183 | 272 |
| 190 | 3300005354 | Ga0070675_100182597 | Ga0070675_1001825972 | 272 |
| 191 | 3300005354 | Ga0070675_100685783 | Ga0070675_1006857831 | 272 |
| 192 | 3300005355 | Ga0070671_100288357 | Ga0070671_1002883572 | 272 |
| 193 | 3300005355 | Ga0070671_100504202 | Ga0070671_1005042021 | 272 |
| 194 | 3300005364 | Ga0070673_100115554 | Ga0070673_1001155543 | 272 |
| 195 | 3300005543 | Ga0070672_100009432 | Ga0070672_1000094321 | 272 |
| 196 | 3300005564 | Ga0070664_100008247 | Ga0070664_1000082477 | 272 |
| 197 | 3300005617 | Ga0068859_100090622 | Ga0068859_1000906223 | 272 |
| 198 | 3300005840 | Ga0068870_10000348 | Ga0068870_100003485 | 272 |
| 199 | 3300005842 | Ga0068858_100122376 | Ga0068858_1001223763 | 272 |
| 200 | 3300005843 | Ga0068860_100022312 | Ga0068860_1000223122 | 272 |
| 201 | 3300005844 | Ga0068862_100006825 | Ga0068862_1000068254 | 272 |
| 202 | 3300006852 | Ga0075433_10012263 | Ga0075433_100122632 | 272 |
| 203 | 3300006871 | Ga0075434_100321623 | Ga0075434_1003216232 | 272 |
| 204 | 3300006931 | Ga0097620_100090624 | Ga0097620_1000906243 | 272 |
| 205 | 3300007076 | Ga0075435_100047786 | Ga0075435_1000477862 | 272 |
| 206 | 3300009094 | Ga0111539_10015323 | Ga0111539_100153237 | 272 |
| 207 | 3300009553 | Ga0105249_10016331 | Ga0105249_100163313 | 272 |
| 208 | 3300011119 | Ga0105246_10016519 | Ga0105246_100165192 | 272 |
| 209 | 3300013306 | Ga0163162_10005742 | Ga0163162_100057427 | 272 |
| 210 | 3300013308 | Ga0157375_10484537 | Ga0157375_104845372 | 272 |
| 211 | 3300014326 | Ga0157380_10338964 | Ga0157380_103389641 | 272 |
| 212 | 3300014968 | Ga0157379_10019460 | Ga0157379_100194603 | 272 |
| 213 | 3300017792 | Ga0163161_10167644 | Ga0163161_101676442 | 272 |
| 214 | 3300025315 | Ga0207697_10001180 | Ga0207697_100011802 | 272 |
| 215 | 3300025893 | Ga0207682_10015653 | Ga0207682_100156533 | 272 |
| 216 | 3300025901 | Ga0207688_10062886 | Ga0207688_100628862 | 272 |
| 217 | 3300025903 | Ga0207680_10024840 | Ga0207680_100248402 | 272 |
| 218 | 3300025907 | Ga0207645_10004591 | Ga0207645_100045915 | 272 |
| 219 | 3300025908 | Ga0207643_10001054 | Ga0207643_100010547 | 272 |
| 220 | 3300025918 | Ga0207662_10009381 | Ga0207662_100093813 | 272 |
| 221 | 3300025923 | Ga0207681_10100408 | Ga0207681_101004082 | 272 |
| 222 | 3300025926 | Ga0207659_10002882 | Ga0207659_100028826 | 272 |
| 223 | 3300025926 | Ga0207659_10490221 | Ga0207659_104902211 | 272 |
| 224 | 3300025927 | Ga0207687_10301170 | Ga0207687_103011702 | 272 |
| 225 | 3300025931 | Ga0207644_10389640 | Ga0207644_103896402 | 272 |
| 226 | 3300025932 | Ga0207690_10070683 | Ga0207690_100706832 | 272 |
| 227 | 3300025936 | Ga0207670_10182863 | Ga0207670_101828632 | 272 |
| 228 | 3300025936 | Ga0207670_10294140 | Ga0207670_102941402 | 272 |
| 229 | 3300025942 | Ga0207689_10004152 | Ga0207689_100041529 | 272 |
| 230 | 3300025960 | Ga0207651_10265793 | Ga0207651_102657931 | 272 |
| 231 | 3300025960 | Ga0207651_10493219 | Ga0207651_104932192 | 272 |
| 232 | 3300025961 | Ga0207712_10052395 | Ga0207712_100523951 | 272 |
| 233 | 3300026023 | Ga0207677_10022193 | Ga0207677_100221933 | 272 |
| 234 | 3300026088 | Ga0207641_10009846 | Ga0207641_100098462 | 272 |
| 235 | 3300027617 | Ga0210002_1011021 | Ga0210002_10110211 | 272 |
| 236 | 3300027717 | Ga0209998_10032123 | Ga0209998_100321232 | 272 |
| 237 | 3300027907 | Ga0207428_10007903 | Ga0207428_100079037 | 272 |
| 238 | 3300028380 | Ga0268265_10039405 | Ga0268265_100394053 | 272 |
| 239 | 3300028381 | Ga0268264_10057936 | Ga0268264_100579363 | 272 |
| 240 | 3300050508 | nmdc:mga09592_33724_c1 | nmdc:mga09592_33724_c1_818_1651 | 272 |
| 241 | 3300050511 | nmdc:mga08y16_122205_c1 | nmdc:mga08y16_122205_c1_1403_2236 | 272 |
| 242 | 3300050512 | nmdc:mga0n895_356757_c1 | nmdc:mga0n895_356757_c1_245_1078 | 272 |
| 243 | 3300050513 | nmdc:mga0rr50_423943_c1 | nmdc:mga0rr50_423943_c1_92_925 | 272 |
| 244 | 3300050515 | nmdc:mga0a205_7765_c1 | nmdc:mga0a205_7765_c1_3312_4145 | 272 |
| 245 | 3300005364 | Ga0070673_100060792 | Ga0070673_1000607924 | 273 |
| 246 | 3300006844 | Ga0075428_100001864 | Ga0075428_10000186415 | 273 |
| 247 | 3300006846 | Ga0075430_100001987 | Ga0075430_10000198713 | 273 |
| 248 | 3300006847 | Ga0075431_100002526 | Ga0075431_1000025263 | 273 |
| 249 | 3300006880 | Ga0075429_100001764 | Ga0075429_10000176413 | 273 |
| 250 | 3300009093 | Ga0105240_10096117 | Ga0105240_100961172 | 273 |
| 251 | 3300009553 | Ga0105249_10444304 | Ga0105249_104443042 | 273 |
| 252 | 3300025893 | Ga0207682_10088430 | Ga0207682_100884302 | 273 |
| 253 | 3300025940 | Ga0207691_10286296 | Ga0207691_102862961 | 273 |
| 254 | 3300025960 | Ga0207651_10158464 | Ga0207651_101584643 | 273 |
| 255 | 3300025961 | Ga0207712_10044134 | Ga0207712_100441344 | 273 |
| 256 | 3300031344 | Ga0265316_10019254 | Ga0265316_100192543 | 273 |
| 257 | 3300039450 | Ga0436363_1455988 | Ga0436363_1455988_30_863 | 273 |
| 258 | 3300046472 | Ga0495580_0065487 | Ga0495580_0065487_788_1612 | 273 |
| 259 | 3300046475 | Ga0495639_0113809 | Ga0495639_0113809_405_1241 | 273 |
| 260 | 3300046531 | Ga0495665_0202636 | Ga0495665_0202636_39_863 | 273 |
| 261 | 3300049572 | Ga0501036_0016900 | Ga0501036_0016900_4857_5693 | 273 |
| 262 | 3300049576 | Ga0501040_0008123 | Ga0501040_0008123_324_1160 | 273 |
| 263 | 3300049577 | Ga0501041_0005268 | Ga0501041_0005268_6232_7068 | 273 |
| 264 | 3300049582 | Ga0501048_0020750 | Ga0501048_0020750_2561_3397 | 273 |
| 265 | 3300049584 | Ga0501068_0158399 | Ga0501068_0158399_314_1150 | 273 |
| 266 | 3300049587 | Ga0501071_0036063 | Ga0501071_0036063_25_861 | 273 |
| 267 | 3300049588 | Ga0501072_0210034 | Ga0501072_0210034_513_1349 | 273 |
| 268 | 3300049590 | Ga0501074_0106929 | Ga0501074_0106929_304_1140 | 273 |
| 269 | 3300049592 | Ga0501076_0063116 | Ga0501076_0063116_552_1388 | 273 |
| 270 | 3300049593 | Ga0501077_0033490 | Ga0501077_0033490_2102_2938 | 273 |
| 271 | 3300049741 | Ga0501079_0012290 | Ga0501079_0012290_2378_3214 | 273 |
| 272 | 3300049742 | Ga0501080_0050666 | Ga0501080_0050666_2713_3549 | 273 |
| 273 | 3300049822 | Ga0501035_0546233 | Ga0501035_0546233_62_898 | 273 |
| 274 | 3300049824 | Ga0501045_0056312 | Ga0501045_0056312_904_1740 | 273 |
| 275 | 3300050508 | nmdc:mga09592_4883_c1 | nmdc:mga09592_4883_c1_3875_4711 | 273 |
| 276 | 3300050509 | nmdc:mga0qj67_8621_c1 | nmdc:mga0qj67_8621_c1_5084_5920 | 273 |
| 277 | 3300050510 | nmdc:mga06r32_1387_c1 | nmdc:mga06r32_1387_c1_8122_8958 | 273 |
| 278 | 3300050512 | nmdc:mga0n895_19099_c1 | nmdc:mga0n895_19099_c1_166_1029 | 273 |
| 279 | 3300054114 | Ga0501084_0294060 | Ga0501084_0294060_190_1026 | 273 |
| 280 | 3300060353 | Ga0501082_0011799 | Ga0501082_0011799_3378_4214 | 273 |
| 281 | 3300061734 | Ga0530510_0100901 | Ga0530510_0100901_1206_2042 | 273 |
| 282 | 3300005290 | Ga0065712_10032483 | Ga0065712_100324831 | 274 |
| 283 | 3300005295 | Ga0065707_10093911 | Ga0065707_100939112 | 274 |
| 284 | 3300005336 | Ga0070680_100174634 | Ga0070680_1001746341 | 274 |
| 285 | 3300005343 | Ga0070687_100125767 | Ga0070687_1001257672 | 274 |
| 286 | 3300005354 | Ga0070675_100000739 | Ga0070675_1000007395 | 274 |
| 287 | 3300005356 | Ga0070674_100030121 | Ga0070674_1000301212 | 274 |
| 288 | 3300005445 | Ga0070708_100003651 | Ga0070708_1000036515 | 274 |
| 289 | 3300005459 | Ga0068867_100285494 | Ga0068867_1002854941 | 274 |
| 290 | 3300005467 | Ga0070706_100011620 | Ga0070706_1000116205 | 274 |
| 291 | 3300005468 | Ga0070707_100019771 | Ga0070707_1000197714 | 274 |
| 292 | 3300005471 | Ga0070698_100005969 | Ga0070698_10000596910 | 274 |
| 293 | 3300005518 | Ga0070699_100005358 | Ga0070699_1000053583 | 274 |
| 294 | 3300005536 | Ga0070697_100016125 | Ga0070697_1000161256 | 274 |
| 295 | 3300005719 | Ga0068861_100237621 | Ga0068861_1002376213 | 274 |
| 296 | 3300005842 | Ga0068858_100001351 | Ga0068858_1000013515 | 274 |
| 297 | 3300005842 | Ga0068858_100059537 | Ga0068858_1000595374 | 274 |
| 298 | 3300006844 | Ga0075428_100000023 | Ga0075428_10000002333 | 274 |
| 299 | 3300006846 | Ga0075430_100291878 | Ga0075430_1002918782 | 274 |
| 300 | 3300006880 | Ga0075429_100061268 | Ga0075429_1000612684 | 274 |
| 301 | 3300006880 | Ga0075429_100102080 | Ga0075429_1001020803 | 274 |
| 302 | 3300009094 | Ga0111539_10000001 | Ga0111539_10000001706 | 274 |
| 303 | 3300009094 | Ga0111539_10163892 | Ga0111539_101638922 | 274 |
| 304 | 3300009101 | Ga0105247_10193098 | Ga0105247_101930982 | 274 |
| 305 | 3300009101 | Ga0105247_10237369 | Ga0105247_102373692 | 274 |
| 306 | 3300009147 | Ga0114129_10030545 | Ga0114129_100305458 | 274 |
| 307 | 3300009176 | Ga0105242_10236136 | Ga0105242_102361362 | 274 |
| 308 | 3300009176 | Ga0105242_10340332 | Ga0105242_103403323 | 274 |
| 309 | 3300009177 | Ga0105248_10038890 | Ga0105248_100388904 | 274 |
| 310 | 3300009177 | Ga0105248_10132247 | Ga0105248_101322471 | 274 |
| 311 | 3300009177 | Ga0105248_10384894 | Ga0105248_103848942 | 274 |
| 312 | 3300009553 | Ga0105249_10550283 | Ga0105249_105502832 | 274 |
| 313 | 3300013306 | Ga0163162_10046149 | Ga0163162_100461493 | 274 |
| 314 | 3300013308 | Ga0157375_10277462 | Ga0157375_102774622 | 274 |
| 315 | 3300014325 | Ga0163163_10411143 | Ga0163163_104111431 | 274 |
| 316 | 3300014745 | Ga0157377_10024546 | Ga0157377_100245462 | 274 |
| 317 | 3300014968 | Ga0157379_10012421 | Ga0157379_100124212 | 274 |
| 318 | 3300014968 | Ga0157379_10013451 | Ga0157379_100134513 | 274 |
| 319 | 3300025315 | Ga0207697_10052573 | Ga0207697_100525732 | 274 |
| 320 | 3300025900 | Ga0207710_10056137 | Ga0207710_100561372 | 274 |
| 321 | 3300025918 | Ga0207662_10201167 | Ga0207662_102011672 | 274 |
| 322 | 3300025923 | Ga0207681_10534918 | Ga0207681_105349181 | 274 |
| 323 | 3300025926 | Ga0207659_10000642 | Ga0207659_100006425 | 274 |
| 324 | 3300025937 | Ga0207669_10059837 | Ga0207669_100598372 | 274 |
| 325 | 3300025940 | Ga0207691_10182599 | Ga0207691_101825993 | 274 |
| 326 | 3300025941 | Ga0207711_10168820 | Ga0207711_101688203 | 274 |
| 327 | 3300025942 | Ga0207689_10098810 | Ga0207689_100988102 | 274 |
| 328 | 3300025960 | Ga0207651_10137640 | Ga0207651_101376402 | 274 |
| 329 | 3300026035 | Ga0207703_10009661 | Ga0207703_100096616 | 274 |
| 330 | 3300026035 | Ga0207703_10032794 | Ga0207703_100327943 | 274 |
| 331 | 3300026095 | Ga0207676_10480687 | Ga0207676_104806872 | 274 |
| 332 | 3300027907 | Ga0207428_10000002 | Ga0207428_10000002719 | 274 |
| 333 | 3300027907 | Ga0207428_10352895 | Ga0207428_103528951 | 274 |
| 334 | 3300028379 | Ga0268266_10786697 | Ga0268266_107866971 | 274 |
| 335 | 3300028381 | Ga0268264_10218100 | Ga0268264_102181002 | 274 |
| 336 | 3300031711 | Ga0265314_10033167 | Ga0265314_100331673 | 274 |
| 337 | 3300035120 | Ga0373957_0070807 | Ga0373957_0070807_34_882 | 274 |
| 338 | 3300046539 | Ga0495621_0060175 | Ga0495621_0060175_139_978 | 274 |
| 339 | 3300047318 | Ga0495636_0166160 | Ga0495636_0166160_130_969 | 274 |
| 340 | 3300049574 | Ga0501038_0068476 | Ga0501038_0068476_170_1009 | 274 |
| 341 | 3300049575 | Ga0501039_0102403 | Ga0501039_0102403_551_1390 | 274 |
| 342 | 3300049576 | Ga0501040_0018969 | Ga0501040_0018969_3220_4059 | 274 |
| 343 | 3300049577 | Ga0501041_0010096 | Ga0501041_0010096_3358_4197 | 274 |
| 344 | 3300049578 | Ga0501042_0021495 | Ga0501042_0021495_1302_2141 | 274 |
| 345 | 3300049580 | Ga0501046_0052948 | Ga0501046_0052948_1716_2555 | 274 |
| 346 | 3300049582 | Ga0501048_0104931 | Ga0501048_0104931_209_1048 | 274 |
| 347 | 3300049588 | Ga0501072_0213540 | Ga0501072_0213540_669_1508 | 274 |
| 348 | 3300049591 | Ga0501075_0018459 | Ga0501075_0018459_2023_2862 | 274 |
| 349 | 3300049741 | Ga0501079_0113463 | Ga0501079_0113463_1007_1846 | 274 |
| 350 | 3300050508 | nmdc:mga09592_123251_c1 | nmdc:mga09592_123251_c1_409_1248 | 274 |
| 351 | 3300050509 | nmdc:mga0qj67_269670_c1 | nmdc:mga0qj67_269670_c1_178_1017 | 274 |
| 352 | 3300050510 | nmdc:mga06r32_243651_c1 | nmdc:mga06r32_243651_c1_49_888 | 274 |
| 353 | 3300050511 | nmdc:mga08y16_3_c1 | nmdc:mga08y16_3_c1_790083_790922 | 274 |
| 354 | 3300050511 | nmdc:mga08y16_69678_c1 | nmdc:mga08y16_69678_c1_2519_3358 | 274 |
| 355 | 3300060353 | Ga0501082_0165990 | Ga0501082_0165990_376_1215 | 274 |
| 356 | 3300061734 | Ga0530510_0001309 | Ga0530510_0001309_11802_12641 | 274 |
| 357 | 3300025906 | Ga0207699_10047766 | Ga0207699_100477663 | 275 |
| 358 | 3300025907 | Ga0207645_10172978 | Ga0207645_101729781 | 275 |
| 359 | 3300025939 | Ga0207665_10076197 | Ga0207665_100761972 | 275 |
| 360 | 3300027671 | Ga0209588_1000001 | Ga0209588_1000001297 | 275 |
| 361 | 3300028381 | Ga0268264_10743142 | Ga0268264_107431422 | 275 |
| 362 | 3300031090 | Ga0265760_10011422 | Ga0265760_100114222 | 275 |
| 363 | 3300031250 | Ga0265331_10012844 | Ga0265331_100128446 | 275 |
| 364 | 3300031344 | Ga0265316_10014330 | Ga0265316_100143306 | 275 |
| 365 | 3300031595 | Ga0265313_10003181 | Ga0265313_1000318112 | 275 |
| 366 | 3300031711 | Ga0265314_10150276 | Ga0265314_101502762 | 275 |
| 367 | 3300059421 | Ga0590071_005999 | Ga0590071_005999_1574_2422 | 275 |
| 368 | 3300059426 | Ga0590077_002674 | Ga0590077_002674_1095_1943 | 275 |
| 369 | 3300005434 | Ga0070709_10052454 | Ga0070709_100524542 | 276 |
| 370 | 3300005434 | Ga0070709_10171128 | Ga0070709_101711282 | 276 |
| 371 | 3300005436 | Ga0070713_100056670 | Ga0070713_1000566703 | 276 |
| 372 | 3300005439 | Ga0070711_100001229 | Ga0070711_10000122911 | 276 |
| 373 | 3300005445 | Ga0070708_100006273 | Ga0070708_1000062737 | 276 |
| 374 | 3300005445 | Ga0070708_100066556 | Ga0070708_1000665563 | 276 |
| 375 | 3300005445 | Ga0070708_100107291 | Ga0070708_1001072912 | 276 |
| 376 | 3300005467 | Ga0070706_100002094 | Ga0070706_1000020945 | 276 |
| 377 | 3300005467 | Ga0070706_100175853 | Ga0070706_1001758532 | 276 |
| 378 | 3300005471 | Ga0070698_100343820 | Ga0070698_1003438202 | 276 |
| 379 | 3300005518 | Ga0070699_100007587 | Ga0070699_1000075873 | 276 |
| 380 | 3300005518 | Ga0070699_100148811 | Ga0070699_1001488112 | 276 |
| 381 | 3300005536 | Ga0070697_100002395 | Ga0070697_1000023954 | 276 |
| 382 | 3300005614 | Ga0068856_100125292 | Ga0068856_1001252923 | 276 |
| 383 | 3300006173 | Ga0070716_100254285 | Ga0070716_1002542852 | 276 |
| 384 | 3300006175 | Ga0070712_100000468 | Ga0070712_10000046819 | 276 |
| 385 | 3300006237 | Ga0097621_100004631 | Ga0097621_1000046317 | 276 |
| 386 | 3300006358 | Ga0068871_100013790 | Ga0068871_1000137903 | 276 |
| 387 | 3300009098 | Ga0105245_10124984 | Ga0105245_101249842 | 276 |
| 388 | 3300009174 | Ga0105241_10007930 | Ga0105241_100079306 | 276 |
| 389 | 3300009174 | Ga0105241_10189512 | Ga0105241_101895122 | 276 |
| 390 | 3300009551 | Ga0105238_10024029 | Ga0105238_100240293 | 276 |
| 391 | 3300013296 | Ga0157374_10021505 | Ga0157374_100215053 | 276 |
| 392 | 3300013297 | Ga0157378_10082890 | Ga0157378_100828903 | 276 |
| 393 | 3300013297 | Ga0157378_10210633 | Ga0157378_102106332 | 276 |
| 394 | 3300014968 | Ga0157379_10004208 | Ga0157379_100042084 | 276 |
| 395 | 3300014969 | Ga0157376_10085139 | Ga0157376_100851393 | 276 |
| 396 | 3300025905 | Ga0207685_10067157 | Ga0207685_100671572 | 276 |
| 397 | 3300025906 | Ga0207699_10172588 | Ga0207699_101725882 | 276 |
| 398 | 3300025906 | Ga0207699_10191628 | Ga0207699_101916282 | 276 |
| 399 | 3300025910 | Ga0207684_10004878 | Ga0207684_100048783 | 276 |
| 400 | 3300025915 | Ga0207693_10001167 | Ga0207693_1000116719 | 276 |
| 401 | 3300025916 | Ga0207663_10010876 | Ga0207663_100108763 | 276 |
| 402 | 3300025924 | Ga0207694_10036471 | Ga0207694_100364713 | 276 |
| 403 | 3300025928 | Ga0207700_10426237 | Ga0207700_104262372 | 276 |
| 404 | 3300025939 | Ga0207665_10039155 | Ga0207665_100391553 | 276 |
| 405 | 3300026078 | Ga0207702_10112427 | Ga0207702_101124273 | 276 |
| 406 | 3300035170 | Ga0373943_0043030 | Ga0373943_0043030_798_1637 | 276 |
| 407 | 3300035692 | Ga0373935_0061927 | Ga0373935_0061927_719_1558 | 276 |
| 408 | 3300035695 | Ga0373927_0093605 | Ga0373927_0093605_97_936 | 276 |
| 409 | 3300035725 | Ga0373947_0024378 | Ga0373947_0024378_1426_2265 | 276 |
| 410 | 3300037068 | Ga0373925_0037190 | Ga0373925_0037190_2682_3521 | 276 |
| 411 | 3300046472 | Ga0495580_0018437 | Ga0495580_0018437_1807_2652 | 276 |
| 412 | 3300046517 | Ga0495630_0032428 | Ga0495630_0032428_2152_2991 | 276 |
| 413 | 3300046663 | Ga0495635_0076315 | Ga0495635_0076315_1447_2286 | 276 |
| 414 | 3300046809 | Ga0495600_0174794 | Ga0495600_0174794_339_1181 | 276 |
| 415 | 3300048903 | Ga0496100_0006702 | Ga0496100_0006702_1721_2566 | 276 |
| 416 | 3300048906 | Ga0496103_0001075 | Ga0496103_0001075_6856_7701 | 276 |
| 417 | 3300048907 | Ga0496104_0007903 | Ga0496104_0007903_7795_8640 | 276 |
| 418 | 3300048908 | Ga0496105_0040070 | Ga0496105_0040070_516_1361 | 276 |
| 419 | 3300048915 | Ga0496112_0060610 | Ga0496112_0060610_2181_3026 | 276 |
| 420 | 3300048917 | Ga0496114_0149725 | Ga0496114_0149725_866_1711 | 276 |
| 421 | 3300048918 | Ga0496115_0002823 | Ga0496115_0002823_6614_7459 | 276 |
| 422 | 3300005467 | Ga0070706_100000336 | Ga0070706_10000033622 | 277 |
| 423 | 3300005468 | Ga0070707_100021052 | Ga0070707_1000210523 | 277 |
| 424 | 3300005471 | Ga0070698_100256521 | Ga0070698_1002565213 | 277 |
| 425 | 3300005536 | Ga0070697_100014445 | Ga0070697_1000144453 | 277 |
| 426 | 3300005536 | Ga0070697_100261749 | Ga0070697_1002617491 | 277 |
| 427 | 3300005545 | Ga0070695_100254949 | Ga0070695_1002549491 | 277 |
| 428 | 3300025910 | Ga0207684_10000320 | Ga0207684_1000032032 | 277 |
| 429 | 3300046511 | Ga0495608_0103142 | Ga0495608_0103142_668_1510 | 277 |
| 430 | 3300003320 | rootH2_10158235 | rootH2_101582352 | 278 |
| 431 | 3300005436 | Ga0070713_100011617 | Ga0070713_1000116174 | 278 |
| 432 | 3300005436 | Ga0070713_100074091 | Ga0070713_1000740914 | 278 |
| 433 | 3300005471 | Ga0070698_100256401 | Ga0070698_1002564012 | 278 |
| 434 | 3300006028 | Ga0070717_10247204 | Ga0070717_102472042 | 278 |
| 435 | 3300006871 | Ga0075434_100051841 | Ga0075434_1000518413 | 278 |
| 436 | 3300006914 | Ga0075436_100230607 | Ga0075436_1002306072 | 278 |
| 437 | 3300007076 | Ga0075435_100077191 | Ga0075435_1000771913 | 278 |
| 438 | 3300009147 | Ga0114129_10543115 | Ga0114129_105431152 | 278 |
| 439 | 3300013297 | Ga0157378_10085504 | Ga0157378_100855042 | 278 |
| 440 | 3300021388 | Ga0213875_10134125 | Ga0213875_101341252 | 278 |
| 441 | 3300025906 | Ga0207699_10242932 | Ga0207699_102429322 | 278 |
| 442 | 3300025922 | Ga0207646_10337240 | Ga0207646_103372402 | 278 |
| 443 | 3300025927 | Ga0207687_10077756 | Ga0207687_100777563 | 278 |
| 444 | 3300025928 | Ga0207700_10063979 | Ga0207700_100639793 | 278 |
| 445 | 3300025928 | Ga0207700_10204560 | Ga0207700_102045602 | 278 |
| 446 | 3300030760 | Ga0265762_1026117 | Ga0265762_10261172 | 278 |
| 447 | 3300031235 | Ga0265330_10000186 | Ga0265330_1000018630 | 278 |
| 448 | 3300031241 | Ga0265325_10000138 | Ga0265325_1000013831 | 278 |
| 449 | 3300031249 | Ga0265339_10001543 | Ga0265339_1000154310 | 278 |
| 450 | 3300031344 | Ga0265316_10000510 | Ga0265316_100005106 | 278 |
| 451 | 3300031595 | Ga0265313_10006745 | Ga0265313_100067455 | 278 |
| 452 | 3300031712 | Ga0265342_10006543 | Ga0265342_100065439 | 278 |
| 453 | 3300037853 | Ga0436364_0703870 | Ga0436364_0703870_509_1354 | 278 |
| 454 | 3300039437 | Ga0436365_1220175 | Ga0436365_1220175_1908_2753 | 278 |
| 455 | 3300046472 | Ga0495580_0019663 | Ga0495580_0019663_4152_4997 | 278 |
| 456 | 3300050507 | nmdc:mga05p37_559415_c1 | nmdc:mga05p37_559415_c1_277_1131 | 278 |
| 457 | 3300050512 | nmdc:mga0n895_100643_c1 | nmdc:mga0n895_100643_c1_654_1499 | 278 |
| 458 | 3300050513 | nmdc:mga0rr50_126767_c1 | nmdc:mga0rr50_126767_c1_1038_1883 | 278 |
| 459 | 3300004803 | Ga0058862_12808267 | Ga0058862_128082672 | 279 |
| 460 | 3300005435 | Ga0070714_100029132 | Ga0070714_1000291323 | 279 |
| 461 | 3300005435 | Ga0070714_100182116 | Ga0070714_1001821162 | 279 |
| 462 | 3300005436 | Ga0070713_100000476 | Ga0070713_10000047611 | 279 |
| 463 | 3300005436 | Ga0070713_100056701 | Ga0070713_1000567014 | 279 |
| 464 | 3300005437 | Ga0070710_10136282 | Ga0070710_101362822 | 279 |
| 465 | 3300005439 | Ga0070711_100000281 | Ga0070711_1000002815 | 279 |
| 466 | 3300005439 | Ga0070711_100033648 | Ga0070711_1000336483 | 279 |
| 467 | 3300006028 | Ga0070717_10032853 | Ga0070717_100328533 | 279 |
| 468 | 3300006028 | Ga0070717_10354068 | Ga0070717_103540681 | 279 |
| 469 | 3300006163 | Ga0070715_10000763 | Ga0070715_100007633 | 279 |
| 470 | 3300006173 | Ga0070716_100010159 | Ga0070716_1000101593 | 279 |
| 471 | 3300006175 | Ga0070712_100002849 | Ga0070712_1000028495 | 279 |
| 472 | 3300006175 | Ga0070712_100003144 | Ga0070712_1000031443 | 279 |
| 473 | 3300013104 | Ga0157370_10168118 | Ga0157370_101681182 | 279 |
| 474 | 3300020070 | Ga0206356_10844687 | Ga0206356_108446872 | 279 |
| 475 | 3300021388 | Ga0213875_10037145 | Ga0213875_100371454 | 279 |
| 476 | 3300025905 | Ga0207685_10001682 | Ga0207685_100016823 | 279 |
| 477 | 3300025915 | Ga0207693_10000008 | Ga0207693_1000000824 | 279 |
| 478 | 3300025915 | Ga0207693_10007049 | Ga0207693_100070493 | 279 |
| 479 | 3300025916 | Ga0207663_10000111 | Ga0207663_100001114 | 279 |
| 480 | 3300025928 | Ga0207700_10000107 | Ga0207700_1000010719 | 279 |
| 481 | 3300025929 | Ga0207664_10054162 | Ga0207664_100541622 | 279 |
| 482 | 3300025929 | Ga0207664_10176543 | Ga0207664_101765432 | 279 |
| 483 | 3300025939 | Ga0207665_10016930 | Ga0207665_100169303 | 279 |
| 484 | 3300031235 | Ga0265330_10038099 | Ga0265330_100380992 | 279 |
| 485 | 3300031712 | Ga0265342_10039255 | Ga0265342_100392552 | 279 |
| 486 | 3300031712 | Ga0265342_10045773 | Ga0265342_100457734 | 279 |
| 487 | 3300035113 | Ga0373936_0003520 | Ga0373936_0003520_2821_3669 | 279 |
| 488 | 3300037853 | Ga0436364_1014577 | Ga0436364_1014577_509_1357 | 279 |
| 489 | 3300046472 | Ga0495580_0002181 | Ga0495580_0002181_1521_2372 | 279 |
| 490 | 3300046472 | Ga0495580_0010201 | Ga0495580_0010201_1188_2036 | 279 |
| 491 | 3300046473 | Ga0495582_0012347 | Ga0495582_0012347_2042_2890 | 279 |
| 492 | 3300046477 | Ga0495664_0053165 | Ga0495664_0053165_23_871 | 279 |
| 493 | 3300046517 | Ga0495630_0004015 | Ga0495630_0004015_475_1344 | 279 |
| 494 | 3300046517 | Ga0495630_0168703 | Ga0495630_0168703_628_1476 | 279 |
| 495 | 3300046675 | Ga0495657_0102308 | Ga0495657_0102308_647_1495 | 279 |
| 496 | 3300046678 | Ga0495599_0080445 | Ga0495599_0080445_995_1843 | 279 |
| 497 | 3300046683 | Ga0495658_0206709 | Ga0495658_0206709_143_991 | 279 |
| 498 | 3300046689 | Ga0495613_0246119 | Ga0495613_0246119_247_1095 | 279 |
| 499 | 3300046690 | Ga0495624_0229335 | Ga0495624_0229335_200_1048 | 279 |
| 500 | 3300047319 | Ga0495674_0007648 | Ga0495674_0007648_5515_6363 | 279 |
| 501 | 3300047319 | Ga0495674_0032047 | Ga0495674_0032047_3862_4731 | 279 |
| 502 | 3300047673 | Ga0495593_0054240 | Ga0495593_0054240_255_1103 | 279 |
| 503 | 3300048918 | Ga0496115_0006852 | Ga0496115_0006852_5040_5888 | 279 |
| 504 | 3300059630 | Ga0587128_011851 | Ga0587128_011851_196_1047 | 279 |
| 505 | 3300004798 | Ga0058859_10571141 | Ga0058859_105711412 | 280 |
| 506 | 3300004799 | Ga0058863_11271652 | Ga0058863_112716523 | 280 |
| 507 | 3300004800 | Ga0058861_11276067 | Ga0058861_112760672 | 280 |
| 508 | 3300004803 | Ga0058862_11810453 | Ga0058862_118104532 | 280 |
| 509 | 3300005327 | Ga0070658_10015017 | Ga0070658_100150172 | 280 |
| 510 | 3300005328 | Ga0070676_10088917 | Ga0070676_100889171 | 280 |
| 511 | 3300005329 | Ga0070683_100033133 | Ga0070683_1000331335 | 280 |
| 512 | 3300005330 | Ga0070690_100060729 | Ga0070690_1000607292 | 280 |
| 513 | 3300005330 | Ga0070690_100075007 | Ga0070690_1000750072 | 280 |
| 514 | 3300005334 | Ga0068869_100002543 | Ga0068869_1000025433 | 280 |
| 515 | 3300005334 | Ga0068869_100051719 | Ga0068869_1000517193 | 280 |
| 516 | 3300005336 | Ga0070680_100096347 | Ga0070680_1000963473 | 280 |
| 517 | 3300005337 | Ga0070682_100024660 | Ga0070682_1000246603 | 280 |
| 518 | 3300005338 | Ga0068868_100007292 | Ga0068868_1000072926 | 280 |
| 519 | 3300005338 | Ga0068868_100013904 | Ga0068868_1000139044 | 280 |
| 520 | 3300005338 | Ga0068868_100029316 | Ga0068868_1000293163 | 280 |
| 521 | 3300005338 | Ga0068868_100091197 | Ga0068868_1000911973 | 280 |
| 522 | 3300005339 | Ga0070660_100009135 | Ga0070660_1000091353 | 280 |
| 523 | 3300005339 | Ga0070660_100113116 | Ga0070660_1001131162 | 280 |
| 524 | 3300005340 | Ga0070689_100369176 | Ga0070689_1003691762 | 280 |
| 525 | 3300005341 | Ga0070691_10136183 | Ga0070691_101361831 | 280 |
| 526 | 3300005343 | Ga0070687_100012491 | Ga0070687_1000124914 | 280 |
| 527 | 3300005353 | Ga0070669_100088909 | Ga0070669_1000889093 | 280 |
| 528 | 3300005355 | Ga0070671_100254728 | Ga0070671_1002547281 | 280 |
| 529 | 3300005364 | Ga0070673_100223896 | Ga0070673_1002238962 | 280 |
| 530 | 3300005366 | Ga0070659_100152039 | Ga0070659_1001520392 | 280 |
| 531 | 3300005434 | Ga0070709_10018121 | Ga0070709_100181213 | 280 |
| 532 | 3300005435 | Ga0070714_100211414 | Ga0070714_1002114142 | 280 |
| 533 | 3300005436 | Ga0070713_100001852 | Ga0070713_1000018529 | 280 |
| 534 | 3300005436 | Ga0070713_100198400 | Ga0070713_1001984002 | 280 |
| 535 | 3300005439 | Ga0070711_100020727 | Ga0070711_1000207273 | 280 |
| 536 | 3300005455 | Ga0070663_100177850 | Ga0070663_1001778501 | 280 |
| 537 | 3300005456 | Ga0070678_100340196 | Ga0070678_1003401962 | 280 |
| 538 | 3300005457 | Ga0070662_100017281 | Ga0070662_1000172817 | 280 |
| 539 | 3300005458 | Ga0070681_10001282 | Ga0070681_100012825 | 280 |
| 540 | 3300005458 | Ga0070681_10010428 | Ga0070681_100104285 | 280 |
| 541 | 3300005458 | Ga0070681_10036998 | Ga0070681_100369983 | 280 |
| 542 | 3300005458 | Ga0070681_10157001 | Ga0070681_101570012 | 280 |
| 543 | 3300005458 | Ga0070681_10393319 | Ga0070681_103933191 | 280 |
| 544 | 3300005459 | Ga0068867_100060541 | Ga0068867_1000605413 | 280 |
| 545 | 3300005459 | Ga0068867_100224802 | Ga0068867_1002248023 | 280 |
| 546 | 3300005466 | Ga0070685_10009573 | Ga0070685_100095732 | 280 |
| 547 | 3300005466 | Ga0070685_10116179 | Ga0070685_101161792 | 280 |
| 548 | 3300005530 | Ga0070679_100021290 | Ga0070679_1000212907 | 280 |
| 549 | 3300005530 | Ga0070679_100045647 | Ga0070679_1000456473 | 280 |
| 550 | 3300005530 | Ga0070679_100120107 | Ga0070679_1001201072 | 280 |
| 551 | 3300005530 | Ga0070679_100585457 | Ga0070679_1005854571 | 280 |
| 552 | 3300005535 | Ga0070684_100031772 | Ga0070684_1000317727 | 280 |
| 553 | 3300005535 | Ga0070684_100051325 | Ga0070684_1000513252 | 280 |
| 554 | 3300005535 | Ga0070684_100339810 | Ga0070684_1003398102 | 280 |
| 555 | 3300005539 | Ga0068853_100198663 | Ga0068853_1001986633 | 280 |
| 556 | 3300005539 | Ga0068853_100218901 | Ga0068853_1002189011 | 280 |
| 557 | 3300005546 | Ga0070696_100151488 | Ga0070696_1001514882 | 280 |
| 558 | 3300005547 | Ga0070693_100029239 | Ga0070693_1000292391 | 280 |
| 559 | 3300005547 | Ga0070693_100078116 | Ga0070693_1000781162 | 280 |
| 560 | 3300005547 | Ga0070693_100227770 | Ga0070693_1002277701 | 280 |
| 561 | 3300005548 | Ga0070665_100029410 | Ga0070665_1000294105 | 280 |
| 562 | 3300005563 | Ga0068855_100000234 | Ga0068855_10000023427 | 280 |
| 563 | 3300005563 | Ga0068855_100000432 | Ga0068855_10000043245 | 280 |
| 564 | 3300005563 | Ga0068855_100001150 | Ga0068855_10000115023 | 280 |
| 565 | 3300005563 | Ga0068855_100013501 | Ga0068855_1000135019 | 280 |
| 566 | 3300005564 | Ga0070664_100000726 | Ga0070664_1000007267 | 280 |
| 567 | 3300005564 | Ga0070664_100764576 | Ga0070664_1007645761 | 280 |
| 568 | 3300005577 | Ga0068857_100000096 | Ga0068857_10000009636 | 280 |
| 569 | 3300005577 | Ga0068857_100005406 | Ga0068857_1000054068 | 280 |
| 570 | 3300005577 | Ga0068857_100211098 | Ga0068857_1002110982 | 280 |
| 571 | 3300005578 | Ga0068854_100009756 | Ga0068854_1000097566 | 280 |
| 572 | 3300005578 | Ga0068854_100140582 | Ga0068854_1001405821 | 280 |
| 573 | 3300005614 | Ga0068856_100000062 | Ga0068856_10000006215 | 280 |
| 574 | 3300005614 | Ga0068856_100000179 | Ga0068856_10000017931 | 280 |
| 575 | 3300005614 | Ga0068856_100000854 | Ga0068856_1000008541 | 280 |
| 576 | 3300005614 | Ga0068856_100041098 | Ga0068856_1000410983 | 280 |
| 577 | 3300005614 | Ga0068856_100086315 | Ga0068856_1000863152 | 280 |
| 578 | 3300005614 | Ga0068856_100168389 | Ga0068856_1001683892 | 280 |
| 579 | 3300005614 | Ga0068856_100184126 | Ga0068856_1001841263 | 280 |
| 580 | 3300005615 | Ga0070702_100153082 | Ga0070702_1001530821 | 280 |
| 581 | 3300005616 | Ga0068852_100016336 | Ga0068852_1000163365 | 280 |
| 582 | 3300005616 | Ga0068852_100036794 | Ga0068852_1000367943 | 280 |
| 583 | 3300005616 | Ga0068852_100052877 | Ga0068852_1000528772 | 280 |
| 584 | 3300005616 | Ga0068852_100220903 | Ga0068852_1002209032 | 280 |
| 585 | 3300005617 | Ga0068859_100091350 | Ga0068859_1000913504 | 280 |
| 586 | 3300005617 | Ga0068859_100099523 | Ga0068859_1000995233 | 280 |
| 587 | 3300005617 | Ga0068859_100123873 | Ga0068859_1001238733 | 280 |
| 588 | 3300005618 | Ga0068864_100000129 | Ga0068864_10000012939 | 280 |
| 589 | 3300005618 | Ga0068864_100012733 | Ga0068864_1000127335 | 280 |
| 590 | 3300005718 | Ga0068866_10026910 | Ga0068866_100269101 | 280 |
| 591 | 3300005718 | Ga0068866_10067783 | Ga0068866_100677833 | 280 |
| 592 | 3300005840 | Ga0068870_10130633 | Ga0068870_101306332 | 280 |
| 593 | 3300005841 | Ga0068863_100008178 | Ga0068863_1000081785 | 280 |
| 594 | 3300005842 | Ga0068858_100002990 | Ga0068858_1000029909 | 280 |
| 595 | 3300005842 | Ga0068858_100010506 | Ga0068858_10001050611 | 280 |
| 596 | 3300005842 | Ga0068858_100014019 | Ga0068858_1000140191 | 280 |
| 597 | 3300005842 | Ga0068858_100077143 | Ga0068858_1000771434 | 280 |
| 598 | 3300005842 | Ga0068858_100844542 | Ga0068858_1008445421 | 280 |
| 599 | 3300005843 | Ga0068860_100075164 | Ga0068860_1000751642 | 280 |
| 600 | 3300005843 | Ga0068860_100096300 | Ga0068860_1000963002 | 280 |
| 601 | 3300005843 | Ga0068860_100131638 | Ga0068860_1001316383 | 280 |
| 602 | 3300005843 | Ga0068860_100160120 | Ga0068860_1001601203 | 280 |
| 603 | 3300005844 | Ga0068862_100056072 | Ga0068862_1000560723 | 280 |
| 604 | 3300005983 | Ga0081540_1024169 | Ga0081540_10241693 | 280 |
| 605 | 3300006163 | Ga0070715_10132775 | Ga0070715_101327752 | 280 |
| 606 | 3300006175 | Ga0070712_100008773 | Ga0070712_1000087737 | 280 |
| 607 | 3300006175 | Ga0070712_100028949 | Ga0070712_1000289493 | 280 |
| 608 | 3300006175 | Ga0070712_100564588 | Ga0070712_1005645881 | 280 |
| 609 | 3300006237 | Ga0097621_100000148 | Ga0097621_1000001483 | 280 |
| 610 | 3300006237 | Ga0097621_100000980 | Ga0097621_10000098013 | 280 |
| 611 | 3300006237 | Ga0097621_100115625 | Ga0097621_1001156253 | 280 |
| 612 | 3300006358 | Ga0068871_100000049 | Ga0068871_10000004937 | 280 |
| 613 | 3300006358 | Ga0068871_100000465 | Ga0068871_10000046518 | 280 |
| 614 | 3300006358 | Ga0068871_100031575 | Ga0068871_1000315752 | 280 |
| 615 | 3300006871 | Ga0075434_100261955 | Ga0075434_1002619552 | 280 |
| 616 | 3300006881 | Ga0068865_100075093 | Ga0068865_1000750932 | 280 |
| 617 | 3300006881 | Ga0068865_100077749 | Ga0068865_1000777493 | 280 |
| 618 | 3300006881 | Ga0068865_100093951 | Ga0068865_1000939512 | 280 |
| 619 | 3300006931 | Ga0097620_100091355 | Ga0097620_1000913554 | 280 |
| 620 | 3300006931 | Ga0097620_100099524 | Ga0097620_1000995243 | 280 |
| 621 | 3300006931 | Ga0097620_100123888 | Ga0097620_1001238882 | 280 |
| 622 | 3300009093 | Ga0105240_10000378 | Ga0105240_1000037854 | 280 |
| 623 | 3300009093 | Ga0105240_10014149 | Ga0105240_100141493 | 280 |
| 624 | 3300009093 | Ga0105240_10206710 | Ga0105240_102067103 | 280 |
| 625 | 3300009098 | Ga0105245_10014526 | Ga0105245_100145263 | 280 |
| 626 | 3300009098 | Ga0105245_10115053 | Ga0105245_101150532 | 280 |
| 627 | 3300009148 | Ga0105243_10202473 | Ga0105243_102024732 | 280 |
| 628 | 3300009174 | Ga0105241_10083824 | Ga0105241_100838243 | 280 |
| 629 | 3300009176 | Ga0105242_10070983 | Ga0105242_100709833 | 280 |
| 630 | 3300009176 | Ga0105242_10235268 | Ga0105242_102352683 | 280 |
| 631 | 3300009177 | Ga0105248_10279095 | Ga0105248_102790952 | 280 |
| 632 | 3300009545 | Ga0105237_10017405 | Ga0105237_100174053 | 280 |
| 633 | 3300009545 | Ga0105237_10093606 | Ga0105237_100936063 | 280 |
| 634 | 3300009545 | Ga0105237_10158974 | Ga0105237_101589742 | 280 |
| 635 | 3300009545 | Ga0105237_10309965 | Ga0105237_103099652 | 280 |
| 636 | 3300009551 | Ga0105238_10000609 | Ga0105238_1000060916 | 280 |
| 637 | 3300009551 | Ga0105238_10013340 | Ga0105238_100133405 | 280 |
| 638 | 3300009551 | Ga0105238_10025730 | Ga0105238_100257302 | 280 |
| 639 | 3300009553 | Ga0105249_10006270 | Ga0105249_100062707 | 280 |
| 640 | 3300010375 | Ga0105239_10039316 | Ga0105239_100393164 | 280 |
| 641 | 3300010375 | Ga0105239_10469679 | Ga0105239_104696792 | 280 |
| 642 | 3300010375 | Ga0105239_10819542 | Ga0105239_108195422 | 280 |
| 643 | 3300013100 | Ga0157373_10011663 | Ga0157373_100116632 | 280 |
| 644 | 3300013100 | Ga0157373_10091841 | Ga0157373_100918413 | 280 |
| 645 | 3300013102 | Ga0157371_10024243 | Ga0157371_100242433 | 280 |
| 646 | 3300013102 | Ga0157371_10054599 | Ga0157371_100545992 | 280 |
| 647 | 3300013104 | Ga0157370_10005013 | Ga0157370_1000501312 | 280 |
| 648 | 3300013104 | Ga0157370_10184107 | Ga0157370_101841072 | 280 |
| 649 | 3300013105 | Ga0157369_10000159 | Ga0157369_1000015959 | 280 |
| 650 | 3300013105 | Ga0157369_10018776 | Ga0157369_100187768 | 280 |
| 651 | 3300013105 | Ga0157369_10200402 | Ga0157369_102004022 | 280 |
| 652 | 3300013296 | Ga0157374_10000062 | Ga0157374_1000006257 | 280 |
| 653 | 3300013296 | Ga0157374_10000338 | Ga0157374_1000033815 | 280 |
| 654 | 3300013296 | Ga0157374_10016801 | Ga0157374_100168015 | 280 |
| 655 | 3300013296 | Ga0157374_10033555 | Ga0157374_100335552 | 280 |
| 656 | 3300013296 | Ga0157374_10084221 | Ga0157374_100842214 | 280 |
| 657 | 3300013297 | Ga0157378_10000009 | Ga0157378_1000000947 | 280 |
| 658 | 3300013297 | Ga0157378_10005749 | Ga0157378_100057497 | 280 |
| 659 | 3300013297 | Ga0157378_10123896 | Ga0157378_101238963 | 280 |
| 660 | 3300013297 | Ga0157378_10388862 | Ga0157378_103888622 | 280 |
| 661 | 3300013306 | Ga0163162_10444852 | Ga0163162_104448522 | 280 |
| 662 | 3300013307 | Ga0157372_10000540 | Ga0157372_1000054032 | 280 |
| 663 | 3300013307 | Ga0157372_10001184 | Ga0157372_100011848 | 280 |
| 664 | 3300013307 | Ga0157372_10019861 | Ga0157372_100198616 | 280 |
| 665 | 3300013307 | Ga0157372_10305829 | Ga0157372_103058292 | 280 |
| 666 | 3300014325 | Ga0163163_10230261 | Ga0163163_102302612 | 280 |
| 667 | 3300014968 | Ga0157379_10051201 | Ga0157379_100512013 | 280 |
| 668 | 3300014968 | Ga0157379_10092968 | Ga0157379_100929683 | 280 |
| 669 | 3300014969 | Ga0157376_10038471 | Ga0157376_100384713 | 280 |
| 670 | 3300014969 | Ga0157376_10069513 | Ga0157376_100695133 | 280 |
| 671 | 3300020070 | Ga0206356_10660814 | Ga0206356_106608142 | 280 |
| 672 | 3300020070 | Ga0206356_10693455 | Ga0206356_106934552 | 280 |
| 673 | 3300020075 | Ga0206349_1194817 | Ga0206349_11948172 | 280 |
| 674 | 3300020080 | Ga0206350_11158639 | Ga0206350_111586393 | 280 |
| 675 | 3300022467 | Ga0224712_10001197 | Ga0224712_100011973 | 280 |
| 676 | 3300022467 | Ga0224712_10044238 | Ga0224712_100442382 | 280 |
| 677 | 3300025904 | Ga0207647_10004807 | Ga0207647_100048077 | 280 |
| 678 | 3300025904 | Ga0207647_10016923 | Ga0207647_100169233 | 280 |
| 679 | 3300025907 | Ga0207645_10003579 | Ga0207645_1000357912 | 280 |
| 680 | 3300025909 | Ga0207705_10002624 | Ga0207705_100026242 | 280 |
| 681 | 3300025911 | Ga0207654_10020250 | Ga0207654_100202502 | 280 |
| 682 | 3300025912 | Ga0207707_10001452 | Ga0207707_1000145219 | 280 |
| 683 | 3300025912 | Ga0207707_10004494 | Ga0207707_100044943 | 280 |
| 684 | 3300025912 | Ga0207707_10018296 | Ga0207707_100182964 | 280 |
| 685 | 3300025912 | Ga0207707_10060733 | Ga0207707_100607333 | 280 |
| 686 | 3300025913 | Ga0207695_10008636 | Ga0207695_100086364 | 280 |
| 687 | 3300025913 | Ga0207695_10013009 | Ga0207695_100130092 | 280 |
| 688 | 3300025913 | Ga0207695_10114494 | Ga0207695_101144944 | 280 |
| 689 | 3300025914 | Ga0207671_10167045 | Ga0207671_101670452 | 280 |
| 690 | 3300025915 | Ga0207693_10015202 | Ga0207693_100152024 | 280 |
| 691 | 3300025915 | Ga0207693_10026238 | Ga0207693_100262383 | 280 |
| 692 | 3300025917 | Ga0207660_10016931 | Ga0207660_100169316 | 280 |
| 693 | 3300025917 | Ga0207660_10099890 | Ga0207660_100998902 | 280 |
| 694 | 3300025919 | Ga0207657_10002009 | Ga0207657_100020097 | 280 |
| 695 | 3300025919 | Ga0207657_10005757 | Ga0207657_100057573 | 280 |
| 696 | 3300025920 | Ga0207649_10015374 | Ga0207649_100153743 | 280 |
| 697 | 3300025921 | Ga0207652_10005785 | Ga0207652_100057853 | 280 |
| 698 | 3300025921 | Ga0207652_10023725 | Ga0207652_100237254 | 280 |
| 699 | 3300025921 | Ga0207652_10050957 | Ga0207652_100509573 | 280 |
| 700 | 3300025921 | Ga0207652_10297020 | Ga0207652_102970202 | 280 |
| 701 | 3300025924 | Ga0207694_10003298 | Ga0207694_100032985 | 280 |
| 702 | 3300025924 | Ga0207694_10036165 | Ga0207694_100361652 | 280 |
| 703 | 3300025925 | Ga0207650_10067229 | Ga0207650_100672291 | 280 |
| 704 | 3300025927 | Ga0207687_10066038 | Ga0207687_100660382 | 280 |
| 705 | 3300025927 | Ga0207687_10111801 | Ga0207687_101118012 | 280 |
| 706 | 3300025927 | Ga0207687_10467384 | Ga0207687_104673842 | 280 |
| 707 | 3300025928 | Ga0207700_10068309 | Ga0207700_100683093 | 280 |
| 708 | 3300025928 | Ga0207700_10180330 | Ga0207700_101803302 | 280 |
| 709 | 3300025929 | Ga0207664_10187705 | Ga0207664_101877052 | 280 |
| 710 | 3300025929 | Ga0207664_10302520 | Ga0207664_103025202 | 280 |
| 711 | 3300025931 | Ga0207644_10030295 | Ga0207644_100302953 | 280 |
| 712 | 3300025933 | Ga0207706_10000641 | Ga0207706_1000064120 | 280 |
| 713 | 3300025933 | Ga0207706_10092392 | Ga0207706_100923923 | 280 |
| 714 | 3300025938 | Ga0207704_10012937 | Ga0207704_100129373 | 280 |
| 715 | 3300025938 | Ga0207704_10034810 | Ga0207704_100348102 | 280 |
| 716 | 3300025940 | Ga0207691_10424416 | Ga0207691_104244162 | 280 |
| 717 | 3300025941 | Ga0207711_10056241 | Ga0207711_100562414 | 280 |
| 718 | 3300025942 | Ga0207689_10003694 | Ga0207689_100036943 | 280 |
| 719 | 3300025942 | Ga0207689_10025571 | Ga0207689_100255714 | 280 |
| 720 | 3300025942 | Ga0207689_10046783 | Ga0207689_100467832 | 280 |
| 721 | 3300025949 | Ga0207667_10000087 | Ga0207667_10000087114 | 280 |
| 722 | 3300025949 | Ga0207667_10000465 | Ga0207667_1000046519 | 280 |
| 723 | 3300025949 | Ga0207667_10001399 | Ga0207667_1000139934 | 280 |
| 724 | 3300025949 | Ga0207667_10012244 | Ga0207667_100122446 | 280 |
| 725 | 3300025949 | Ga0207667_10055236 | Ga0207667_100552363 | 280 |
| 726 | 3300025961 | Ga0207712_10088737 | Ga0207712_100887372 | 280 |
| 727 | 3300025981 | Ga0207640_10034171 | Ga0207640_100341713 | 280 |
| 728 | 3300025981 | Ga0207640_10054643 | Ga0207640_100546432 | 280 |
| 729 | 3300025981 | Ga0207640_10105632 | Ga0207640_101056322 | 280 |
| 730 | 3300025981 | Ga0207640_10135407 | Ga0207640_101354072 | 280 |
| 731 | 3300026023 | Ga0207677_10444773 | Ga0207677_104447732 | 280 |
| 732 | 3300026035 | Ga0207703_10003748 | Ga0207703_100037487 | 280 |
| 733 | 3300026035 | Ga0207703_10004875 | Ga0207703_100048758 | 280 |
| 734 | 3300026035 | Ga0207703_10056180 | Ga0207703_100561802 | 280 |
| 735 | 3300026041 | Ga0207639_10040615 | Ga0207639_100406153 | 280 |
| 736 | 3300026041 | Ga0207639_10061531 | Ga0207639_100615312 | 280 |
| 737 | 3300026041 | Ga0207639_10088557 | Ga0207639_100885572 | 280 |
| 738 | 3300026067 | Ga0207678_10008144 | Ga0207678_100081446 | 280 |
| 739 | 3300026078 | Ga0207702_10000458 | Ga0207702_1000045827 | 280 |
| 740 | 3300026078 | Ga0207702_10001096 | Ga0207702_100010968 | 280 |
| 741 | 3300026078 | Ga0207702_10019664 | Ga0207702_100196644 | 280 |
| 742 | 3300026078 | Ga0207702_10157820 | Ga0207702_101578202 | 280 |
| 743 | 3300026088 | Ga0207641_10013325 | Ga0207641_100133254 | 280 |
| 744 | 3300026089 | Ga0207648_10017102 | Ga0207648_100171024 | 280 |
| 745 | 3300026089 | Ga0207648_10027431 | Ga0207648_100274315 | 280 |
| 746 | 3300026089 | Ga0207648_10091877 | Ga0207648_100918772 | 280 |
| 747 | 3300026116 | Ga0207674_10003692 | Ga0207674_100036924 | 280 |
| 748 | 3300026116 | Ga0207674_10005293 | Ga0207674_100052934 | 280 |
| 749 | 3300026116 | Ga0207674_10021941 | Ga0207674_100219412 | 280 |
| 750 | 3300026116 | Ga0207674_10198554 | Ga0207674_101985543 | 280 |
| 751 | 3300026118 | Ga0207675_100343394 | Ga0207675_1003433942 | 280 |
| 752 | 3300026121 | Ga0207683_10016513 | Ga0207683_100165131 | 280 |
| 753 | 3300026142 | Ga0207698_10055113 | Ga0207698_100551133 | 280 |
| 754 | 3300026142 | Ga0207698_10236936 | Ga0207698_102369362 | 280 |
| 755 | 3300026142 | Ga0207698_10311178 | Ga0207698_103111782 | 280 |
| 756 | 3300028379 | Ga0268266_10046251 | Ga0268266_100462512 | 280 |
| 757 | 3300028380 | Ga0268265_10015036 | Ga0268265_100150362 | 280 |
| 758 | 3300028381 | Ga0268264_10015954 | Ga0268264_100159542 | 280 |
| 759 | 3300028381 | Ga0268264_10143586 | Ga0268264_101435862 | 280 |
| 760 | 3300028381 | Ga0268264_10156666 | Ga0268264_101566662 | 280 |
| 761 | 3300028577 | Ga0265318_10005107 | Ga0265318_100051074 | 280 |
| 762 | 3300028800 | Ga0265338_10013466 | Ga0265338_100134666 | 280 |
| 763 | 3300028800 | Ga0265338_10212034 | Ga0265338_102120342 | 280 |
| 764 | 3300028800 | Ga0265338_10270358 | Ga0265338_102703582 | 280 |
| 765 | 3300029957 | Ga0265324_10057812 | Ga0265324_100578122 | 280 |
| 766 | 3300031235 | Ga0265330_10000338 | Ga0265330_1000033817 | 280 |
| 767 | 3300031238 | Ga0265332_10005345 | Ga0265332_100053452 | 280 |
| 768 | 3300031239 | Ga0265328_10003777 | Ga0265328_100037772 | 280 |
| 769 | 3300031241 | Ga0265325_10002006 | Ga0265325_100020063 | 280 |
| 770 | 3300031247 | Ga0265340_10002941 | Ga0265340_100029415 | 280 |
| 771 | 3300031249 | Ga0265339_10004329 | Ga0265339_100043293 | 280 |
| 772 | 3300031344 | Ga0265316_10000713 | Ga0265316_1000071313 | 280 |
| 773 | 3300031595 | Ga0265313_10002720 | Ga0265313_100027203 | 280 |
| 774 | 3300031711 | Ga0265314_10000187 | Ga0265314_1000018773 | 280 |
| 775 | 3300031711 | Ga0265314_10022657 | Ga0265314_100226573 | 280 |
| 776 | 3300031712 | Ga0265342_10000101 | Ga0265342_1000010183 | 280 |
| 777 | 3300035085 | Ga0373929_0024780 | Ga0373929_0024780_32_883 | 280 |
| 778 | 3300035207 | Ga0373942_0031264 | Ga0373942_0031264_472_1323 | 280 |
| 779 | 3300035691 | Ga0373931_0048317 | Ga0373931_0048317_1249_2103 | 280 |
| 780 | 3300045051 | Ga0451576_0039470 | Ga0451576_0039470_3337_4188 | 280 |
| 781 | 3300046472 | Ga0495580_0038512 | Ga0495580_0038512_1746_2597 | 280 |
| 782 | 3300046543 | Ga0495645_0002510 | Ga0495645_0002510_10534_11397 | 280 |
| 783 | 3300048903 | Ga0496100_0144936 | Ga0496100_0144936_813_1667 | 280 |
| 784 | 3300048905 | Ga0496102_0031150 | Ga0496102_0031150_3603_4457 | 280 |
| 785 | 3300048905 | Ga0496102_0050682 | Ga0496102_0050682_2496_3347 | 280 |
| 786 | 3300048906 | Ga0496103_0152184 | Ga0496103_0152184_347_1201 | 280 |
| 787 | 3300048906 | Ga0496103_0196537 | Ga0496103_0196537_429_1280 | 280 |
| 788 | 3300048907 | Ga0496104_0091868 | Ga0496104_0091868_1354_2205 | 280 |
| 789 | 3300048908 | Ga0496105_0005363 | Ga0496105_0005363_5074_5928 | 280 |
| 790 | 3300048908 | Ga0496105_0073262 | Ga0496105_0073262_763_1614 | 280 |
| 791 | 3300048909 | Ga0496106_0105462 | Ga0496106_0105462_1083_1937 | 280 |
| 792 | 3300048910 | Ga0496107_0100740 | Ga0496107_0100740_234_1088 | 280 |
| 793 | 3300048915 | Ga0496112_0001729 | Ga0496112_0001729_10031_10882 | 280 |
| 794 | 3300048916 | Ga0496113_0225172 | Ga0496113_0225172_360_1211 | 280 |
| 795 | 3300049744 | Ga0501083_0300733 | Ga0501083_0300733_174_1025 | 280 |
| 796 | 3300050512 | nmdc:mga0n895_124865_c1 | nmdc:mga0n895_124865_c1_1293_2147 | 280 |
| 797 | 3300050513 | nmdc:mga0rr50_107149_c1 | nmdc:mga0rr50_107149_c1_1331_2185 | 280 |
| 798 | 3300005434 | Ga0070709_10001162 | Ga0070709_100011624 | 281 |
| 799 | 3300005436 | Ga0070713_100002307 | Ga0070713_1000023072 | 281 |
| 800 | 3300005439 | Ga0070711_100030637 | Ga0070711_1000306373 | 281 |
| 801 | 3300005445 | Ga0070708_100245908 | Ga0070708_1002459082 | 281 |
| 802 | 3300005536 | Ga0070697_100177312 | Ga0070697_1001773121 | 281 |
| 803 | 3300005981 | Ga0081538_10004787 | Ga0081538_100047878 | 281 |
| 804 | 3300006173 | Ga0070716_100023487 | Ga0070716_1000234874 | 281 |
| 805 | 3300006175 | Ga0070712_100001119 | Ga0070712_10000111914 | 281 |
| 806 | 3300025910 | Ga0207684_10078135 | Ga0207684_100781351 | 281 |
| 807 | 3300025915 | Ga0207693_10002431 | Ga0207693_100024317 | 281 |
| 808 | 3300025916 | Ga0207663_10056451 | Ga0207663_100564512 | 281 |
| 809 | 3300025928 | Ga0207700_10006279 | Ga0207700_100062795 | 281 |
| 810 | 3300044673 | Ga0453683_0002798 | Ga0453683_0002798_7425_8282 | 281 |
| 811 | 3300005295 | Ga0065707_10176281 | Ga0065707_101762812 | 283 |
| 812 | 3300005436 | Ga0070713_100014557 | Ga0070713_1000145573 | 283 |
| 813 | 3300005437 | Ga0070710_10061053 | Ga0070710_100610531 | 283 |
| 814 | 3300005437 | Ga0070710_10236652 | Ga0070710_102366521 | 283 |
| 815 | 3300005439 | Ga0070711_100172618 | Ga0070711_1001726182 | 283 |
| 816 | 3300005518 | Ga0070699_100151824 | Ga0070699_1001518242 | 283 |
| 817 | 3300006173 | Ga0070716_100221598 | Ga0070716_1002215982 | 283 |
| 818 | 3300006175 | Ga0070712_100008180 | Ga0070712_1000081804 | 283 |
| 819 | 3300007265 | Ga0099794_10063610 | Ga0099794_100636102 | 283 |
| 820 | 3300010159 | Ga0099796_10000427 | Ga0099796_100004274 | 283 |
| 821 | 3300022730 | Ga0224570_100214 | Ga0224570_1002143 | 283 |
| 822 | 3300022732 | Ga0224569_100615 | Ga0224569_1006154 | 283 |
| 823 | 3300022734 | Ga0224571_100223 | Ga0224571_1002234 | 283 |
| 824 | 3300024225 | Ga0224572_1001725 | Ga0224572_10017251 | 283 |
| 825 | 3300024227 | Ga0228598_1000044 | Ga0228598_10000448 | 283 |
| 826 | 3300024227 | Ga0228598_1001333 | Ga0228598_10013332 | 283 |
| 827 | 3300025898 | Ga0207692_10013451 | Ga0207692_100134513 | 283 |
| 828 | 3300025898 | Ga0207692_10091051 | Ga0207692_100910511 | 283 |
| 829 | 3300025915 | Ga0207693_10009953 | Ga0207693_100099535 | 283 |
| 830 | 3300025916 | Ga0207663_10047053 | Ga0207663_100470533 | 283 |
| 831 | 3300025922 | Ga0207646_10410762 | Ga0207646_104107622 | 283 |
| 832 | 3300025928 | Ga0207700_10019351 | Ga0207700_100193516 | 283 |
| 833 | 3300027671 | Ga0209588_1007857 | Ga0209588_10078574 | 283 |
| 834 | 3300028016 | Ga0265354_1000756 | Ga0265354_10007563 | 283 |
| 835 | 3300028017 | Ga0265356_1000296 | Ga0265356_10002965 | 283 |
| 836 | 3300030760 | Ga0265762_1000130 | Ga0265762_100013013 | 283 |
| 837 | 3300030878 | Ga0265770_1000180 | Ga0265770_10001807 | 283 |
| 838 | 3300030879 | Ga0265765_1000179 | Ga0265765_10001793 | 283 |
| 839 | 3300031090 | Ga0265760_10001544 | Ga0265760_100015444 | 283 |
| 840 | 3300031090 | Ga0265760_10010701 | Ga0265760_100107014 | 283 |
| 841 | 3300031250 | Ga0265331_10090161 | Ga0265331_100901611 | 283 |
| 842 | 3300033547 | Ga0316212_1001140 | Ga0316212_10011402 | 283 |
| 843 | 3300033547 | Ga0316212_1009626 | Ga0316212_10096262 | 283 |
| 844 | 3300042876 | Ga0451577_0128481 | Ga0451577_0128481_567_1439 | 283 |
| 845 | 3300044673 | Ga0453683_0006940 | Ga0453683_0006940_3699_4571 | 283 |
| 846 | 3300044712 | Ga0453684_0022220 | Ga0453684_0022220_2082_2954 | 283 |
| 847 | 3300005546 | Ga0070696_100176927 | Ga0070696_1001769272 | 284 |
| 848 | 3300024227 | Ga0228598_1000070 | Ga0228598_10000703 | 284 |
| 849 | 3300030760 | Ga0265762_1028232 | Ga0265762_10282322 | 284 |
| 850 | 3300031711 | Ga0265314_10000509 | Ga0265314_100005099 | 284 |
| 851 | 3300050512 | nmdc:mga0n895_379390_c1 | nmdc:mga0n895_379390_c1_114_977 | 284 |
| 852 | 3300050515 | nmdc:mga0a205_518313_c1 | nmdc:mga0a205_518313_c1_78_941 | 284 |
| 853 | 3300003203 | JGI25406J46586_10002645 | JGI25406J46586_100026455 | 285 |
| 854 | 3300005293 | Ga0065715_10106597 | Ga0065715_101065972 | 285 |
| 855 | 3300005328 | Ga0070676_10219894 | Ga0070676_102198942 | 285 |
| 856 | 3300005468 | Ga0070707_100222816 | Ga0070707_1002228162 | 285 |
| 857 | 3300005471 | Ga0070698_100270311 | Ga0070698_1002703111 | 285 |
| 858 | 3300005545 | Ga0070695_100050386 | Ga0070695_1000503862 | 285 |
| 859 | 3300005985 | Ga0081539_10002905 | Ga0081539_100029056 | 285 |
| 860 | 3300006847 | Ga0075431_100399986 | Ga0075431_1003999862 | 285 |
| 861 | 3300006852 | Ga0075433_10013715 | Ga0075433_100137153 | 285 |
| 862 | 3300009147 | Ga0114129_10035231 | Ga0114129_100352315 | 285 |
| 863 | 3300009177 | Ga0105248_10002269 | Ga0105248_1000226917 | 285 |
| 864 | 3300025885 | Ga0207653_10016643 | Ga0207653_100166432 | 285 |
| 865 | 3300025922 | Ga0207646_10073817 | Ga0207646_100738172 | 285 |
| 866 | 3300025939 | Ga0207665_10113248 | Ga0207665_101132482 | 285 |
| 867 | 3300025941 | Ga0207711_10066415 | Ga0207711_100664153 | 285 |
| 868 | 3300026023 | Ga0207677_10319207 | Ga0207677_103192072 | 285 |
| 869 | 3300026035 | Ga0207703_10121586 | Ga0207703_101215863 | 285 |
| 870 | 3300026118 | Ga0207675_100342874 | Ga0207675_1003428742 | 285 |
| 871 | 3300031344 | Ga0265316_10006792 | Ga0265316_100067929 | 285 |
| 872 | 3300042439 | Ga0439464_0019508 | Ga0439464_0019508_851_1717 | 285 |
| 873 | 3300050507 | nmdc:mga05p37_171860_c1 | nmdc:mga05p37_171860_c1_1066_1932 | 285 |
| 874 | 3300050507 | nmdc:mga05p37_47597_c1 | nmdc:mga05p37_47597_c1_2405_3268 | 285 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1kqf-assembly1.cif.gz_C | formate dehydrogenase n from e. coli | 0.7196 | 64 | 285 |
| 1kqf-assembly1.cif.gz_C | formate dehydrogenase n from e. coli | 0.7105 | 64 | 285 |
| 6g94-assembly1.cif.gz_B | structure of e. coli hydrogenase-1 c19g variant in complex with cytochrome b | 0.5707 | 75 | 235 |
| 4gd3-assembly1.cif.gz_A | structure of e. coli hydrogenase-1 in complex with cytochrome b | 0.559 | 48 | 238 |
| 6g94-assembly1.cif.gz_B | structure of e. coli hydrogenase-1 c19g variant in complex with cytochrome b | 0.5495 | 75 | 235 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1kqgC00 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.723 | 64 | 285 | 1.20.950.20 |
| 1kqgC00 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.7139 | 64 | 285 | 1.20.950.20 |
| af_P77409_60_261_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.7069 | 66 | 254 | 1.20.950.20 |
| af_P0AEL0_1_211_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.6973 | 65 | 282 | 1.20.950.20 |
| af_P0AEL0_1_211_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.6768 | 65 | 282 | 1.20.950.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9QGW4-F1-model_v4 | Cytochrome B | 0.9594 | 1 | 268 |
GO:0005886
GO:0009055 GO:0020037 GO:0022904 GO:0046872 |
| AF-A0A7X2TZ38-F1-model_v4 | Cytochrome b/b6 domain-containing protein | 0.948 | 1 | 268 |
GO:0005886
GO:0009055 GO:0020037 GO:0022904 GO:0046872 |
| AF-A0A6B1BTH4-F1-model_v4 | Cytochrome b/b6 domain-containing protein | 0.9316 | 64 | 267 |
GO:0005886
GO:0009055 GO:0020037 GO:0022904 |
| AF-A0A7X2TZ38-F1-model_v4 | Cytochrome b/b6 domain-containing protein | 0.9246 | 1 | 268 |
GO:0005886
GO:0009055 GO:0020037 GO:0022904 GO:0046872 |
| AF-A0A2E9VAC3-F1-model_v4 | Cytochrome B | 0.9228 | 1 | 268 |
GO:0005886
GO:0009055 GO:0020037 GO:0022904 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar