F484308

General Info

Members Datasets Scaffolds Average Seq Length
874 373 1748 149

Family's Representative Sequence

Representative Sequence 3300046648|Ga0495611_0029615|Ga0495611_0029615_990_1508
Length 172
Sequence MDTFHPGPAQVASRQRCCIRYAGAMLADIAIRLKRLPHGQGLPLPAYATAHAAGMDVVAAEALTLAPGARHAVATGFAIAIPEGYEVQVRPRSGLALKHGVTCLNTPGTIDADYRGEVKVILANLGSEPFVIARGERIAQLVPAAVQRARFEEVELLDETVRGEGGFGSTGR

Samples

Sample ID Description Type Environment
1 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
167 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
174 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
178 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
193 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
194 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
195 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
196 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
198 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
199 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
202 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
208 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
219 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
220 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
221 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
222 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
223 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
224 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
225 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
226 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
227 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
228 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
229 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
230 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
231 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
232 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
233 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
234 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
235 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
236 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
237 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
238 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
239 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
240 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
241 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
242 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
243 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
244 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
245 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
246 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
247 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
248 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
249 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
250 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
251 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
252 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
253 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
254 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
255 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
256 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
257 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
258 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
259 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
260 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
261 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
262 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
263 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
276 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
277 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
278 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
279 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
280 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
281 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
282 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
283 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
284 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
285 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
286 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
288 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
289 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
290 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
291 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
292 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
306 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
307 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
310 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
311 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
312 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
313 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
314 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
315 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
316 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
317 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
318 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
319 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
320 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
321 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
322 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
323 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
324 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
329 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
330 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
331 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
332 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
333 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
334 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
335 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
336 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
337 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
338 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
339 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
340 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
341 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
342 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
343 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
344 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
345 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
346 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
347 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
348 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
349 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
350 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
351 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
352 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
353 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
354 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
355 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
356 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
357 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
358 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
359 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
360 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
361 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
362 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
363 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
364 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
365 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
366 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
367 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
368 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
369 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
370 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
371 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
372 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
373 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.71
Metatranscriptomes 0.46
Isolates 1.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.09
Nodule 0.11
Rhizoplane 1.95
Rhizosphere 85.13
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495611_0029615 3300046648 Bacteria 2401
2 JGI24740J21852_10005081 3300001979 Bacteria 5587
3 JGI24739J22299_10000986 3300001989 Bacteria 10619
4 JGI24739J22299_10007198 3300001989 Bacteria 4186
5 JGI24739J22299_10074953 3300001989 Bacteria 1047
6 JGI24737J22298_10000178 3300001990 Bacteria 20564
7 JGI24737J22298_10002030 3300001990 Bacteria 7240
8 JGI24735J21928_10105427 3300002067 Bacteria 810
9 JGI24750J21931_1070073 3300002070 Bacteria 572
10 JGI24745J21846_1012602 3300002073 Bacteria 971
11 JGI24738J21930_10000035 3300002075 Bacteria 25714
12 JGI24738J21930_10010010 3300002075 Bacteria 2120
13 JGI24749J21850_1000469 3300002076 Bacteria 5983
14 JGI24744J21845_10040748 3300002077 Bacteria 869
15 JGI24751J29686_10022773 3300002459 Bacteria 1299
16 JGI24751J29686_10110404 3300002459 Bacteria 576
17 rootH1_10116051 3300003316 Bacteria 1495
18 rootH1_10189427 3300003323 Unclassified 2493
19 Ga0055532_1015105 3300003758 Bacteria 857
20 Ga0065715_10431933 3300005293 Bacteria 846
21 Ga0065707_10314600 3300005295 Bacteria 978
22 Ga0070658_10000950 3300005327 Bacteria 24773
23 Ga0070658_10672602 3300005327 Bacteria 898
24 Ga0070658_10879731 3300005327 Bacteria 779
25 Ga0070658_10959707 3300005327 Bacteria 743
26 Ga0070676_10216327 3300005328 Bacteria 1263
27 Ga0070683_100001317 3300005329 Bacteria 18886
28 Ga0070683_100148591 3300005329 Bacteria 2221
29 Ga0070683_100251900 3300005329 Bacteria 1679
30 Ga0070683_100540705 3300005329 Bacteria 1114
31 Ga0070690_100021166 3300005330 Bacteria 3968
32 Ga0070690_100461119 3300005330 Bacteria 944
33 Ga0070670_100027055 3300005331 Bacteria 4933
34 Ga0070670_100083372 3300005331 Bacteria 2747
35 Ga0070670_100086486 3300005331 Bacteria 2693
36 Ga0070670_100139668 3300005331 Bacteria 2095
37 Ga0070670_100160167 3300005331 Bacteria 1950
38 Ga0070670_100949249 3300005331 Bacteria 781
39 Ga0070677_10012789 3300005333 Bacteria 2920
40 Ga0068869_100060475 3300005334 Bacteria 2776
41 Ga0068869_100843939 3300005334 Bacteria 790
42 Ga0070666_10002265 3300005335 Bacteria 11628
43 Ga0070666_10019253 3300005335 Bacteria 4403
44 Ga0070666_10027841 3300005335 Bacteria 3705
45 Ga0070666_10030176 3300005335 Bacteria 3570
46 Ga0070666_10123373 3300005335 Bacteria 1797
47 Ga0070680_100294773 3300005336 Bacteria 1375
48 Ga0070682_100282228 3300005337 Bacteria 1211
49 Ga0070660_100000260 3300005339 Bacteria 34947
50 Ga0070660_100037179 3300005339 Bacteria 3691
51 Ga0070660_100289081 3300005339 Bacteria 1342
52 Ga0070660_100293830 3300005339 Bacteria 1331
53 Ga0070689_100136046 3300005340 Bacteria 1973
54 Ga0070661_100000246 3300005344 Bacteria 44536
55 Ga0070661_100035625 3300005344 Bacteria 3615
56 Ga0070661_100181818 3300005344 Bacteria 1600
57 Ga0070661_100744837 3300005344 Bacteria 801
58 Ga0070692_10716495 3300005345 Bacteria 675
59 Ga0070668_100000028 3300005347 Bacteria 89707
60 Ga0070668_100000064 3300005347 Bacteria 65793
61 Ga0070668_100000468 3300005347 Bacteria 26737
62 Ga0070668_100004618 3300005347 Bacteria 10202
63 Ga0070668_100025986 3300005347 Bacteria 4440
64 Ga0070669_100001504 3300005353 Bacteria 16853
65 Ga0070669_100003371 3300005353 Bacteria 11487
66 Ga0070669_100182914 3300005353 Bacteria 1641
67 Ga0070669_100501148 3300005353 Bacteria 1007
68 Ga0070675_100019838 3300005354 Bacteria 5363
69 Ga0070675_100124634 3300005354 Bacteria 2191
70 Ga0070671_100000829 3300005355 Bacteria 22442
71 Ga0070671_100001575 3300005355 Bacteria 17171
72 Ga0070671_100005874 3300005355 Bacteria 9778
73 Ga0070671_100040285 3300005355 Bacteria 3880
74 Ga0070671_100187231 3300005355 Bacteria 1754
75 Ga0070671_100480140 3300005355 Bacteria 1068
76 Ga0070673_100004134 3300005364 Bacteria 9142
77 Ga0070673_100514552 3300005364 Bacteria 1084
78 Ga0070659_100000195 3300005366 Bacteria 46642
79 Ga0070659_100095743 3300005366 Bacteria 2384
80 Ga0070659_100261312 3300005366 Bacteria 1436
81 Ga0070659_100470982 3300005366 Bacteria 1068
82 Ga0070659_100531552 3300005366 Bacteria 1005
83 Ga0070659_100871826 3300005366 Bacteria 786
84 Ga0070659_101632690 3300005366 Bacteria 576
85 Ga0070667_100000003 3300005367 Bacteria 447715
86 Ga0070667_100000016 3300005367 Bacteria 237028
87 Ga0070667_100003644 3300005367 Bacteria 13107
88 Ga0070667_100004495 3300005367 Bacteria 11767
89 Ga0070667_100009905 3300005367 Bacteria 7901
90 Ga0070667_100012716 3300005367 Bacteria 6958
91 Ga0070714_100746496 3300005435 Bacteria 946
92 Ga0070713_100151733 3300005436 Bacteria 2062
93 Ga0070663_100002814 3300005455 Bacteria 9876
94 Ga0070678_100607394 3300005456 Bacteria 977
95 Ga0070662_100000047 3300005457 Bacteria 66967
96 Ga0070662_100002369 3300005457 Bacteria 11577
97 Ga0070681_10455323 3300005458 Bacteria 1192
98 Ga0068867_100016487 3300005459 Bacteria 5245
99 Ga0070685_10168672 3300005466 Bacteria 1401
100 Ga0070707_100482005 3300005468 Bacteria 1202
101 Ga0070679_100138866 3300005530 Bacteria 2411
102 Ga0070679_100386071 3300005530 Bacteria 1347
103 Ga0070679_101202095 3300005530 Bacteria 703
104 Ga0070684_100042567 3300005535 Bacteria 3921
105 Ga0070684_100126214 3300005535 Bacteria 2305
106 Ga0070684_100186503 3300005535 Bacteria 1886
107 Ga0070684_100611468 3300005535 Bacteria 1013
108 Ga0070684_100709370 3300005535 Bacteria 938
109 Ga0070684_101562541 3300005535 Bacteria 622
110 Ga0068853_100000033 3300005539 Bacteria 113700
111 Ga0068853_100129978 3300005539 Bacteria 2254
112 Ga0068853_100133526 3300005539 Bacteria 2223
113 Ga0068853_100209934 3300005539 Bacteria 1774
114 Ga0068853_101315307 3300005539 Bacteria 699
115 Ga0068853_101674325 3300005539 Bacteria 617
116 Ga0070672_100089311 3300005543 Bacteria 2483
117 Ga0070686_100000235 3300005544 Bacteria 37581
118 Ga0070686_100261290 3300005544 Bacteria 1269
119 Ga0070693_100010785 3300005547 Bacteria 4585
120 Ga0070665_100000038 3300005548 Bacteria 309230
121 Ga0070665_100000070 3300005548 Bacteria 200681
122 Ga0070665_100002115 3300005548 Bacteria 22199
123 Ga0070665_100032833 3300005548 Bacteria 5223
124 Ga0068855_100000531 3300005563 Bacteria 46681
125 Ga0068855_100001755 3300005563 Bacteria 27069
126 Ga0068855_100079313 3300005563 Bacteria 3808
127 Ga0068855_100781375 3300005563 Bacteria 1016
128 Ga0068855_101505804 3300005563 Bacteria 691
129 Ga0070664_100000242 3300005564 Bacteria 39241
130 Ga0070664_100041826 3300005564 Bacteria 3868
131 Ga0070664_100149870 3300005564 Bacteria 2059
132 Ga0068857_100001908 3300005577 Bacteria 16796
133 Ga0068857_100053309 3300005577 Bacteria 3588
134 Ga0068857_100123472 3300005577 Bacteria 2333
135 Ga0068857_100124422 3300005577 Bacteria 2323
136 Ga0068857_100209124 3300005577 Bacteria 1780
137 Ga0068854_100006502 3300005578 Bacteria 7437
138 Ga0068854_100010181 3300005578 Bacteria 6094
139 Ga0068854_100033722 3300005578 Bacteria 3570
140 Ga0068854_100126047 3300005578 Bacteria 1950
141 Ga0068854_100698189 3300005578 Bacteria 875
142 Ga0068854_101903278 3300005578 Bacteria 547
143 Ga0068856_100000162 3300005614 Bacteria 69640
144 Ga0068856_100920639 3300005614 Bacteria 893
145 Ga0068856_101178185 3300005614 Bacteria 783
146 Ga0070702_100184049 3300005615 Bacteria 1369
147 Ga0068852_100000471 3300005616 Bacteria 26414
148 Ga0068852_100003956 3300005616 Bacteria 10413
149 Ga0068852_100143413 3300005616 Bacteria 2213
150 Ga0068852_100280612 3300005616 Bacteria 1606
151 Ga0068852_100532334 3300005616 Bacteria 1173
152 Ga0068852_100921900 3300005616 Bacteria 891
153 Ga0068859_100045654 3300005617 Bacteria 4401
154 Ga0068859_100163402 3300005617 Bacteria 2306
155 Ga0068859_100216750 3300005617 Bacteria 2002
156 Ga0068859_100228159 3300005617 Bacteria 1950
157 Ga0068859_100270285 3300005617 Bacteria 1792
158 Ga0068859_100471064 3300005617 Bacteria 1351
159 Ga0068859_100521586 3300005617 Bacteria 1283
160 Ga0068859_101543891 3300005617 Bacteria 733
161 Ga0068859_101549848 3300005617 Bacteria 732
162 Ga0068859_101842040 3300005617 Bacteria 668
163 Ga0068859_102528791 3300005617 Bacteria 565
164 Ga0068864_100015986 3300005618 Bacteria 6244
165 Ga0068864_100032381 3300005618 Bacteria 4442
166 Ga0068864_100056815 3300005618 Bacteria 3381
167 Ga0068861_100029338 3300005719 Bacteria 4025
168 Ga0068861_100116342 3300005719 Bacteria 2150
169 Ga0068851_10031330 3300005834 Bacteria 2641
170 Ga0068851_10415195 3300005834 Bacteria 794
171 Ga0068863_100000052 3300005841 Bacteria 125430
172 Ga0068863_100000092 3300005841 Bacteria 97076
173 Ga0068863_100000727 3300005841 Bacteria 33031
174 Ga0068863_100002981 3300005841 Bacteria 16743
175 Ga0068863_100062680 3300005841 Bacteria 3516
176 Ga0068863_100066588 3300005841 Bacteria 3407
177 Ga0068863_100100169 3300005841 Bacteria 2754
178 Ga0068863_100177476 3300005841 Bacteria 2044
179 Ga0068858_100000892 3300005842 Bacteria 30965
180 Ga0068858_100009735 3300005842 Bacteria 9154
181 Ga0068858_100015627 3300005842 Bacteria 7139
182 Ga0068858_100133549 3300005842 Bacteria 2328
183 Ga0068858_100415136 3300005842 Bacteria 1294
184 Ga0068860_100000007 3300005843 Bacteria 429329
185 Ga0068860_100000045 3300005843 Bacteria 223252
186 Ga0068860_100000196 3300005843 Bacteria 97096
187 Ga0068860_100006131 3300005843 Bacteria 12091
188 Ga0068860_100010108 3300005843 Bacteria 9349
189 Ga0068860_100076639 3300005843 Bacteria 3180
190 Ga0068860_100167035 3300005843 Bacteria 2124
191 Ga0068860_100595112 3300005843 Bacteria 1111
192 Ga0068860_101474580 3300005843 Bacteria 702
193 Ga0068862_100000385 3300005844 Bacteria 47562
194 Ga0068862_100000877 3300005844 Bacteria 29301
195 Ga0068862_100007339 3300005844 Bacteria 9155
196 Ga0068862_100011387 3300005844 Bacteria 7341
197 Ga0068862_100039746 3300005844 Bacteria 3997
198 Ga0068862_100103090 3300005844 Bacteria 2498
199 Ga0068862_100132959 3300005844 Bacteria 2202
200 Ga0068862_100152714 3300005844 Bacteria 2056
201 Ga0081455_10061870 3300005937 Bacteria 3148
202 Ga0075368_10000152 3300006042 Bacteria 18566
203 Ga0075363_100002645 3300006048 Bacteria 7386
204 Ga0075363_100050909 3300006048 Bacteria 2207
205 Ga0075364_10087542 3300006051 Bacteria 2064
206 Ga0075364_10658184 3300006051 Bacteria 715
207 Ga0075362_10042057 3300006177 Bacteria 2018
208 Ga0075362_10137077 3300006177 Bacteria 1168
209 Ga0075367_10000134 3300006178 Bacteria 22041
210 Ga0075367_10075854 3300006178 Bacteria 2028
211 Ga0075369_10003510 3300006186 Bacteria 5708
212 Ga0075366_10071053 3300006195 Bacteria 2074
213 Ga0075366_10130440 3300006195 Bacteria 1517
214 Ga0075366_10262904 3300006195 Bacteria 1053
215 Ga0075366_10303107 3300006195 Bacteria 977
216 Ga0097621_100039279 3300006237 Bacteria 3801
217 Ga0097621_100171752 3300006237 Bacteria 1869
218 Ga0097621_100934274 3300006237 Bacteria 809
219 Ga0075370_10057671 3300006353 Bacteria 2207
220 Ga0075370_10203751 3300006353 Bacteria 1167
221 Ga0075370_10622442 3300006353 Bacteria 654
222 Ga0068871_100108292 3300006358 Bacteria 2335
223 Ga0068871_100145109 3300006358 Bacteria 2020
224 Ga0075430_100210608 3300006846 Bacteria 1613
225 Ga0075434_100100221 3300006871 Bacteria 2903
226 Ga0075434_100627907 3300006871 Bacteria 1093
227 Ga0075434_102457447 3300006871 Bacteria 523
228 Ga0068865_100087005 3300006881 Bacteria 2257
229 Ga0075436_100714259 3300006914 Bacteria 743
230 Ga0097620_100020395 3300006931 Bacteria 6653
231 Ga0097620_100045653 3300006931 Bacteria 4401
232 Ga0097620_100163398 3300006931 Bacteria 2306
233 Ga0097620_100216746 3300006931 Bacteria 2002
234 Ga0097620_100228162 3300006931 Bacteria 1950
235 Ga0097620_100270299 3300006931 Bacteria 1792
236 Ga0097620_100471065 3300006931 Bacteria 1351
237 Ga0097620_100521583 3300006931 Bacteria 1283
238 Ga0097620_101543352 3300006931 Bacteria 733
239 Ga0097620_101549883 3300006931 Bacteria 732
240 Ga0097620_101842897 3300006931 Bacteria 668
241 Ga0097620_102530419 3300006931 Bacteria 565
242 Ga0105251_10005582 3300009011 Bacteria 8183
243 Ga0105240_10066895 3300009093 Bacteria 4456
244 Ga0105240_10087616 3300009093 Bacteria 3812
245 Ga0105240_10150868 3300009093 Bacteria 2768
246 Ga0105240_10684580 3300009093 Bacteria 1121
247 Ga0105245_10000285 3300009098 Bacteria 48237
248 Ga0105245_10169598 3300009098 Bacteria 2078
249 Ga0105247_10051194 3300009101 Bacteria 2542
250 Ga0105247_10160341 3300009101 Bacteria 1489
251 Ga0105247_10238002 3300009101 Bacteria 1239
252 Ga0105243_10038024 3300009148 Bacteria 3746
253 Ga0105241_10245403 3300009174 Bacteria 1516
254 Ga0105241_12231835 3300009174 Bacteria 543
255 Ga0105248_10000659 3300009177 Bacteria 39245
256 Ga0105248_10011429 3300009177 Bacteria 9784
257 Ga0105248_10161443 3300009177 Bacteria 2528
258 Ga0105248_10225459 3300009177 Bacteria 2109
259 Ga0105248_11980827 3300009177 Bacteria 662
260 Ga0105248_13001525 3300009177 Bacteria 537
261 Ga0105237_10710107 3300009545 Bacteria 1012
262 Ga0105238_10008171 3300009551 Bacteria 10468
263 Ga0105238_10038975 3300009551 Bacteria 4822
264 Ga0105238_10253224 3300009551 Bacteria 1739
265 Ga0105238_10672731 3300009551 Bacteria 1046
266 Ga0105238_12135921 3300009551 Bacteria 594
267 Ga0105249_10000574 3300009553 Bacteria 33721
268 Ga0105249_10056713 3300009553 Bacteria 3587
269 Ga0105249_10088658 3300009553 Bacteria 2890
270 Ga0105249_10854049 3300009553 Bacteria 976
271 Ga0105239_10011926 3300010375 Bacteria 9695
272 Ga0105239_10130902 3300010375 Bacteria 2791
273 Ga0105239_10580364 3300010375 Bacteria 1278
274 Ga0105239_11365987 3300010375 Bacteria 818
275 Ga0105246_10184144 3300011119 Bacteria 1611
276 Ga0157373_10022263 3300013100 Bacteria 4599
277 Ga0157373_10050159 3300013100 Bacteria 2973
278 Ga0157373_10068400 3300013100 Bacteria 2510
279 Ga0157373_10155580 3300013100 Bacteria 1608
280 Ga0157373_10299862 3300013100 Bacteria 1140
281 Ga0157373_10723507 3300013100 Bacteria 730
282 Ga0157373_10918408 3300013100 Bacteria 650
283 Ga0157371_10014963 3300013102 Bacteria 5836
284 Ga0157371_10079335 3300013102 Bacteria 2325
285 Ga0157371_10091128 3300013102 Bacteria 2159
286 Ga0157371_10180439 3300013102 Bacteria 1510
287 Ga0157371_10313661 3300013102 Bacteria 1137
288 Ga0157371_10356052 3300013102 Bacteria 1066
289 Ga0157370_10036970 3300013104 Bacteria 4736
290 Ga0157370_10334480 3300013104 Bacteria 1396
291 Ga0157370_10384626 3300013104 Bacteria 1292
292 Ga0157369_10017738 3300013105 Bacteria 7995
293 Ga0157369_10022100 3300013105 Bacteria 7106
294 Ga0157369_10101220 3300013105 Bacteria 3071
295 Ga0157369_10126550 3300013105 Bacteria 2708
296 Ga0157369_10419918 3300013105 Bacteria 1386
297 Ga0157369_10427958 3300013105 Bacteria 1372
298 Ga0157369_10996038 3300013105 Bacteria 858
299 Ga0157374_10922535 3300013296 Bacteria 891
300 Ga0157378_10028389 3300013297 Bacteria 4936
301 Ga0157378_10029855 3300013297 Bacteria 4814
302 Ga0163162_10000077 3300013306 Viruses 90095
303 Ga0163162_10020508 3300013306 Bacteria 6495
304 Ga0163162_10392518 3300013306 Bacteria 1520
305 Ga0157372_10005572 3300013307 Bacteria 13383
306 Ga0157372_10047838 3300013307 Bacteria 4753
307 Ga0157372_10354969 3300013307 Bacteria 1708
308 Ga0157372_10361528 3300013307 Bacteria 1691
309 Ga0157372_10472375 3300013307 Bacteria 1462
310 Ga0157375_11138896 3300013308 Bacteria 914
311 Ga0157375_11821260 3300013308 Bacteria 722
312 Ga0163163_10000273 3300014325 Bacteria 51622
313 Ga0157380_10003514 3300014326 Bacteria 10769
314 Ga0157380_10726996 3300014326 Bacteria 1001
315 Ga0157377_10597970 3300014745 Bacteria 786
316 Ga0157379_10099121 3300014968 Bacteria 2616
317 Ga0157376_12087936 3300014969 Bacteria 605
318 Ga0206356_10192360 3300020070 Bacteria 2814
319 Ga0206354_10727992 3300020081 Bacteria 8937
320 Ga0206353_11090631 3300020082 Bacteria 8670
321 Ga0213873_10000009 3300021358 Bacteria 237102
322 Ga0213876_10000004 3300021384 Bacteria 943822
323 Ga0213876_10008570 3300021384 Bacteria 5535
324 Ga0209147_100921 3300025229 Bacteria 13170
325 Ga0207697_10000881 3300025315 Bacteria 16992
326 Ga0207697_10083317 3300025315 Bacteria 1349
327 Ga0207656_10004743 3300025321 Bacteria 4768
328 Ga0207656_10560469 3300025321 Bacteria 582
329 Ga0207713_1002734 3300025735 Bacteria 12572
330 Ga0207710_10138298 3300025900 Bacteria 1174
331 Ga0207688_10000317 3300025901 Bacteria 22230
332 Ga0207680_10001920 3300025903 Bacteria 9744
333 Ga0207680_10018954 3300025903 Bacteria 3672
334 Ga0207680_10026804 3300025903 Bacteria 3199
335 Ga0207680_10140136 3300025903 Bacteria 1603
336 Ga0207680_10140625 3300025903 Bacteria 1600
337 Ga0207647_10000253 3300025904 Bacteria 43758
338 Ga0207647_10006748 3300025904 Bacteria 8332
339 Ga0207647_10050706 3300025904 Bacteria 2568
340 Ga0207647_10076958 3300025904 Bacteria 2006
341 Ga0207647_10153480 3300025904 Bacteria 1345
342 Ga0207705_10000062 3300025909 Bacteria 149432
343 Ga0207705_10034240 3300025909 Bacteria 3631
344 Ga0207705_10050994 3300025909 Bacteria 2979
345 Ga0207654_10092434 3300025911 Bacteria 1847
346 Ga0207654_10199835 3300025911 Bacteria 1316
347 Ga0207654_10298773 3300025911 Bacteria 1094
348 Ga0207707_10096206 3300025912 Bacteria 2588
349 Ga0207707_10450058 3300025912 Bacteria 1102
350 Ga0207707_10901100 3300025912 Bacteria 731
351 Ga0207695_10013403 3300025913 Bacteria 9779
352 Ga0207695_10271142 3300025913 Bacteria 1593
353 Ga0207695_10614868 3300025913 Bacteria 968
354 Ga0207660_10041658 3300025917 Bacteria 3219
355 Ga0207660_11032129 3300025917 Bacteria 670
356 Ga0207657_10000403 3300025919 Bacteria 45863
357 Ga0207657_10000946 3300025919 Bacteria 30768
358 Ga0207657_10005971 3300025919 Bacteria 12670
359 Ga0207657_10013271 3300025919 Bacteria 8083
360 Ga0207657_10119775 3300025919 Bacteria 2166
361 Ga0207657_10139818 3300025919 Bacteria 1979
362 Ga0207657_10201408 3300025919 Bacteria 1601
363 Ga0207657_10430477 3300025919 Bacteria 1036
364 Ga0207649_10000230 3300025920 Bacteria 45560
365 Ga0207649_10057862 3300025920 Bacteria 2425
366 Ga0207649_10154061 3300025920 Bacteria 1586
367 Ga0207649_10391836 3300025920 Bacteria 1037
368 Ga0207649_10812423 3300025920 Bacteria 730
369 Ga0207652_10628159 3300025921 Bacteria 962
370 Ga0207681_10003582 3300025923 Bacteria 9670
371 Ga0207681_10003999 3300025923 Bacteria 9150
372 Ga0207681_10135485 3300025923 Bacteria 1827
373 Ga0207681_10190801 3300025923 Bacteria 1568
374 Ga0207694_10001776 3300025924 Bacteria 18021
375 Ga0207694_10004075 3300025924 Bacteria 11490
376 Ga0207694_10474597 3300025924 Bacteria 1046
377 Ga0207650_10020484 3300025925 Bacteria 4665
378 Ga0207650_10062456 3300025925 Bacteria 2783
379 Ga0207650_10081795 3300025925 Bacteria 2450
380 Ga0207659_10035708 3300025926 Bacteria 3438
381 Ga0207659_10265706 3300025926 Bacteria 1398
382 Ga0207687_10007641 3300025927 Bacteria 7107
383 Ga0207664_11031449 3300025929 Bacteria 737
384 Ga0207644_10000125 3300025931 Bacteria 56447
385 Ga0207644_10000569 3300025931 Bacteria 23672
386 Ga0207644_10020991 3300025931 Bacteria 4446
387 Ga0207644_10032656 3300025931 Bacteria 3633
388 Ga0207644_10035130 3300025931 Bacteria 3510
389 Ga0207644_10292079 3300025931 Bacteria 1311
390 Ga0207644_10430088 3300025931 Bacteria 1082
391 Ga0207690_10000155 3300025932 Bacteria 53735
392 Ga0207690_10080730 3300025932 Bacteria 2270
393 Ga0207690_10084474 3300025932 Bacteria 2225
394 Ga0207690_10781949 3300025932 Bacteria 788
395 Ga0207706_10000342 3300025933 Bacteria 50517
396 Ga0207706_10000643 3300025933 Bacteria 37034
397 Ga0207670_10113087 3300025936 Bacteria 1960
398 Ga0207704_10029226 3300025938 Bacteria 3070
399 Ga0207691_10000848 3300025940 Bacteria 30357
400 Ga0207691_10108497 3300025940 Bacteria 2470
401 Ga0207711_10006705 3300025941 Bacteria 9690
402 Ga0207711_10014364 3300025941 Bacteria 6576
403 Ga0207711_10016073 3300025941 Bacteria 6210
404 Ga0207711_10292234 3300025941 Bacteria 1502
405 Ga0207689_10000017 3300025942 Bacteria 117159
406 Ga0207689_10153331 3300025942 Bacteria 1899
407 Ga0207661_10000947 3300025944 Bacteria 19105
408 Ga0207661_10012302 3300025944 Bacteria 6215
409 Ga0207661_10436692 3300025944 Bacteria 1191
410 Ga0207679_10000213 3300025945 Bacteria 45916
411 Ga0207679_10049081 3300025945 Bacteria 3077
412 Ga0207667_10001300 3300025949 Bacteria 31316
413 Ga0207667_10001543 3300025949 Bacteria 28962
414 Ga0207667_10180783 3300025949 Bacteria 2166
415 Ga0207667_10485200 3300025949 Bacteria 1254
416 Ga0207667_11151997 3300025949 Bacteria 757
417 Ga0207651_10002101 3300025960 Bacteria 9407
418 Ga0207712_10000476 3300025961 Bacteria 33733
419 Ga0207712_10057347 3300025961 Bacteria 2748
420 Ga0207712_10159561 3300025961 Bacteria 1751
421 Ga0207712_10314157 3300025961 Bacteria 1290
422 Ga0207668_10000030 3300025972 Bacteria 122797
423 Ga0207668_10000076 3300025972 Bacteria 75056
424 Ga0207668_10001049 3300025972 Bacteria 16486
425 Ga0207668_10003547 3300025972 Bacteria 9173
426 Ga0207668_10034211 3300025972 Bacteria 3373
427 Ga0207668_10113134 3300025972 Bacteria 2040
428 Ga0207668_10158411 3300025972 Bacteria 1761
429 Ga0207640_10013642 3300025981 Bacteria 4663
430 Ga0207640_10015320 3300025981 Bacteria 4435
431 Ga0207640_10068231 3300025981 Bacteria 2382
432 Ga0207640_10164718 3300025981 Bacteria 1645
433 Ga0207640_10915216 3300025981 Bacteria 767
434 Ga0207640_11775412 3300025981 Bacteria 557
435 Ga0207658_10000002 3300025986 Bacteria 1364188
436 Ga0207658_10000075 3300025986 Bacteria 109004
437 Ga0207658_10005000 3300025986 Bacteria 9134
438 Ga0207658_10005408 3300025986 Bacteria 8761
439 Ga0207658_10029070 3300025986 Bacteria 3898
440 Ga0207658_10060416 3300025986 Bacteria 2828
441 Ga0207658_10075950 3300025986 Bacteria 2558
442 Ga0207658_10878567 3300025986 Bacteria 816
443 Ga0207677_11214999 3300026023 Bacteria 690
444 Ga0207703_10000358 3300026035 Bacteria 49140
445 Ga0207703_10077833 3300026035 Bacteria 2754
446 Ga0207703_10108548 3300026035 Bacteria 2364
447 Ga0207703_10271113 3300026035 Bacteria 1537
448 Ga0207639_10000199 3300026041 Bacteria 45241
449 Ga0207639_10000347 3300026041 Bacteria 32007
450 Ga0207639_10094150 3300026041 Bacteria 2404
451 Ga0207639_10159640 3300026041 Bacteria 1898
452 Ga0207639_10175880 3300026041 Bacteria 1817
453 Ga0207639_10384484 3300026041 Bacteria 1261
454 Ga0207639_10739372 3300026041 Bacteria 914
455 Ga0207639_10979968 3300026041 Bacteria 791
456 Ga0207678_10137305 3300026067 Bacteria 2086
457 Ga0207678_10431540 3300026067 Bacteria 1143
458 Ga0207708_10375209 3300026075 Bacteria 1172
459 Ga0207702_10000496 3300026078 Bacteria 44248
460 Ga0207702_10098715 3300026078 Bacteria 2573
461 Ga0207702_10355059 3300026078 Bacteria 1404
462 Ga0207702_10617275 3300026078 Bacteria 1065
463 Ga0207702_11267867 3300026078 Bacteria 731
464 Ga0207702_11297307 3300026078 Bacteria 722
465 Ga0207641_10000004 3300026088 Bacteria 481088
466 Ga0207641_10000042 3300026088 Bacteria 186384
467 Ga0207641_10000720 3300026088 Bacteria 35557
468 Ga0207641_10000959 3300026088 Bacteria 29576
469 Ga0207641_10004191 3300026088 Bacteria 12564
470 Ga0207641_10043172 3300026088 Bacteria 3785
471 Ga0207641_10080673 3300026088 Bacteria 2823
472 Ga0207641_10253550 3300026088 Bacteria 1644
473 Ga0207641_10572491 3300026088 Bacteria 1103
474 Ga0207641_10935034 3300026088 Bacteria 862
475 Ga0207648_10001216 3300026089 Bacteria 28854
476 Ga0207676_10001237 3300026095 Bacteria 19005
477 Ga0207676_10019321 3300026095 Bacteria 4969
478 Ga0207676_10026624 3300026095 Bacteria 4300
479 Ga0207676_10802081 3300026095 Bacteria 918
480 Ga0207674_10000945 3300026116 Bacteria 37959
481 Ga0207674_10005054 3300026116 Bacteria 15745
482 Ga0207674_10006327 3300026116 Bacteria 13948
483 Ga0207674_10013895 3300026116 Bacteria 8909
484 Ga0207674_10099138 3300026116 Bacteria 2896
485 Ga0207674_10171056 3300026116 Bacteria 2126
486 Ga0207674_10193815 3300026116 Bacteria 1982
487 Ga0207674_10268205 3300026116 Bacteria 1654
488 Ga0207675_100046539 3300026118 Bacteria 4053
489 Ga0207675_100056638 3300026118 Bacteria 3656
490 Ga0207698_10000427 3300026142 Bacteria 24235
491 Ga0207698_10015214 3300026142 Bacteria 5148
492 Ga0207698_10334046 3300026142 Bacteria 1425
493 Ga0207698_10673859 3300026142 Bacteria 1027
494 Ga0207698_10720843 3300026142 Bacteria 994
495 Ga0209813_10000017 3300027866 Bacteria 75687
496 Ga0209813_10000082 3300027866 Bacteria 34870
497 Ga0209974_10034832 3300027876 Bacteria 1672
498 Ga0268266_10000118 3300028379 Bacteria 163466
499 Ga0268266_10000309 3300028379 Bacteria 77336
500 Ga0268266_10002431 3300028379 Bacteria 20016
501 Ga0268266_10005364 3300028379 Bacteria 11980
502 Ga0268266_10122751 3300028379 Bacteria 2313
503 Ga0268265_10000424 3300028380 Bacteria 45348
504 Ga0268265_10000469 3300028380 Bacteria 42727
505 Ga0268265_10028122 3300028380 Bacteria 4022
506 Ga0268265_10084403 3300028380 Bacteria 2517
507 Ga0268265_10108110 3300028380 Bacteria 2263
508 Ga0268265_10149817 3300028380 Bacteria 1966
509 Ga0268265_10219792 3300028380 Bacteria 1661
510 Ga0268265_10501821 3300028380 Bacteria 1143
511 Ga0268265_10937659 3300028380 Bacteria 852
512 Ga0268264_10000087 3300028381 Bacteria 236696
513 Ga0268264_10000091 3300028381 Bacteria 233338
514 Ga0268264_10000101 3300028381 Bacteria 225109
515 Ga0268264_10000134 3300028381 Bacteria 179475
516 Ga0268264_10011832 3300028381 Bacteria 7193
517 Ga0268264_10053504 3300028381 Bacteria 3368
518 Ga0268264_10153593 3300028381 Bacteria 2066
519 Ga0307517_10187486 3300028786 Bacteria 1321
520 Ga0265338_10199094 3300028800 Bacteria 1512
521 Ga0265331_10059525 3300031250 Bacteria 1806
522 Ga0265327_10047419 3300031251 Bacteria 2268
523 Ga0307513_10109817 3300031456 Bacteria 2755
524 Ga0307408_100010852 3300031548 Bacteria 6011
525 Ga0307408_100105234 3300031548 Bacteria 2157
526 Ga0307408_100492285 3300031548 Bacteria 1072
527 Ga0307408_100916674 3300031548 Bacteria 803
528 Ga0307408_101114027 3300031548 Bacteria 733
529 Ga0265313_10255408 3300031595 Bacteria 714
530 Ga0316575_10001316 3300031665 Bacteria 7930
531 Ga0316575_10439230 3300031665 Bacteria 562
532 Ga0265314_10015740 3300031711 Bacteria 5992
533 Ga0307516_10152207 3300031730 Bacteria 2072
534 Ga0307405_10029770 3300031731 Bacteria 3194
535 Ga0307405_10145134 3300031731 Bacteria 1661
536 Ga0307405_11099492 3300031731 Bacteria 683
537 Ga0307413_10105216 3300031824 Bacteria 1875
538 Ga0307413_10818549 3300031824 Bacteria 784
539 Ga0307413_10985474 3300031824 Bacteria 721
540 Ga0307410_10014693 3300031852 Bacteria 4618
541 Ga0307406_10118407 3300031901 Bacteria 1836
542 Ga0307406_10431377 3300031901 Bacteria 1053
543 Ga0307406_10728889 3300031901 Bacteria 830
544 Ga0307406_11020277 3300031901 Bacteria 711
545 Ga0307407_10286441 3300031903 Bacteria 1143
546 Ga0307407_10822272 3300031903 Bacteria 708
547 Ga0307412_10160407 3300031911 Bacteria 1670
548 Ga0307412_10245213 3300031911 Bacteria 1388
549 Ga0307412_10471254 3300031911 Bacteria 1039
550 Ga0307412_11388979 3300031911 Bacteria 635
551 Ga0307409_100018325 3300031995 Bacteria 4703
552 Ga0307409_100065368 3300031995 Bacteria 2862
553 Ga0307409_100600216 3300031995 Bacteria 1088
554 Ga0307409_101338017 3300031995 Bacteria 742
555 Ga0307416_100016385 3300032002 Bacteria 5151
556 Ga0307416_100061652 3300032002 Bacteria 3062
557 Ga0307416_100824235 3300032002 Bacteria 1025
558 Ga0307414_10005500 3300032004 Bacteria 6982
559 Ga0307414_10084360 3300032004 Bacteria 2336
560 Ga0307414_10370744 3300032004 Bacteria 1235
561 Ga0307414_10393213 3300032004 Bacteria 1202
562 Ga0307414_10475099 3300032004 Bacteria 1101
563 Ga0307414_11192195 3300032004 Bacteria 705
564 Ga0307411_10010117 3300032005 Bacteria 5007
565 Ga0307411_10434007 3300032005 Bacteria 1094
566 Ga0307415_100418905 3300032126 Bacteria 1149
567 Ga0316583_10012845 3300032133 Bacteria 3022
568 Ga0373959_0015955 3300034820 Bacteria 1386
569 Ga0373938_0064894 3300034957 Bacteria 861
570 Ga0373934_0303686 3300035086 Bacteria 662
571 Ga0373923_0004387 3300035111 Bacteria 4675
572 Ga0373923_0106023 3300035111 Bacteria 1244
573 Ga0373956_0010017 3300035119 Bacteria 3868
574 Ga0373957_0017656 3300035120 Bacteria 2489
575 Ga0373960_0015422 3300035121 Bacteria 1951
576 Ga0373955_0002366 3300035172 Bacteria 8205
577 Ga0373942_0048300 3300035207 Bacteria 1185
578 Ga0373962_0096931 3300035242 Bacteria 915
579 Ga0373931_0047725 3300035691 Bacteria 2267
580 Ga0373935_0547913 3300035692 Bacteria 843
581 Ga0373933_0086952 3300035724 Bacteria 1924
582 Ga0373937_0006632 3300036401 Bacteria 9994
583 Ga0316582_0224828 3300036647 Bacteria 1284
584 Ga0316582_0889782 3300036647 Unclassified 609
585 Ga0316584_0024034 3300036712 Bacteria 4456
586 Ga0373925_0256850 3300037068 Bacteria 1403
587 Ga0395899_0037881 3300037312 Bacteria 3614
588 Ga0395899_0046407 3300037312 Bacteria 3236
589 Ga0395899_0076741 3300037312 Bacteria 2438
590 Ga0395899_0076776 3300037312 Bacteria 2438
591 Ga0395899_0110916 3300037312 Bacteria 1972
592 Ga0395899_0388300 3300037312 Bacteria 926
593 Ga0395899_0396896 3300037312 Bacteria 913
594 Ga0395900_0000209 3300037418 Bacteria 91678
595 Ga0395900_0052961 3300037418 Bacteria 4177
596 Ga0395900_0084617 3300037418 Bacteria 3259
597 Ga0395900_0139753 3300037418 Bacteria 2480
598 Ga0395900_0167894 3300037418 Bacteria 2235
599 Ga0395900_0242926 3300037418 Bacteria 1805
600 Ga0395900_0348972 3300037418 Bacteria 1453
601 Ga0395900_0367241 3300037418 Bacteria 1409
602 Ga0395900_0727841 3300037418 Bacteria 924
603 Ga0395900_0833971 3300037418 Bacteria 848
604 Ga0395900_0972316 3300037418 Bacteria 770
605 Ga0395898_0004531 3300037466 Bacteria 15168
606 Ga0395898_0038647 3300037466 Bacteria 4728
607 Ga0395898_0230714 3300037466 Bacteria 1765
608 Ga0395898_0244719 3300037466 Bacteria 1710
609 Ga0395898_0369396 3300037466 Bacteria 1368
610 Ga0395898_0591404 3300037466 Bacteria 1052
611 Ga0395898_1363132 3300037466 Bacteria 637
612 Ga0395905_0008172 3300037471 Bacteria 10331
613 Ga0395905_0025304 3300037471 Bacteria 5597
614 Ga0395905_0050182 3300037471 Bacteria 3910
615 Ga0395905_0096517 3300037471 Bacteria 2775
616 Ga0395905_0103309 3300037471 Bacteria 2675
617 Ga0395905_0208157 3300037471 Bacteria 1833
618 Ga0395905_0306413 3300037471 Bacteria 1476
619 Ga0395905_0439178 3300037471 Bacteria 1202
620 Ga0395905_0864200 3300037471 Bacteria 807
621 Ga0395905_1373346 3300037471 Bacteria 610
622 Ga0395905_1492281 3300037471 Bacteria 580
623 Ga0395905_1747883 3300037471 Bacteria 527
624 Ga0436364_0619037 3300037853 Bacteria 1986
625 Ga0395901_0008144 3300038443 Bacteria 10588
626 Ga0395901_0134144 3300038443 Bacteria 2602
627 Ga0395901_0282727 3300038443 Bacteria 1723
628 Ga0395901_0288212 3300038443 Bacteria 1704
629 Ga0395901_0330994 3300038443 Bacteria 1574
630 Ga0395901_0511359 3300038443 Bacteria 1221
631 Ga0395901_0611927 3300038443 Bacteria 1097
632 Ga0395901_0967425 3300038443 Bacteria 829
633 Ga0395901_1103085 3300038443 Bacteria 764
634 Ga0436365_0192103 3300039437 Bacteria 182879
635 Ga0436365_0410983 3300039437 Bacteria 18944
636 Ga0436363_0930037 3300039450 Bacteria 682
637 Ga0436362_0383697 3300039453 Bacteria 74416
638 Ga0439447_000009 3300041407 Unclassified 90162
639 Ga0439453_0005321 3300041408 Bacteria 1955
640 Ga0439466_0009170 3300041411 Viruses 3707
641 Ga0451791_1678702 3300041451 Bacteria 622
642 Ga0451800_1418878 3300041459 Bacteria 551
643 Ga0451853_3208052 3300041512 Bacteria 606
644 Ga0439446_0146374 3300042156 Unclassified 774
645 Ga0439434_0109128 3300042435 Bacteria 895
646 Ga0451577_0003514 3300042876 Bacteria 17371
647 Ga0466969_0108133 3300044656 Bacteria 1304
648 Ga0466963_0085421 3300044694 Bacteria 2142
649 Ga0466957_0085985 3300044842 Bacteria 1965
650 Ga0466959_0104571 3300045049 Bacteria 2025
651 Ga0451576_0008302 3300045051 Bacteria 12207
652 Ga0451576_0264872 3300045051 Bacteria 1796
653 Ga0495617_074497 3300046452 Bacteria 1114
654 Ga0495627_000570 3300046453 Bacteria 29747
655 Ga0495627_001851 3300046453 Bacteria 11213
656 Ga0495638_0123113 3300046460 Bacteria 1531
657 Ga0495638_0165833 3300046460 Bacteria 1271
658 Ga0495650_0145666 3300046471 Bacteria 854
659 Ga0495650_0201405 3300046471 Bacteria 692
660 Ga0495584_0005846 3300046491 Bacteria 6482
661 Ga0495596_0000008 3300046500 Bacteria 150860
662 Ga0495583_0000577 3300046506 Bacteria 50418
663 Ga0495606_0003324 3300046507 Bacteria 17167
664 Ga0495606_0139796 3300046507 Bacteria 1431
665 Ga0495610_0000268 3300046512 Bacteria 54316
666 Ga0495616_0348458 3300046513 Bacteria 617
667 Ga0495631_0106470 3300046518 Bacteria 1206
668 Ga0495632_0000075 3300046519 Bacteria 102051
669 Ga0495632_0060944 3300046519 Bacteria 1832
670 Ga0495637_0000123 3300046520 Bacteria 57717
671 Ga0495637_0000890 3300046520 Bacteria 19264
672 Ga0495643_0000009 3300046522 Bacteria 344767
673 Ga0495643_0015079 3300046522 Bacteria 4579
674 Ga0495648_0002760 3300046524 Bacteria 15853
675 Ga0495663_0000003 3300046525 Bacteria 362694
676 Ga0495642_0073523 3300046528 Bacteria 1432
677 Ga0495654_0192564 3300046530 Bacteria 877
678 Ga0495621_0009525 3300046539 Bacteria 2953
679 Ga0495621_0020629 3300046539 Bacteria 2165
680 Ga0495633_0000173 3300046558 Bacteria 84576
681 Ga0495633_0000834 3300046558 Bacteria 27197
682 Ga0495656_0000023 3300046615 Unclassified 88819
683 Ga0495668_0358132 3300046616 Bacteria 801
684 Ga0495625_0037398 3300046660 Bacteria 3562
685 Ga0495625_0165371 3300046660 Bacteria 1479
686 Ga0495625_0680309 3300046660 Bacteria 610
687 Ga0495659_0000192 3300046664 Bacteria 26727
688 Ga0495661_0191590 3300046665 Bacteria 1076
689 Ga0495623_0012520 3300046679 Bacteria 5488
690 Ga0495670_0046480 3300046691 Bacteria 2168
691 Ga0495670_0072476 3300046691 Bacteria 1745
692 Ga0495671_0000013 3300046692 Bacteria 344767
693 Ga0495671_0068061 3300046692 Bacteria 1751
694 Ga0495671_0080367 3300046692 Bacteria 1597
695 Ga0495672_0109202 3300047320 Bacteria 1487
696 Ga0495687_182929 3300047443 Bacteria 682
697 Ga0495681_0000059 3300047470 Bacteria 102400
698 Ga0495681_0001690 3300047470 Bacteria 16347
699 Ga0495681_0095122 3300047470 Bacteria 1310
700 Ga0495686_0000430 3300047472 Bacteria 65300
701 Ga0495686_0001136 3300047472 Bacteria 31452
702 Ga0495686_0001320 3300047472 Bacteria 27790
703 Ga0495686_0001775 3300047472 Bacteria 21986
704 Ga0495686_0026479 3300047472 Bacteria 3793
705 Ga0495686_0167029 3300047472 Bacteria 1282
706 Ga0496101_0066545 3300048904 Bacteria 2629
707 Ga0496102_0007382 3300048905 Bacteria 9389
708 Ga0496102_0008608 3300048905 Viruses 8755
709 Ga0496102_0662149 3300048905 Bacteria 967
710 Ga0496103_0003095 3300048906 Bacteria 10222
711 Ga0496103_0710718 3300048906 Bacteria 637
712 Ga0496104_0010352 3300048907 Bacteria 8329
713 Ga0496105_0007301 3300048908 Bacteria 8537
714 Ga0496106_0726706 3300048909 Bacteria 790
715 Ga0496109_0178434 3300048912 Bacteria 1994
716 Ga0496109_0415352 3300048912 Bacteria 1271
717 Ga0496110_0169877 3300048913 Bacteria 1978
718 Ga0496110_0186659 3300048913 Bacteria 1883
719 Ga0496111_0616798 3300048914 Bacteria 793
720 Ga0496114_0000131 3300048917 Bacteria 54315
721 Ga0496116_0000089 3300048919 Bacteria 213129
722 Ga0496116_0020569 3300048919 Bacteria 5009
723 Ga0496117_0003608 3300048920 Bacteria 17829
724 Ga0496117_0014014 3300048920 Bacteria 6938
725 Ga0496117_0024513 3300048920 Bacteria 4768
726 Ga0496117_0052042 3300048920 Bacteria 2888
727 Ga0496117_0083593 3300048920 Bacteria 2086
728 Ga0496117_0093819 3300048920 Bacteria 1923
729 Ga0496118_0004303 3300048921 Bacteria 17009
730 Ga0496118_0010761 3300048921 Bacteria 9017
731 Ga0496118_0023122 3300048921 Bacteria 5410
732 Ga0496118_0039935 3300048921 Bacteria 3738
733 Ga0496118_0281397 3300048921 Bacteria 925
734 Ga0496119_0102841 3300048922 Bacteria 1601
735 Ga0496119_0260541 3300048922 Bacteria 870
736 Ga0496120_0058204 3300048923 Bacteria 2172
737 Ga0496120_0133236 3300048923 Bacteria 1270
738 Ga0496121_0000196 3300048924 Bacteria 135812
739 Ga0496121_0006803 3300048924 Bacteria 14006
740 Ga0496122_0001736 3300048925 Bacteria 33820
741 Ga0496123_0000590 3300048926 Bacteria 61951
742 Ga0496123_0147502 3300048926 Bacteria 1275
743 Ga0496124_0008334 3300048927 Bacteria 10854
744 Ga0496124_0032443 3300048927 Bacteria 4611
745 Ga0496124_0122778 3300048927 Bacteria 2073
746 Ga0496124_0424727 3300048927 Bacteria 914
747 Ga0496124_0546701 3300048927 Bacteria 765
748 Ga0496125_0049512 3300048928 Bacteria 3491
749 Ga0496125_0403189 3300048928 Bacteria 798
750 Ga0496126_0039078 3300048929 Bacteria 4407
751 Ga0496126_0319523 3300048929 Bacteria 1276
752 Ga0501307_041291 3300049162 Bacteria 671
753 Ga0495678_054039 3300049459 Bacteria 1539
754 Ga0495682_0002949 3300049460 Bacteria 7781
755 Ga0501290_000159 3300049513 Bacteria 10830
756 Ga0501292_000020 3300049515 Bacteria 54099
757 Ga0501294_000244 3300049517 Bacteria 6757
758 Ga0501031_0197420 3300049568 Bacteria 1313
759 Ga0501032_0028908 3300049569 Bacteria 3807
760 Ga0501032_0406198 3300049569 Bacteria 875
761 Ga0501033_0389042 3300049570 Bacteria 974
762 Ga0501034_0054204 3300049571 Bacteria 4037
763 Ga0501034_0057262 3300049571 Bacteria 3919
764 Ga0501034_0545075 3300049571 Bacteria 1070
765 Ga0501037_0117007 3300049573 Bacteria 1918
766 Ga0501039_0269984 3300049575 Bacteria 1337
767 Ga0501039_1071627 3300049575 Bacteria 625
768 Ga0501040_0750192 3300049576 Bacteria 706
769 Ga0501041_0549636 3300049577 Bacteria 736
770 Ga0501042_0270174 3300049578 Bacteria 1228
771 Ga0501043_0079703 3300049579 Bacteria 2573
772 Ga0501046_0056977 3300049580 Bacteria 3066
773 Ga0501047_0002116 3300049581 Bacteria 18997
774 Ga0501047_0274117 3300049581 Bacteria 1533
775 Ga0501047_0903470 3300049581 Bacteria 696
776 Ga0501047_0911445 3300049581 Bacteria 692
777 Ga0501048_0074973 3300049582 Bacteria 2387
778 Ga0501067_0003583 3300049583 Bacteria 8552
779 Ga0501068_0242824 3300049584 Bacteria 1146
780 Ga0501072_0679489 3300049588 Bacteria 810
781 Ga0501074_0891450 3300049590 Bacteria 626
782 Ga0501206_000401 3300049653 Bacteria 5161
783 Ga0501222_000648 3300049662 Bacteria 5093
784 Ga0501223_005698 3300049663 Bacteria 2605
785 Ga0501224_000328 3300049664 Bacteria 5557
786 Ga0501235_011202 3300049669 Bacteria 1964
787 Ga0501249_001014 3300049679 Bacteria 6031
788 Ga0501257_000031 3300049686 Bacteria 40822
789 Ga0501259_000367 3300049688 Bacteria 7092
790 Ga0501261_001824 3300049690 Bacteria 2621
791 Ga0501225_0009052 3300049705 Bacteria 2845
792 Ga0501245_000196 3300049708 Bacteria 6766
793 Ga0501079_0197723 3300049741 Bacteria 1570
794 Ga0501079_0629603 3300049741 Bacteria 844
795 Ga0501279_000022 3300049775 Bacteria 54370
796 Ga0501280_000353 3300049776 Bacteria 11455
797 Ga0501280_003906 3300049776 Bacteria 2239
798 Ga0501281_00259 3300049777 Bacteria 5634
799 Ga0501282_000191 3300049778 Bacteria 7523
800 Ga0501035_0122135 3300049822 Bacteria 2276
801 Ga0501035_0358936 3300049822 Bacteria 1218
802 Ga0501035_0386940 3300049822 Bacteria 1166
803 Ga0501044_0077021 3300049823 Bacteria 3383
804 Ga0501044_0086482 3300049823 Bacteria 3167
805 Ga0501045_0887699 3300049824 Bacteria 655
806 Ga0501204_009184 3300049850 Bacteria 1138
807 nmdc:mga03683_259403_c1 3300050489 Bacteria 809
808 nmdc:mga03683_3517_c1 3300050489 Bacteria 5070
809 nmdc:mga03n38_40422_c1 3300050490 Bacteria 2027
810 nmdc:mga03n38_47793_c1 3300050490 Bacteria 1896
811 nmdc:mga03n38_75671_c1 3300050490 Bacteria 1569
812 nmdc:mga00v17_51062_c1 3300050491 Bacteria 2515
813 nmdc:mga00v17_5310_c1 3300050491 Bacteria 6788
814 nmdc:mga00v17_581703_c1 3300050491 Bacteria 723
815 nmdc:mga0yw44_108049_c1 3300050492 Bacteria 1780
816 nmdc:mga0yw44_204872_c1 3300050492 Bacteria 1304
817 nmdc:mga0k408_121012_c1 3300050493 Bacteria 1550
818 nmdc:mga0k408_221074_c1 3300050493 Bacteria 1131
819 nmdc:mga0k408_3840_c1 3300050493 Bacteria 7966
820 nmdc:mga0k408_61685_c1 3300050493 Bacteria 2180
821 nmdc:mga06z11_20_c1 3300050494 Bacteria 75712
822 nmdc:mga06z11_770_c1 3300050494 Bacteria 11686
823 nmdc:mga04h51_108_c1 3300050495 Bacteria 24818
824 nmdc:mga04h51_339_c1 3300050495 Bacteria 11749
825 nmdc:mga07m45_35_c1 3300050496 Bacteria 74486
826 nmdc:mga0qj67_112215_c1 3300050509 Bacteria 2201
827 nmdc:mga0n895_1306955_c1 3300050512 Bacteria 696
828 nmdc:mga0n895_1625131_c1 3300050512 Bacteria 610
829 nmdc:mga0n895_92167_c1 3300050512 Bacteria 3033
830 nmdc:mga0rr50_316682_c1 3300050513 Bacteria 1307
831 nmdc:mga0sz30_41_c1 3300050516 Bacteria 46173
832 nmdc:mga0sz30_79563_c1 3300050516 Bacteria 1418
833 Ga0495612_0107420 3300053078 Bacteria 1192
834 Ga0495595_0468711 3300053084 Bacteria 641
835 Ga0500643_000195 3300053087 Bacteria 57960
836 Ga0500643_012652 3300053087 Bacteria 3014
837 Ga0500643_024520 3300053087 Bacteria 1914
838 Ga0500643_038746 3300053087 Bacteria 1411
839 Ga0500643_070216 3300053087 Bacteria 972
840 Ga0500555_000645 3300053103 Bacteria 13442
841 Ga0500556_0000054 3300053104 Bacteria 115949
842 Ga0500562_002192 3300053108 Bacteria 4884
843 Ga0500562_007791 3300053108 Bacteria 2702
844 Ga0500592_001661 3300053116 Bacteria 3608
845 Ga0500592_022803 3300053116 Bacteria 1009
846 Ga0500593_065595 3300053117 Bacteria 1587
847 Ga0500595_000379 3300053119 Bacteria 28661
848 Ga0500595_011903 3300053119 Bacteria 3386
849 Ga0500618_152347 3300053125 Bacteria 528
850 Ga0500559_0209779 3300053136 Bacteria 919
851 Ga0500604_0038426 3300053151 Bacteria 1436
852 Ga0500616_0043163 3300053153 Bacteria 2411
853 Ga0500622_0000119 3300053156 Bacteria 82219
854 Ga0500637_0003430 3300053178 Bacteria 7324
855 Ga0501084_0331746 3300054114 Bacteria 1285
856 Ga0501084_0364019 3300054114 Bacteria 1222
857 Ga0501084_1856662 3300054114 Bacteria 503
858 Ga0466962_0410849 3300061719 Bacteria 678
859 2511126458 2510917021 Bacteria 5705459
860 2512645012 2512564014 Bacteria 4639632
861 2643730557 2643221541 Bacteria 5498788
862 2643950756 2643221588 Bacteria 3692460
863 2644037540 2643221605 Bacteria 4772303
864 2644043726 2643221606 Bacteria 5588032
865 2644393885 2643221671 Bacteria 5496681
866 2809064879 2808606401 Bacteria 4586670
867 2809080955 2808606404 Bacteria 4652788
868 2809085211 2808606405 Bacteria 4586632
869 2830078753 2830075706 Bacteria 3855215
870 2842335732 2842333319 Bacteria 8899485
871 2846952796 2846952575 Bacteria 6587527
872 2880521944 2880518877 Bacteria 5012590
873 2896430600 2896429255 Bacteria 2557483
874 2919709874 2919709256 Bacteria 4318106
875 Ga0495611_0029615
876 JGI24740J21852_10005081
877 JGI24739J22299_10000986
878 JGI24739J22299_10007198
879 JGI24739J22299_10074953
880 JGI24737J22298_10000178
881 JGI24737J22298_10002030
882 JGI24735J21928_10105427
883 JGI24750J21931_1070073
884 JGI24745J21846_1012602
885 JGI24738J21930_10000035
886 JGI24738J21930_10010010
887 JGI24749J21850_1000469
888 JGI24744J21845_10040748
889 JGI24751J29686_10022773
890 JGI24751J29686_10110404
891 rootH1_10116051
892 rootH1_10189427
893 Ga0055532_1015105
894 Ga0065715_10431933
895 Ga0065707_10314600
896 Ga0070658_10000950
897 Ga0070658_10672602
898 Ga0070658_10879731
899 Ga0070658_10959707
900 Ga0070676_10216327
901 Ga0070683_100001317
902 Ga0070683_100148591
903 Ga0070683_100251900
904 Ga0070683_100540705
905 Ga0070690_100021166
906 Ga0070690_100461119
907 Ga0070670_100027055
908 Ga0070670_100083372
909 Ga0070670_100086486
910 Ga0070670_100139668
911 Ga0070670_100160167
912 Ga0070670_100949249
913 Ga0070677_10012789
914 Ga0068869_100060475
915 Ga0068869_100843939
916 Ga0070666_10002265
917 Ga0070666_10019253
918 Ga0070666_10027841
919 Ga0070666_10030176
920 Ga0070666_10123373
921 Ga0070680_100294773
922 Ga0070682_100282228
923 Ga0070660_100000260
924 Ga0070660_100037179
925 Ga0070660_100289081
926 Ga0070660_100293830
927 Ga0070689_100136046
928 Ga0070661_100000246
929 Ga0070661_100035625
930 Ga0070661_100181818
931 Ga0070661_100744837
932 Ga0070692_10716495
933 Ga0070668_100000028
934 Ga0070668_100000064
935 Ga0070668_100000468
936 Ga0070668_100004618
937 Ga0070668_100025986
938 Ga0070669_100001504
939 Ga0070669_100003371
940 Ga0070669_100182914
941 Ga0070669_100501148
942 Ga0070675_100019838
943 Ga0070675_100124634
944 Ga0070671_100000829
945 Ga0070671_100001575
946 Ga0070671_100005874
947 Ga0070671_100040285
948 Ga0070671_100187231
949 Ga0070671_100480140
950 Ga0070673_100004134
951 Ga0070673_100514552
952 Ga0070659_100000195
953 Ga0070659_100095743
954 Ga0070659_100261312
955 Ga0070659_100470982
956 Ga0070659_100531552
957 Ga0070659_100871826
958 Ga0070659_101632690
959 Ga0070667_100000003
960 Ga0070667_100000016
961 Ga0070667_100003644
962 Ga0070667_100004495
963 Ga0070667_100009905
964 Ga0070667_100012716
965 Ga0070714_100746496
966 Ga0070713_100151733
967 Ga0070663_100002814
968 Ga0070678_100607394
969 Ga0070662_100000047
970 Ga0070662_100002369
971 Ga0070681_10455323
972 Ga0068867_100016487
973 Ga0070685_10168672
974 Ga0070707_100482005
975 Ga0070679_100138866
976 Ga0070679_100386071
977 Ga0070679_101202095
978 Ga0070684_100042567
979 Ga0070684_100126214
980 Ga0070684_100186503
981 Ga0070684_100611468
982 Ga0070684_100709370
983 Ga0070684_101562541
984 Ga0068853_100000033
985 Ga0068853_100129978
986 Ga0068853_100133526
987 Ga0068853_100209934
988 Ga0068853_101315307
989 Ga0068853_101674325
990 Ga0070672_100089311
991 Ga0070686_100000235
992 Ga0070686_100261290
993 Ga0070693_100010785
994 Ga0070665_100000038
995 Ga0070665_100000070
996 Ga0070665_100002115
997 Ga0070665_100032833
998 Ga0068855_100000531
999 Ga0068855_100001755
1000 Ga0068855_100079313
1001 Ga0068855_100781375
1002 Ga0068855_101505804
1003 Ga0070664_100000242
1004 Ga0070664_100041826
1005 Ga0070664_100149870
1006 Ga0068857_100001908
1007 Ga0068857_100053309
1008 Ga0068857_100123472
1009 Ga0068857_100124422
1010 Ga0068857_100209124
1011 Ga0068854_100006502
1012 Ga0068854_100010181
1013 Ga0068854_100033722
1014 Ga0068854_100126047
1015 Ga0068854_100698189
1016 Ga0068854_101903278
1017 Ga0068856_100000162
1018 Ga0068856_100920639
1019 Ga0068856_101178185
1020 Ga0070702_100184049
1021 Ga0068852_100000471
1022 Ga0068852_100003956
1023 Ga0068852_100143413
1024 Ga0068852_100280612
1025 Ga0068852_100532334
1026 Ga0068852_100921900
1027 Ga0068859_100045654
1028 Ga0068859_100163402
1029 Ga0068859_100216750
1030 Ga0068859_100228159
1031 Ga0068859_100270285
1032 Ga0068859_100471064
1033 Ga0068859_100521586
1034 Ga0068859_101543891
1035 Ga0068859_101549848
1036 Ga0068859_101842040
1037 Ga0068859_102528791
1038 Ga0068864_100015986
1039 Ga0068864_100032381
1040 Ga0068864_100056815
1041 Ga0068861_100029338
1042 Ga0068861_100116342
1043 Ga0068851_10031330
1044 Ga0068851_10415195
1045 Ga0068863_100000052
1046 Ga0068863_100000092
1047 Ga0068863_100000727
1048 Ga0068863_100002981
1049 Ga0068863_100062680
1050 Ga0068863_100066588
1051 Ga0068863_100100169
1052 Ga0068863_100177476
1053 Ga0068858_100000892
1054 Ga0068858_100009735
1055 Ga0068858_100015627
1056 Ga0068858_100133549
1057 Ga0068858_100415136
1058 Ga0068860_100000007
1059 Ga0068860_100000045
1060 Ga0068860_100000196
1061 Ga0068860_100006131
1062 Ga0068860_100010108
1063 Ga0068860_100076639
1064 Ga0068860_100167035
1065 Ga0068860_100595112
1066 Ga0068860_101474580
1067 Ga0068862_100000385
1068 Ga0068862_100000877
1069 Ga0068862_100007339
1070 Ga0068862_100011387
1071 Ga0068862_100039746
1072 Ga0068862_100103090
1073 Ga0068862_100132959
1074 Ga0068862_100152714
1075 Ga0081455_10061870
1076 Ga0075368_10000152
1077 Ga0075363_100002645
1078 Ga0075363_100050909
1079 Ga0075364_10087542
1080 Ga0075364_10658184
1081 Ga0075362_10042057
1082 Ga0075362_10137077
1083 Ga0075367_10000134
1084 Ga0075367_10075854
1085 Ga0075369_10003510
1086 Ga0075366_10071053
1087 Ga0075366_10130440
1088 Ga0075366_10262904
1089 Ga0075366_10303107
1090 Ga0097621_100039279
1091 Ga0097621_100171752
1092 Ga0097621_100934274
1093 Ga0075370_10057671
1094 Ga0075370_10203751
1095 Ga0075370_10622442
1096 Ga0068871_100108292
1097 Ga0068871_100145109
1098 Ga0075430_100210608
1099 Ga0075434_100100221
1100 Ga0075434_100627907
1101 Ga0075434_102457447
1102 Ga0068865_100087005
1103 Ga0075436_100714259
1104 Ga0097620_100020395
1105 Ga0097620_100045653
1106 Ga0097620_100163398
1107 Ga0097620_100216746
1108 Ga0097620_100228162
1109 Ga0097620_100270299
1110 Ga0097620_100471065
1111 Ga0097620_100521583
1112 Ga0097620_101543352
1113 Ga0097620_101549883
1114 Ga0097620_101842897
1115 Ga0097620_102530419
1116 Ga0105251_10005582
1117 Ga0105240_10066895
1118 Ga0105240_10087616
1119 Ga0105240_10150868
1120 Ga0105240_10684580
1121 Ga0105245_10000285
1122 Ga0105245_10169598
1123 Ga0105247_10051194
1124 Ga0105247_10160341
1125 Ga0105247_10238002
1126 Ga0105243_10038024
1127 Ga0105241_10245403
1128 Ga0105241_12231835
1129 Ga0105248_10000659
1130 Ga0105248_10011429
1131 Ga0105248_10161443
1132 Ga0105248_10225459
1133 Ga0105248_11980827
1134 Ga0105248_13001525
1135 Ga0105237_10710107
1136 Ga0105238_10008171
1137 Ga0105238_10038975
1138 Ga0105238_10253224
1139 Ga0105238_10672731
1140 Ga0105238_12135921
1141 Ga0105249_10000574
1142 Ga0105249_10056713
1143 Ga0105249_10088658
1144 Ga0105249_10854049
1145 Ga0105239_10011926
1146 Ga0105239_10130902
1147 Ga0105239_10580364
1148 Ga0105239_11365987
1149 Ga0105246_10184144
1150 Ga0157373_10022263
1151 Ga0157373_10050159
1152 Ga0157373_10068400
1153 Ga0157373_10155580
1154 Ga0157373_10299862
1155 Ga0157373_10723507
1156 Ga0157373_10918408
1157 Ga0157371_10014963
1158 Ga0157371_10079335
1159 Ga0157371_10091128
1160 Ga0157371_10180439
1161 Ga0157371_10313661
1162 Ga0157371_10356052
1163 Ga0157370_10036970
1164 Ga0157370_10334480
1165 Ga0157370_10384626
1166 Ga0157369_10017738
1167 Ga0157369_10022100
1168 Ga0157369_10101220
1169 Ga0157369_10126550
1170 Ga0157369_10419918
1171 Ga0157369_10427958
1172 Ga0157369_10996038
1173 Ga0157374_10922535
1174 Ga0157378_10028389
1175 Ga0157378_10029855
1176 Ga0163162_10000077
1177 Ga0163162_10020508
1178 Ga0163162_10392518
1179 Ga0157372_10005572
1180 Ga0157372_10047838
1181 Ga0157372_10354969
1182 Ga0157372_10361528
1183 Ga0157372_10472375
1184 Ga0157375_11138896
1185 Ga0157375_11821260
1186 Ga0163163_10000273
1187 Ga0157380_10003514
1188 Ga0157380_10726996
1189 Ga0157377_10597970
1190 Ga0157379_10099121
1191 Ga0157376_12087936
1192 Ga0206356_10192360
1193 Ga0206354_10727992
1194 Ga0206353_11090631
1195 Ga0213873_10000009
1196 Ga0213876_10000004
1197 Ga0213876_10008570
1198 Ga0209147_100921
1199 Ga0207697_10000881
1200 Ga0207697_10083317
1201 Ga0207656_10004743
1202 Ga0207656_10560469
1203 Ga0207713_1002734
1204 Ga0207710_10138298
1205 Ga0207688_10000317
1206 Ga0207680_10001920
1207 Ga0207680_10018954
1208 Ga0207680_10026804
1209 Ga0207680_10140136
1210 Ga0207680_10140625
1211 Ga0207647_10000253
1212 Ga0207647_10006748
1213 Ga0207647_10050706
1214 Ga0207647_10076958
1215 Ga0207647_10153480
1216 Ga0207705_10000062
1217 Ga0207705_10034240
1218 Ga0207705_10050994
1219 Ga0207654_10092434
1220 Ga0207654_10199835
1221 Ga0207654_10298773
1222 Ga0207707_10096206
1223 Ga0207707_10450058
1224 Ga0207707_10901100
1225 Ga0207695_10013403
1226 Ga0207695_10271142
1227 Ga0207695_10614868
1228 Ga0207660_10041658
1229 Ga0207660_11032129
1230 Ga0207657_10000403
1231 Ga0207657_10000946
1232 Ga0207657_10005971
1233 Ga0207657_10013271
1234 Ga0207657_10119775
1235 Ga0207657_10139818
1236 Ga0207657_10201408
1237 Ga0207657_10430477
1238 Ga0207649_10000230
1239 Ga0207649_10057862
1240 Ga0207649_10154061
1241 Ga0207649_10391836
1242 Ga0207649_10812423
1243 Ga0207652_10628159
1244 Ga0207681_10003582
1245 Ga0207681_10003999
1246 Ga0207681_10135485
1247 Ga0207681_10190801
1248 Ga0207694_10001776
1249 Ga0207694_10004075
1250 Ga0207694_10474597
1251 Ga0207650_10020484
1252 Ga0207650_10062456
1253 Ga0207650_10081795
1254 Ga0207659_10035708
1255 Ga0207659_10265706
1256 Ga0207687_10007641
1257 Ga0207664_11031449
1258 Ga0207644_10000125
1259 Ga0207644_10000569
1260 Ga0207644_10020991
1261 Ga0207644_10032656
1262 Ga0207644_10035130
1263 Ga0207644_10292079
1264 Ga0207644_10430088
1265 Ga0207690_10000155
1266 Ga0207690_10080730
1267 Ga0207690_10084474
1268 Ga0207690_10781949
1269 Ga0207706_10000342
1270 Ga0207706_10000643
1271 Ga0207670_10113087
1272 Ga0207704_10029226
1273 Ga0207691_10000848
1274 Ga0207691_10108497
1275 Ga0207711_10006705
1276 Ga0207711_10014364
1277 Ga0207711_10016073
1278 Ga0207711_10292234
1279 Ga0207689_10000017
1280 Ga0207689_10153331
1281 Ga0207661_10000947
1282 Ga0207661_10012302
1283 Ga0207661_10436692
1284 Ga0207679_10000213
1285 Ga0207679_10049081
1286 Ga0207667_10001300
1287 Ga0207667_10001543
1288 Ga0207667_10180783
1289 Ga0207667_10485200
1290 Ga0207667_11151997
1291 Ga0207651_10002101
1292 Ga0207712_10000476
1293 Ga0207712_10057347
1294 Ga0207712_10159561
1295 Ga0207712_10314157
1296 Ga0207668_10000030
1297 Ga0207668_10000076
1298 Ga0207668_10001049
1299 Ga0207668_10003547
1300 Ga0207668_10034211
1301 Ga0207668_10113134
1302 Ga0207668_10158411
1303 Ga0207640_10013642
1304 Ga0207640_10015320
1305 Ga0207640_10068231
1306 Ga0207640_10164718
1307 Ga0207640_10915216
1308 Ga0207640_11775412
1309 Ga0207658_10000002
1310 Ga0207658_10000075
1311 Ga0207658_10005000
1312 Ga0207658_10005408
1313 Ga0207658_10029070
1314 Ga0207658_10060416
1315 Ga0207658_10075950
1316 Ga0207658_10878567
1317 Ga0207677_11214999
1318 Ga0207703_10000358
1319 Ga0207703_10077833
1320 Ga0207703_10108548
1321 Ga0207703_10271113
1322 Ga0207639_10000199
1323 Ga0207639_10000347
1324 Ga0207639_10094150
1325 Ga0207639_10159640
1326 Ga0207639_10175880
1327 Ga0207639_10384484
1328 Ga0207639_10739372
1329 Ga0207639_10979968
1330 Ga0207678_10137305
1331 Ga0207678_10431540
1332 Ga0207708_10375209
1333 Ga0207702_10000496
1334 Ga0207702_10098715
1335 Ga0207702_10355059
1336 Ga0207702_10617275
1337 Ga0207702_11267867
1338 Ga0207702_11297307
1339 Ga0207641_10000004
1340 Ga0207641_10000042
1341 Ga0207641_10000720
1342 Ga0207641_10000959
1343 Ga0207641_10004191
1344 Ga0207641_10043172
1345 Ga0207641_10080673
1346 Ga0207641_10253550
1347 Ga0207641_10572491
1348 Ga0207641_10935034
1349 Ga0207648_10001216
1350 Ga0207676_10001237
1351 Ga0207676_10019321
1352 Ga0207676_10026624
1353 Ga0207676_10802081
1354 Ga0207674_10000945
1355 Ga0207674_10005054
1356 Ga0207674_10006327
1357 Ga0207674_10013895
1358 Ga0207674_10099138
1359 Ga0207674_10171056
1360 Ga0207674_10193815
1361 Ga0207674_10268205
1362 Ga0207675_100046539
1363 Ga0207675_100056638
1364 Ga0207698_10000427
1365 Ga0207698_10015214
1366 Ga0207698_10334046
1367 Ga0207698_10673859
1368 Ga0207698_10720843
1369 Ga0209813_10000017
1370 Ga0209813_10000082
1371 Ga0209974_10034832
1372 Ga0268266_10000118
1373 Ga0268266_10000309
1374 Ga0268266_10002431
1375 Ga0268266_10005364
1376 Ga0268266_10122751
1377 Ga0268265_10000424
1378 Ga0268265_10000469
1379 Ga0268265_10028122
1380 Ga0268265_10084403
1381 Ga0268265_10108110
1382 Ga0268265_10149817
1383 Ga0268265_10219792
1384 Ga0268265_10501821
1385 Ga0268265_10937659
1386 Ga0268264_10000087
1387 Ga0268264_10000091
1388 Ga0268264_10000101
1389 Ga0268264_10000134
1390 Ga0268264_10011832
1391 Ga0268264_10053504
1392 Ga0268264_10153593
1393 Ga0307517_10187486
1394 Ga0265338_10199094
1395 Ga0265331_10059525
1396 Ga0265327_10047419
1397 Ga0307513_10109817
1398 Ga0307408_100010852
1399 Ga0307408_100105234
1400 Ga0307408_100492285
1401 Ga0307408_100916674
1402 Ga0307408_101114027
1403 Ga0265313_10255408
1404 Ga0316575_10001316
1405 Ga0316575_10439230
1406 Ga0265314_10015740
1407 Ga0307516_10152207
1408 Ga0307405_10029770
1409 Ga0307405_10145134
1410 Ga0307405_11099492
1411 Ga0307413_10105216
1412 Ga0307413_10818549
1413 Ga0307413_10985474
1414 Ga0307410_10014693
1415 Ga0307406_10118407
1416 Ga0307406_10431377
1417 Ga0307406_10728889
1418 Ga0307406_11020277
1419 Ga0307407_10286441
1420 Ga0307407_10822272
1421 Ga0307412_10160407
1422 Ga0307412_10245213
1423 Ga0307412_10471254
1424 Ga0307412_11388979
1425 Ga0307409_100018325
1426 Ga0307409_100065368
1427 Ga0307409_100600216
1428 Ga0307409_101338017
1429 Ga0307416_100016385
1430 Ga0307416_100061652
1431 Ga0307416_100824235
1432 Ga0307414_10005500
1433 Ga0307414_10084360
1434 Ga0307414_10370744
1435 Ga0307414_10393213
1436 Ga0307414_10475099
1437 Ga0307414_11192195
1438 Ga0307411_10010117
1439 Ga0307411_10434007
1440 Ga0307415_100418905
1441 Ga0316583_10012845
1442 Ga0373959_0015955
1443 Ga0373938_0064894
1444 Ga0373934_0303686
1445 Ga0373923_0004387
1446 Ga0373923_0106023
1447 Ga0373956_0010017
1448 Ga0373957_0017656
1449 Ga0373960_0015422
1450 Ga0373955_0002366
1451 Ga0373942_0048300
1452 Ga0373962_0096931
1453 Ga0373931_0047725
1454 Ga0373935_0547913
1455 Ga0373933_0086952
1456 Ga0373937_0006632
1457 Ga0316582_0224828
1458 Ga0316582_0889782
1459 Ga0316584_0024034
1460 Ga0373925_0256850
1461 Ga0395899_0037881
1462 Ga0395899_0046407
1463 Ga0395899_0076741
1464 Ga0395899_0076776
1465 Ga0395899_0110916
1466 Ga0395899_0388300
1467 Ga0395899_0396896
1468 Ga0395900_0000209
1469 Ga0395900_0052961
1470 Ga0395900_0084617
1471 Ga0395900_0139753
1472 Ga0395900_0167894
1473 Ga0395900_0242926
1474 Ga0395900_0348972
1475 Ga0395900_0367241
1476 Ga0395900_0727841
1477 Ga0395900_0833971
1478 Ga0395900_0972316
1479 Ga0395898_0004531
1480 Ga0395898_0038647
1481 Ga0395898_0230714
1482 Ga0395898_0244719
1483 Ga0395898_0369396
1484 Ga0395898_0591404
1485 Ga0395898_1363132
1486 Ga0395905_0008172
1487 Ga0395905_0025304
1488 Ga0395905_0050182
1489 Ga0395905_0096517
1490 Ga0395905_0103309
1491 Ga0395905_0208157
1492 Ga0395905_0306413
1493 Ga0395905_0439178
1494 Ga0395905_0864200
1495 Ga0395905_1373346
1496 Ga0395905_1492281
1497 Ga0395905_1747883
1498 Ga0436364_0619037
1499 Ga0395901_0008144
1500 Ga0395901_0134144
1501 Ga0395901_0282727
1502 Ga0395901_0288212
1503 Ga0395901_0330994
1504 Ga0395901_0511359
1505 Ga0395901_0611927
1506 Ga0395901_0967425
1507 Ga0395901_1103085
1508 Ga0436365_0192103
1509 Ga0436365_0410983
1510 Ga0436363_0930037
1511 Ga0436362_0383697
1512 Ga0439447_000009
1513 Ga0439453_0005321
1514 Ga0439466_0009170
1515 Ga0451791_1678702
1516 Ga0451800_1418878
1517 Ga0451853_3208052
1518 Ga0439446_0146374
1519 Ga0439434_0109128
1520 Ga0451577_0003514
1521 Ga0466969_0108133
1522 Ga0466963_0085421
1523 Ga0466957_0085985
1524 Ga0466959_0104571
1525 Ga0451576_0008302
1526 Ga0451576_0264872
1527 Ga0495617_074497
1528 Ga0495627_000570
1529 Ga0495627_001851
1530 Ga0495638_0123113
1531 Ga0495638_0165833
1532 Ga0495650_0145666
1533 Ga0495650_0201405
1534 Ga0495584_0005846
1535 Ga0495596_0000008
1536 Ga0495583_0000577
1537 Ga0495606_0003324
1538 Ga0495606_0139796
1539 Ga0495610_0000268
1540 Ga0495616_0348458
1541 Ga0495631_0106470
1542 Ga0495632_0000075
1543 Ga0495632_0060944
1544 Ga0495637_0000123
1545 Ga0495637_0000890
1546 Ga0495643_0000009
1547 Ga0495643_0015079
1548 Ga0495648_0002760
1549 Ga0495663_0000003
1550 Ga0495642_0073523
1551 Ga0495654_0192564
1552 Ga0495621_0009525
1553 Ga0495621_0020629
1554 Ga0495633_0000173
1555 Ga0495633_0000834
1556 Ga0495656_0000023
1557 Ga0495668_0358132
1558 Ga0495625_0037398
1559 Ga0495625_0165371
1560 Ga0495625_0680309
1561 Ga0495659_0000192
1562 Ga0495661_0191590
1563 Ga0495623_0012520
1564 Ga0495670_0046480
1565 Ga0495670_0072476
1566 Ga0495671_0000013
1567 Ga0495671_0068061
1568 Ga0495671_0080367
1569 Ga0495672_0109202
1570 Ga0495687_182929
1571 Ga0495681_0000059
1572 Ga0495681_0001690
1573 Ga0495681_0095122
1574 Ga0495686_0000430
1575 Ga0495686_0001136
1576 Ga0495686_0001320
1577 Ga0495686_0001775
1578 Ga0495686_0026479
1579 Ga0495686_0167029
1580 Ga0496101_0066545
1581 Ga0496102_0007382
1582 Ga0496102_0008608
1583 Ga0496102_0662149
1584 Ga0496103_0003095
1585 Ga0496103_0710718
1586 Ga0496104_0010352
1587 Ga0496105_0007301
1588 Ga0496106_0726706
1589 Ga0496109_0178434
1590 Ga0496109_0415352
1591 Ga0496110_0169877
1592 Ga0496110_0186659
1593 Ga0496111_0616798
1594 Ga0496114_0000131
1595 Ga0496116_0000089
1596 Ga0496116_0020569
1597 Ga0496117_0003608
1598 Ga0496117_0014014
1599 Ga0496117_0024513
1600 Ga0496117_0052042
1601 Ga0496117_0083593
1602 Ga0496117_0093819
1603 Ga0496118_0004303
1604 Ga0496118_0010761
1605 Ga0496118_0023122
1606 Ga0496118_0039935
1607 Ga0496118_0281397
1608 Ga0496119_0102841
1609 Ga0496119_0260541
1610 Ga0496120_0058204
1611 Ga0496120_0133236
1612 Ga0496121_0000196
1613 Ga0496121_0006803
1614 Ga0496122_0001736
1615 Ga0496123_0000590
1616 Ga0496123_0147502
1617 Ga0496124_0008334
1618 Ga0496124_0032443
1619 Ga0496124_0122778
1620 Ga0496124_0424727
1621 Ga0496124_0546701
1622 Ga0496125_0049512
1623 Ga0496125_0403189
1624 Ga0496126_0039078
1625 Ga0496126_0319523
1626 Ga0501307_041291
1627 Ga0495678_054039
1628 Ga0495682_0002949
1629 Ga0501290_000159
1630 Ga0501292_000020
1631 Ga0501294_000244
1632 Ga0501031_0197420
1633 Ga0501032_0028908
1634 Ga0501032_0406198
1635 Ga0501033_0389042
1636 Ga0501034_0054204
1637 Ga0501034_0057262
1638 Ga0501034_0545075
1639 Ga0501037_0117007
1640 Ga0501039_0269984
1641 Ga0501039_1071627
1642 Ga0501040_0750192
1643 Ga0501041_0549636
1644 Ga0501042_0270174
1645 Ga0501043_0079703
1646 Ga0501046_0056977
1647 Ga0501047_0002116
1648 Ga0501047_0274117
1649 Ga0501047_0903470
1650 Ga0501047_0911445
1651 Ga0501048_0074973
1652 Ga0501067_0003583
1653 Ga0501068_0242824
1654 Ga0501072_0679489
1655 Ga0501074_0891450
1656 Ga0501206_000401
1657 Ga0501222_000648
1658 Ga0501223_005698
1659 Ga0501224_000328
1660 Ga0501235_011202
1661 Ga0501249_001014
1662 Ga0501257_000031
1663 Ga0501259_000367
1664 Ga0501261_001824
1665 Ga0501225_0009052
1666 Ga0501245_000196
1667 Ga0501079_0197723
1668 Ga0501079_0629603
1669 Ga0501279_000022
1670 Ga0501280_000353
1671 Ga0501280_003906
1672 Ga0501281_00259
1673 Ga0501282_000191
1674 Ga0501035_0122135
1675 Ga0501035_0358936
1676 Ga0501035_0386940
1677 Ga0501044_0077021
1678 Ga0501044_0086482
1679 Ga0501045_0887699
1680 Ga0501204_009184
1681 nmdc:mga03683_259403_c1
1682 nmdc:mga03683_3517_c1
1683 nmdc:mga03n38_40422_c1
1684 nmdc:mga03n38_47793_c1
1685 nmdc:mga03n38_75671_c1
1686 nmdc:mga00v17_51062_c1
1687 nmdc:mga00v17_5310_c1
1688 nmdc:mga00v17_581703_c1
1689 nmdc:mga0yw44_108049_c1
1690 nmdc:mga0yw44_204872_c1
1691 nmdc:mga0k408_121012_c1
1692 nmdc:mga0k408_221074_c1
1693 nmdc:mga0k408_3840_c1
1694 nmdc:mga0k408_61685_c1
1695 nmdc:mga06z11_20_c1
1696 nmdc:mga06z11_770_c1
1697 nmdc:mga04h51_108_c1
1698 nmdc:mga04h51_339_c1
1699 nmdc:mga07m45_35_c1
1700 nmdc:mga0qj67_112215_c1
1701 nmdc:mga0n895_1306955_c1
1702 nmdc:mga0n895_1625131_c1
1703 nmdc:mga0n895_92167_c1
1704 nmdc:mga0rr50_316682_c1
1705 nmdc:mga0sz30_41_c1
1706 nmdc:mga0sz30_79563_c1
1707 Ga0495612_0107420
1708 Ga0495595_0468711
1709 Ga0500643_000195
1710 Ga0500643_012652
1711 Ga0500643_024520
1712 Ga0500643_038746
1713 Ga0500643_070216
1714 Ga0500555_000645
1715 Ga0500556_0000054
1716 Ga0500562_002192
1717 Ga0500562_007791
1718 Ga0500592_001661
1719 Ga0500592_022803
1720 Ga0500593_065595
1721 Ga0500595_000379
1722 Ga0500595_011903
1723 Ga0500618_152347
1724 Ga0500559_0209779
1725 Ga0500604_0038426
1726 Ga0500616_0043163
1727 Ga0500622_0000119
1728 Ga0500637_0003430
1729 Ga0501084_0331746
1730 Ga0501084_0364019
1731 Ga0501084_1856662
1732 Ga0466962_0410849
1733 2511126458
1734 2512645012
1735 2643730557
1736 2643950756
1737 2644037540
1738 2644043726
1739 2644393885
1740 2809064879
1741 2809080955
1742 2809085211
1743 2830078753
1744 2842335732
1745 2846952796
1746 2880521944
1747 2896430600
1748 2919709874

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00692

dUTPase

dUTPase

40

171

0.95

PF22769

DCD

dCTP deaminase-like

48

146

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mbq-assembly1.cif.gz_B crystal structure of deoxyuridine 5-triphosphate nucleotidohydrolase from brucella melitensis, orthorhombic crystal form 0.9696 1 127
3h6d-assembly1.cif.gz_A structure of the mycobacterium tuberculosis dutpase d28n mutant 0.9656 3 129
5edd-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis dutpase r140k, h145w mutant 0.9653 3 129
7n56-assembly3.cif.gz_K crystal structure of deoxyuridine 5'-triphosphate nucleotidohydrolase from rickettsia prowazekii str. madrid e 0.9629 1 131
3i93-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis dutpase stop138t mutant 0.9609 3 129
ID Description Score Start End Superfamily
3mbqA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9583 1 131 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9548 1 130 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9477 1 130 2.70.40.10
2p9oA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9338 1 132 2.70.40.10
1sjnC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9299 1 139 2.70.40.10
ID Description Score Start End GO Terms
AF-A0A1F9ZMA5-F1-model_v4 deleted 0.9905 1 122
AF-A0A349J258-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9861 1 127 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A1Q3IXS7-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9835 2 130 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A2S6THV7-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9823 1 127 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A357CEZ8-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9817 1 130 GO:0000287
GO:0004170
GO:0006226
GO:0046081

Map