F484308
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 874 | 373 | 1748 | 149 |
Family's Representative Sequence
| Representative Sequence | 3300046648|Ga0495611_0029615|Ga0495611_0029615_990_1508 |
| Length | 172 |
| Sequence | MDTFHPGPAQVASRQRCCIRYAGAMLADIAIRLKRLPHGQGLPLPAYATAHAAGMDVVAAEALTLAPGARHAVATGFAIAIPEGYEVQVRPRSGLALKHGVTCLNTPGTIDADYRGEVKVILANLGSEPFVIARGERIAQLVPAAVQRARFEEVELLDETVRGEGGFGSTGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 7 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 172 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 175 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 176 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 177 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 179 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 181 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 183 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 184 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 185 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 186 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 188 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 189 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 190 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 191 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 192 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 193 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 194 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 195 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 199 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 200 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 203 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 208 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 211 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 212 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 213 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 214 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 215 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 216 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 217 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 218 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 219 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 220 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 221 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 222 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 225 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 226 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 227 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 228 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 229 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 230 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 231 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 232 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 233 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 267 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 268 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 269 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 270 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 271 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 273 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 274 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 275 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 276 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 277 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 278 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 279 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 280 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 281 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 282 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 283 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 284 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 285 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 286 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 290 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 291 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 292 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 310 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 311 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 312 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 313 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 314 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 315 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 316 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 317 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 318 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 319 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 320 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 322 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 323 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 324 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 325 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 329 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 330 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 331 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 332 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 333 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 334 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 335 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 336 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 337 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 341 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 344 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 345 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 346 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 347 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 348 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 349 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 350 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 351 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 352 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 353 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 354 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 355 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 356 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 358 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 359 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 360 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 361 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 362 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 363 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 364 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 365 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 366 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 367 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 368 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 369 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 370 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 371 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 372 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 373 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.71 |
| Metatranscriptomes | 0.46 |
| Isolates | 1.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.09 |
| Nodule | 0.11 |
| Rhizoplane | 1.95 |
| Rhizosphere | 85.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495611_0029615 | 3300046648 | Bacteria | 2401 |
| 2 | JGI24740J21852_10005081 | 3300001979 | Bacteria | 5587 |
| 3 | JGI24739J22299_10000986 | 3300001989 | Bacteria | 10619 |
| 4 | JGI24739J22299_10007198 | 3300001989 | Bacteria | 4186 |
| 5 | JGI24739J22299_10074953 | 3300001989 | Bacteria | 1047 |
| 6 | JGI24737J22298_10000178 | 3300001990 | Bacteria | 20564 |
| 7 | JGI24737J22298_10002030 | 3300001990 | Bacteria | 7240 |
| 8 | JGI24735J21928_10105427 | 3300002067 | Bacteria | 810 |
| 9 | JGI24750J21931_1070073 | 3300002070 | Bacteria | 572 |
| 10 | JGI24745J21846_1012602 | 3300002073 | Bacteria | 971 |
| 11 | JGI24738J21930_10000035 | 3300002075 | Bacteria | 25714 |
| 12 | JGI24738J21930_10010010 | 3300002075 | Bacteria | 2120 |
| 13 | JGI24749J21850_1000469 | 3300002076 | Bacteria | 5983 |
| 14 | JGI24744J21845_10040748 | 3300002077 | Bacteria | 869 |
| 15 | JGI24751J29686_10022773 | 3300002459 | Bacteria | 1299 |
| 16 | JGI24751J29686_10110404 | 3300002459 | Bacteria | 576 |
| 17 | rootH1_10116051 | 3300003316 | Bacteria | 1495 |
| 18 | rootH1_10189427 | 3300003323 | Unclassified | 2493 |
| 19 | Ga0055532_1015105 | 3300003758 | Bacteria | 857 |
| 20 | Ga0065715_10431933 | 3300005293 | Bacteria | 846 |
| 21 | Ga0065707_10314600 | 3300005295 | Bacteria | 978 |
| 22 | Ga0070658_10000950 | 3300005327 | Bacteria | 24773 |
| 23 | Ga0070658_10672602 | 3300005327 | Bacteria | 898 |
| 24 | Ga0070658_10879731 | 3300005327 | Bacteria | 779 |
| 25 | Ga0070658_10959707 | 3300005327 | Bacteria | 743 |
| 26 | Ga0070676_10216327 | 3300005328 | Bacteria | 1263 |
| 27 | Ga0070683_100001317 | 3300005329 | Bacteria | 18886 |
| 28 | Ga0070683_100148591 | 3300005329 | Bacteria | 2221 |
| 29 | Ga0070683_100251900 | 3300005329 | Bacteria | 1679 |
| 30 | Ga0070683_100540705 | 3300005329 | Bacteria | 1114 |
| 31 | Ga0070690_100021166 | 3300005330 | Bacteria | 3968 |
| 32 | Ga0070690_100461119 | 3300005330 | Bacteria | 944 |
| 33 | Ga0070670_100027055 | 3300005331 | Bacteria | 4933 |
| 34 | Ga0070670_100083372 | 3300005331 | Bacteria | 2747 |
| 35 | Ga0070670_100086486 | 3300005331 | Bacteria | 2693 |
| 36 | Ga0070670_100139668 | 3300005331 | Bacteria | 2095 |
| 37 | Ga0070670_100160167 | 3300005331 | Bacteria | 1950 |
| 38 | Ga0070670_100949249 | 3300005331 | Bacteria | 781 |
| 39 | Ga0070677_10012789 | 3300005333 | Bacteria | 2920 |
| 40 | Ga0068869_100060475 | 3300005334 | Bacteria | 2776 |
| 41 | Ga0068869_100843939 | 3300005334 | Bacteria | 790 |
| 42 | Ga0070666_10002265 | 3300005335 | Bacteria | 11628 |
| 43 | Ga0070666_10019253 | 3300005335 | Bacteria | 4403 |
| 44 | Ga0070666_10027841 | 3300005335 | Bacteria | 3705 |
| 45 | Ga0070666_10030176 | 3300005335 | Bacteria | 3570 |
| 46 | Ga0070666_10123373 | 3300005335 | Bacteria | 1797 |
| 47 | Ga0070680_100294773 | 3300005336 | Bacteria | 1375 |
| 48 | Ga0070682_100282228 | 3300005337 | Bacteria | 1211 |
| 49 | Ga0070660_100000260 | 3300005339 | Bacteria | 34947 |
| 50 | Ga0070660_100037179 | 3300005339 | Bacteria | 3691 |
| 51 | Ga0070660_100289081 | 3300005339 | Bacteria | 1342 |
| 52 | Ga0070660_100293830 | 3300005339 | Bacteria | 1331 |
| 53 | Ga0070689_100136046 | 3300005340 | Bacteria | 1973 |
| 54 | Ga0070661_100000246 | 3300005344 | Bacteria | 44536 |
| 55 | Ga0070661_100035625 | 3300005344 | Bacteria | 3615 |
| 56 | Ga0070661_100181818 | 3300005344 | Bacteria | 1600 |
| 57 | Ga0070661_100744837 | 3300005344 | Bacteria | 801 |
| 58 | Ga0070692_10716495 | 3300005345 | Bacteria | 675 |
| 59 | Ga0070668_100000028 | 3300005347 | Bacteria | 89707 |
| 60 | Ga0070668_100000064 | 3300005347 | Bacteria | 65793 |
| 61 | Ga0070668_100000468 | 3300005347 | Bacteria | 26737 |
| 62 | Ga0070668_100004618 | 3300005347 | Bacteria | 10202 |
| 63 | Ga0070668_100025986 | 3300005347 | Bacteria | 4440 |
| 64 | Ga0070669_100001504 | 3300005353 | Bacteria | 16853 |
| 65 | Ga0070669_100003371 | 3300005353 | Bacteria | 11487 |
| 66 | Ga0070669_100182914 | 3300005353 | Bacteria | 1641 |
| 67 | Ga0070669_100501148 | 3300005353 | Bacteria | 1007 |
| 68 | Ga0070675_100019838 | 3300005354 | Bacteria | 5363 |
| 69 | Ga0070675_100124634 | 3300005354 | Bacteria | 2191 |
| 70 | Ga0070671_100000829 | 3300005355 | Bacteria | 22442 |
| 71 | Ga0070671_100001575 | 3300005355 | Bacteria | 17171 |
| 72 | Ga0070671_100005874 | 3300005355 | Bacteria | 9778 |
| 73 | Ga0070671_100040285 | 3300005355 | Bacteria | 3880 |
| 74 | Ga0070671_100187231 | 3300005355 | Bacteria | 1754 |
| 75 | Ga0070671_100480140 | 3300005355 | Bacteria | 1068 |
| 76 | Ga0070673_100004134 | 3300005364 | Bacteria | 9142 |
| 77 | Ga0070673_100514552 | 3300005364 | Bacteria | 1084 |
| 78 | Ga0070659_100000195 | 3300005366 | Bacteria | 46642 |
| 79 | Ga0070659_100095743 | 3300005366 | Bacteria | 2384 |
| 80 | Ga0070659_100261312 | 3300005366 | Bacteria | 1436 |
| 81 | Ga0070659_100470982 | 3300005366 | Bacteria | 1068 |
| 82 | Ga0070659_100531552 | 3300005366 | Bacteria | 1005 |
| 83 | Ga0070659_100871826 | 3300005366 | Bacteria | 786 |
| 84 | Ga0070659_101632690 | 3300005366 | Bacteria | 576 |
| 85 | Ga0070667_100000003 | 3300005367 | Bacteria | 447715 |
| 86 | Ga0070667_100000016 | 3300005367 | Bacteria | 237028 |
| 87 | Ga0070667_100003644 | 3300005367 | Bacteria | 13107 |
| 88 | Ga0070667_100004495 | 3300005367 | Bacteria | 11767 |
| 89 | Ga0070667_100009905 | 3300005367 | Bacteria | 7901 |
| 90 | Ga0070667_100012716 | 3300005367 | Bacteria | 6958 |
| 91 | Ga0070714_100746496 | 3300005435 | Bacteria | 946 |
| 92 | Ga0070713_100151733 | 3300005436 | Bacteria | 2062 |
| 93 | Ga0070663_100002814 | 3300005455 | Bacteria | 9876 |
| 94 | Ga0070678_100607394 | 3300005456 | Bacteria | 977 |
| 95 | Ga0070662_100000047 | 3300005457 | Bacteria | 66967 |
| 96 | Ga0070662_100002369 | 3300005457 | Bacteria | 11577 |
| 97 | Ga0070681_10455323 | 3300005458 | Bacteria | 1192 |
| 98 | Ga0068867_100016487 | 3300005459 | Bacteria | 5245 |
| 99 | Ga0070685_10168672 | 3300005466 | Bacteria | 1401 |
| 100 | Ga0070707_100482005 | 3300005468 | Bacteria | 1202 |
| 101 | Ga0070679_100138866 | 3300005530 | Bacteria | 2411 |
| 102 | Ga0070679_100386071 | 3300005530 | Bacteria | 1347 |
| 103 | Ga0070679_101202095 | 3300005530 | Bacteria | 703 |
| 104 | Ga0070684_100042567 | 3300005535 | Bacteria | 3921 |
| 105 | Ga0070684_100126214 | 3300005535 | Bacteria | 2305 |
| 106 | Ga0070684_100186503 | 3300005535 | Bacteria | 1886 |
| 107 | Ga0070684_100611468 | 3300005535 | Bacteria | 1013 |
| 108 | Ga0070684_100709370 | 3300005535 | Bacteria | 938 |
| 109 | Ga0070684_101562541 | 3300005535 | Bacteria | 622 |
| 110 | Ga0068853_100000033 | 3300005539 | Bacteria | 113700 |
| 111 | Ga0068853_100129978 | 3300005539 | Bacteria | 2254 |
| 112 | Ga0068853_100133526 | 3300005539 | Bacteria | 2223 |
| 113 | Ga0068853_100209934 | 3300005539 | Bacteria | 1774 |
| 114 | Ga0068853_101315307 | 3300005539 | Bacteria | 699 |
| 115 | Ga0068853_101674325 | 3300005539 | Bacteria | 617 |
| 116 | Ga0070672_100089311 | 3300005543 | Bacteria | 2483 |
| 117 | Ga0070686_100000235 | 3300005544 | Bacteria | 37581 |
| 118 | Ga0070686_100261290 | 3300005544 | Bacteria | 1269 |
| 119 | Ga0070693_100010785 | 3300005547 | Bacteria | 4585 |
| 120 | Ga0070665_100000038 | 3300005548 | Bacteria | 309230 |
| 121 | Ga0070665_100000070 | 3300005548 | Bacteria | 200681 |
| 122 | Ga0070665_100002115 | 3300005548 | Bacteria | 22199 |
| 123 | Ga0070665_100032833 | 3300005548 | Bacteria | 5223 |
| 124 | Ga0068855_100000531 | 3300005563 | Bacteria | 46681 |
| 125 | Ga0068855_100001755 | 3300005563 | Bacteria | 27069 |
| 126 | Ga0068855_100079313 | 3300005563 | Bacteria | 3808 |
| 127 | Ga0068855_100781375 | 3300005563 | Bacteria | 1016 |
| 128 | Ga0068855_101505804 | 3300005563 | Bacteria | 691 |
| 129 | Ga0070664_100000242 | 3300005564 | Bacteria | 39241 |
| 130 | Ga0070664_100041826 | 3300005564 | Bacteria | 3868 |
| 131 | Ga0070664_100149870 | 3300005564 | Bacteria | 2059 |
| 132 | Ga0068857_100001908 | 3300005577 | Bacteria | 16796 |
| 133 | Ga0068857_100053309 | 3300005577 | Bacteria | 3588 |
| 134 | Ga0068857_100123472 | 3300005577 | Bacteria | 2333 |
| 135 | Ga0068857_100124422 | 3300005577 | Bacteria | 2323 |
| 136 | Ga0068857_100209124 | 3300005577 | Bacteria | 1780 |
| 137 | Ga0068854_100006502 | 3300005578 | Bacteria | 7437 |
| 138 | Ga0068854_100010181 | 3300005578 | Bacteria | 6094 |
| 139 | Ga0068854_100033722 | 3300005578 | Bacteria | 3570 |
| 140 | Ga0068854_100126047 | 3300005578 | Bacteria | 1950 |
| 141 | Ga0068854_100698189 | 3300005578 | Bacteria | 875 |
| 142 | Ga0068854_101903278 | 3300005578 | Bacteria | 547 |
| 143 | Ga0068856_100000162 | 3300005614 | Bacteria | 69640 |
| 144 | Ga0068856_100920639 | 3300005614 | Bacteria | 893 |
| 145 | Ga0068856_101178185 | 3300005614 | Bacteria | 783 |
| 146 | Ga0070702_100184049 | 3300005615 | Bacteria | 1369 |
| 147 | Ga0068852_100000471 | 3300005616 | Bacteria | 26414 |
| 148 | Ga0068852_100003956 | 3300005616 | Bacteria | 10413 |
| 149 | Ga0068852_100143413 | 3300005616 | Bacteria | 2213 |
| 150 | Ga0068852_100280612 | 3300005616 | Bacteria | 1606 |
| 151 | Ga0068852_100532334 | 3300005616 | Bacteria | 1173 |
| 152 | Ga0068852_100921900 | 3300005616 | Bacteria | 891 |
| 153 | Ga0068859_100045654 | 3300005617 | Bacteria | 4401 |
| 154 | Ga0068859_100163402 | 3300005617 | Bacteria | 2306 |
| 155 | Ga0068859_100216750 | 3300005617 | Bacteria | 2002 |
| 156 | Ga0068859_100228159 | 3300005617 | Bacteria | 1950 |
| 157 | Ga0068859_100270285 | 3300005617 | Bacteria | 1792 |
| 158 | Ga0068859_100471064 | 3300005617 | Bacteria | 1351 |
| 159 | Ga0068859_100521586 | 3300005617 | Bacteria | 1283 |
| 160 | Ga0068859_101543891 | 3300005617 | Bacteria | 733 |
| 161 | Ga0068859_101549848 | 3300005617 | Bacteria | 732 |
| 162 | Ga0068859_101842040 | 3300005617 | Bacteria | 668 |
| 163 | Ga0068859_102528791 | 3300005617 | Bacteria | 565 |
| 164 | Ga0068864_100015986 | 3300005618 | Bacteria | 6244 |
| 165 | Ga0068864_100032381 | 3300005618 | Bacteria | 4442 |
| 166 | Ga0068864_100056815 | 3300005618 | Bacteria | 3381 |
| 167 | Ga0068861_100029338 | 3300005719 | Bacteria | 4025 |
| 168 | Ga0068861_100116342 | 3300005719 | Bacteria | 2150 |
| 169 | Ga0068851_10031330 | 3300005834 | Bacteria | 2641 |
| 170 | Ga0068851_10415195 | 3300005834 | Bacteria | 794 |
| 171 | Ga0068863_100000052 | 3300005841 | Bacteria | 125430 |
| 172 | Ga0068863_100000092 | 3300005841 | Bacteria | 97076 |
| 173 | Ga0068863_100000727 | 3300005841 | Bacteria | 33031 |
| 174 | Ga0068863_100002981 | 3300005841 | Bacteria | 16743 |
| 175 | Ga0068863_100062680 | 3300005841 | Bacteria | 3516 |
| 176 | Ga0068863_100066588 | 3300005841 | Bacteria | 3407 |
| 177 | Ga0068863_100100169 | 3300005841 | Bacteria | 2754 |
| 178 | Ga0068863_100177476 | 3300005841 | Bacteria | 2044 |
| 179 | Ga0068858_100000892 | 3300005842 | Bacteria | 30965 |
| 180 | Ga0068858_100009735 | 3300005842 | Bacteria | 9154 |
| 181 | Ga0068858_100015627 | 3300005842 | Bacteria | 7139 |
| 182 | Ga0068858_100133549 | 3300005842 | Bacteria | 2328 |
| 183 | Ga0068858_100415136 | 3300005842 | Bacteria | 1294 |
| 184 | Ga0068860_100000007 | 3300005843 | Bacteria | 429329 |
| 185 | Ga0068860_100000045 | 3300005843 | Bacteria | 223252 |
| 186 | Ga0068860_100000196 | 3300005843 | Bacteria | 97096 |
| 187 | Ga0068860_100006131 | 3300005843 | Bacteria | 12091 |
| 188 | Ga0068860_100010108 | 3300005843 | Bacteria | 9349 |
| 189 | Ga0068860_100076639 | 3300005843 | Bacteria | 3180 |
| 190 | Ga0068860_100167035 | 3300005843 | Bacteria | 2124 |
| 191 | Ga0068860_100595112 | 3300005843 | Bacteria | 1111 |
| 192 | Ga0068860_101474580 | 3300005843 | Bacteria | 702 |
| 193 | Ga0068862_100000385 | 3300005844 | Bacteria | 47562 |
| 194 | Ga0068862_100000877 | 3300005844 | Bacteria | 29301 |
| 195 | Ga0068862_100007339 | 3300005844 | Bacteria | 9155 |
| 196 | Ga0068862_100011387 | 3300005844 | Bacteria | 7341 |
| 197 | Ga0068862_100039746 | 3300005844 | Bacteria | 3997 |
| 198 | Ga0068862_100103090 | 3300005844 | Bacteria | 2498 |
| 199 | Ga0068862_100132959 | 3300005844 | Bacteria | 2202 |
| 200 | Ga0068862_100152714 | 3300005844 | Bacteria | 2056 |
| 201 | Ga0081455_10061870 | 3300005937 | Bacteria | 3148 |
| 202 | Ga0075368_10000152 | 3300006042 | Bacteria | 18566 |
| 203 | Ga0075363_100002645 | 3300006048 | Bacteria | 7386 |
| 204 | Ga0075363_100050909 | 3300006048 | Bacteria | 2207 |
| 205 | Ga0075364_10087542 | 3300006051 | Bacteria | 2064 |
| 206 | Ga0075364_10658184 | 3300006051 | Bacteria | 715 |
| 207 | Ga0075362_10042057 | 3300006177 | Bacteria | 2018 |
| 208 | Ga0075362_10137077 | 3300006177 | Bacteria | 1168 |
| 209 | Ga0075367_10000134 | 3300006178 | Bacteria | 22041 |
| 210 | Ga0075367_10075854 | 3300006178 | Bacteria | 2028 |
| 211 | Ga0075369_10003510 | 3300006186 | Bacteria | 5708 |
| 212 | Ga0075366_10071053 | 3300006195 | Bacteria | 2074 |
| 213 | Ga0075366_10130440 | 3300006195 | Bacteria | 1517 |
| 214 | Ga0075366_10262904 | 3300006195 | Bacteria | 1053 |
| 215 | Ga0075366_10303107 | 3300006195 | Bacteria | 977 |
| 216 | Ga0097621_100039279 | 3300006237 | Bacteria | 3801 |
| 217 | Ga0097621_100171752 | 3300006237 | Bacteria | 1869 |
| 218 | Ga0097621_100934274 | 3300006237 | Bacteria | 809 |
| 219 | Ga0075370_10057671 | 3300006353 | Bacteria | 2207 |
| 220 | Ga0075370_10203751 | 3300006353 | Bacteria | 1167 |
| 221 | Ga0075370_10622442 | 3300006353 | Bacteria | 654 |
| 222 | Ga0068871_100108292 | 3300006358 | Bacteria | 2335 |
| 223 | Ga0068871_100145109 | 3300006358 | Bacteria | 2020 |
| 224 | Ga0075430_100210608 | 3300006846 | Bacteria | 1613 |
| 225 | Ga0075434_100100221 | 3300006871 | Bacteria | 2903 |
| 226 | Ga0075434_100627907 | 3300006871 | Bacteria | 1093 |
| 227 | Ga0075434_102457447 | 3300006871 | Bacteria | 523 |
| 228 | Ga0068865_100087005 | 3300006881 | Bacteria | 2257 |
| 229 | Ga0075436_100714259 | 3300006914 | Bacteria | 743 |
| 230 | Ga0097620_100020395 | 3300006931 | Bacteria | 6653 |
| 231 | Ga0097620_100045653 | 3300006931 | Bacteria | 4401 |
| 232 | Ga0097620_100163398 | 3300006931 | Bacteria | 2306 |
| 233 | Ga0097620_100216746 | 3300006931 | Bacteria | 2002 |
| 234 | Ga0097620_100228162 | 3300006931 | Bacteria | 1950 |
| 235 | Ga0097620_100270299 | 3300006931 | Bacteria | 1792 |
| 236 | Ga0097620_100471065 | 3300006931 | Bacteria | 1351 |
| 237 | Ga0097620_100521583 | 3300006931 | Bacteria | 1283 |
| 238 | Ga0097620_101543352 | 3300006931 | Bacteria | 733 |
| 239 | Ga0097620_101549883 | 3300006931 | Bacteria | 732 |
| 240 | Ga0097620_101842897 | 3300006931 | Bacteria | 668 |
| 241 | Ga0097620_102530419 | 3300006931 | Bacteria | 565 |
| 242 | Ga0105251_10005582 | 3300009011 | Bacteria | 8183 |
| 243 | Ga0105240_10066895 | 3300009093 | Bacteria | 4456 |
| 244 | Ga0105240_10087616 | 3300009093 | Bacteria | 3812 |
| 245 | Ga0105240_10150868 | 3300009093 | Bacteria | 2768 |
| 246 | Ga0105240_10684580 | 3300009093 | Bacteria | 1121 |
| 247 | Ga0105245_10000285 | 3300009098 | Bacteria | 48237 |
| 248 | Ga0105245_10169598 | 3300009098 | Bacteria | 2078 |
| 249 | Ga0105247_10051194 | 3300009101 | Bacteria | 2542 |
| 250 | Ga0105247_10160341 | 3300009101 | Bacteria | 1489 |
| 251 | Ga0105247_10238002 | 3300009101 | Bacteria | 1239 |
| 252 | Ga0105243_10038024 | 3300009148 | Bacteria | 3746 |
| 253 | Ga0105241_10245403 | 3300009174 | Bacteria | 1516 |
| 254 | Ga0105241_12231835 | 3300009174 | Bacteria | 543 |
| 255 | Ga0105248_10000659 | 3300009177 | Bacteria | 39245 |
| 256 | Ga0105248_10011429 | 3300009177 | Bacteria | 9784 |
| 257 | Ga0105248_10161443 | 3300009177 | Bacteria | 2528 |
| 258 | Ga0105248_10225459 | 3300009177 | Bacteria | 2109 |
| 259 | Ga0105248_11980827 | 3300009177 | Bacteria | 662 |
| 260 | Ga0105248_13001525 | 3300009177 | Bacteria | 537 |
| 261 | Ga0105237_10710107 | 3300009545 | Bacteria | 1012 |
| 262 | Ga0105238_10008171 | 3300009551 | Bacteria | 10468 |
| 263 | Ga0105238_10038975 | 3300009551 | Bacteria | 4822 |
| 264 | Ga0105238_10253224 | 3300009551 | Bacteria | 1739 |
| 265 | Ga0105238_10672731 | 3300009551 | Bacteria | 1046 |
| 266 | Ga0105238_12135921 | 3300009551 | Bacteria | 594 |
| 267 | Ga0105249_10000574 | 3300009553 | Bacteria | 33721 |
| 268 | Ga0105249_10056713 | 3300009553 | Bacteria | 3587 |
| 269 | Ga0105249_10088658 | 3300009553 | Bacteria | 2890 |
| 270 | Ga0105249_10854049 | 3300009553 | Bacteria | 976 |
| 271 | Ga0105239_10011926 | 3300010375 | Bacteria | 9695 |
| 272 | Ga0105239_10130902 | 3300010375 | Bacteria | 2791 |
| 273 | Ga0105239_10580364 | 3300010375 | Bacteria | 1278 |
| 274 | Ga0105239_11365987 | 3300010375 | Bacteria | 818 |
| 275 | Ga0105246_10184144 | 3300011119 | Bacteria | 1611 |
| 276 | Ga0157373_10022263 | 3300013100 | Bacteria | 4599 |
| 277 | Ga0157373_10050159 | 3300013100 | Bacteria | 2973 |
| 278 | Ga0157373_10068400 | 3300013100 | Bacteria | 2510 |
| 279 | Ga0157373_10155580 | 3300013100 | Bacteria | 1608 |
| 280 | Ga0157373_10299862 | 3300013100 | Bacteria | 1140 |
| 281 | Ga0157373_10723507 | 3300013100 | Bacteria | 730 |
| 282 | Ga0157373_10918408 | 3300013100 | Bacteria | 650 |
| 283 | Ga0157371_10014963 | 3300013102 | Bacteria | 5836 |
| 284 | Ga0157371_10079335 | 3300013102 | Bacteria | 2325 |
| 285 | Ga0157371_10091128 | 3300013102 | Bacteria | 2159 |
| 286 | Ga0157371_10180439 | 3300013102 | Bacteria | 1510 |
| 287 | Ga0157371_10313661 | 3300013102 | Bacteria | 1137 |
| 288 | Ga0157371_10356052 | 3300013102 | Bacteria | 1066 |
| 289 | Ga0157370_10036970 | 3300013104 | Bacteria | 4736 |
| 290 | Ga0157370_10334480 | 3300013104 | Bacteria | 1396 |
| 291 | Ga0157370_10384626 | 3300013104 | Bacteria | 1292 |
| 292 | Ga0157369_10017738 | 3300013105 | Bacteria | 7995 |
| 293 | Ga0157369_10022100 | 3300013105 | Bacteria | 7106 |
| 294 | Ga0157369_10101220 | 3300013105 | Bacteria | 3071 |
| 295 | Ga0157369_10126550 | 3300013105 | Bacteria | 2708 |
| 296 | Ga0157369_10419918 | 3300013105 | Bacteria | 1386 |
| 297 | Ga0157369_10427958 | 3300013105 | Bacteria | 1372 |
| 298 | Ga0157369_10996038 | 3300013105 | Bacteria | 858 |
| 299 | Ga0157374_10922535 | 3300013296 | Bacteria | 891 |
| 300 | Ga0157378_10028389 | 3300013297 | Bacteria | 4936 |
| 301 | Ga0157378_10029855 | 3300013297 | Bacteria | 4814 |
| 302 | Ga0163162_10000077 | 3300013306 | Viruses | 90095 |
| 303 | Ga0163162_10020508 | 3300013306 | Bacteria | 6495 |
| 304 | Ga0163162_10392518 | 3300013306 | Bacteria | 1520 |
| 305 | Ga0157372_10005572 | 3300013307 | Bacteria | 13383 |
| 306 | Ga0157372_10047838 | 3300013307 | Bacteria | 4753 |
| 307 | Ga0157372_10354969 | 3300013307 | Bacteria | 1708 |
| 308 | Ga0157372_10361528 | 3300013307 | Bacteria | 1691 |
| 309 | Ga0157372_10472375 | 3300013307 | Bacteria | 1462 |
| 310 | Ga0157375_11138896 | 3300013308 | Bacteria | 914 |
| 311 | Ga0157375_11821260 | 3300013308 | Bacteria | 722 |
| 312 | Ga0163163_10000273 | 3300014325 | Bacteria | 51622 |
| 313 | Ga0157380_10003514 | 3300014326 | Bacteria | 10769 |
| 314 | Ga0157380_10726996 | 3300014326 | Bacteria | 1001 |
| 315 | Ga0157377_10597970 | 3300014745 | Bacteria | 786 |
| 316 | Ga0157379_10099121 | 3300014968 | Bacteria | 2616 |
| 317 | Ga0157376_12087936 | 3300014969 | Bacteria | 605 |
| 318 | Ga0206356_10192360 | 3300020070 | Bacteria | 2814 |
| 319 | Ga0206354_10727992 | 3300020081 | Bacteria | 8937 |
| 320 | Ga0206353_11090631 | 3300020082 | Bacteria | 8670 |
| 321 | Ga0213873_10000009 | 3300021358 | Bacteria | 237102 |
| 322 | Ga0213876_10000004 | 3300021384 | Bacteria | 943822 |
| 323 | Ga0213876_10008570 | 3300021384 | Bacteria | 5535 |
| 324 | Ga0209147_100921 | 3300025229 | Bacteria | 13170 |
| 325 | Ga0207697_10000881 | 3300025315 | Bacteria | 16992 |
| 326 | Ga0207697_10083317 | 3300025315 | Bacteria | 1349 |
| 327 | Ga0207656_10004743 | 3300025321 | Bacteria | 4768 |
| 328 | Ga0207656_10560469 | 3300025321 | Bacteria | 582 |
| 329 | Ga0207713_1002734 | 3300025735 | Bacteria | 12572 |
| 330 | Ga0207710_10138298 | 3300025900 | Bacteria | 1174 |
| 331 | Ga0207688_10000317 | 3300025901 | Bacteria | 22230 |
| 332 | Ga0207680_10001920 | 3300025903 | Bacteria | 9744 |
| 333 | Ga0207680_10018954 | 3300025903 | Bacteria | 3672 |
| 334 | Ga0207680_10026804 | 3300025903 | Bacteria | 3199 |
| 335 | Ga0207680_10140136 | 3300025903 | Bacteria | 1603 |
| 336 | Ga0207680_10140625 | 3300025903 | Bacteria | 1600 |
| 337 | Ga0207647_10000253 | 3300025904 | Bacteria | 43758 |
| 338 | Ga0207647_10006748 | 3300025904 | Bacteria | 8332 |
| 339 | Ga0207647_10050706 | 3300025904 | Bacteria | 2568 |
| 340 | Ga0207647_10076958 | 3300025904 | Bacteria | 2006 |
| 341 | Ga0207647_10153480 | 3300025904 | Bacteria | 1345 |
| 342 | Ga0207705_10000062 | 3300025909 | Bacteria | 149432 |
| 343 | Ga0207705_10034240 | 3300025909 | Bacteria | 3631 |
| 344 | Ga0207705_10050994 | 3300025909 | Bacteria | 2979 |
| 345 | Ga0207654_10092434 | 3300025911 | Bacteria | 1847 |
| 346 | Ga0207654_10199835 | 3300025911 | Bacteria | 1316 |
| 347 | Ga0207654_10298773 | 3300025911 | Bacteria | 1094 |
| 348 | Ga0207707_10096206 | 3300025912 | Bacteria | 2588 |
| 349 | Ga0207707_10450058 | 3300025912 | Bacteria | 1102 |
| 350 | Ga0207707_10901100 | 3300025912 | Bacteria | 731 |
| 351 | Ga0207695_10013403 | 3300025913 | Bacteria | 9779 |
| 352 | Ga0207695_10271142 | 3300025913 | Bacteria | 1593 |
| 353 | Ga0207695_10614868 | 3300025913 | Bacteria | 968 |
| 354 | Ga0207660_10041658 | 3300025917 | Bacteria | 3219 |
| 355 | Ga0207660_11032129 | 3300025917 | Bacteria | 670 |
| 356 | Ga0207657_10000403 | 3300025919 | Bacteria | 45863 |
| 357 | Ga0207657_10000946 | 3300025919 | Bacteria | 30768 |
| 358 | Ga0207657_10005971 | 3300025919 | Bacteria | 12670 |
| 359 | Ga0207657_10013271 | 3300025919 | Bacteria | 8083 |
| 360 | Ga0207657_10119775 | 3300025919 | Bacteria | 2166 |
| 361 | Ga0207657_10139818 | 3300025919 | Bacteria | 1979 |
| 362 | Ga0207657_10201408 | 3300025919 | Bacteria | 1601 |
| 363 | Ga0207657_10430477 | 3300025919 | Bacteria | 1036 |
| 364 | Ga0207649_10000230 | 3300025920 | Bacteria | 45560 |
| 365 | Ga0207649_10057862 | 3300025920 | Bacteria | 2425 |
| 366 | Ga0207649_10154061 | 3300025920 | Bacteria | 1586 |
| 367 | Ga0207649_10391836 | 3300025920 | Bacteria | 1037 |
| 368 | Ga0207649_10812423 | 3300025920 | Bacteria | 730 |
| 369 | Ga0207652_10628159 | 3300025921 | Bacteria | 962 |
| 370 | Ga0207681_10003582 | 3300025923 | Bacteria | 9670 |
| 371 | Ga0207681_10003999 | 3300025923 | Bacteria | 9150 |
| 372 | Ga0207681_10135485 | 3300025923 | Bacteria | 1827 |
| 373 | Ga0207681_10190801 | 3300025923 | Bacteria | 1568 |
| 374 | Ga0207694_10001776 | 3300025924 | Bacteria | 18021 |
| 375 | Ga0207694_10004075 | 3300025924 | Bacteria | 11490 |
| 376 | Ga0207694_10474597 | 3300025924 | Bacteria | 1046 |
| 377 | Ga0207650_10020484 | 3300025925 | Bacteria | 4665 |
| 378 | Ga0207650_10062456 | 3300025925 | Bacteria | 2783 |
| 379 | Ga0207650_10081795 | 3300025925 | Bacteria | 2450 |
| 380 | Ga0207659_10035708 | 3300025926 | Bacteria | 3438 |
| 381 | Ga0207659_10265706 | 3300025926 | Bacteria | 1398 |
| 382 | Ga0207687_10007641 | 3300025927 | Bacteria | 7107 |
| 383 | Ga0207664_11031449 | 3300025929 | Bacteria | 737 |
| 384 | Ga0207644_10000125 | 3300025931 | Bacteria | 56447 |
| 385 | Ga0207644_10000569 | 3300025931 | Bacteria | 23672 |
| 386 | Ga0207644_10020991 | 3300025931 | Bacteria | 4446 |
| 387 | Ga0207644_10032656 | 3300025931 | Bacteria | 3633 |
| 388 | Ga0207644_10035130 | 3300025931 | Bacteria | 3510 |
| 389 | Ga0207644_10292079 | 3300025931 | Bacteria | 1311 |
| 390 | Ga0207644_10430088 | 3300025931 | Bacteria | 1082 |
| 391 | Ga0207690_10000155 | 3300025932 | Bacteria | 53735 |
| 392 | Ga0207690_10080730 | 3300025932 | Bacteria | 2270 |
| 393 | Ga0207690_10084474 | 3300025932 | Bacteria | 2225 |
| 394 | Ga0207690_10781949 | 3300025932 | Bacteria | 788 |
| 395 | Ga0207706_10000342 | 3300025933 | Bacteria | 50517 |
| 396 | Ga0207706_10000643 | 3300025933 | Bacteria | 37034 |
| 397 | Ga0207670_10113087 | 3300025936 | Bacteria | 1960 |
| 398 | Ga0207704_10029226 | 3300025938 | Bacteria | 3070 |
| 399 | Ga0207691_10000848 | 3300025940 | Bacteria | 30357 |
| 400 | Ga0207691_10108497 | 3300025940 | Bacteria | 2470 |
| 401 | Ga0207711_10006705 | 3300025941 | Bacteria | 9690 |
| 402 | Ga0207711_10014364 | 3300025941 | Bacteria | 6576 |
| 403 | Ga0207711_10016073 | 3300025941 | Bacteria | 6210 |
| 404 | Ga0207711_10292234 | 3300025941 | Bacteria | 1502 |
| 405 | Ga0207689_10000017 | 3300025942 | Bacteria | 117159 |
| 406 | Ga0207689_10153331 | 3300025942 | Bacteria | 1899 |
| 407 | Ga0207661_10000947 | 3300025944 | Bacteria | 19105 |
| 408 | Ga0207661_10012302 | 3300025944 | Bacteria | 6215 |
| 409 | Ga0207661_10436692 | 3300025944 | Bacteria | 1191 |
| 410 | Ga0207679_10000213 | 3300025945 | Bacteria | 45916 |
| 411 | Ga0207679_10049081 | 3300025945 | Bacteria | 3077 |
| 412 | Ga0207667_10001300 | 3300025949 | Bacteria | 31316 |
| 413 | Ga0207667_10001543 | 3300025949 | Bacteria | 28962 |
| 414 | Ga0207667_10180783 | 3300025949 | Bacteria | 2166 |
| 415 | Ga0207667_10485200 | 3300025949 | Bacteria | 1254 |
| 416 | Ga0207667_11151997 | 3300025949 | Bacteria | 757 |
| 417 | Ga0207651_10002101 | 3300025960 | Bacteria | 9407 |
| 418 | Ga0207712_10000476 | 3300025961 | Bacteria | 33733 |
| 419 | Ga0207712_10057347 | 3300025961 | Bacteria | 2748 |
| 420 | Ga0207712_10159561 | 3300025961 | Bacteria | 1751 |
| 421 | Ga0207712_10314157 | 3300025961 | Bacteria | 1290 |
| 422 | Ga0207668_10000030 | 3300025972 | Bacteria | 122797 |
| 423 | Ga0207668_10000076 | 3300025972 | Bacteria | 75056 |
| 424 | Ga0207668_10001049 | 3300025972 | Bacteria | 16486 |
| 425 | Ga0207668_10003547 | 3300025972 | Bacteria | 9173 |
| 426 | Ga0207668_10034211 | 3300025972 | Bacteria | 3373 |
| 427 | Ga0207668_10113134 | 3300025972 | Bacteria | 2040 |
| 428 | Ga0207668_10158411 | 3300025972 | Bacteria | 1761 |
| 429 | Ga0207640_10013642 | 3300025981 | Bacteria | 4663 |
| 430 | Ga0207640_10015320 | 3300025981 | Bacteria | 4435 |
| 431 | Ga0207640_10068231 | 3300025981 | Bacteria | 2382 |
| 432 | Ga0207640_10164718 | 3300025981 | Bacteria | 1645 |
| 433 | Ga0207640_10915216 | 3300025981 | Bacteria | 767 |
| 434 | Ga0207640_11775412 | 3300025981 | Bacteria | 557 |
| 435 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 436 | Ga0207658_10000075 | 3300025986 | Bacteria | 109004 |
| 437 | Ga0207658_10005000 | 3300025986 | Bacteria | 9134 |
| 438 | Ga0207658_10005408 | 3300025986 | Bacteria | 8761 |
| 439 | Ga0207658_10029070 | 3300025986 | Bacteria | 3898 |
| 440 | Ga0207658_10060416 | 3300025986 | Bacteria | 2828 |
| 441 | Ga0207658_10075950 | 3300025986 | Bacteria | 2558 |
| 442 | Ga0207658_10878567 | 3300025986 | Bacteria | 816 |
| 443 | Ga0207677_11214999 | 3300026023 | Bacteria | 690 |
| 444 | Ga0207703_10000358 | 3300026035 | Bacteria | 49140 |
| 445 | Ga0207703_10077833 | 3300026035 | Bacteria | 2754 |
| 446 | Ga0207703_10108548 | 3300026035 | Bacteria | 2364 |
| 447 | Ga0207703_10271113 | 3300026035 | Bacteria | 1537 |
| 448 | Ga0207639_10000199 | 3300026041 | Bacteria | 45241 |
| 449 | Ga0207639_10000347 | 3300026041 | Bacteria | 32007 |
| 450 | Ga0207639_10094150 | 3300026041 | Bacteria | 2404 |
| 451 | Ga0207639_10159640 | 3300026041 | Bacteria | 1898 |
| 452 | Ga0207639_10175880 | 3300026041 | Bacteria | 1817 |
| 453 | Ga0207639_10384484 | 3300026041 | Bacteria | 1261 |
| 454 | Ga0207639_10739372 | 3300026041 | Bacteria | 914 |
| 455 | Ga0207639_10979968 | 3300026041 | Bacteria | 791 |
| 456 | Ga0207678_10137305 | 3300026067 | Bacteria | 2086 |
| 457 | Ga0207678_10431540 | 3300026067 | Bacteria | 1143 |
| 458 | Ga0207708_10375209 | 3300026075 | Bacteria | 1172 |
| 459 | Ga0207702_10000496 | 3300026078 | Bacteria | 44248 |
| 460 | Ga0207702_10098715 | 3300026078 | Bacteria | 2573 |
| 461 | Ga0207702_10355059 | 3300026078 | Bacteria | 1404 |
| 462 | Ga0207702_10617275 | 3300026078 | Bacteria | 1065 |
| 463 | Ga0207702_11267867 | 3300026078 | Bacteria | 731 |
| 464 | Ga0207702_11297307 | 3300026078 | Bacteria | 722 |
| 465 | Ga0207641_10000004 | 3300026088 | Bacteria | 481088 |
| 466 | Ga0207641_10000042 | 3300026088 | Bacteria | 186384 |
| 467 | Ga0207641_10000720 | 3300026088 | Bacteria | 35557 |
| 468 | Ga0207641_10000959 | 3300026088 | Bacteria | 29576 |
| 469 | Ga0207641_10004191 | 3300026088 | Bacteria | 12564 |
| 470 | Ga0207641_10043172 | 3300026088 | Bacteria | 3785 |
| 471 | Ga0207641_10080673 | 3300026088 | Bacteria | 2823 |
| 472 | Ga0207641_10253550 | 3300026088 | Bacteria | 1644 |
| 473 | Ga0207641_10572491 | 3300026088 | Bacteria | 1103 |
| 474 | Ga0207641_10935034 | 3300026088 | Bacteria | 862 |
| 475 | Ga0207648_10001216 | 3300026089 | Bacteria | 28854 |
| 476 | Ga0207676_10001237 | 3300026095 | Bacteria | 19005 |
| 477 | Ga0207676_10019321 | 3300026095 | Bacteria | 4969 |
| 478 | Ga0207676_10026624 | 3300026095 | Bacteria | 4300 |
| 479 | Ga0207676_10802081 | 3300026095 | Bacteria | 918 |
| 480 | Ga0207674_10000945 | 3300026116 | Bacteria | 37959 |
| 481 | Ga0207674_10005054 | 3300026116 | Bacteria | 15745 |
| 482 | Ga0207674_10006327 | 3300026116 | Bacteria | 13948 |
| 483 | Ga0207674_10013895 | 3300026116 | Bacteria | 8909 |
| 484 | Ga0207674_10099138 | 3300026116 | Bacteria | 2896 |
| 485 | Ga0207674_10171056 | 3300026116 | Bacteria | 2126 |
| 486 | Ga0207674_10193815 | 3300026116 | Bacteria | 1982 |
| 487 | Ga0207674_10268205 | 3300026116 | Bacteria | 1654 |
| 488 | Ga0207675_100046539 | 3300026118 | Bacteria | 4053 |
| 489 | Ga0207675_100056638 | 3300026118 | Bacteria | 3656 |
| 490 | Ga0207698_10000427 | 3300026142 | Bacteria | 24235 |
| 491 | Ga0207698_10015214 | 3300026142 | Bacteria | 5148 |
| 492 | Ga0207698_10334046 | 3300026142 | Bacteria | 1425 |
| 493 | Ga0207698_10673859 | 3300026142 | Bacteria | 1027 |
| 494 | Ga0207698_10720843 | 3300026142 | Bacteria | 994 |
| 495 | Ga0209813_10000017 | 3300027866 | Bacteria | 75687 |
| 496 | Ga0209813_10000082 | 3300027866 | Bacteria | 34870 |
| 497 | Ga0209974_10034832 | 3300027876 | Bacteria | 1672 |
| 498 | Ga0268266_10000118 | 3300028379 | Bacteria | 163466 |
| 499 | Ga0268266_10000309 | 3300028379 | Bacteria | 77336 |
| 500 | Ga0268266_10002431 | 3300028379 | Bacteria | 20016 |
| 501 | Ga0268266_10005364 | 3300028379 | Bacteria | 11980 |
| 502 | Ga0268266_10122751 | 3300028379 | Bacteria | 2313 |
| 503 | Ga0268265_10000424 | 3300028380 | Bacteria | 45348 |
| 504 | Ga0268265_10000469 | 3300028380 | Bacteria | 42727 |
| 505 | Ga0268265_10028122 | 3300028380 | Bacteria | 4022 |
| 506 | Ga0268265_10084403 | 3300028380 | Bacteria | 2517 |
| 507 | Ga0268265_10108110 | 3300028380 | Bacteria | 2263 |
| 508 | Ga0268265_10149817 | 3300028380 | Bacteria | 1966 |
| 509 | Ga0268265_10219792 | 3300028380 | Bacteria | 1661 |
| 510 | Ga0268265_10501821 | 3300028380 | Bacteria | 1143 |
| 511 | Ga0268265_10937659 | 3300028380 | Bacteria | 852 |
| 512 | Ga0268264_10000087 | 3300028381 | Bacteria | 236696 |
| 513 | Ga0268264_10000091 | 3300028381 | Bacteria | 233338 |
| 514 | Ga0268264_10000101 | 3300028381 | Bacteria | 225109 |
| 515 | Ga0268264_10000134 | 3300028381 | Bacteria | 179475 |
| 516 | Ga0268264_10011832 | 3300028381 | Bacteria | 7193 |
| 517 | Ga0268264_10053504 | 3300028381 | Bacteria | 3368 |
| 518 | Ga0268264_10153593 | 3300028381 | Bacteria | 2066 |
| 519 | Ga0307517_10187486 | 3300028786 | Bacteria | 1321 |
| 520 | Ga0265338_10199094 | 3300028800 | Bacteria | 1512 |
| 521 | Ga0265331_10059525 | 3300031250 | Bacteria | 1806 |
| 522 | Ga0265327_10047419 | 3300031251 | Bacteria | 2268 |
| 523 | Ga0307513_10109817 | 3300031456 | Bacteria | 2755 |
| 524 | Ga0307408_100010852 | 3300031548 | Bacteria | 6011 |
| 525 | Ga0307408_100105234 | 3300031548 | Bacteria | 2157 |
| 526 | Ga0307408_100492285 | 3300031548 | Bacteria | 1072 |
| 527 | Ga0307408_100916674 | 3300031548 | Bacteria | 803 |
| 528 | Ga0307408_101114027 | 3300031548 | Bacteria | 733 |
| 529 | Ga0265313_10255408 | 3300031595 | Bacteria | 714 |
| 530 | Ga0316575_10001316 | 3300031665 | Bacteria | 7930 |
| 531 | Ga0316575_10439230 | 3300031665 | Bacteria | 562 |
| 532 | Ga0265314_10015740 | 3300031711 | Bacteria | 5992 |
| 533 | Ga0307516_10152207 | 3300031730 | Bacteria | 2072 |
| 534 | Ga0307405_10029770 | 3300031731 | Bacteria | 3194 |
| 535 | Ga0307405_10145134 | 3300031731 | Bacteria | 1661 |
| 536 | Ga0307405_11099492 | 3300031731 | Bacteria | 683 |
| 537 | Ga0307413_10105216 | 3300031824 | Bacteria | 1875 |
| 538 | Ga0307413_10818549 | 3300031824 | Bacteria | 784 |
| 539 | Ga0307413_10985474 | 3300031824 | Bacteria | 721 |
| 540 | Ga0307410_10014693 | 3300031852 | Bacteria | 4618 |
| 541 | Ga0307406_10118407 | 3300031901 | Bacteria | 1836 |
| 542 | Ga0307406_10431377 | 3300031901 | Bacteria | 1053 |
| 543 | Ga0307406_10728889 | 3300031901 | Bacteria | 830 |
| 544 | Ga0307406_11020277 | 3300031901 | Bacteria | 711 |
| 545 | Ga0307407_10286441 | 3300031903 | Bacteria | 1143 |
| 546 | Ga0307407_10822272 | 3300031903 | Bacteria | 708 |
| 547 | Ga0307412_10160407 | 3300031911 | Bacteria | 1670 |
| 548 | Ga0307412_10245213 | 3300031911 | Bacteria | 1388 |
| 549 | Ga0307412_10471254 | 3300031911 | Bacteria | 1039 |
| 550 | Ga0307412_11388979 | 3300031911 | Bacteria | 635 |
| 551 | Ga0307409_100018325 | 3300031995 | Bacteria | 4703 |
| 552 | Ga0307409_100065368 | 3300031995 | Bacteria | 2862 |
| 553 | Ga0307409_100600216 | 3300031995 | Bacteria | 1088 |
| 554 | Ga0307409_101338017 | 3300031995 | Bacteria | 742 |
| 555 | Ga0307416_100016385 | 3300032002 | Bacteria | 5151 |
| 556 | Ga0307416_100061652 | 3300032002 | Bacteria | 3062 |
| 557 | Ga0307416_100824235 | 3300032002 | Bacteria | 1025 |
| 558 | Ga0307414_10005500 | 3300032004 | Bacteria | 6982 |
| 559 | Ga0307414_10084360 | 3300032004 | Bacteria | 2336 |
| 560 | Ga0307414_10370744 | 3300032004 | Bacteria | 1235 |
| 561 | Ga0307414_10393213 | 3300032004 | Bacteria | 1202 |
| 562 | Ga0307414_10475099 | 3300032004 | Bacteria | 1101 |
| 563 | Ga0307414_11192195 | 3300032004 | Bacteria | 705 |
| 564 | Ga0307411_10010117 | 3300032005 | Bacteria | 5007 |
| 565 | Ga0307411_10434007 | 3300032005 | Bacteria | 1094 |
| 566 | Ga0307415_100418905 | 3300032126 | Bacteria | 1149 |
| 567 | Ga0316583_10012845 | 3300032133 | Bacteria | 3022 |
| 568 | Ga0373959_0015955 | 3300034820 | Bacteria | 1386 |
| 569 | Ga0373938_0064894 | 3300034957 | Bacteria | 861 |
| 570 | Ga0373934_0303686 | 3300035086 | Bacteria | 662 |
| 571 | Ga0373923_0004387 | 3300035111 | Bacteria | 4675 |
| 572 | Ga0373923_0106023 | 3300035111 | Bacteria | 1244 |
| 573 | Ga0373956_0010017 | 3300035119 | Bacteria | 3868 |
| 574 | Ga0373957_0017656 | 3300035120 | Bacteria | 2489 |
| 575 | Ga0373960_0015422 | 3300035121 | Bacteria | 1951 |
| 576 | Ga0373955_0002366 | 3300035172 | Bacteria | 8205 |
| 577 | Ga0373942_0048300 | 3300035207 | Bacteria | 1185 |
| 578 | Ga0373962_0096931 | 3300035242 | Bacteria | 915 |
| 579 | Ga0373931_0047725 | 3300035691 | Bacteria | 2267 |
| 580 | Ga0373935_0547913 | 3300035692 | Bacteria | 843 |
| 581 | Ga0373933_0086952 | 3300035724 | Bacteria | 1924 |
| 582 | Ga0373937_0006632 | 3300036401 | Bacteria | 9994 |
| 583 | Ga0316582_0224828 | 3300036647 | Bacteria | 1284 |
| 584 | Ga0316582_0889782 | 3300036647 | Unclassified | 609 |
| 585 | Ga0316584_0024034 | 3300036712 | Bacteria | 4456 |
| 586 | Ga0373925_0256850 | 3300037068 | Bacteria | 1403 |
| 587 | Ga0395899_0037881 | 3300037312 | Bacteria | 3614 |
| 588 | Ga0395899_0046407 | 3300037312 | Bacteria | 3236 |
| 589 | Ga0395899_0076741 | 3300037312 | Bacteria | 2438 |
| 590 | Ga0395899_0076776 | 3300037312 | Bacteria | 2438 |
| 591 | Ga0395899_0110916 | 3300037312 | Bacteria | 1972 |
| 592 | Ga0395899_0388300 | 3300037312 | Bacteria | 926 |
| 593 | Ga0395899_0396896 | 3300037312 | Bacteria | 913 |
| 594 | Ga0395900_0000209 | 3300037418 | Bacteria | 91678 |
| 595 | Ga0395900_0052961 | 3300037418 | Bacteria | 4177 |
| 596 | Ga0395900_0084617 | 3300037418 | Bacteria | 3259 |
| 597 | Ga0395900_0139753 | 3300037418 | Bacteria | 2480 |
| 598 | Ga0395900_0167894 | 3300037418 | Bacteria | 2235 |
| 599 | Ga0395900_0242926 | 3300037418 | Bacteria | 1805 |
| 600 | Ga0395900_0348972 | 3300037418 | Bacteria | 1453 |
| 601 | Ga0395900_0367241 | 3300037418 | Bacteria | 1409 |
| 602 | Ga0395900_0727841 | 3300037418 | Bacteria | 924 |
| 603 | Ga0395900_0833971 | 3300037418 | Bacteria | 848 |
| 604 | Ga0395900_0972316 | 3300037418 | Bacteria | 770 |
| 605 | Ga0395898_0004531 | 3300037466 | Bacteria | 15168 |
| 606 | Ga0395898_0038647 | 3300037466 | Bacteria | 4728 |
| 607 | Ga0395898_0230714 | 3300037466 | Bacteria | 1765 |
| 608 | Ga0395898_0244719 | 3300037466 | Bacteria | 1710 |
| 609 | Ga0395898_0369396 | 3300037466 | Bacteria | 1368 |
| 610 | Ga0395898_0591404 | 3300037466 | Bacteria | 1052 |
| 611 | Ga0395898_1363132 | 3300037466 | Bacteria | 637 |
| 612 | Ga0395905_0008172 | 3300037471 | Bacteria | 10331 |
| 613 | Ga0395905_0025304 | 3300037471 | Bacteria | 5597 |
| 614 | Ga0395905_0050182 | 3300037471 | Bacteria | 3910 |
| 615 | Ga0395905_0096517 | 3300037471 | Bacteria | 2775 |
| 616 | Ga0395905_0103309 | 3300037471 | Bacteria | 2675 |
| 617 | Ga0395905_0208157 | 3300037471 | Bacteria | 1833 |
| 618 | Ga0395905_0306413 | 3300037471 | Bacteria | 1476 |
| 619 | Ga0395905_0439178 | 3300037471 | Bacteria | 1202 |
| 620 | Ga0395905_0864200 | 3300037471 | Bacteria | 807 |
| 621 | Ga0395905_1373346 | 3300037471 | Bacteria | 610 |
| 622 | Ga0395905_1492281 | 3300037471 | Bacteria | 580 |
| 623 | Ga0395905_1747883 | 3300037471 | Bacteria | 527 |
| 624 | Ga0436364_0619037 | 3300037853 | Bacteria | 1986 |
| 625 | Ga0395901_0008144 | 3300038443 | Bacteria | 10588 |
| 626 | Ga0395901_0134144 | 3300038443 | Bacteria | 2602 |
| 627 | Ga0395901_0282727 | 3300038443 | Bacteria | 1723 |
| 628 | Ga0395901_0288212 | 3300038443 | Bacteria | 1704 |
| 629 | Ga0395901_0330994 | 3300038443 | Bacteria | 1574 |
| 630 | Ga0395901_0511359 | 3300038443 | Bacteria | 1221 |
| 631 | Ga0395901_0611927 | 3300038443 | Bacteria | 1097 |
| 632 | Ga0395901_0967425 | 3300038443 | Bacteria | 829 |
| 633 | Ga0395901_1103085 | 3300038443 | Bacteria | 764 |
| 634 | Ga0436365_0192103 | 3300039437 | Bacteria | 182879 |
| 635 | Ga0436365_0410983 | 3300039437 | Bacteria | 18944 |
| 636 | Ga0436363_0930037 | 3300039450 | Bacteria | 682 |
| 637 | Ga0436362_0383697 | 3300039453 | Bacteria | 74416 |
| 638 | Ga0439447_000009 | 3300041407 | Unclassified | 90162 |
| 639 | Ga0439453_0005321 | 3300041408 | Bacteria | 1955 |
| 640 | Ga0439466_0009170 | 3300041411 | Viruses | 3707 |
| 641 | Ga0451791_1678702 | 3300041451 | Bacteria | 622 |
| 642 | Ga0451800_1418878 | 3300041459 | Bacteria | 551 |
| 643 | Ga0451853_3208052 | 3300041512 | Bacteria | 606 |
| 644 | Ga0439446_0146374 | 3300042156 | Unclassified | 774 |
| 645 | Ga0439434_0109128 | 3300042435 | Bacteria | 895 |
| 646 | Ga0451577_0003514 | 3300042876 | Bacteria | 17371 |
| 647 | Ga0466969_0108133 | 3300044656 | Bacteria | 1304 |
| 648 | Ga0466963_0085421 | 3300044694 | Bacteria | 2142 |
| 649 | Ga0466957_0085985 | 3300044842 | Bacteria | 1965 |
| 650 | Ga0466959_0104571 | 3300045049 | Bacteria | 2025 |
| 651 | Ga0451576_0008302 | 3300045051 | Bacteria | 12207 |
| 652 | Ga0451576_0264872 | 3300045051 | Bacteria | 1796 |
| 653 | Ga0495617_074497 | 3300046452 | Bacteria | 1114 |
| 654 | Ga0495627_000570 | 3300046453 | Bacteria | 29747 |
| 655 | Ga0495627_001851 | 3300046453 | Bacteria | 11213 |
| 656 | Ga0495638_0123113 | 3300046460 | Bacteria | 1531 |
| 657 | Ga0495638_0165833 | 3300046460 | Bacteria | 1271 |
| 658 | Ga0495650_0145666 | 3300046471 | Bacteria | 854 |
| 659 | Ga0495650_0201405 | 3300046471 | Bacteria | 692 |
| 660 | Ga0495584_0005846 | 3300046491 | Bacteria | 6482 |
| 661 | Ga0495596_0000008 | 3300046500 | Bacteria | 150860 |
| 662 | Ga0495583_0000577 | 3300046506 | Bacteria | 50418 |
| 663 | Ga0495606_0003324 | 3300046507 | Bacteria | 17167 |
| 664 | Ga0495606_0139796 | 3300046507 | Bacteria | 1431 |
| 665 | Ga0495610_0000268 | 3300046512 | Bacteria | 54316 |
| 666 | Ga0495616_0348458 | 3300046513 | Bacteria | 617 |
| 667 | Ga0495631_0106470 | 3300046518 | Bacteria | 1206 |
| 668 | Ga0495632_0000075 | 3300046519 | Bacteria | 102051 |
| 669 | Ga0495632_0060944 | 3300046519 | Bacteria | 1832 |
| 670 | Ga0495637_0000123 | 3300046520 | Bacteria | 57717 |
| 671 | Ga0495637_0000890 | 3300046520 | Bacteria | 19264 |
| 672 | Ga0495643_0000009 | 3300046522 | Bacteria | 344767 |
| 673 | Ga0495643_0015079 | 3300046522 | Bacteria | 4579 |
| 674 | Ga0495648_0002760 | 3300046524 | Bacteria | 15853 |
| 675 | Ga0495663_0000003 | 3300046525 | Bacteria | 362694 |
| 676 | Ga0495642_0073523 | 3300046528 | Bacteria | 1432 |
| 677 | Ga0495654_0192564 | 3300046530 | Bacteria | 877 |
| 678 | Ga0495621_0009525 | 3300046539 | Bacteria | 2953 |
| 679 | Ga0495621_0020629 | 3300046539 | Bacteria | 2165 |
| 680 | Ga0495633_0000173 | 3300046558 | Bacteria | 84576 |
| 681 | Ga0495633_0000834 | 3300046558 | Bacteria | 27197 |
| 682 | Ga0495656_0000023 | 3300046615 | Unclassified | 88819 |
| 683 | Ga0495668_0358132 | 3300046616 | Bacteria | 801 |
| 684 | Ga0495625_0037398 | 3300046660 | Bacteria | 3562 |
| 685 | Ga0495625_0165371 | 3300046660 | Bacteria | 1479 |
| 686 | Ga0495625_0680309 | 3300046660 | Bacteria | 610 |
| 687 | Ga0495659_0000192 | 3300046664 | Bacteria | 26727 |
| 688 | Ga0495661_0191590 | 3300046665 | Bacteria | 1076 |
| 689 | Ga0495623_0012520 | 3300046679 | Bacteria | 5488 |
| 690 | Ga0495670_0046480 | 3300046691 | Bacteria | 2168 |
| 691 | Ga0495670_0072476 | 3300046691 | Bacteria | 1745 |
| 692 | Ga0495671_0000013 | 3300046692 | Bacteria | 344767 |
| 693 | Ga0495671_0068061 | 3300046692 | Bacteria | 1751 |
| 694 | Ga0495671_0080367 | 3300046692 | Bacteria | 1597 |
| 695 | Ga0495672_0109202 | 3300047320 | Bacteria | 1487 |
| 696 | Ga0495687_182929 | 3300047443 | Bacteria | 682 |
| 697 | Ga0495681_0000059 | 3300047470 | Bacteria | 102400 |
| 698 | Ga0495681_0001690 | 3300047470 | Bacteria | 16347 |
| 699 | Ga0495681_0095122 | 3300047470 | Bacteria | 1310 |
| 700 | Ga0495686_0000430 | 3300047472 | Bacteria | 65300 |
| 701 | Ga0495686_0001136 | 3300047472 | Bacteria | 31452 |
| 702 | Ga0495686_0001320 | 3300047472 | Bacteria | 27790 |
| 703 | Ga0495686_0001775 | 3300047472 | Bacteria | 21986 |
| 704 | Ga0495686_0026479 | 3300047472 | Bacteria | 3793 |
| 705 | Ga0495686_0167029 | 3300047472 | Bacteria | 1282 |
| 706 | Ga0496101_0066545 | 3300048904 | Bacteria | 2629 |
| 707 | Ga0496102_0007382 | 3300048905 | Bacteria | 9389 |
| 708 | Ga0496102_0008608 | 3300048905 | Viruses | 8755 |
| 709 | Ga0496102_0662149 | 3300048905 | Bacteria | 967 |
| 710 | Ga0496103_0003095 | 3300048906 | Bacteria | 10222 |
| 711 | Ga0496103_0710718 | 3300048906 | Bacteria | 637 |
| 712 | Ga0496104_0010352 | 3300048907 | Bacteria | 8329 |
| 713 | Ga0496105_0007301 | 3300048908 | Bacteria | 8537 |
| 714 | Ga0496106_0726706 | 3300048909 | Bacteria | 790 |
| 715 | Ga0496109_0178434 | 3300048912 | Bacteria | 1994 |
| 716 | Ga0496109_0415352 | 3300048912 | Bacteria | 1271 |
| 717 | Ga0496110_0169877 | 3300048913 | Bacteria | 1978 |
| 718 | Ga0496110_0186659 | 3300048913 | Bacteria | 1883 |
| 719 | Ga0496111_0616798 | 3300048914 | Bacteria | 793 |
| 720 | Ga0496114_0000131 | 3300048917 | Bacteria | 54315 |
| 721 | Ga0496116_0000089 | 3300048919 | Bacteria | 213129 |
| 722 | Ga0496116_0020569 | 3300048919 | Bacteria | 5009 |
| 723 | Ga0496117_0003608 | 3300048920 | Bacteria | 17829 |
| 724 | Ga0496117_0014014 | 3300048920 | Bacteria | 6938 |
| 725 | Ga0496117_0024513 | 3300048920 | Bacteria | 4768 |
| 726 | Ga0496117_0052042 | 3300048920 | Bacteria | 2888 |
| 727 | Ga0496117_0083593 | 3300048920 | Bacteria | 2086 |
| 728 | Ga0496117_0093819 | 3300048920 | Bacteria | 1923 |
| 729 | Ga0496118_0004303 | 3300048921 | Bacteria | 17009 |
| 730 | Ga0496118_0010761 | 3300048921 | Bacteria | 9017 |
| 731 | Ga0496118_0023122 | 3300048921 | Bacteria | 5410 |
| 732 | Ga0496118_0039935 | 3300048921 | Bacteria | 3738 |
| 733 | Ga0496118_0281397 | 3300048921 | Bacteria | 925 |
| 734 | Ga0496119_0102841 | 3300048922 | Bacteria | 1601 |
| 735 | Ga0496119_0260541 | 3300048922 | Bacteria | 870 |
| 736 | Ga0496120_0058204 | 3300048923 | Bacteria | 2172 |
| 737 | Ga0496120_0133236 | 3300048923 | Bacteria | 1270 |
| 738 | Ga0496121_0000196 | 3300048924 | Bacteria | 135812 |
| 739 | Ga0496121_0006803 | 3300048924 | Bacteria | 14006 |
| 740 | Ga0496122_0001736 | 3300048925 | Bacteria | 33820 |
| 741 | Ga0496123_0000590 | 3300048926 | Bacteria | 61951 |
| 742 | Ga0496123_0147502 | 3300048926 | Bacteria | 1275 |
| 743 | Ga0496124_0008334 | 3300048927 | Bacteria | 10854 |
| 744 | Ga0496124_0032443 | 3300048927 | Bacteria | 4611 |
| 745 | Ga0496124_0122778 | 3300048927 | Bacteria | 2073 |
| 746 | Ga0496124_0424727 | 3300048927 | Bacteria | 914 |
| 747 | Ga0496124_0546701 | 3300048927 | Bacteria | 765 |
| 748 | Ga0496125_0049512 | 3300048928 | Bacteria | 3491 |
| 749 | Ga0496125_0403189 | 3300048928 | Bacteria | 798 |
| 750 | Ga0496126_0039078 | 3300048929 | Bacteria | 4407 |
| 751 | Ga0496126_0319523 | 3300048929 | Bacteria | 1276 |
| 752 | Ga0501307_041291 | 3300049162 | Bacteria | 671 |
| 753 | Ga0495678_054039 | 3300049459 | Bacteria | 1539 |
| 754 | Ga0495682_0002949 | 3300049460 | Bacteria | 7781 |
| 755 | Ga0501290_000159 | 3300049513 | Bacteria | 10830 |
| 756 | Ga0501292_000020 | 3300049515 | Bacteria | 54099 |
| 757 | Ga0501294_000244 | 3300049517 | Bacteria | 6757 |
| 758 | Ga0501031_0197420 | 3300049568 | Bacteria | 1313 |
| 759 | Ga0501032_0028908 | 3300049569 | Bacteria | 3807 |
| 760 | Ga0501032_0406198 | 3300049569 | Bacteria | 875 |
| 761 | Ga0501033_0389042 | 3300049570 | Bacteria | 974 |
| 762 | Ga0501034_0054204 | 3300049571 | Bacteria | 4037 |
| 763 | Ga0501034_0057262 | 3300049571 | Bacteria | 3919 |
| 764 | Ga0501034_0545075 | 3300049571 | Bacteria | 1070 |
| 765 | Ga0501037_0117007 | 3300049573 | Bacteria | 1918 |
| 766 | Ga0501039_0269984 | 3300049575 | Bacteria | 1337 |
| 767 | Ga0501039_1071627 | 3300049575 | Bacteria | 625 |
| 768 | Ga0501040_0750192 | 3300049576 | Bacteria | 706 |
| 769 | Ga0501041_0549636 | 3300049577 | Bacteria | 736 |
| 770 | Ga0501042_0270174 | 3300049578 | Bacteria | 1228 |
| 771 | Ga0501043_0079703 | 3300049579 | Bacteria | 2573 |
| 772 | Ga0501046_0056977 | 3300049580 | Bacteria | 3066 |
| 773 | Ga0501047_0002116 | 3300049581 | Bacteria | 18997 |
| 774 | Ga0501047_0274117 | 3300049581 | Bacteria | 1533 |
| 775 | Ga0501047_0903470 | 3300049581 | Bacteria | 696 |
| 776 | Ga0501047_0911445 | 3300049581 | Bacteria | 692 |
| 777 | Ga0501048_0074973 | 3300049582 | Bacteria | 2387 |
| 778 | Ga0501067_0003583 | 3300049583 | Bacteria | 8552 |
| 779 | Ga0501068_0242824 | 3300049584 | Bacteria | 1146 |
| 780 | Ga0501072_0679489 | 3300049588 | Bacteria | 810 |
| 781 | Ga0501074_0891450 | 3300049590 | Bacteria | 626 |
| 782 | Ga0501206_000401 | 3300049653 | Bacteria | 5161 |
| 783 | Ga0501222_000648 | 3300049662 | Bacteria | 5093 |
| 784 | Ga0501223_005698 | 3300049663 | Bacteria | 2605 |
| 785 | Ga0501224_000328 | 3300049664 | Bacteria | 5557 |
| 786 | Ga0501235_011202 | 3300049669 | Bacteria | 1964 |
| 787 | Ga0501249_001014 | 3300049679 | Bacteria | 6031 |
| 788 | Ga0501257_000031 | 3300049686 | Bacteria | 40822 |
| 789 | Ga0501259_000367 | 3300049688 | Bacteria | 7092 |
| 790 | Ga0501261_001824 | 3300049690 | Bacteria | 2621 |
| 791 | Ga0501225_0009052 | 3300049705 | Bacteria | 2845 |
| 792 | Ga0501245_000196 | 3300049708 | Bacteria | 6766 |
| 793 | Ga0501079_0197723 | 3300049741 | Bacteria | 1570 |
| 794 | Ga0501079_0629603 | 3300049741 | Bacteria | 844 |
| 795 | Ga0501279_000022 | 3300049775 | Bacteria | 54370 |
| 796 | Ga0501280_000353 | 3300049776 | Bacteria | 11455 |
| 797 | Ga0501280_003906 | 3300049776 | Bacteria | 2239 |
| 798 | Ga0501281_00259 | 3300049777 | Bacteria | 5634 |
| 799 | Ga0501282_000191 | 3300049778 | Bacteria | 7523 |
| 800 | Ga0501035_0122135 | 3300049822 | Bacteria | 2276 |
| 801 | Ga0501035_0358936 | 3300049822 | Bacteria | 1218 |
| 802 | Ga0501035_0386940 | 3300049822 | Bacteria | 1166 |
| 803 | Ga0501044_0077021 | 3300049823 | Bacteria | 3383 |
| 804 | Ga0501044_0086482 | 3300049823 | Bacteria | 3167 |
| 805 | Ga0501045_0887699 | 3300049824 | Bacteria | 655 |
| 806 | Ga0501204_009184 | 3300049850 | Bacteria | 1138 |
| 807 | nmdc:mga03683_259403_c1 | 3300050489 | Bacteria | 809 |
| 808 | nmdc:mga03683_3517_c1 | 3300050489 | Bacteria | 5070 |
| 809 | nmdc:mga03n38_40422_c1 | 3300050490 | Bacteria | 2027 |
| 810 | nmdc:mga03n38_47793_c1 | 3300050490 | Bacteria | 1896 |
| 811 | nmdc:mga03n38_75671_c1 | 3300050490 | Bacteria | 1569 |
| 812 | nmdc:mga00v17_51062_c1 | 3300050491 | Bacteria | 2515 |
| 813 | nmdc:mga00v17_5310_c1 | 3300050491 | Bacteria | 6788 |
| 814 | nmdc:mga00v17_581703_c1 | 3300050491 | Bacteria | 723 |
| 815 | nmdc:mga0yw44_108049_c1 | 3300050492 | Bacteria | 1780 |
| 816 | nmdc:mga0yw44_204872_c1 | 3300050492 | Bacteria | 1304 |
| 817 | nmdc:mga0k408_121012_c1 | 3300050493 | Bacteria | 1550 |
| 818 | nmdc:mga0k408_221074_c1 | 3300050493 | Bacteria | 1131 |
| 819 | nmdc:mga0k408_3840_c1 | 3300050493 | Bacteria | 7966 |
| 820 | nmdc:mga0k408_61685_c1 | 3300050493 | Bacteria | 2180 |
| 821 | nmdc:mga06z11_20_c1 | 3300050494 | Bacteria | 75712 |
| 822 | nmdc:mga06z11_770_c1 | 3300050494 | Bacteria | 11686 |
| 823 | nmdc:mga04h51_108_c1 | 3300050495 | Bacteria | 24818 |
| 824 | nmdc:mga04h51_339_c1 | 3300050495 | Bacteria | 11749 |
| 825 | nmdc:mga07m45_35_c1 | 3300050496 | Bacteria | 74486 |
| 826 | nmdc:mga0qj67_112215_c1 | 3300050509 | Bacteria | 2201 |
| 827 | nmdc:mga0n895_1306955_c1 | 3300050512 | Bacteria | 696 |
| 828 | nmdc:mga0n895_1625131_c1 | 3300050512 | Bacteria | 610 |
| 829 | nmdc:mga0n895_92167_c1 | 3300050512 | Bacteria | 3033 |
| 830 | nmdc:mga0rr50_316682_c1 | 3300050513 | Bacteria | 1307 |
| 831 | nmdc:mga0sz30_41_c1 | 3300050516 | Bacteria | 46173 |
| 832 | nmdc:mga0sz30_79563_c1 | 3300050516 | Bacteria | 1418 |
| 833 | Ga0495612_0107420 | 3300053078 | Bacteria | 1192 |
| 834 | Ga0495595_0468711 | 3300053084 | Bacteria | 641 |
| 835 | Ga0500643_000195 | 3300053087 | Bacteria | 57960 |
| 836 | Ga0500643_012652 | 3300053087 | Bacteria | 3014 |
| 837 | Ga0500643_024520 | 3300053087 | Bacteria | 1914 |
| 838 | Ga0500643_038746 | 3300053087 | Bacteria | 1411 |
| 839 | Ga0500643_070216 | 3300053087 | Bacteria | 972 |
| 840 | Ga0500555_000645 | 3300053103 | Bacteria | 13442 |
| 841 | Ga0500556_0000054 | 3300053104 | Bacteria | 115949 |
| 842 | Ga0500562_002192 | 3300053108 | Bacteria | 4884 |
| 843 | Ga0500562_007791 | 3300053108 | Bacteria | 2702 |
| 844 | Ga0500592_001661 | 3300053116 | Bacteria | 3608 |
| 845 | Ga0500592_022803 | 3300053116 | Bacteria | 1009 |
| 846 | Ga0500593_065595 | 3300053117 | Bacteria | 1587 |
| 847 | Ga0500595_000379 | 3300053119 | Bacteria | 28661 |
| 848 | Ga0500595_011903 | 3300053119 | Bacteria | 3386 |
| 849 | Ga0500618_152347 | 3300053125 | Bacteria | 528 |
| 850 | Ga0500559_0209779 | 3300053136 | Bacteria | 919 |
| 851 | Ga0500604_0038426 | 3300053151 | Bacteria | 1436 |
| 852 | Ga0500616_0043163 | 3300053153 | Bacteria | 2411 |
| 853 | Ga0500622_0000119 | 3300053156 | Bacteria | 82219 |
| 854 | Ga0500637_0003430 | 3300053178 | Bacteria | 7324 |
| 855 | Ga0501084_0331746 | 3300054114 | Bacteria | 1285 |
| 856 | Ga0501084_0364019 | 3300054114 | Bacteria | 1222 |
| 857 | Ga0501084_1856662 | 3300054114 | Bacteria | 503 |
| 858 | Ga0466962_0410849 | 3300061719 | Bacteria | 678 |
| 859 | 2511126458 | 2510917021 | Bacteria | 5705459 |
| 860 | 2512645012 | 2512564014 | Bacteria | 4639632 |
| 861 | 2643730557 | 2643221541 | Bacteria | 5498788 |
| 862 | 2643950756 | 2643221588 | Bacteria | 3692460 |
| 863 | 2644037540 | 2643221605 | Bacteria | 4772303 |
| 864 | 2644043726 | 2643221606 | Bacteria | 5588032 |
| 865 | 2644393885 | 2643221671 | Bacteria | 5496681 |
| 866 | 2809064879 | 2808606401 | Bacteria | 4586670 |
| 867 | 2809080955 | 2808606404 | Bacteria | 4652788 |
| 868 | 2809085211 | 2808606405 | Bacteria | 4586632 |
| 869 | 2830078753 | 2830075706 | Bacteria | 3855215 |
| 870 | 2842335732 | 2842333319 | Bacteria | 8899485 |
| 871 | 2846952796 | 2846952575 | Bacteria | 6587527 |
| 872 | 2880521944 | 2880518877 | Bacteria | 5012590 |
| 873 | 2896430600 | 2896429255 | Bacteria | 2557483 |
| 874 | 2919709874 | 2919709256 | Bacteria | 4318106 |
| 875 | Ga0495611_0029615 | |||
| 876 | JGI24740J21852_10005081 | |||
| 877 | JGI24739J22299_10000986 | |||
| 878 | JGI24739J22299_10007198 | |||
| 879 | JGI24739J22299_10074953 | |||
| 880 | JGI24737J22298_10000178 | |||
| 881 | JGI24737J22298_10002030 | |||
| 882 | JGI24735J21928_10105427 | |||
| 883 | JGI24750J21931_1070073 | |||
| 884 | JGI24745J21846_1012602 | |||
| 885 | JGI24738J21930_10000035 | |||
| 886 | JGI24738J21930_10010010 | |||
| 887 | JGI24749J21850_1000469 | |||
| 888 | JGI24744J21845_10040748 | |||
| 889 | JGI24751J29686_10022773 | |||
| 890 | JGI24751J29686_10110404 | |||
| 891 | rootH1_10116051 | |||
| 892 | rootH1_10189427 | |||
| 893 | Ga0055532_1015105 | |||
| 894 | Ga0065715_10431933 | |||
| 895 | Ga0065707_10314600 | |||
| 896 | Ga0070658_10000950 | |||
| 897 | Ga0070658_10672602 | |||
| 898 | Ga0070658_10879731 | |||
| 899 | Ga0070658_10959707 | |||
| 900 | Ga0070676_10216327 | |||
| 901 | Ga0070683_100001317 | |||
| 902 | Ga0070683_100148591 | |||
| 903 | Ga0070683_100251900 | |||
| 904 | Ga0070683_100540705 | |||
| 905 | Ga0070690_100021166 | |||
| 906 | Ga0070690_100461119 | |||
| 907 | Ga0070670_100027055 | |||
| 908 | Ga0070670_100083372 | |||
| 909 | Ga0070670_100086486 | |||
| 910 | Ga0070670_100139668 | |||
| 911 | Ga0070670_100160167 | |||
| 912 | Ga0070670_100949249 | |||
| 913 | Ga0070677_10012789 | |||
| 914 | Ga0068869_100060475 | |||
| 915 | Ga0068869_100843939 | |||
| 916 | Ga0070666_10002265 | |||
| 917 | Ga0070666_10019253 | |||
| 918 | Ga0070666_10027841 | |||
| 919 | Ga0070666_10030176 | |||
| 920 | Ga0070666_10123373 | |||
| 921 | Ga0070680_100294773 | |||
| 922 | Ga0070682_100282228 | |||
| 923 | Ga0070660_100000260 | |||
| 924 | Ga0070660_100037179 | |||
| 925 | Ga0070660_100289081 | |||
| 926 | Ga0070660_100293830 | |||
| 927 | Ga0070689_100136046 | |||
| 928 | Ga0070661_100000246 | |||
| 929 | Ga0070661_100035625 | |||
| 930 | Ga0070661_100181818 | |||
| 931 | Ga0070661_100744837 | |||
| 932 | Ga0070692_10716495 | |||
| 933 | Ga0070668_100000028 | |||
| 934 | Ga0070668_100000064 | |||
| 935 | Ga0070668_100000468 | |||
| 936 | Ga0070668_100004618 | |||
| 937 | Ga0070668_100025986 | |||
| 938 | Ga0070669_100001504 | |||
| 939 | Ga0070669_100003371 | |||
| 940 | Ga0070669_100182914 | |||
| 941 | Ga0070669_100501148 | |||
| 942 | Ga0070675_100019838 | |||
| 943 | Ga0070675_100124634 | |||
| 944 | Ga0070671_100000829 | |||
| 945 | Ga0070671_100001575 | |||
| 946 | Ga0070671_100005874 | |||
| 947 | Ga0070671_100040285 | |||
| 948 | Ga0070671_100187231 | |||
| 949 | Ga0070671_100480140 | |||
| 950 | Ga0070673_100004134 | |||
| 951 | Ga0070673_100514552 | |||
| 952 | Ga0070659_100000195 | |||
| 953 | Ga0070659_100095743 | |||
| 954 | Ga0070659_100261312 | |||
| 955 | Ga0070659_100470982 | |||
| 956 | Ga0070659_100531552 | |||
| 957 | Ga0070659_100871826 | |||
| 958 | Ga0070659_101632690 | |||
| 959 | Ga0070667_100000003 | |||
| 960 | Ga0070667_100000016 | |||
| 961 | Ga0070667_100003644 | |||
| 962 | Ga0070667_100004495 | |||
| 963 | Ga0070667_100009905 | |||
| 964 | Ga0070667_100012716 | |||
| 965 | Ga0070714_100746496 | |||
| 966 | Ga0070713_100151733 | |||
| 967 | Ga0070663_100002814 | |||
| 968 | Ga0070678_100607394 | |||
| 969 | Ga0070662_100000047 | |||
| 970 | Ga0070662_100002369 | |||
| 971 | Ga0070681_10455323 | |||
| 972 | Ga0068867_100016487 | |||
| 973 | Ga0070685_10168672 | |||
| 974 | Ga0070707_100482005 | |||
| 975 | Ga0070679_100138866 | |||
| 976 | Ga0070679_100386071 | |||
| 977 | Ga0070679_101202095 | |||
| 978 | Ga0070684_100042567 | |||
| 979 | Ga0070684_100126214 | |||
| 980 | Ga0070684_100186503 | |||
| 981 | Ga0070684_100611468 | |||
| 982 | Ga0070684_100709370 | |||
| 983 | Ga0070684_101562541 | |||
| 984 | Ga0068853_100000033 | |||
| 985 | Ga0068853_100129978 | |||
| 986 | Ga0068853_100133526 | |||
| 987 | Ga0068853_100209934 | |||
| 988 | Ga0068853_101315307 | |||
| 989 | Ga0068853_101674325 | |||
| 990 | Ga0070672_100089311 | |||
| 991 | Ga0070686_100000235 | |||
| 992 | Ga0070686_100261290 | |||
| 993 | Ga0070693_100010785 | |||
| 994 | Ga0070665_100000038 | |||
| 995 | Ga0070665_100000070 | |||
| 996 | Ga0070665_100002115 | |||
| 997 | Ga0070665_100032833 | |||
| 998 | Ga0068855_100000531 | |||
| 999 | Ga0068855_100001755 | |||
| 1000 | Ga0068855_100079313 | |||
| 1001 | Ga0068855_100781375 | |||
| 1002 | Ga0068855_101505804 | |||
| 1003 | Ga0070664_100000242 | |||
| 1004 | Ga0070664_100041826 | |||
| 1005 | Ga0070664_100149870 | |||
| 1006 | Ga0068857_100001908 | |||
| 1007 | Ga0068857_100053309 | |||
| 1008 | Ga0068857_100123472 | |||
| 1009 | Ga0068857_100124422 | |||
| 1010 | Ga0068857_100209124 | |||
| 1011 | Ga0068854_100006502 | |||
| 1012 | Ga0068854_100010181 | |||
| 1013 | Ga0068854_100033722 | |||
| 1014 | Ga0068854_100126047 | |||
| 1015 | Ga0068854_100698189 | |||
| 1016 | Ga0068854_101903278 | |||
| 1017 | Ga0068856_100000162 | |||
| 1018 | Ga0068856_100920639 | |||
| 1019 | Ga0068856_101178185 | |||
| 1020 | Ga0070702_100184049 | |||
| 1021 | Ga0068852_100000471 | |||
| 1022 | Ga0068852_100003956 | |||
| 1023 | Ga0068852_100143413 | |||
| 1024 | Ga0068852_100280612 | |||
| 1025 | Ga0068852_100532334 | |||
| 1026 | Ga0068852_100921900 | |||
| 1027 | Ga0068859_100045654 | |||
| 1028 | Ga0068859_100163402 | |||
| 1029 | Ga0068859_100216750 | |||
| 1030 | Ga0068859_100228159 | |||
| 1031 | Ga0068859_100270285 | |||
| 1032 | Ga0068859_100471064 | |||
| 1033 | Ga0068859_100521586 | |||
| 1034 | Ga0068859_101543891 | |||
| 1035 | Ga0068859_101549848 | |||
| 1036 | Ga0068859_101842040 | |||
| 1037 | Ga0068859_102528791 | |||
| 1038 | Ga0068864_100015986 | |||
| 1039 | Ga0068864_100032381 | |||
| 1040 | Ga0068864_100056815 | |||
| 1041 | Ga0068861_100029338 | |||
| 1042 | Ga0068861_100116342 | |||
| 1043 | Ga0068851_10031330 | |||
| 1044 | Ga0068851_10415195 | |||
| 1045 | Ga0068863_100000052 | |||
| 1046 | Ga0068863_100000092 | |||
| 1047 | Ga0068863_100000727 | |||
| 1048 | Ga0068863_100002981 | |||
| 1049 | Ga0068863_100062680 | |||
| 1050 | Ga0068863_100066588 | |||
| 1051 | Ga0068863_100100169 | |||
| 1052 | Ga0068863_100177476 | |||
| 1053 | Ga0068858_100000892 | |||
| 1054 | Ga0068858_100009735 | |||
| 1055 | Ga0068858_100015627 | |||
| 1056 | Ga0068858_100133549 | |||
| 1057 | Ga0068858_100415136 | |||
| 1058 | Ga0068860_100000007 | |||
| 1059 | Ga0068860_100000045 | |||
| 1060 | Ga0068860_100000196 | |||
| 1061 | Ga0068860_100006131 | |||
| 1062 | Ga0068860_100010108 | |||
| 1063 | Ga0068860_100076639 | |||
| 1064 | Ga0068860_100167035 | |||
| 1065 | Ga0068860_100595112 | |||
| 1066 | Ga0068860_101474580 | |||
| 1067 | Ga0068862_100000385 | |||
| 1068 | Ga0068862_100000877 | |||
| 1069 | Ga0068862_100007339 | |||
| 1070 | Ga0068862_100011387 | |||
| 1071 | Ga0068862_100039746 | |||
| 1072 | Ga0068862_100103090 | |||
| 1073 | Ga0068862_100132959 | |||
| 1074 | Ga0068862_100152714 | |||
| 1075 | Ga0081455_10061870 | |||
| 1076 | Ga0075368_10000152 | |||
| 1077 | Ga0075363_100002645 | |||
| 1078 | Ga0075363_100050909 | |||
| 1079 | Ga0075364_10087542 | |||
| 1080 | Ga0075364_10658184 | |||
| 1081 | Ga0075362_10042057 | |||
| 1082 | Ga0075362_10137077 | |||
| 1083 | Ga0075367_10000134 | |||
| 1084 | Ga0075367_10075854 | |||
| 1085 | Ga0075369_10003510 | |||
| 1086 | Ga0075366_10071053 | |||
| 1087 | Ga0075366_10130440 | |||
| 1088 | Ga0075366_10262904 | |||
| 1089 | Ga0075366_10303107 | |||
| 1090 | Ga0097621_100039279 | |||
| 1091 | Ga0097621_100171752 | |||
| 1092 | Ga0097621_100934274 | |||
| 1093 | Ga0075370_10057671 | |||
| 1094 | Ga0075370_10203751 | |||
| 1095 | Ga0075370_10622442 | |||
| 1096 | Ga0068871_100108292 | |||
| 1097 | Ga0068871_100145109 | |||
| 1098 | Ga0075430_100210608 | |||
| 1099 | Ga0075434_100100221 | |||
| 1100 | Ga0075434_100627907 | |||
| 1101 | Ga0075434_102457447 | |||
| 1102 | Ga0068865_100087005 | |||
| 1103 | Ga0075436_100714259 | |||
| 1104 | Ga0097620_100020395 | |||
| 1105 | Ga0097620_100045653 | |||
| 1106 | Ga0097620_100163398 | |||
| 1107 | Ga0097620_100216746 | |||
| 1108 | Ga0097620_100228162 | |||
| 1109 | Ga0097620_100270299 | |||
| 1110 | Ga0097620_100471065 | |||
| 1111 | Ga0097620_100521583 | |||
| 1112 | Ga0097620_101543352 | |||
| 1113 | Ga0097620_101549883 | |||
| 1114 | Ga0097620_101842897 | |||
| 1115 | Ga0097620_102530419 | |||
| 1116 | Ga0105251_10005582 | |||
| 1117 | Ga0105240_10066895 | |||
| 1118 | Ga0105240_10087616 | |||
| 1119 | Ga0105240_10150868 | |||
| 1120 | Ga0105240_10684580 | |||
| 1121 | Ga0105245_10000285 | |||
| 1122 | Ga0105245_10169598 | |||
| 1123 | Ga0105247_10051194 | |||
| 1124 | Ga0105247_10160341 | |||
| 1125 | Ga0105247_10238002 | |||
| 1126 | Ga0105243_10038024 | |||
| 1127 | Ga0105241_10245403 | |||
| 1128 | Ga0105241_12231835 | |||
| 1129 | Ga0105248_10000659 | |||
| 1130 | Ga0105248_10011429 | |||
| 1131 | Ga0105248_10161443 | |||
| 1132 | Ga0105248_10225459 | |||
| 1133 | Ga0105248_11980827 | |||
| 1134 | Ga0105248_13001525 | |||
| 1135 | Ga0105237_10710107 | |||
| 1136 | Ga0105238_10008171 | |||
| 1137 | Ga0105238_10038975 | |||
| 1138 | Ga0105238_10253224 | |||
| 1139 | Ga0105238_10672731 | |||
| 1140 | Ga0105238_12135921 | |||
| 1141 | Ga0105249_10000574 | |||
| 1142 | Ga0105249_10056713 | |||
| 1143 | Ga0105249_10088658 | |||
| 1144 | Ga0105249_10854049 | |||
| 1145 | Ga0105239_10011926 | |||
| 1146 | Ga0105239_10130902 | |||
| 1147 | Ga0105239_10580364 | |||
| 1148 | Ga0105239_11365987 | |||
| 1149 | Ga0105246_10184144 | |||
| 1150 | Ga0157373_10022263 | |||
| 1151 | Ga0157373_10050159 | |||
| 1152 | Ga0157373_10068400 | |||
| 1153 | Ga0157373_10155580 | |||
| 1154 | Ga0157373_10299862 | |||
| 1155 | Ga0157373_10723507 | |||
| 1156 | Ga0157373_10918408 | |||
| 1157 | Ga0157371_10014963 | |||
| 1158 | Ga0157371_10079335 | |||
| 1159 | Ga0157371_10091128 | |||
| 1160 | Ga0157371_10180439 | |||
| 1161 | Ga0157371_10313661 | |||
| 1162 | Ga0157371_10356052 | |||
| 1163 | Ga0157370_10036970 | |||
| 1164 | Ga0157370_10334480 | |||
| 1165 | Ga0157370_10384626 | |||
| 1166 | Ga0157369_10017738 | |||
| 1167 | Ga0157369_10022100 | |||
| 1168 | Ga0157369_10101220 | |||
| 1169 | Ga0157369_10126550 | |||
| 1170 | Ga0157369_10419918 | |||
| 1171 | Ga0157369_10427958 | |||
| 1172 | Ga0157369_10996038 | |||
| 1173 | Ga0157374_10922535 | |||
| 1174 | Ga0157378_10028389 | |||
| 1175 | Ga0157378_10029855 | |||
| 1176 | Ga0163162_10000077 | |||
| 1177 | Ga0163162_10020508 | |||
| 1178 | Ga0163162_10392518 | |||
| 1179 | Ga0157372_10005572 | |||
| 1180 | Ga0157372_10047838 | |||
| 1181 | Ga0157372_10354969 | |||
| 1182 | Ga0157372_10361528 | |||
| 1183 | Ga0157372_10472375 | |||
| 1184 | Ga0157375_11138896 | |||
| 1185 | Ga0157375_11821260 | |||
| 1186 | Ga0163163_10000273 | |||
| 1187 | Ga0157380_10003514 | |||
| 1188 | Ga0157380_10726996 | |||
| 1189 | Ga0157377_10597970 | |||
| 1190 | Ga0157379_10099121 | |||
| 1191 | Ga0157376_12087936 | |||
| 1192 | Ga0206356_10192360 | |||
| 1193 | Ga0206354_10727992 | |||
| 1194 | Ga0206353_11090631 | |||
| 1195 | Ga0213873_10000009 | |||
| 1196 | Ga0213876_10000004 | |||
| 1197 | Ga0213876_10008570 | |||
| 1198 | Ga0209147_100921 | |||
| 1199 | Ga0207697_10000881 | |||
| 1200 | Ga0207697_10083317 | |||
| 1201 | Ga0207656_10004743 | |||
| 1202 | Ga0207656_10560469 | |||
| 1203 | Ga0207713_1002734 | |||
| 1204 | Ga0207710_10138298 | |||
| 1205 | Ga0207688_10000317 | |||
| 1206 | Ga0207680_10001920 | |||
| 1207 | Ga0207680_10018954 | |||
| 1208 | Ga0207680_10026804 | |||
| 1209 | Ga0207680_10140136 | |||
| 1210 | Ga0207680_10140625 | |||
| 1211 | Ga0207647_10000253 | |||
| 1212 | Ga0207647_10006748 | |||
| 1213 | Ga0207647_10050706 | |||
| 1214 | Ga0207647_10076958 | |||
| 1215 | Ga0207647_10153480 | |||
| 1216 | Ga0207705_10000062 | |||
| 1217 | Ga0207705_10034240 | |||
| 1218 | Ga0207705_10050994 | |||
| 1219 | Ga0207654_10092434 | |||
| 1220 | Ga0207654_10199835 | |||
| 1221 | Ga0207654_10298773 | |||
| 1222 | Ga0207707_10096206 | |||
| 1223 | Ga0207707_10450058 | |||
| 1224 | Ga0207707_10901100 | |||
| 1225 | Ga0207695_10013403 | |||
| 1226 | Ga0207695_10271142 | |||
| 1227 | Ga0207695_10614868 | |||
| 1228 | Ga0207660_10041658 | |||
| 1229 | Ga0207660_11032129 | |||
| 1230 | Ga0207657_10000403 | |||
| 1231 | Ga0207657_10000946 | |||
| 1232 | Ga0207657_10005971 | |||
| 1233 | Ga0207657_10013271 | |||
| 1234 | Ga0207657_10119775 | |||
| 1235 | Ga0207657_10139818 | |||
| 1236 | Ga0207657_10201408 | |||
| 1237 | Ga0207657_10430477 | |||
| 1238 | Ga0207649_10000230 | |||
| 1239 | Ga0207649_10057862 | |||
| 1240 | Ga0207649_10154061 | |||
| 1241 | Ga0207649_10391836 | |||
| 1242 | Ga0207649_10812423 | |||
| 1243 | Ga0207652_10628159 | |||
| 1244 | Ga0207681_10003582 | |||
| 1245 | Ga0207681_10003999 | |||
| 1246 | Ga0207681_10135485 | |||
| 1247 | Ga0207681_10190801 | |||
| 1248 | Ga0207694_10001776 | |||
| 1249 | Ga0207694_10004075 | |||
| 1250 | Ga0207694_10474597 | |||
| 1251 | Ga0207650_10020484 | |||
| 1252 | Ga0207650_10062456 | |||
| 1253 | Ga0207650_10081795 | |||
| 1254 | Ga0207659_10035708 | |||
| 1255 | Ga0207659_10265706 | |||
| 1256 | Ga0207687_10007641 | |||
| 1257 | Ga0207664_11031449 | |||
| 1258 | Ga0207644_10000125 | |||
| 1259 | Ga0207644_10000569 | |||
| 1260 | Ga0207644_10020991 | |||
| 1261 | Ga0207644_10032656 | |||
| 1262 | Ga0207644_10035130 | |||
| 1263 | Ga0207644_10292079 | |||
| 1264 | Ga0207644_10430088 | |||
| 1265 | Ga0207690_10000155 | |||
| 1266 | Ga0207690_10080730 | |||
| 1267 | Ga0207690_10084474 | |||
| 1268 | Ga0207690_10781949 | |||
| 1269 | Ga0207706_10000342 | |||
| 1270 | Ga0207706_10000643 | |||
| 1271 | Ga0207670_10113087 | |||
| 1272 | Ga0207704_10029226 | |||
| 1273 | Ga0207691_10000848 | |||
| 1274 | Ga0207691_10108497 | |||
| 1275 | Ga0207711_10006705 | |||
| 1276 | Ga0207711_10014364 | |||
| 1277 | Ga0207711_10016073 | |||
| 1278 | Ga0207711_10292234 | |||
| 1279 | Ga0207689_10000017 | |||
| 1280 | Ga0207689_10153331 | |||
| 1281 | Ga0207661_10000947 | |||
| 1282 | Ga0207661_10012302 | |||
| 1283 | Ga0207661_10436692 | |||
| 1284 | Ga0207679_10000213 | |||
| 1285 | Ga0207679_10049081 | |||
| 1286 | Ga0207667_10001300 | |||
| 1287 | Ga0207667_10001543 | |||
| 1288 | Ga0207667_10180783 | |||
| 1289 | Ga0207667_10485200 | |||
| 1290 | Ga0207667_11151997 | |||
| 1291 | Ga0207651_10002101 | |||
| 1292 | Ga0207712_10000476 | |||
| 1293 | Ga0207712_10057347 | |||
| 1294 | Ga0207712_10159561 | |||
| 1295 | Ga0207712_10314157 | |||
| 1296 | Ga0207668_10000030 | |||
| 1297 | Ga0207668_10000076 | |||
| 1298 | Ga0207668_10001049 | |||
| 1299 | Ga0207668_10003547 | |||
| 1300 | Ga0207668_10034211 | |||
| 1301 | Ga0207668_10113134 | |||
| 1302 | Ga0207668_10158411 | |||
| 1303 | Ga0207640_10013642 | |||
| 1304 | Ga0207640_10015320 | |||
| 1305 | Ga0207640_10068231 | |||
| 1306 | Ga0207640_10164718 | |||
| 1307 | Ga0207640_10915216 | |||
| 1308 | Ga0207640_11775412 | |||
| 1309 | Ga0207658_10000002 | |||
| 1310 | Ga0207658_10000075 | |||
| 1311 | Ga0207658_10005000 | |||
| 1312 | Ga0207658_10005408 | |||
| 1313 | Ga0207658_10029070 | |||
| 1314 | Ga0207658_10060416 | |||
| 1315 | Ga0207658_10075950 | |||
| 1316 | Ga0207658_10878567 | |||
| 1317 | Ga0207677_11214999 | |||
| 1318 | Ga0207703_10000358 | |||
| 1319 | Ga0207703_10077833 | |||
| 1320 | Ga0207703_10108548 | |||
| 1321 | Ga0207703_10271113 | |||
| 1322 | Ga0207639_10000199 | |||
| 1323 | Ga0207639_10000347 | |||
| 1324 | Ga0207639_10094150 | |||
| 1325 | Ga0207639_10159640 | |||
| 1326 | Ga0207639_10175880 | |||
| 1327 | Ga0207639_10384484 | |||
| 1328 | Ga0207639_10739372 | |||
| 1329 | Ga0207639_10979968 | |||
| 1330 | Ga0207678_10137305 | |||
| 1331 | Ga0207678_10431540 | |||
| 1332 | Ga0207708_10375209 | |||
| 1333 | Ga0207702_10000496 | |||
| 1334 | Ga0207702_10098715 | |||
| 1335 | Ga0207702_10355059 | |||
| 1336 | Ga0207702_10617275 | |||
| 1337 | Ga0207702_11267867 | |||
| 1338 | Ga0207702_11297307 | |||
| 1339 | Ga0207641_10000004 | |||
| 1340 | Ga0207641_10000042 | |||
| 1341 | Ga0207641_10000720 | |||
| 1342 | Ga0207641_10000959 | |||
| 1343 | Ga0207641_10004191 | |||
| 1344 | Ga0207641_10043172 | |||
| 1345 | Ga0207641_10080673 | |||
| 1346 | Ga0207641_10253550 | |||
| 1347 | Ga0207641_10572491 | |||
| 1348 | Ga0207641_10935034 | |||
| 1349 | Ga0207648_10001216 | |||
| 1350 | Ga0207676_10001237 | |||
| 1351 | Ga0207676_10019321 | |||
| 1352 | Ga0207676_10026624 | |||
| 1353 | Ga0207676_10802081 | |||
| 1354 | Ga0207674_10000945 | |||
| 1355 | Ga0207674_10005054 | |||
| 1356 | Ga0207674_10006327 | |||
| 1357 | Ga0207674_10013895 | |||
| 1358 | Ga0207674_10099138 | |||
| 1359 | Ga0207674_10171056 | |||
| 1360 | Ga0207674_10193815 | |||
| 1361 | Ga0207674_10268205 | |||
| 1362 | Ga0207675_100046539 | |||
| 1363 | Ga0207675_100056638 | |||
| 1364 | Ga0207698_10000427 | |||
| 1365 | Ga0207698_10015214 | |||
| 1366 | Ga0207698_10334046 | |||
| 1367 | Ga0207698_10673859 | |||
| 1368 | Ga0207698_10720843 | |||
| 1369 | Ga0209813_10000017 | |||
| 1370 | Ga0209813_10000082 | |||
| 1371 | Ga0209974_10034832 | |||
| 1372 | Ga0268266_10000118 | |||
| 1373 | Ga0268266_10000309 | |||
| 1374 | Ga0268266_10002431 | |||
| 1375 | Ga0268266_10005364 | |||
| 1376 | Ga0268266_10122751 | |||
| 1377 | Ga0268265_10000424 | |||
| 1378 | Ga0268265_10000469 | |||
| 1379 | Ga0268265_10028122 | |||
| 1380 | Ga0268265_10084403 | |||
| 1381 | Ga0268265_10108110 | |||
| 1382 | Ga0268265_10149817 | |||
| 1383 | Ga0268265_10219792 | |||
| 1384 | Ga0268265_10501821 | |||
| 1385 | Ga0268265_10937659 | |||
| 1386 | Ga0268264_10000087 | |||
| 1387 | Ga0268264_10000091 | |||
| 1388 | Ga0268264_10000101 | |||
| 1389 | Ga0268264_10000134 | |||
| 1390 | Ga0268264_10011832 | |||
| 1391 | Ga0268264_10053504 | |||
| 1392 | Ga0268264_10153593 | |||
| 1393 | Ga0307517_10187486 | |||
| 1394 | Ga0265338_10199094 | |||
| 1395 | Ga0265331_10059525 | |||
| 1396 | Ga0265327_10047419 | |||
| 1397 | Ga0307513_10109817 | |||
| 1398 | Ga0307408_100010852 | |||
| 1399 | Ga0307408_100105234 | |||
| 1400 | Ga0307408_100492285 | |||
| 1401 | Ga0307408_100916674 | |||
| 1402 | Ga0307408_101114027 | |||
| 1403 | Ga0265313_10255408 | |||
| 1404 | Ga0316575_10001316 | |||
| 1405 | Ga0316575_10439230 | |||
| 1406 | Ga0265314_10015740 | |||
| 1407 | Ga0307516_10152207 | |||
| 1408 | Ga0307405_10029770 | |||
| 1409 | Ga0307405_10145134 | |||
| 1410 | Ga0307405_11099492 | |||
| 1411 | Ga0307413_10105216 | |||
| 1412 | Ga0307413_10818549 | |||
| 1413 | Ga0307413_10985474 | |||
| 1414 | Ga0307410_10014693 | |||
| 1415 | Ga0307406_10118407 | |||
| 1416 | Ga0307406_10431377 | |||
| 1417 | Ga0307406_10728889 | |||
| 1418 | Ga0307406_11020277 | |||
| 1419 | Ga0307407_10286441 | |||
| 1420 | Ga0307407_10822272 | |||
| 1421 | Ga0307412_10160407 | |||
| 1422 | Ga0307412_10245213 | |||
| 1423 | Ga0307412_10471254 | |||
| 1424 | Ga0307412_11388979 | |||
| 1425 | Ga0307409_100018325 | |||
| 1426 | Ga0307409_100065368 | |||
| 1427 | Ga0307409_100600216 | |||
| 1428 | Ga0307409_101338017 | |||
| 1429 | Ga0307416_100016385 | |||
| 1430 | Ga0307416_100061652 | |||
| 1431 | Ga0307416_100824235 | |||
| 1432 | Ga0307414_10005500 | |||
| 1433 | Ga0307414_10084360 | |||
| 1434 | Ga0307414_10370744 | |||
| 1435 | Ga0307414_10393213 | |||
| 1436 | Ga0307414_10475099 | |||
| 1437 | Ga0307414_11192195 | |||
| 1438 | Ga0307411_10010117 | |||
| 1439 | Ga0307411_10434007 | |||
| 1440 | Ga0307415_100418905 | |||
| 1441 | Ga0316583_10012845 | |||
| 1442 | Ga0373959_0015955 | |||
| 1443 | Ga0373938_0064894 | |||
| 1444 | Ga0373934_0303686 | |||
| 1445 | Ga0373923_0004387 | |||
| 1446 | Ga0373923_0106023 | |||
| 1447 | Ga0373956_0010017 | |||
| 1448 | Ga0373957_0017656 | |||
| 1449 | Ga0373960_0015422 | |||
| 1450 | Ga0373955_0002366 | |||
| 1451 | Ga0373942_0048300 | |||
| 1452 | Ga0373962_0096931 | |||
| 1453 | Ga0373931_0047725 | |||
| 1454 | Ga0373935_0547913 | |||
| 1455 | Ga0373933_0086952 | |||
| 1456 | Ga0373937_0006632 | |||
| 1457 | Ga0316582_0224828 | |||
| 1458 | Ga0316582_0889782 | |||
| 1459 | Ga0316584_0024034 | |||
| 1460 | Ga0373925_0256850 | |||
| 1461 | Ga0395899_0037881 | |||
| 1462 | Ga0395899_0046407 | |||
| 1463 | Ga0395899_0076741 | |||
| 1464 | Ga0395899_0076776 | |||
| 1465 | Ga0395899_0110916 | |||
| 1466 | Ga0395899_0388300 | |||
| 1467 | Ga0395899_0396896 | |||
| 1468 | Ga0395900_0000209 | |||
| 1469 | Ga0395900_0052961 | |||
| 1470 | Ga0395900_0084617 | |||
| 1471 | Ga0395900_0139753 | |||
| 1472 | Ga0395900_0167894 | |||
| 1473 | Ga0395900_0242926 | |||
| 1474 | Ga0395900_0348972 | |||
| 1475 | Ga0395900_0367241 | |||
| 1476 | Ga0395900_0727841 | |||
| 1477 | Ga0395900_0833971 | |||
| 1478 | Ga0395900_0972316 | |||
| 1479 | Ga0395898_0004531 | |||
| 1480 | Ga0395898_0038647 | |||
| 1481 | Ga0395898_0230714 | |||
| 1482 | Ga0395898_0244719 | |||
| 1483 | Ga0395898_0369396 | |||
| 1484 | Ga0395898_0591404 | |||
| 1485 | Ga0395898_1363132 | |||
| 1486 | Ga0395905_0008172 | |||
| 1487 | Ga0395905_0025304 | |||
| 1488 | Ga0395905_0050182 | |||
| 1489 | Ga0395905_0096517 | |||
| 1490 | Ga0395905_0103309 | |||
| 1491 | Ga0395905_0208157 | |||
| 1492 | Ga0395905_0306413 | |||
| 1493 | Ga0395905_0439178 | |||
| 1494 | Ga0395905_0864200 | |||
| 1495 | Ga0395905_1373346 | |||
| 1496 | Ga0395905_1492281 | |||
| 1497 | Ga0395905_1747883 | |||
| 1498 | Ga0436364_0619037 | |||
| 1499 | Ga0395901_0008144 | |||
| 1500 | Ga0395901_0134144 | |||
| 1501 | Ga0395901_0282727 | |||
| 1502 | Ga0395901_0288212 | |||
| 1503 | Ga0395901_0330994 | |||
| 1504 | Ga0395901_0511359 | |||
| 1505 | Ga0395901_0611927 | |||
| 1506 | Ga0395901_0967425 | |||
| 1507 | Ga0395901_1103085 | |||
| 1508 | Ga0436365_0192103 | |||
| 1509 | Ga0436365_0410983 | |||
| 1510 | Ga0436363_0930037 | |||
| 1511 | Ga0436362_0383697 | |||
| 1512 | Ga0439447_000009 | |||
| 1513 | Ga0439453_0005321 | |||
| 1514 | Ga0439466_0009170 | |||
| 1515 | Ga0451791_1678702 | |||
| 1516 | Ga0451800_1418878 | |||
| 1517 | Ga0451853_3208052 | |||
| 1518 | Ga0439446_0146374 | |||
| 1519 | Ga0439434_0109128 | |||
| 1520 | Ga0451577_0003514 | |||
| 1521 | Ga0466969_0108133 | |||
| 1522 | Ga0466963_0085421 | |||
| 1523 | Ga0466957_0085985 | |||
| 1524 | Ga0466959_0104571 | |||
| 1525 | Ga0451576_0008302 | |||
| 1526 | Ga0451576_0264872 | |||
| 1527 | Ga0495617_074497 | |||
| 1528 | Ga0495627_000570 | |||
| 1529 | Ga0495627_001851 | |||
| 1530 | Ga0495638_0123113 | |||
| 1531 | Ga0495638_0165833 | |||
| 1532 | Ga0495650_0145666 | |||
| 1533 | Ga0495650_0201405 | |||
| 1534 | Ga0495584_0005846 | |||
| 1535 | Ga0495596_0000008 | |||
| 1536 | Ga0495583_0000577 | |||
| 1537 | Ga0495606_0003324 | |||
| 1538 | Ga0495606_0139796 | |||
| 1539 | Ga0495610_0000268 | |||
| 1540 | Ga0495616_0348458 | |||
| 1541 | Ga0495631_0106470 | |||
| 1542 | Ga0495632_0000075 | |||
| 1543 | Ga0495632_0060944 | |||
| 1544 | Ga0495637_0000123 | |||
| 1545 | Ga0495637_0000890 | |||
| 1546 | Ga0495643_0000009 | |||
| 1547 | Ga0495643_0015079 | |||
| 1548 | Ga0495648_0002760 | |||
| 1549 | Ga0495663_0000003 | |||
| 1550 | Ga0495642_0073523 | |||
| 1551 | Ga0495654_0192564 | |||
| 1552 | Ga0495621_0009525 | |||
| 1553 | Ga0495621_0020629 | |||
| 1554 | Ga0495633_0000173 | |||
| 1555 | Ga0495633_0000834 | |||
| 1556 | Ga0495656_0000023 | |||
| 1557 | Ga0495668_0358132 | |||
| 1558 | Ga0495625_0037398 | |||
| 1559 | Ga0495625_0165371 | |||
| 1560 | Ga0495625_0680309 | |||
| 1561 | Ga0495659_0000192 | |||
| 1562 | Ga0495661_0191590 | |||
| 1563 | Ga0495623_0012520 | |||
| 1564 | Ga0495670_0046480 | |||
| 1565 | Ga0495670_0072476 | |||
| 1566 | Ga0495671_0000013 | |||
| 1567 | Ga0495671_0068061 | |||
| 1568 | Ga0495671_0080367 | |||
| 1569 | Ga0495672_0109202 | |||
| 1570 | Ga0495687_182929 | |||
| 1571 | Ga0495681_0000059 | |||
| 1572 | Ga0495681_0001690 | |||
| 1573 | Ga0495681_0095122 | |||
| 1574 | Ga0495686_0000430 | |||
| 1575 | Ga0495686_0001136 | |||
| 1576 | Ga0495686_0001320 | |||
| 1577 | Ga0495686_0001775 | |||
| 1578 | Ga0495686_0026479 | |||
| 1579 | Ga0495686_0167029 | |||
| 1580 | Ga0496101_0066545 | |||
| 1581 | Ga0496102_0007382 | |||
| 1582 | Ga0496102_0008608 | |||
| 1583 | Ga0496102_0662149 | |||
| 1584 | Ga0496103_0003095 | |||
| 1585 | Ga0496103_0710718 | |||
| 1586 | Ga0496104_0010352 | |||
| 1587 | Ga0496105_0007301 | |||
| 1588 | Ga0496106_0726706 | |||
| 1589 | Ga0496109_0178434 | |||
| 1590 | Ga0496109_0415352 | |||
| 1591 | Ga0496110_0169877 | |||
| 1592 | Ga0496110_0186659 | |||
| 1593 | Ga0496111_0616798 | |||
| 1594 | Ga0496114_0000131 | |||
| 1595 | Ga0496116_0000089 | |||
| 1596 | Ga0496116_0020569 | |||
| 1597 | Ga0496117_0003608 | |||
| 1598 | Ga0496117_0014014 | |||
| 1599 | Ga0496117_0024513 | |||
| 1600 | Ga0496117_0052042 | |||
| 1601 | Ga0496117_0083593 | |||
| 1602 | Ga0496117_0093819 | |||
| 1603 | Ga0496118_0004303 | |||
| 1604 | Ga0496118_0010761 | |||
| 1605 | Ga0496118_0023122 | |||
| 1606 | Ga0496118_0039935 | |||
| 1607 | Ga0496118_0281397 | |||
| 1608 | Ga0496119_0102841 | |||
| 1609 | Ga0496119_0260541 | |||
| 1610 | Ga0496120_0058204 | |||
| 1611 | Ga0496120_0133236 | |||
| 1612 | Ga0496121_0000196 | |||
| 1613 | Ga0496121_0006803 | |||
| 1614 | Ga0496122_0001736 | |||
| 1615 | Ga0496123_0000590 | |||
| 1616 | Ga0496123_0147502 | |||
| 1617 | Ga0496124_0008334 | |||
| 1618 | Ga0496124_0032443 | |||
| 1619 | Ga0496124_0122778 | |||
| 1620 | Ga0496124_0424727 | |||
| 1621 | Ga0496124_0546701 | |||
| 1622 | Ga0496125_0049512 | |||
| 1623 | Ga0496125_0403189 | |||
| 1624 | Ga0496126_0039078 | |||
| 1625 | Ga0496126_0319523 | |||
| 1626 | Ga0501307_041291 | |||
| 1627 | Ga0495678_054039 | |||
| 1628 | Ga0495682_0002949 | |||
| 1629 | Ga0501290_000159 | |||
| 1630 | Ga0501292_000020 | |||
| 1631 | Ga0501294_000244 | |||
| 1632 | Ga0501031_0197420 | |||
| 1633 | Ga0501032_0028908 | |||
| 1634 | Ga0501032_0406198 | |||
| 1635 | Ga0501033_0389042 | |||
| 1636 | Ga0501034_0054204 | |||
| 1637 | Ga0501034_0057262 | |||
| 1638 | Ga0501034_0545075 | |||
| 1639 | Ga0501037_0117007 | |||
| 1640 | Ga0501039_0269984 | |||
| 1641 | Ga0501039_1071627 | |||
| 1642 | Ga0501040_0750192 | |||
| 1643 | Ga0501041_0549636 | |||
| 1644 | Ga0501042_0270174 | |||
| 1645 | Ga0501043_0079703 | |||
| 1646 | Ga0501046_0056977 | |||
| 1647 | Ga0501047_0002116 | |||
| 1648 | Ga0501047_0274117 | |||
| 1649 | Ga0501047_0903470 | |||
| 1650 | Ga0501047_0911445 | |||
| 1651 | Ga0501048_0074973 | |||
| 1652 | Ga0501067_0003583 | |||
| 1653 | Ga0501068_0242824 | |||
| 1654 | Ga0501072_0679489 | |||
| 1655 | Ga0501074_0891450 | |||
| 1656 | Ga0501206_000401 | |||
| 1657 | Ga0501222_000648 | |||
| 1658 | Ga0501223_005698 | |||
| 1659 | Ga0501224_000328 | |||
| 1660 | Ga0501235_011202 | |||
| 1661 | Ga0501249_001014 | |||
| 1662 | Ga0501257_000031 | |||
| 1663 | Ga0501259_000367 | |||
| 1664 | Ga0501261_001824 | |||
| 1665 | Ga0501225_0009052 | |||
| 1666 | Ga0501245_000196 | |||
| 1667 | Ga0501079_0197723 | |||
| 1668 | Ga0501079_0629603 | |||
| 1669 | Ga0501279_000022 | |||
| 1670 | Ga0501280_000353 | |||
| 1671 | Ga0501280_003906 | |||
| 1672 | Ga0501281_00259 | |||
| 1673 | Ga0501282_000191 | |||
| 1674 | Ga0501035_0122135 | |||
| 1675 | Ga0501035_0358936 | |||
| 1676 | Ga0501035_0386940 | |||
| 1677 | Ga0501044_0077021 | |||
| 1678 | Ga0501044_0086482 | |||
| 1679 | Ga0501045_0887699 | |||
| 1680 | Ga0501204_009184 | |||
| 1681 | nmdc:mga03683_259403_c1 | |||
| 1682 | nmdc:mga03683_3517_c1 | |||
| 1683 | nmdc:mga03n38_40422_c1 | |||
| 1684 | nmdc:mga03n38_47793_c1 | |||
| 1685 | nmdc:mga03n38_75671_c1 | |||
| 1686 | nmdc:mga00v17_51062_c1 | |||
| 1687 | nmdc:mga00v17_5310_c1 | |||
| 1688 | nmdc:mga00v17_581703_c1 | |||
| 1689 | nmdc:mga0yw44_108049_c1 | |||
| 1690 | nmdc:mga0yw44_204872_c1 | |||
| 1691 | nmdc:mga0k408_121012_c1 | |||
| 1692 | nmdc:mga0k408_221074_c1 | |||
| 1693 | nmdc:mga0k408_3840_c1 | |||
| 1694 | nmdc:mga0k408_61685_c1 | |||
| 1695 | nmdc:mga06z11_20_c1 | |||
| 1696 | nmdc:mga06z11_770_c1 | |||
| 1697 | nmdc:mga04h51_108_c1 | |||
| 1698 | nmdc:mga04h51_339_c1 | |||
| 1699 | nmdc:mga07m45_35_c1 | |||
| 1700 | nmdc:mga0qj67_112215_c1 | |||
| 1701 | nmdc:mga0n895_1306955_c1 | |||
| 1702 | nmdc:mga0n895_1625131_c1 | |||
| 1703 | nmdc:mga0n895_92167_c1 | |||
| 1704 | nmdc:mga0rr50_316682_c1 | |||
| 1705 | nmdc:mga0sz30_41_c1 | |||
| 1706 | nmdc:mga0sz30_79563_c1 | |||
| 1707 | Ga0495612_0107420 | |||
| 1708 | Ga0495595_0468711 | |||
| 1709 | Ga0500643_000195 | |||
| 1710 | Ga0500643_012652 | |||
| 1711 | Ga0500643_024520 | |||
| 1712 | Ga0500643_038746 | |||
| 1713 | Ga0500643_070216 | |||
| 1714 | Ga0500555_000645 | |||
| 1715 | Ga0500556_0000054 | |||
| 1716 | Ga0500562_002192 | |||
| 1717 | Ga0500562_007791 | |||
| 1718 | Ga0500592_001661 | |||
| 1719 | Ga0500592_022803 | |||
| 1720 | Ga0500593_065595 | |||
| 1721 | Ga0500595_000379 | |||
| 1722 | Ga0500595_011903 | |||
| 1723 | Ga0500618_152347 | |||
| 1724 | Ga0500559_0209779 | |||
| 1725 | Ga0500604_0038426 | |||
| 1726 | Ga0500616_0043163 | |||
| 1727 | Ga0500622_0000119 | |||
| 1728 | Ga0500637_0003430 | |||
| 1729 | Ga0501084_0331746 | |||
| 1730 | Ga0501084_0364019 | |||
| 1731 | Ga0501084_1856662 | |||
| 1732 | Ga0466962_0410849 | |||
| 1733 | 2511126458 | |||
| 1734 | 2512645012 | |||
| 1735 | 2643730557 | |||
| 1736 | 2643950756 | |||
| 1737 | 2644037540 | |||
| 1738 | 2644043726 | |||
| 1739 | 2644393885 | |||
| 1740 | 2809064879 | |||
| 1741 | 2809080955 | |||
| 1742 | 2809085211 | |||
| 1743 | 2830078753 | |||
| 1744 | 2842335732 | |||
| 1745 | 2846952796 | |||
| 1746 | 2880521944 | |||
| 1747 | 2896430600 | |||
| 1748 | 2919709874 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3mbq-assembly1.cif.gz_B | crystal structure of deoxyuridine 5-triphosphate nucleotidohydrolase from brucella melitensis, orthorhombic crystal form | 0.9696 | 1 | 127 |
| 3h6d-assembly1.cif.gz_A | structure of the mycobacterium tuberculosis dutpase d28n mutant | 0.9656 | 3 | 129 |
| 5edd-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis dutpase r140k, h145w mutant | 0.9653 | 3 | 129 |
| 7n56-assembly3.cif.gz_K | crystal structure of deoxyuridine 5'-triphosphate nucleotidohydrolase from rickettsia prowazekii str. madrid e | 0.9629 | 1 | 131 |
| 3i93-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis dutpase stop138t mutant | 0.9609 | 3 | 129 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3mbqA00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9583 | 1 | 131 | 2.70.40.10 |
| 1snfC00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9548 | 1 | 130 | 2.70.40.10 |
| 1snfC00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9477 | 1 | 130 | 2.70.40.10 |
| 2p9oA00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9338 | 1 | 132 | 2.70.40.10 |
| 1sjnC00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9299 | 1 | 139 | 2.70.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F9ZMA5-F1-model_v4 | deleted | 0.9905 | 1 | 122 |
|
| AF-A0A349J258-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9861 | 1 | 127 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A1Q3IXS7-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9835 | 2 | 130 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A2S6THV7-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9823 | 1 | 127 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A357CEZ8-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9817 | 1 | 130 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |