F484331

General Info

Members Datasets Scaffolds Average Seq Length
875 463 1750 196

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0489775|Ga0496105_0489775_86_709
Length 207
Sequence VSQHTIEIDDSRTDAGERIDRRAFVGDLLAQTPEALVVTGLGSPTYDVFATTPRPGHFHLWGAMGASIPLGLGLALAQPDKSVVVITGDGEQLMGIGALGTVGAQLPANLTIVVLDNGHFGETGMQQSHTSLGTDLVAVAKGFNISNAFLVTDQRGHKTIADHIVARTGTTYAQVLIAADEPPRVLPPRDGVANKNSFRAELGLPTF

Samples

Sample ID Description Type Environment
1 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
79 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
80 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
116 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
117 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
118 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
119 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
175 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
176 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
183 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
193 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
194 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
209 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
210 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
213 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
214 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
215 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
216 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
217 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
218 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
219 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
220 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
221 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
222 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
223 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
224 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
225 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
226 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
227 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
228 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
229 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
230 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
231 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
239 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
240 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
241 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
242 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
243 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
244 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
245 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
246 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
247 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
248 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
249 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
250 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
251 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
252 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
253 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
254 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
255 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
256 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
257 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
258 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
259 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
260 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
261 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
262 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
263 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
264 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
265 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
266 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
267 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
268 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
269 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
270 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
271 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
272 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
273 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
274 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
275 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
276 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
277 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
278 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
279 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
280 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
281 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
282 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
283 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
284 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
285 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
286 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
287 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
288 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
289 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
290 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
291 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
292 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
293 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
294 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
295 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
296 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
297 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
298 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
299 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
300 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
301 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
302 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
303 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
304 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
305 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
306 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
307 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
308 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
309 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
310 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
311 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
315 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
316 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
317 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
318 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
322 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
323 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
324 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
325 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
326 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
327 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
328 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
329 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
330 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
331 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
332 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
333 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
339 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
340 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
341 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
342 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
345 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
346 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
347 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
348 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
349 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
350 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
351 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
352 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
353 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
354 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
355 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
356 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
357 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
358 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
359 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
360 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
361 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
362 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
363 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
364 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
365 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
366 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
367 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
368 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
369 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
370 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
371 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
372 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
373 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
374 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
375 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
376 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
377 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
378 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
379 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
380 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
381 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
382 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
383 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
384 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
385 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
386 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
387 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
388 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
389 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
390 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
391 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
392 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
393 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
394 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
395 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
396 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
397 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
398 2511231004 Pseudomonas sp. GM102 Isolate Nodule
399 2511231012 Pseudomonas sp. GM33 Isolate Nodule
400 2511231015 Pseudomonas sp. GM49 Isolate Nodule
401 2511231017 Pseudomonas sp. GM55 Isolate Nodule
402 2511231020 Pseudomonas sp. GM74 Isolate Nodule
403 2511231021 Pseudomonas sp. GM78 Isolate Nodule
404 2511231022 Pseudomonas sp. GM79 Isolate Nodule
405 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
406 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
407 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
408 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
409 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
410 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
411 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
412 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
413 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
414 2643221569 Achromobacter sp. Root565 Isolate Unclassified
415 2643221621 Achromobacter sp. Root83 Isolate Unclassified
416 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
417 2643221733 Bosea sp. Root381 Isolate Unclassified
418 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
419 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
420 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
421 2738543012 Acidovorax sp. CF301 Isolate Unclassified
422 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
423 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
424 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
425 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
426 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
427 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
428 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
429 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
430 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
431 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
432 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
433 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
434 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
435 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
436 2904699407
437 2906610324
438 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
439 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
440 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
441 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
442 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
443 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
444 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
445 2922425934
446 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
447 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
448 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
449 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
450 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
451 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
452 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
453 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
454 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
455 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
456 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
457 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
458 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
459 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
460 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
461 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
462 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
463 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.32
Metatranscriptomes 0.11
Isolates 7.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.46
Nodule 4.11
Rhizoplane 2.74
Rhizosphere 67.54
Stem 0
Stem Tuber 0
Unclassified 2.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496105_0489775 3300048908 Bacteria 966
2 MRS2a_Contig_802 2124908027 Bacteria 4905
3 JGI24744J21845_10016867 3300002077 Unclassified 1453
4 JGI25151J46595_10015039 3300003187 Bacteria 3430
5 JGI25404J52841_10005115 3300003659 Bacteria 2701
6 JGI25404J52841_10006721 3300003659 Bacteria 2414
7 JGI25404J52841_10011730 3300003659 Bacteria 1893
8 Ga0055530_10032187 3300003791 Bacteria 1367
9 Ga0065714_10032856 3300005288 Bacteria 716
10 Ga0065714_10073987 3300005288 Bacteria 3097
11 Ga0065714_10075886 3300005288 Bacteria 2853
12 Ga0065714_10133304 3300005288 Bacteria 1230
13 Ga0065714_10145153 3300005288 Bacteria 1143
14 Ga0065714_10268002 3300005288 Bacteria 744
15 Ga0065704_10266369 3300005289 Bacteria 953
16 Ga0065707_10083763 3300005295 Bacteria 8296
17 Ga0070676_10075749 3300005328 Bacteria 2029
18 Ga0070676_10519996 3300005328 Bacteria 848
19 Ga0070690_100008552 3300005330 Bacteria 5900
20 Ga0070670_100076157 3300005331 Bacteria 2883
21 Ga0068869_100184186 3300005334 Bacteria 1638
22 Ga0070666_10366943 3300005335 Bacteria 1032
23 Ga0068868_100358742 3300005338 Bacteria 1250
24 Ga0068868_100820002 3300005338 Bacteria 841
25 Ga0068868_100829551 3300005338 Bacteria 836
26 Ga0070689_100357515 3300005340 Bacteria 1226
27 Ga0070687_100243817 3300005343 Bacteria 1113
28 Ga0070687_100317877 3300005343 Bacteria 994
29 Ga0070661_100210586 3300005344 Bacteria 1488
30 Ga0070692_10395283 3300005345 Bacteria 871
31 Ga0070668_100608193 3300005347 Bacteria 957
32 Ga0070669_100012891 3300005353 Bacteria 5937
33 Ga0070669_100018866 3300005353 Bacteria 4930
34 Ga0070669_100279652 3300005353 Bacteria 1337
35 Ga0070675_100368672 3300005354 Bacteria 1276
36 Ga0070675_101054076 3300005354 Bacteria 747
37 Ga0070671_100075829 3300005355 Bacteria 2810
38 Ga0070671_101363638 3300005355 Bacteria 626
39 Ga0070674_100004356 3300005356 Bacteria 8071
40 Ga0070673_100077132 3300005364 Bacteria 2693
41 Ga0070673_100634843 3300005364 Bacteria 976
42 Ga0070688_100072259 3300005365 Unclassified 2210
43 Ga0070667_100154202 3300005367 Unclassified 2020
44 Ga0070667_100355633 3300005367 Bacteria 1327
45 Ga0070709_10164174 3300005434 Bacteria 1547
46 Ga0070714_100025074 3300005435 Bacteria 4918
47 Ga0070713_100141794 3300005436 Bacteria 2129
48 Ga0070713_100393664 3300005436 Bacteria 1293
49 Ga0070713_100768958 3300005436 Bacteria 922
50 Ga0070713_101365959 3300005436 Bacteria 687
51 Ga0070710_10539375 3300005437 Bacteria 804
52 Ga0070711_100546739 3300005439 Bacteria 960
53 Ga0070700_100452940 3300005441 Bacteria 977
54 Ga0070708_100339816 3300005445 Bacteria 1415
55 Ga0070678_100082518 3300005456 Bacteria 2441
56 Ga0070678_100107211 3300005456 Bacteria 2178
57 Ga0070678_100447304 3300005456 Bacteria 1131
58 Ga0070678_100585835 3300005456 Bacteria 994
59 Ga0070662_100366473 3300005457 Bacteria 1183
60 Ga0068867_100042610 3300005459 Viruses 3321
61 Ga0070685_10020415 3300005466 Viruses 3584
62 Ga0070706_100001696 3300005467 Bacteria 22935
63 Ga0070698_100026347 3300005471 Bacteria 6051
64 Ga0070699_100450385 3300005518 Bacteria 1167
65 Ga0068853_100318534 3300005539 Bacteria 1441
66 Ga0068853_100611294 3300005539 Bacteria 1036
67 Ga0070672_100213922 3300005543 Bacteria 1615
68 Ga0070686_100034486 3300005544 Bacteria 3119
69 Ga0070695_100603225 3300005545 Bacteria 862
70 Ga0070665_100382110 3300005548 Bacteria 1416
71 Ga0070665_101027716 3300005548 Bacteria 836
72 Ga0068855_100014536 3300005563 Bacteria 9481
73 Ga0068855_100223814 3300005563 Bacteria 2109
74 Ga0068857_100111626 3300005577 Bacteria 2458
75 Ga0068857_100324916 3300005577 Bacteria 1421
76 Ga0068856_100184679 3300005614 Bacteria 2099
77 Ga0070702_100195635 3300005615 Bacteria 1334
78 Ga0068859_100468511 3300005617 Bacteria 1355
79 Ga0068864_100111411 3300005618 Bacteria 2438
80 Ga0068864_100127751 3300005618 Bacteria 2280
81 Ga0068866_10293503 3300005718 Unclassified 1012
82 Ga0068861_100082903 3300005719 Unclassified 2514
83 Ga0068863_100088352 3300005841 Bacteria 2937
84 Ga0068863_100162888 3300005841 Bacteria 2138
85 Ga0068863_100789709 3300005841 Bacteria 947
86 Ga0068863_101123489 3300005841 Bacteria 791
87 Ga0068858_100148467 3300005842 Bacteria 2203
88 Ga0068858_100189830 3300005842 Bacteria 1942
89 Ga0068860_100002010 3300005843 Bacteria 21458
90 Ga0081455_10004636 3300005937 Bacteria 15315
91 Ga0081455_10020916 3300005937 Bacteria 6149
92 Ga0081540_1004587 3300005983 Bacteria 10460
93 Ga0081540_1025653 3300005983 Bacteria 3386
94 Ga0081540_1031606 3300005983 Bacteria 2908
95 Ga0081540_1064824 3300005983 Bacteria 1722
96 Ga0081539_10152530 3300005985 Bacteria 1110
97 Ga0075365_10008449 3300006038 Bacteria 5848
98 Ga0075365_10012820 3300006038 Bacteria 4993
99 Ga0075365_10051253 3300006038 Bacteria 2725
100 Ga0075365_10470835 3300006038 Bacteria 887
101 Ga0075363_100005959 3300006048 Bacteria 5495
102 Ga0075363_100039008 3300006048 Bacteria 2499
103 Ga0075363_100150935 3300006048 Bacteria 1312
104 Ga0075364_10000521 3300006051 Bacteria 19552
105 Ga0075364_10001007 3300006051 Bacteria 14921
106 Ga0075364_10006108 3300006051 Bacteria 7055
107 Ga0075364_10033900 3300006051 Bacteria 3290
108 Ga0075364_10106916 3300006051 Bacteria 1864
109 Ga0075364_10120341 3300006051 Bacteria 1757
110 Ga0075364_10579238 3300006051 Bacteria 767
111 Ga0075432_10000692 3300006058 Bacteria 10373
112 Ga0075432_10018168 3300006058 Bacteria 2398
113 Ga0075432_10054035 3300006058 Bacteria 1421
114 Ga0075432_10055723 3300006058 Bacteria 1401
115 Ga0075432_10118629 3300006058 Bacteria 992
116 Ga0075432_10125886 3300006058 Bacteria 966
117 Ga0075432_10256760 3300006058 Bacteria 711
118 Ga0070716_100231530 3300006173 Bacteria 1247
119 Ga0075362_10004185 3300006177 Bacteria 5149
120 Ga0075362_10013135 3300006177 Bacteria 3307
121 Ga0075362_10046148 3300006177 Bacteria 1937
122 Ga0075362_10166408 3300006177 Bacteria 1063
123 Ga0075369_10034089 3300006186 Bacteria 2160
124 Ga0075366_10008335 3300006195 Bacteria 5757
125 Ga0075366_10024268 3300006195 Bacteria 3537
126 Ga0075366_10065815 3300006195 Bacteria 2156
127 Ga0075366_10101778 3300006195 Bacteria 1724
128 Ga0075366_10131781 3300006195 Bacteria 1509
129 Ga0075366_10156790 3300006195 Bacteria 1379
130 Ga0097621_100373161 3300006237 Bacteria 1273
131 Ga0097621_100430227 3300006237 Bacteria 1186
132 Ga0075370_10008628 3300006353 Bacteria 5253
133 Ga0075370_10008840 3300006353 Bacteria 5201
134 Ga0075370_10061355 3300006353 Bacteria 2142
135 Ga0068871_100031823 3300006358 Viruses 4162
136 Ga0075430_100004962 3300006846 Bacteria 11199
137 Ga0075430_100322430 3300006846 Bacteria 1277
138 Ga0075431_100237759 3300006847 Bacteria 1854
139 Ga0075434_100067553 3300006871 Bacteria 3560
140 Ga0075434_100885008 3300006871 Bacteria 908
141 Ga0075429_100005817 3300006880 Bacteria 10639
142 Ga0075436_100241275 3300006914 Bacteria 1285
143 Ga0075436_100488983 3300006914 Unclassified 899
144 Ga0097620_100468522 3300006931 Bacteria 1355
145 Ga0099825_1047979 3300006941 Bacteria 994
146 Ga0099824_1004050 3300006942 Bacteria 21204
147 Ga0099822_1000838 3300006943 Bacteria 32461
148 Ga0075435_100123083 3300007076 Bacteria 2166
149 Ga0105251_10005081 3300009011 Bacteria 8716
150 Ga0105244_10004844 3300009036 Bacteria 9127
151 Ga0105244_10008013 3300009036 Bacteria 6645
152 Ga0105244_10385900 3300009036 Bacteria 645
153 Ga0105250_10009214 3300009092 Bacteria 4162
154 Ga0105250_10011333 3300009092 Bacteria 3699
155 Ga0105250_10090525 3300009092 Bacteria 1244
156 Ga0105250_10144120 3300009092 Bacteria 989
157 Ga0105250_10221277 3300009092 Bacteria 803
158 Ga0105240_10005569 3300009093 Bacteria 18721
159 Ga0105240_10201140 3300009093 Bacteria 2334
160 Ga0111539_10692636 3300009094 Bacteria 1186
161 Ga0105245_10159249 3300009098 Bacteria 2141
162 Ga0105247_10068052 3300009101 Bacteria 2220
163 Ga0105247_10097716 3300009101 Bacteria 1873
164 Ga0105241_10592272 3300009174 Bacteria 1001
165 Ga0105242_10097873 3300009176 Unclassified 2481
166 Ga0105242_10772235 3300009176 Bacteria 948
167 Ga0105248_10393192 3300009177 Bacteria 1561
168 Ga0105248_10411793 3300009177 Bacteria 1522
169 Ga0105248_10597311 3300009177 Bacteria 1245
170 Ga0105237_10022573 3300009545 Bacteria 6455
171 Ga0105237_10026227 3300009545 Bacteria 5956
172 Ga0105237_10063278 3300009545 Bacteria 3697
173 Ga0105238_10647933 3300009551 Bacteria 1066
174 Ga0105249_10610120 3300009553 Bacteria 1146
175 Ga0105239_10000839 3300010375 Bacteria 43658
176 Ga0105239_10193698 3300010375 Bacteria 2276
177 Ga0105246_10015011 3300011119 Bacteria 4880
178 Ga0157373_10007217 3300013100 Bacteria 8287
179 Ga0157373_10007637 3300013100 Bacteria 8031
180 Ga0157370_10000335 3300013104 Bacteria 59202
181 Ga0157370_10010674 3300013104 Bacteria 9662
182 Ga0157370_10012653 3300013104 Bacteria 8740
183 Ga0157370_10103245 3300013104 Bacteria 2669
184 Ga0157370_10391672 3300013104 Bacteria 1279
185 Ga0157369_10087235 3300013105 Bacteria 3332
186 Ga0157369_10130823 3300013105 Bacteria 2660
187 Ga0157374_10849957 3300013296 Bacteria 929
188 Ga0157378_10019428 3300013297 Bacteria 5973
189 Ga0163162_10103461 3300013306 Bacteria 2942
190 Ga0163162_10374249 3300013306 Bacteria 1557
191 Ga0163162_10458776 3300013306 Bacteria 1406
192 Ga0163162_10778671 3300013306 Bacteria 1075
193 Ga0157375_10080404 3300013308 Unclassified 3297
194 Ga0157375_10443723 3300013308 Bacteria 1463
195 Ga0163163_11220184 3300014325 Bacteria 815
196 Ga0163163_11304906 3300014325 Bacteria 788
197 Ga0157380_10073032 3300014326 Bacteria 2780
198 Ga0182008_10000377 3300014497 Bacteria 34436
199 Ga0182008_10003201 3300014497 Bacteria 10002
200 Ga0182008_10018577 3300014497 Bacteria 3599
201 Ga0182008_10036097 3300014497 Bacteria 2474
202 Ga0182008_10149717 3300014497 Bacteria 1170
203 Ga0157379_10340472 3300014968 Bacteria 1372
204 Ga0157379_10364488 3300014968 Bacteria 1325
205 Ga0157376_10114077 3300014969 Unclassified 2383
206 Ga0182006_1006091 3300015261 Bacteria 5641
207 Ga0182007_10002571 3300015262 Bacteria 8935
208 Ga0182007_10006498 3300015262 Bacteria 5015
209 Ga0163161_10003570 3300017792 Bacteria 10894
210 Ga0163161_10009160 3300017792 Bacteria 6841
211 Ga0206353_10735147 3300020082 Bacteria 1626
212 Ga0213874_10001796 3300021377 Bacteria 4504
213 Ga0213876_10008528 3300021384 Bacteria 5548
214 Ga0213876_10150104 3300021384 Bacteria 1239
215 Ga0213875_10006049 3300021388 Bacteria 6407
216 Ga0228711_1000090 3300022739 Bacteria 71335
217 Ga0209759_1008336 3300025256 Bacteria 3240
218 Ga0209129_1001072 3300025258 Bacteria 16142
219 Ga0209673_1001085 3300025273 Bacteria 30631
220 Ga0209675_1029475 3300025291 Bacteria 1320
221 Ga0209676_1001213 3300025292 Bacteria 27426
222 Ga0209676_1024168 3300025292 Bacteria 1975
223 Ga0209025_1000049 3300025294 Bacteria 333459
224 Ga0209025_1000432 3300025294 Bacteria 82875
225 Ga0209564_1020708 3300025295 Bacteria 2398
226 Ga0209050_1001546 3300025298 Bacteria 24090
227 Ga0209050_1001665 3300025298 Bacteria 22438
228 Ga0209051_1001880 3300025303 Bacteria 16459
229 Ga0209051_1009683 3300025303 Bacteria 4942
230 Ga0209051_1013359 3300025303 Bacteria 3914
231 Ga0207656_10249042 3300025321 Bacteria 870
232 Ga0207696_1000006 3300025711 Bacteria 616498
233 Ga0207696_1021860 3300025711 Bacteria 2042
234 Ga0207655_1000077 3300025728 Bacteria 219418
235 Ga0207655_1008254 3300025728 Bacteria 6633
236 Ga0207655_1017632 3300025728 Bacteria 3840
237 Ga0207655_1027069 3300025728 Bacteria 2740
238 Ga0207713_1000724 3300025735 Bacteria 30902
239 Ga0207713_1014369 3300025735 Bacteria 4119
240 Ga0207713_1014477 3300025735 Bacteria 4096
241 Ga0207713_1043701 3300025735 Bacteria 1849
242 Ga0207713_1062936 3300025735 Bacteria 1404
243 Ga0207682_10000382 3300025893 Bacteria 20446
244 Ga0207692_10134426 3300025898 Bacteria 1400
245 Ga0207692_10470288 3300025898 Bacteria 794
246 Ga0207710_10048610 3300025900 Bacteria 1899
247 Ga0207688_10134685 3300025901 Bacteria 1450
248 Ga0207647_10057824 3300025904 Bacteria 2377
249 Ga0207645_10004537 3300025907 Bacteria 10259
250 Ga0207645_10353085 3300025907 Bacteria 984
251 Ga0207643_10022889 3300025908 Bacteria 3443
252 Ga0207684_10001749 3300025910 Bacteria 22938
253 Ga0207654_10473237 3300025911 Bacteria 881
254 Ga0207695_10009502 3300025913 Bacteria 12026
255 Ga0207695_10399770 3300025913 Bacteria 1258
256 Ga0207671_10019532 3300025914 Bacteria 5180
257 Ga0207671_10212210 3300025914 Bacteria 1515
258 Ga0207693_10049887 3300025915 Bacteria 3287
259 Ga0207663_10404956 3300025916 Bacteria 1044
260 Ga0207662_10049770 3300025918 Bacteria 2487
261 Ga0207646_10077368 3300025922 Bacteria 2973
262 Ga0207681_10010912 3300025923 Bacteria 5580
263 Ga0207681_10071399 3300025923 Bacteria 2422
264 Ga0207681_10102773 3300025923 Unclassified 2064
265 Ga0207694_10102695 3300025924 Bacteria 2267
266 Ga0207659_10387775 3300025926 Bacteria 1166
267 Ga0207659_10582071 3300025926 Unclassified 953
268 Ga0207687_10115032 3300025927 Bacteria 2003
269 Ga0207700_10015666 3300025928 Bacteria 5010
270 Ga0207700_10097728 3300025928 Bacteria 2334
271 Ga0207700_10651458 3300025928 Bacteria 939
272 Ga0207664_10141687 3300025929 Bacteria 2034
273 Ga0207644_10063063 3300025931 Bacteria 2690
274 Ga0207706_10336488 3300025933 Bacteria 1313
275 Ga0207686_10193850 3300025934 Unclassified 1450
276 Ga0207709_10072479 3300025935 Bacteria 2191
277 Ga0207709_10080881 3300025935 Bacteria 2093
278 Ga0207670_10221752 3300025936 Bacteria 1448
279 Ga0207670_10362796 3300025936 Bacteria 1150
280 Ga0207669_10002543 3300025937 Bacteria 7789
281 Ga0207704_11017236 3300025938 Bacteria 701
282 Ga0207691_10055076 3300025940 Bacteria 3626
283 Ga0207691_10055931 3300025940 Unclassified 3595
284 Ga0207711_10290821 3300025941 Bacteria 1506
285 Ga0207711_10325150 3300025941 Bacteria 1422
286 Ga0207689_10195432 3300025942 Bacteria 1670
287 Ga0207651_10029123 3300025960 Bacteria 3494
288 Ga0207651_10033973 3300025960 Bacteria 3297
289 Ga0207651_10785371 3300025960 Bacteria 843
290 Ga0207651_10817305 3300025960 Bacteria 827
291 Ga0207640_10388724 3300025981 Bacteria 1133
292 Ga0207658_10228086 3300025986 Bacteria 1571
293 Ga0207658_10606204 3300025986 Bacteria 984
294 Ga0207677_10543296 3300026023 Bacteria 1011
295 Ga0207703_10416869 3300026035 Bacteria 1249
296 Ga0207703_10736389 3300026035 Bacteria 939
297 Ga0207639_10073041 3300026041 Bacteria 2688
298 Ga0207639_11038541 3300026041 Bacteria 768
299 Ga0207708_10244090 3300026075 Bacteria 1445
300 Ga0207641_10461088 3300026088 Bacteria 1229
301 Ga0207641_10966895 3300026088 Bacteria 847
302 Ga0207648_10015626 3300026089 Bacteria 6975
303 Ga0207676_10105634 3300026095 Bacteria 2345
304 Ga0207674_10028891 3300026116 Bacteria 5845
305 Ga0207674_10775829 3300026116 Bacteria 925
306 Ga0207675_100976810 3300026118 Bacteria 865
307 Ga0207683_10020747 3300026121 Bacteria 5621
308 Ga0207683_10324636 3300026121 Bacteria 1410
309 Ga0207683_10492906 3300026121 Bacteria 1131
310 Ga0209589_1000007 3300027357 Bacteria 425699
311 Ga0209489_100008 3300027361 Bacteria 425699
312 Ga0209700_100009 3300027363 Bacteria 425699
313 Ga0207428_10149883 3300027907 Bacteria 1776
314 Ga0207428_10481730 3300027907 Bacteria 902
315 Ga0207428_10500371 3300027907 Bacteria 883
316 Ga0207428_10505261 3300027907 Bacteria 878
317 Ga0268266_10061575 3300028379 Bacteria 3237
318 Ga0268264_10000403 3300028381 Bacteria 61631
319 Ga0268264_10000429 3300028381 Bacteria 58174
320 Ga0268264_11288066 3300028381 Bacteria 741
321 Ga0265316_10196533 3300031344 Bacteria 1497
322 Ga0307408_100009897 3300031548 Bacteria 6282
323 Ga0307408_100040524 3300031548 Bacteria 3298
324 Ga0307408_100816641 3300031548 Bacteria 847
325 Ga0307508_10122188 3300031616 Bacteria 2207
326 Ga0307516_10070237 3300031730 Bacteria 3366
327 Ga0307413_10556454 3300031824 Unclassified 931
328 Ga0307406_10482218 3300031901 Bacteria 1002
329 Ga0307412_10021171 3300031911 Bacteria 3968
330 Ga0307412_10858724 3300031911 Bacteria 792
331 Ga0307409_100207361 3300031995 Bacteria 1759
332 Ga0307416_100704861 3300032002 Bacteria 1099
333 Ga0307414_10018264 3300032004 Bacteria 4312
334 Ga0307414_10738111 3300032004 Bacteria 894
335 Ga0307411_10748053 3300032005 Bacteria 856
336 Ga0307415_100685318 3300032126 Bacteria 923
337 Ga0307507_10073944 3300033179 Bacteria 3060
338 Ga0315911_1000007 3300033442 Bacteria 413725
339 Ga0373934_0249200 3300035086 Bacteria 734
340 Ga0373935_0401229 3300035692 Bacteria 985
341 Ga0373927_0025122 3300035695 Bacteria 3895
342 Ga0373947_0308827 3300035725 Bacteria 1056
343 Ga0373937_0058954 3300036401 Bacteria 3527
344 Ga0373937_0194573 3300036401 Bacteria 1906
345 Ga0373925_0019721 3300037068 Bacteria 4908
346 Ga0373925_0146078 3300037068 Bacteria 1854
347 Ga0395899_0012525 3300037312 Bacteria 6499
348 Ga0395899_0244942 3300037312 Bacteria 1232
349 Ga0395900_0061125 3300037418 Bacteria 3874
350 Ga0395900_0168333 3300037418 Bacteria 2232
351 Ga0395900_0302761 3300037418 Bacteria 1584
352 Ga0395898_0274127 3300037466 Bacteria 1609
353 Ga0436364_0017649 3300037853 Bacteria 4776
354 Ga0436364_0607526 3300037853 Bacteria 3493
355 Ga0395901_0118581 3300038443 Bacteria 2781
356 Ga0395901_0351714 3300038443 Bacteria 1520
357 Ga0436365_0247948 3300039437 Bacteria 48555
358 Ga0436365_0615596 3300039437 Bacteria 1527
359 Ga0436365_1690415 3300039437 Bacteria 2339
360 Ga0436365_1912359 3300039437 Bacteria 5618
361 Ga0436360_0251041 3300039438 Bacteria 909
362 Ga0436363_0106692 3300039450 Bacteria 15781
363 Ga0436363_0710564 3300039450 Bacteria 2712
364 Ga0436363_0957601 3300039450 Bacteria 1668
365 Ga0439438_000163 3300041405 Bacteria 30548
366 Ga0439438_000737 3300041405 Bacteria 14700
367 Ga0439438_013856 3300041405 Bacteria 2416
368 Ga0439447_000211 3300041407 Bacteria 20579
369 Ga0439447_061219 3300041407 Bacteria 885
370 Ga0439447_086358 3300041407 Bacteria 722
371 Ga0439466_0018776 3300041411 Bacteria 2478
372 Ga0439466_0050089 3300041411 Bacteria 1370
373 Ga0451853_1495030 3300041512 Bacteria 13527
374 Ga0439445_0111969 3300042004 Bacteria 779
375 Ga0439432_023075 3300042006 Bacteria 2051
376 Ga0439451_000757 3300042009 Bacteria 6135
377 Ga0439451_042068 3300042009 Bacteria 917
378 Ga0439452_001610 3300042010 Bacteria 8922
379 Ga0439456_001175 3300042013 Bacteria 5195
380 Ga0439456_004550 3300042013 Bacteria 2804
381 Ga0439456_063682 3300042013 Bacteria 812
382 Ga0450911_000117 3300042115 Bacteria 31836
383 Ga0450911_009912 3300042115 Bacteria 1326
384 Ga0450920_022032 3300042122 Bacteria 1233
385 Ga0450902_009128 3300042137 Bacteria 1559
386 Ga0450903_000724 3300042138 Bacteria 6533
387 Ga0450903_007618 3300042138 Bacteria 1778
388 Ga0450903_016007 3300042138 Bacteria 1178
389 Ga0450905_006389 3300042142 Bacteria 1594
390 Ga0450905_025767 3300042142 Bacteria 886
391 Ga0450906_021269 3300042145 Bacteria 1160
392 Ga0450907_000283 3300042146 Bacteria 17199
393 Ga0450908_000101 3300042184 Bacteria 17206
394 Ga0439434_0146557 3300042435 Bacteria 780
395 Ga0439460_0003018 3300042461 Bacteria 4063
396 Ga0466966_0043244 3300044684 Bacteria 2889
397 Ga0466961_0307696 3300044693 Bacteria 967
398 Ga0453684_0015372 3300044712 Bacteria 12117
399 Ga0466968_0000008 3300044735 Bacteria 73540
400 Ga0466970_0104087 3300044765 Bacteria 1547
401 Ga0466957_0045017 3300044842 Bacteria 2675
402 Ga0466960_0032713 3300044901 Bacteria 2411
403 Ga0466959_0140759 3300045049 Bacteria 1705
404 Ga0466959_0754691 3300045049 Bacteria 651
405 Ga0451576_0302602 3300045051 Bacteria 1673
406 Ga0466958_0048891 3300045836 Bacteria 2557
407 Ga0466958_0356370 3300045836 Bacteria 942
408 Ga0466967_0094486 3300045976 Bacteria 2723
409 Ga0466967_0094767 3300045976 Bacteria 2719
410 Ga0495617_000633 3300046452 Bacteria 17644
411 Ga0495617_003137 3300046452 Bacteria 6293
412 Ga0495617_033296 3300046452 Bacteria 1729
413 Ga0495617_087949 3300046452 Bacteria 1015
414 Ga0495627_001773 3300046453 Bacteria 11594
415 Ga0495627_026356 3300046453 Bacteria 1875
416 Ga0495603_0010415 3300046455 Bacteria 5631
417 Ga0495603_0092043 3300046455 Bacteria 1772
418 Ga0495590_0014969 3300046457 Bacteria 2824
419 Ga0495590_0027762 3300046457 Bacteria 1985
420 Ga0495590_0044585 3300046457 Bacteria 1546
421 Ga0495591_000730 3300046458 Bacteria 23791
422 Ga0495591_001059 3300046458 Bacteria 18504
423 Ga0495629_0392073 3300046459 Bacteria 944
424 Ga0495638_0011540 3300046460 Bacteria 6085
425 Ga0495638_0016359 3300046460 Bacteria 4969
426 Ga0495638_0043614 3300046460 Bacteria 2829
427 Ga0495638_0082168 3300046460 Bacteria 1954
428 Ga0495638_0109477 3300046460 Bacteria 1642
429 Ga0495638_0397002 3300046460 Bacteria 716
430 Ga0495653_0001150 3300046463 Bacteria 20361
431 Ga0495650_0001328 3300046471 Bacteria 24822
432 Ga0495650_0002139 3300046471 Bacteria 16815
433 Ga0495650_0008143 3300046471 Bacteria 6169
434 Ga0495650_0020467 3300046471 Bacteria 3225
435 Ga0495650_0100398 3300046471 Unclassified 1087
436 Ga0495580_0002934 3300046472 Bacteria 14643
437 Ga0495605_0001099 3300046474 Bacteria 18029
438 Ga0495605_0001937 3300046474 Bacteria 13167
439 Ga0495605_0002177 3300046474 Bacteria 12245
440 Ga0495605_0016277 3300046474 Bacteria 4027
441 Ga0495605_0034203 3300046474 Bacteria 2574
442 Ga0495605_0082552 3300046474 Bacteria 1501
443 Ga0495639_0075898 3300046475 Bacteria 1559
444 Ga0495584_0000851 3300046491 Bacteria 19724
445 Ga0495584_0023748 3300046491 Bacteria 3108
446 Ga0495584_0037424 3300046491 Bacteria 2452
447 Ga0495584_0113452 3300046491 Bacteria 1371
448 Ga0495585_0010531 3300046492 Bacteria 5500
449 Ga0495594_0007401 3300046499 Bacteria 5648
450 Ga0495594_0013066 3300046499 Bacteria 4330
451 Ga0495596_0000421 3300046500 Bacteria 27052
452 Ga0495607_0063801 3300046501 Bacteria 2082
453 Ga0495607_0188944 3300046501 Bacteria 1027
454 Ga0495607_0272920 3300046501 Bacteria 805
455 Ga0495583_0000172 3300046506 Bacteria 109791
456 Ga0495583_0011494 3300046506 Bacteria 5078
457 Ga0495583_0015244 3300046506 Bacteria 4189
458 Ga0495583_0052429 3300046506 Bacteria 1856
459 Ga0495606_0001019 3300046507 Bacteria 40637
460 Ga0495610_0009130 3300046512 Bacteria 6309
461 Ga0495610_0113762 3300046512 Bacteria 1195
462 Ga0495616_0000456 3300046513 Bacteria 31180
463 Ga0495616_0006807 3300046513 Bacteria 6888
464 Ga0495616_0092756 3300046513 Bacteria 1427
465 Ga0495620_0000006 3300046515 Bacteria 273098
466 Ga0495620_0001273 3300046515 Bacteria 15374
467 Ga0495620_0004743 3300046515 Bacteria 7645
468 Ga0495630_0020504 3300046517 Bacteria 4874
469 Ga0495630_0603503 3300046517 Bacteria 841
470 Ga0495631_0066030 3300046518 Bacteria 1565
471 Ga0495631_0260185 3300046518 Bacteria 739
472 Ga0495632_0000031 3300046519 Bacteria 166613
473 Ga0495632_0000170 3300046519 Bacteria 66918
474 Ga0495632_0001021 3300046519 Bacteria 24197
475 Ga0495632_0002096 3300046519 Bacteria 15613
476 Ga0495637_0000799 3300046520 Bacteria 20925
477 Ga0495637_0001764 3300046520 Bacteria 12389
478 Ga0495637_0009093 3300046520 Bacteria 4853
479 Ga0495637_0043837 3300046520 Bacteria 1907
480 Ga0495643_0012198 3300046522 Bacteria 5191
481 Ga0495643_0013461 3300046522 Bacteria 4892
482 Ga0495643_0022047 3300046522 Bacteria 3641
483 Ga0495643_0129090 3300046522 Bacteria 1270
484 Ga0495644_0210516 3300046523 Bacteria 750
485 Ga0495648_0000267 3300046524 Bacteria 58885
486 Ga0495648_0000402 3300046524 Bacteria 47633
487 Ga0495648_0014286 3300046524 Bacteria 5821
488 Ga0495648_0015925 3300046524 Bacteria 5434
489 Ga0495648_0032837 3300046524 Bacteria 3399
490 Ga0495666_0002052 3300046526 Bacteria 9969
491 Ga0495666_0040601 3300046526 Bacteria 2255
492 Ga0495642_0000584 3300046528 Bacteria 18271
493 Ga0495642_0000977 3300046528 Bacteria 13311
494 Ga0495654_0010877 3300046530 Bacteria 4943
495 Ga0495654_0061793 3300046530 Bacteria 1797
496 Ga0495654_0099023 3300046530 Bacteria 1344
497 Ga0495654_0124773 3300046530 Bacteria 1161
498 Ga0495665_0011202 3300046531 Bacteria 4856
499 Ga0495665_0058750 3300046531 Bacteria 2030
500 Ga0495587_0000835 3300046536 Bacteria 20361
501 Ga0495598_0008123 3300046537 Unclassified 2434
502 Ga0495609_0000552 3300046538 Bacteria 29569
503 Ga0495609_0001596 3300046538 Bacteria 14815
504 Ga0495609_0016775 3300046538 Bacteria 3410
505 Ga0495609_0030749 3300046538 Bacteria 2444
506 Ga0495621_0021407 3300046539 Unclassified 2131
507 Ga0495621_0193580 3300046539 Bacteria 816
508 Ga0495597_0004922 3300046542 Bacteria 7183
509 Ga0495597_0021913 3300046542 Bacteria 2967
510 Ga0495597_0078768 3300046542 Bacteria 1411
511 Ga0495622_0013456 3300046557 Bacteria 3795
512 Ga0495622_0315722 3300046557 Bacteria 679
513 Ga0495633_0002829 3300046558 Bacteria 11955
514 Ga0495633_0042079 3300046558 Bacteria 2171
515 Ga0495633_0140577 3300046558 Bacteria 1116
516 Ga0495656_0014112 3300046615 Bacteria 2988
517 Ga0495656_0076937 3300046615 Bacteria 1496
518 Ga0495668_0001425 3300046616 Bacteria 23196
519 Ga0495634_0000347 3300046642 Bacteria 44864
520 Ga0495611_0132362 3300046648 Bacteria 1163
521 Ga0495625_0005230 3300046660 Bacteria 11945
522 Ga0495625_0010607 3300046660 Bacteria 7602
523 Ga0495625_0089038 3300046660 Bacteria 2137
524 Ga0495625_0113577 3300046660 Bacteria 1849
525 Ga0495625_0156972 3300046660 Bacteria 1526
526 Ga0495635_0000402 3300046663 Bacteria 27473
527 Ga0495635_0564407 3300046663 Bacteria 745
528 Ga0495659_0000252 3300046664 Bacteria 22168
529 Ga0495659_0002938 3300046664 Bacteria 5474
530 Ga0495659_0146539 3300046664 Bacteria 945
531 Ga0495661_0036598 3300046665 Bacteria 3071
532 Ga0495661_0109816 3300046665 Bacteria 1538
533 Ga0495661_0116931 3300046665 Bacteria 1478
534 Ga0495661_0156942 3300046665 Bacteria 1224
535 Ga0495588_0000444 3300046674 Bacteria 20968
536 Ga0495588_0002335 3300046674 Bacteria 8133
537 Ga0495588_0476177 3300046674 Bacteria 655
538 Ga0495646_0000541 3300046680 Bacteria 20361
539 Ga0495658_0577562 3300046683 Bacteria 720
540 Ga0495669_0000022 3300046684 Bacteria 117864
541 Ga0495669_0000576 3300046684 Bacteria 16289
542 Ga0495669_0006562 3300046684 Bacteria 4864
543 Ga0495669_0155276 3300046684 Bacteria 1084
544 Ga0495624_0150196 3300046690 Bacteria 1425
545 Ga0495624_0173755 3300046690 Bacteria 1314
546 Ga0495670_0001231 3300046691 Bacteria 12472
547 Ga0495670_0004594 3300046691 Bacteria 6777
548 Ga0495670_0092196 3300046691 Bacteria 1551
549 Ga0495670_0176837 3300046691 Bacteria 1125
550 Ga0495671_0002464 3300046692 Bacteria 11679
551 Ga0495671_0002792 3300046692 Bacteria 10923
552 Ga0495649_0000106 3300046694 Bacteria 74615
553 Ga0495649_0000811 3300046694 Bacteria 25193
554 Ga0495649_0031264 3300046694 Bacteria 2936
555 Ga0495589_0008767 3300046794 Bacteria 5263
556 Ga0495589_0015375 3300046794 Bacteria 3939
557 Ga0495589_0024430 3300046794 Bacteria 3072
558 Ga0495660_0013968 3300046810 Bacteria 4655
559 Ga0495660_0017097 3300046810 Bacteria 4176
560 Ga0495660_0022090 3300046810 Bacteria 3636
561 Ga0495660_0066028 3300046810 Bacteria 1930
562 Ga0495660_0127284 3300046810 Bacteria 1281
563 Ga0495660_0127579 3300046810 Bacteria 1279
564 Ga0495660_0281446 3300046810 Bacteria 760
565 Ga0495604_0012438 3300047317 Bacteria 6769
566 Ga0495604_0094408 3300047317 Bacteria 2211
567 Ga0495636_0000436 3300047318 Bacteria 15466
568 Ga0495636_0002142 3300047318 Bacteria 7584
569 Ga0495674_0076560 3300047319 Bacteria 2877
570 Ga0495672_0000357 3300047320 Bacteria 58589
571 Ga0495672_0000987 3300047320 Bacteria 29395
572 Ga0495672_0003208 3300047320 Bacteria 14216
573 Ga0495672_0005169 3300047320 Bacteria 10418
574 Ga0495672_0141779 3300047320 Bacteria 1254
575 Ga0495672_0161133 3300047320 Bacteria 1153
576 Ga0495672_0194306 3300047320 Bacteria 1018
577 Ga0495676_0000456 3300047321 Bacteria 33576
578 Ga0495683_0005131 3300047323 Bacteria 7298
579 Ga0495683_0005677 3300047323 Bacteria 6893
580 Ga0495683_0057323 3300047323 Bacteria 1936
581 Ga0495683_0113173 3300047323 Bacteria 1293
582 Ga0495683_0196426 3300047323 Bacteria 912
583 Ga0495687_000159 3300047443 Bacteria 101178
584 Ga0495687_000343 3300047443 Bacteria 59599
585 Ga0495687_002486 3300047443 Bacteria 14699
586 Ga0495677_0000308 3300047445 Bacteria 21215
587 Ga0495679_025105 3300047446 Bacteria 1997
588 Ga0495685_054055 3300047447 Bacteria 1359
589 Ga0495685_056544 3300047447 Bacteria 1326
590 Ga0495673_0000142 3300047469 Bacteria 128538
591 Ga0495673_0001971 3300047469 Bacteria 15192
592 Ga0495673_0013732 3300047469 Bacteria 4239
593 Ga0495673_0022217 3300047469 Bacteria 3113
594 Ga0495681_0011182 3300047470 Bacteria 5367
595 Ga0495681_0013602 3300047470 Bacteria 4710
596 Ga0495681_0068702 3300047470 Bacteria 1611
597 Ga0495681_0219752 3300047470 Bacteria 762
598 Ga0495593_0000536 3300047673 Bacteria 21520
599 Ga0495593_0003207 3300047673 Bacteria 9813
600 Ga0495593_0054980 3300047673 Bacteria 2097
601 Ga0495593_0142471 3300047673 Bacteria 1214
602 Ga0495602_0077339 3300048088 Bacteria 2816
603 Ga0495614_0000445 3300048089 Bacteria 16992
604 Ga0495626_0002671 3300048091 Bacteria 12079
605 Ga0495626_0002800 3300048091 Bacteria 11693
606 Ga0495626_0011624 3300048091 Bacteria 4648
607 Ga0495626_0014962 3300048091 Bacteria 3980
608 Ga0495626_0021804 3300048091 Bacteria 3171
609 Ga0496102_0000444 3300048905 Bacteria 47025
610 Ga0496102_0344646 3300048905 Bacteria 1403
611 Ga0496103_0000290 3300048906 Bacteria 47006
612 Ga0496103_0067436 3300048906 Bacteria 2235
613 Ga0496103_0424747 3300048906 Bacteria 853
614 Ga0496106_0001400 3300048909 Bacteria 18078
615 Ga0496106_0040227 3300048909 Bacteria 3501
616 Ga0496106_0095899 3300048909 Bacteria 2295
617 Ga0496107_0390987 3300048910 Bacteria 1034
618 Ga0496108_0349077 3300048911 Bacteria 1291
619 Ga0496110_0048556 3300048913 Bacteria 3721
620 Ga0496112_0368077 3300048915 Bacteria 1379
621 Ga0496112_0613369 3300048915 Bacteria 1019
622 Ga0496114_0015450 3300048917 Bacteria 6141
623 Ga0496114_0076715 3300048917 Bacteria 2816
624 Ga0496114_0269582 3300048917 Bacteria 1500
625 Ga0496114_0271380 3300048917 Bacteria 1495
626 Ga0496114_0478191 3300048917 Bacteria 1102
627 Ga0496115_0018008 3300048918 Bacteria 5412
628 Ga0496115_0646931 3300048918 Bacteria 836
629 Ga0496116_0000231 3300048919 Bacteria 103493
630 Ga0496116_0001738 3300048919 Bacteria 23730
631 Ga0496116_0012086 3300048919 Bacteria 7075
632 Ga0496116_0021642 3300048919 Bacteria 4842
633 Ga0496117_0000428 3300048920 Bacteria 70517
634 Ga0496117_0000460 3300048920 Bacteria 68039
635 Ga0496117_0005335 3300048920 Bacteria 13552
636 Ga0496117_0069886 3300048920 Bacteria 2362
637 Ga0496117_0155803 3300048920 Bacteria 1345
638 Ga0496117_0169612 3300048920 Bacteria 1268
639 Ga0496118_0000106 3300048921 Bacteria 155884
640 Ga0496118_0001373 3300048921 Bacteria 36687
641 Ga0496118_0002522 3300048921 Bacteria 24575
642 Ga0496118_0004391 3300048921 Bacteria 16756
643 Ga0496118_0036942 3300048921 Bacteria 3940
644 Ga0496118_0042526 3300048921 Bacteria 3583
645 Ga0496118_0131345 3300048921 Bacteria 1607
646 Ga0496118_0214010 3300048921 Bacteria 1128
647 Ga0496119_0024932 3300048922 Bacteria 4190
648 Ga0496119_0057100 3300048922 Bacteria 2361
649 Ga0496119_0145051 3300048922 Bacteria 1278
650 Ga0496121_0000233 3300048924 Bacteria 119434
651 Ga0496121_0000602 3300048924 Bacteria 67586
652 Ga0496121_0002550 3300048924 Bacteria 27617
653 Ga0496121_0034085 3300048924 Bacteria 4589
654 Ga0496121_0038513 3300048924 Bacteria 4231
655 Ga0496121_0040873 3300048924 Bacteria 4062
656 Ga0496121_0046322 3300048924 Bacteria 3723
657 Ga0496121_0058950 3300048924 Bacteria 3169
658 Ga0496121_0068058 3300048924 Bacteria 2883
659 Ga0496121_0108695 3300048924 Bacteria 2121
660 Ga0496121_0146496 3300048924 Bacteria 1744
661 Ga0496121_0207410 3300048924 Bacteria 1391
662 Ga0496121_0218056 3300048924 Bacteria 1346
663 Ga0496121_0241898 3300048924 Bacteria 1257
664 Ga0496121_0338216 3300048924 Bacteria 1007
665 Ga0496121_0382764 3300048924 Bacteria 927
666 Ga0496122_0000582 3300048925 Bacteria 74845
667 Ga0496122_0003924 3300048925 Bacteria 19025
668 Ga0496122_0028198 3300048925 Bacteria 4774
669 Ga0496122_0052736 3300048925 Bacteria 3075
670 Ga0496122_0244818 3300048925 Bacteria 1008
671 Ga0496122_0296592 3300048925 Bacteria 874
672 Ga0496122_0302168 3300048925 Bacteria 862
673 Ga0496123_0000479 3300048926 Bacteria 69250
674 Ga0496123_0001070 3300048926 Bacteria 41381
675 Ga0496123_0151128 3300048926 Bacteria 1253
676 Ga0496123_0184946 3300048926 Bacteria 1084
677 Ga0496124_0000036 3300048927 Bacteria 318032
678 Ga0496124_0002300 3300048927 Bacteria 25227
679 Ga0496124_0007825 3300048927 Bacteria 11281
680 Ga0496124_0041675 3300048927 Bacteria 3959
681 Ga0496124_0053031 3300048927 Bacteria 3441
682 Ga0496124_0087639 3300048927 Bacteria 2546
683 Ga0496124_0096438 3300048927 Bacteria 2402
684 Ga0496124_0178078 3300048927 Bacteria 1639
685 Ga0496125_0000038 3300048928 Bacteria 328120
686 Ga0496125_0015470 3300048928 Bacteria 7376
687 Ga0496125_0033974 3300048928 Bacteria 4503
688 Ga0496125_0043559 3300048928 Bacteria 3806
689 Ga0496125_0053328 3300048928 Bacteria 3316
690 Ga0496125_0060589 3300048928 Bacteria 3040
691 Ga0496125_0212054 3300048928 Bacteria 1257
692 Ga0496125_0274507 3300048928 Bacteria 1048
693 Ga0496126_0001857 3300048929 Bacteria 30790
694 Ga0496126_0019278 3300048929 Bacteria 6721
695 Ga0496126_0029405 3300048929 Bacteria 5220
696 Ga0496126_0031802 3300048929 Bacteria 4979
697 Ga0496126_0048088 3300048929 Bacteria 3901
698 Ga0496126_0085695 3300048929 Bacteria 2777
699 Ga0496126_0104389 3300048929 Bacteria 2476
700 Ga0496126_0555464 3300048929 Bacteria 910
701 Ga0495678_004472 3300049459 Bacteria 8073
702 Ga0495678_008649 3300049459 Bacteria 5116
703 Ga0495678_014566 3300049459 Bacteria 3652
704 Ga0495678_037128 3300049459 Bacteria 1982
705 Ga0495678_042992 3300049459 Bacteria 1797
706 Ga0495678_080193 3300049459 Bacteria 1173
707 Ga0495682_0000057 3300049460 Bacteria 102695
708 Ga0495682_0000497 3300049460 Bacteria 27198
709 Ga0495682_0000755 3300049460 Bacteria 20873
710 Ga0495682_0013167 3300049460 Bacteria 3153
711 Ga0495682_0022002 3300049460 Bacteria 2387
712 Ga0501033_0449075 3300049570 Bacteria 896
713 Ga0501038_0383047 3300049574 Bacteria 1091
714 Ga0501039_0229305 3300049575 Bacteria 1460
715 Ga0501041_0186625 3300049577 Bacteria 1299
716 Ga0501047_0172843 3300049581 Bacteria 2029
717 Ga0501047_0332511 3300049581 Bacteria 1358
718 Ga0501047_0747653 3300049581 Bacteria 794
719 Ga0501072_0000980 3300049588 Bacteria 21092
720 Ga0501076_0054908 3300049592 Bacteria 3158
721 Ga0501081_0092147 3300049743 Bacteria 2132
722 Ga0501083_0111255 3300049744 Bacteria 1800
723 Ga0501083_0636818 3300049744 Unclassified 693
724 Ga0501035_0058359 3300049822 Bacteria 3439
725 Ga0501044_0018701 3300049823 Bacteria 7420
726 Ga0501044_0101349 3300049823 Bacteria 2897
727 Ga0501045_0513342 3300049824 Bacteria 890
728 nmdc:mga03683_133221_c1 3300050489 Bacteria 1113
729 nmdc:mga03683_306335_c1 3300050489 Bacteria 746
730 nmdc:mga03683_64866_c1 3300050489 Bacteria 1551
731 nmdc:mga03683_65817_c1 3300050489 Bacteria 1540
732 nmdc:mga03n38_10883_c1 3300050490 Bacteria 3368
733 nmdc:mga03n38_187252_c1 3300050490 Bacteria 1064
734 nmdc:mga03n38_246124_c1 3300050490 Bacteria 943
735 nmdc:mga03n38_30608_c1 3300050490 Bacteria 2264
736 nmdc:mga00v17_190318_c1 3300050491 Bacteria 1325
737 nmdc:mga00v17_230353_c1 3300050491 Bacteria 1200
738 nmdc:mga00v17_2321_c1 3300050491 Bacteria 9740
739 nmdc:mga00v17_36690_c2 3300050491 Unclassified 1994
740 nmdc:mga00v17_445192_c1 3300050491 Bacteria 841
741 nmdc:mga00v17_97197_c1 3300050491 Bacteria 1856
742 nmdc:mga0yw44_140905_c1 3300050492 Bacteria 1567
743 nmdc:mga0yw44_4500_c1 3300050492 Bacteria 6406
744 nmdc:mga0k408_164479_c1 3300050493 Bacteria 1322
745 nmdc:mga0k408_80734_c1 3300050493 Bacteria 1904
746 nmdc:mga06z11_20687_c1 3300050494 Bacteria 3045
747 nmdc:mga06z11_339634_c1 3300050494 Bacteria 898
748 nmdc:mga07m45_123815_c1 3300050496 Bacteria 1494
749 nmdc:mga07m45_43444_c1 3300050496 Bacteria 2520
750 nmdc:mga07m45_9626_c1 3300050496 Bacteria 5022
751 nmdc:mga05p37_305676_c1 3300050507 Bacteria 1000
752 nmdc:mga09592_728_c1 3300050508 Bacteria 25328
753 nmdc:mga0qj67_27874_c1 3300050509 Bacteria 4380
754 nmdc:mga06r32_529118_c1 3300050510 Bacteria 1154
755 nmdc:mga0n895_107513_c1 3300050512 Bacteria 2803
756 nmdc:mga0n895_209856_c1 3300050512 Bacteria 1978
757 nmdc:mga0n895_277879_c1 3300050512 Bacteria 1698
758 nmdc:mga0n895_543892_c1 3300050512 Bacteria 1167
759 nmdc:mga0rr50_481794_c1 3300050513 Bacteria 1054
760 nmdc:mga08x19_84623_c2 3300050514 Bacteria 1097
761 nmdc:mga0a205_751896_c1 3300050515 Bacteria 823
762 nmdc:mga0sz30_263700_c1 3300050516 Bacteria 767
763 Ga0500610_0000141 3300053079 Bacteria 21515
764 Ga0500635_0085252 3300053080 Bacteria 1141
765 Ga0500643_010084 3300053087 Bacteria 3548
766 Ga0500643_044372 3300053087 Bacteria 1292
767 Ga0500644_0003496 3300053088 Bacteria 3891
768 Ga0500644_0008007 3300053088 Bacteria 2773
769 Ga0500581_063378 3300053089 Bacteria 1868
770 Ga0500651_0000099 3300053093 Bacteria 53568
771 Ga0500651_0103858 3300053093 Bacteria 1740
772 Ga0500566_0000214 3300053094 Bacteria 30715
773 Ga0500566_0008235 3300053094 Bacteria 6170
774 Ga0500650_0030296 3300053098 Bacteria 2453
775 Ga0500556_0000216 3300053104 Bacteria 46888
776 Ga0500560_003344 3300053107 Bacteria 3231
777 Ga0500562_001385 3300053108 Bacteria 5981
778 Ga0500569_006309 3300053109 Bacteria 2599
779 Ga0500569_036810 3300053109 Bacteria 1411
780 Ga0500571_000006 3300053110 Bacteria 105538
781 Ga0500597_004806 3300053120 Bacteria 4256
782 Ga0500608_065151 3300053122 Bacteria 1738
783 Ga0500618_001190 3300053125 Bacteria 12512
784 Ga0500642_0000012 3300053130 Bacteria 206424
785 Ga0500642_0308788 3300053130 Bacteria 712
786 Ga0500652_000403 3300053131 Bacteria 15465
787 Ga0500655_000056 3300053133 Bacteria 30742
788 Ga0500658_0000091 3300053134 Bacteria 41865
789 Ga0500658_0022293 3300053134 Bacteria 2406
790 Ga0500659_0001844 3300053135 Bacteria 13201
791 Ga0500559_0000167 3300053136 Bacteria 51877
792 Ga0500568_0001627 3300053139 Bacteria 14157
793 Ga0500574_000057 3300053141 Bacteria 12891
794 Ga0500586_000481 3300053145 Bacteria 8013
795 Ga0500604_0005154 3300053151 Bacteria 3450
796 Ga0500616_0000515 3300053153 Bacteria 48965
797 Ga0500616_0049606 3300053153 Bacteria 2220
798 Ga0500619_034805 3300053154 Bacteria 1559
799 Ga0500622_0002295 3300053156 Bacteria 14006
800 Ga0500627_0075634 3300053158 Bacteria 1496
801 Ga0500634_0012052 3300053161 Bacteria 4490
802 Ga0500636_0009790 3300053177 Bacteria 5581
803 Ga0500636_0049435 3300053177 Bacteria 2474
804 Ga0500645_068054 3300053730 Bacteria 1024
805 Ga0501084_0354427 3300054114 Bacteria 1239
806 Ga0501082_0301212 3300060353 Bacteria 1396
807 2501081030 2501025502 Bacteria 9641094
808 2511091713 2510917013 Bacteria 9951648
809 2511253439 2511231004 Bacteria 6669789
810 2511304909 2511231012 Bacteria 6738011
811 2511321771 2511231015 Bacteria 6598026
812 2511333784 2511231017 Bacteria 6503007
813 2511348987 2511231020 Bacteria 6115223
814 2511358901 2511231021 Bacteria 7302637
815 2511364442 2511231022 Bacteria 6719296
816 2513657826 2513237096 Bacteria 8722461
817 2513861489 2513237137 Bacteria 9558895
818 2513919824 2513237145 Bacteria 8979722
819 2517895162 2517572143 Bacteria 9484767
820 2524536290 2524023228 Bacteria 10118060
821 2558907290 2558860112 Bacteria 9931328
822 2600367572 2600254931 Bacteria 6734225
823 2603857415 2602042107 Bacteria 6226103
824 2643843375 2643221565 Bacteria 6216018
825 2643860166 2643221569 Bacteria 6064337
826 2644119994 2643221621 Bacteria 6212786
827 2644244089 2643221644 Bacteria 6865017
828 2644729872 2643221733 Bacteria 5690728
829 2671121806 2667528175 Bacteria 7532676
830 2692314982 2690316117 Bacteria 6800650
831 2728752229 2728368998 Bacteria 8720350
832 2739243704 2738543012 Bacteria 7115078
833 2739256962 2738543015 Bacteria 6750701
834 2792839136 2791355137 Bacteria 9654227
835 2793069117 2791355197 Bacteria 8420563
836 2809215350 2808606445 Bacteria 6057339
837 2842779386 2842775625 Bacteria 5587290
838 2847419960 2847417321 Bacteria 6913799
839 2857526795 2857524615 Bacteria 6615449
840 2885273886 2885270888 Bacteria 9831543
841 2885376491 2885374607 Bacteria 8927485
842 2893069958 2893066018 Bacteria 6158120
843 2894776802 2894772417 Bacteria 5305674
844 2903750673 2903748898 Bacteria 9972761
845 2904542158 2904541872 Bacteria 8915136
846 2904698323 2904690495 Bacteria 9412302
847 2904699998
848 2906611830
849 2906641048 2906635258 Bacteria 8601019
850 2906665489 2906660503 Bacteria 8595048
851 2908740648 2908739725 Bacteria 8628932
852 2908762924 2908756301 Bacteria 8864324
853 2913040589 2913036834 Bacteria 6704877
854 2917705674 2917699015 Bacteria 7043791
855 2919077694 2919073203 Bacteria 6531949
856 2922427466
857 2929167443 2929160207 Bacteria 9075316
858 2931401255 2931396565 Bacteria 7251677
859 2935637125 2935630451 Bacteria 8169952
860 2939639189 2939636861 Bacteria 6297853
861 2941513788 2941507105 Bacteria 8166816
862 2941521750 2941515067 Bacteria 8166720
863 2941529680 2941523033 Bacteria 8169134
864 3005477182 3005474847 Bacteria 9259049
865 3007806933 3007803356 Bacteria 5931491
866 3007856538 3007855910 Bacteria 5637581
867 643604357 643348564 Bacteria 8839022
868 8004021733 8004021418 Bacteria 4313954
869 8004023809 8004021418 Bacteria 4313954
870 8006978467 8006973647 Bacteria 10679141
871 8019560635 8019555841 Bacteria 9642137
872 8019570720 8019565922 Bacteria 9639779
873 8054507194 8054503363 Bacteria 6101651
874 8056139974 8056137416 Bacteria 6147080
875 8056691561 8056689827 Bacteria 6712655
876 Ga0496105_0489775
877 MRS2a_Contig_802
878 JGI24744J21845_10016867
879 JGI25151J46595_10015039
880 JGI25404J52841_10005115
881 JGI25404J52841_10006721
882 JGI25404J52841_10011730
883 Ga0055530_10032187
884 Ga0065714_10032856
885 Ga0065714_10073987
886 Ga0065714_10075886
887 Ga0065714_10133304
888 Ga0065714_10145153
889 Ga0065714_10268002
890 Ga0065704_10266369
891 Ga0065707_10083763
892 Ga0070676_10075749
893 Ga0070676_10519996
894 Ga0070690_100008552
895 Ga0070670_100076157
896 Ga0068869_100184186
897 Ga0070666_10366943
898 Ga0068868_100358742
899 Ga0068868_100820002
900 Ga0068868_100829551
901 Ga0070689_100357515
902 Ga0070687_100243817
903 Ga0070687_100317877
904 Ga0070661_100210586
905 Ga0070692_10395283
906 Ga0070668_100608193
907 Ga0070669_100012891
908 Ga0070669_100018866
909 Ga0070669_100279652
910 Ga0070675_100368672
911 Ga0070675_101054076
912 Ga0070671_100075829
913 Ga0070671_101363638
914 Ga0070674_100004356
915 Ga0070673_100077132
916 Ga0070673_100634843
917 Ga0070688_100072259
918 Ga0070667_100154202
919 Ga0070667_100355633
920 Ga0070709_10164174
921 Ga0070714_100025074
922 Ga0070713_100141794
923 Ga0070713_100393664
924 Ga0070713_100768958
925 Ga0070713_101365959
926 Ga0070710_10539375
927 Ga0070711_100546739
928 Ga0070700_100452940
929 Ga0070708_100339816
930 Ga0070678_100082518
931 Ga0070678_100107211
932 Ga0070678_100447304
933 Ga0070678_100585835
934 Ga0070662_100366473
935 Ga0068867_100042610
936 Ga0070685_10020415
937 Ga0070706_100001696
938 Ga0070698_100026347
939 Ga0070699_100450385
940 Ga0068853_100318534
941 Ga0068853_100611294
942 Ga0070672_100213922
943 Ga0070686_100034486
944 Ga0070695_100603225
945 Ga0070665_100382110
946 Ga0070665_101027716
947 Ga0068855_100014536
948 Ga0068855_100223814
949 Ga0068857_100111626
950 Ga0068857_100324916
951 Ga0068856_100184679
952 Ga0070702_100195635
953 Ga0068859_100468511
954 Ga0068864_100111411
955 Ga0068864_100127751
956 Ga0068866_10293503
957 Ga0068861_100082903
958 Ga0068863_100088352
959 Ga0068863_100162888
960 Ga0068863_100789709
961 Ga0068863_101123489
962 Ga0068858_100148467
963 Ga0068858_100189830
964 Ga0068860_100002010
965 Ga0081455_10004636
966 Ga0081455_10020916
967 Ga0081540_1004587
968 Ga0081540_1025653
969 Ga0081540_1031606
970 Ga0081540_1064824
971 Ga0081539_10152530
972 Ga0075365_10008449
973 Ga0075365_10012820
974 Ga0075365_10051253
975 Ga0075365_10470835
976 Ga0075363_100005959
977 Ga0075363_100039008
978 Ga0075363_100150935
979 Ga0075364_10000521
980 Ga0075364_10001007
981 Ga0075364_10006108
982 Ga0075364_10033900
983 Ga0075364_10106916
984 Ga0075364_10120341
985 Ga0075364_10579238
986 Ga0075432_10000692
987 Ga0075432_10018168
988 Ga0075432_10054035
989 Ga0075432_10055723
990 Ga0075432_10118629
991 Ga0075432_10125886
992 Ga0075432_10256760
993 Ga0070716_100231530
994 Ga0075362_10004185
995 Ga0075362_10013135
996 Ga0075362_10046148
997 Ga0075362_10166408
998 Ga0075369_10034089
999 Ga0075366_10008335
1000 Ga0075366_10024268
1001 Ga0075366_10065815
1002 Ga0075366_10101778
1003 Ga0075366_10131781
1004 Ga0075366_10156790
1005 Ga0097621_100373161
1006 Ga0097621_100430227
1007 Ga0075370_10008628
1008 Ga0075370_10008840
1009 Ga0075370_10061355
1010 Ga0068871_100031823
1011 Ga0075430_100004962
1012 Ga0075430_100322430
1013 Ga0075431_100237759
1014 Ga0075434_100067553
1015 Ga0075434_100885008
1016 Ga0075429_100005817
1017 Ga0075436_100241275
1018 Ga0075436_100488983
1019 Ga0097620_100468522
1020 Ga0099825_1047979
1021 Ga0099824_1004050
1022 Ga0099822_1000838
1023 Ga0075435_100123083
1024 Ga0105251_10005081
1025 Ga0105244_10004844
1026 Ga0105244_10008013
1027 Ga0105244_10385900
1028 Ga0105250_10009214
1029 Ga0105250_10011333
1030 Ga0105250_10090525
1031 Ga0105250_10144120
1032 Ga0105250_10221277
1033 Ga0105240_10005569
1034 Ga0105240_10201140
1035 Ga0111539_10692636
1036 Ga0105245_10159249
1037 Ga0105247_10068052
1038 Ga0105247_10097716
1039 Ga0105241_10592272
1040 Ga0105242_10097873
1041 Ga0105242_10772235
1042 Ga0105248_10393192
1043 Ga0105248_10411793
1044 Ga0105248_10597311
1045 Ga0105237_10022573
1046 Ga0105237_10026227
1047 Ga0105237_10063278
1048 Ga0105238_10647933
1049 Ga0105249_10610120
1050 Ga0105239_10000839
1051 Ga0105239_10193698
1052 Ga0105246_10015011
1053 Ga0157373_10007217
1054 Ga0157373_10007637
1055 Ga0157370_10000335
1056 Ga0157370_10010674
1057 Ga0157370_10012653
1058 Ga0157370_10103245
1059 Ga0157370_10391672
1060 Ga0157369_10087235
1061 Ga0157369_10130823
1062 Ga0157374_10849957
1063 Ga0157378_10019428
1064 Ga0163162_10103461
1065 Ga0163162_10374249
1066 Ga0163162_10458776
1067 Ga0163162_10778671
1068 Ga0157375_10080404
1069 Ga0157375_10443723
1070 Ga0163163_11220184
1071 Ga0163163_11304906
1072 Ga0157380_10073032
1073 Ga0182008_10000377
1074 Ga0182008_10003201
1075 Ga0182008_10018577
1076 Ga0182008_10036097
1077 Ga0182008_10149717
1078 Ga0157379_10340472
1079 Ga0157379_10364488
1080 Ga0157376_10114077
1081 Ga0182006_1006091
1082 Ga0182007_10002571
1083 Ga0182007_10006498
1084 Ga0163161_10003570
1085 Ga0163161_10009160
1086 Ga0206353_10735147
1087 Ga0213874_10001796
1088 Ga0213876_10008528
1089 Ga0213876_10150104
1090 Ga0213875_10006049
1091 Ga0228711_1000090
1092 Ga0209759_1008336
1093 Ga0209129_1001072
1094 Ga0209673_1001085
1095 Ga0209675_1029475
1096 Ga0209676_1001213
1097 Ga0209676_1024168
1098 Ga0209025_1000049
1099 Ga0209025_1000432
1100 Ga0209564_1020708
1101 Ga0209050_1001546
1102 Ga0209050_1001665
1103 Ga0209051_1001880
1104 Ga0209051_1009683
1105 Ga0209051_1013359
1106 Ga0207656_10249042
1107 Ga0207696_1000006
1108 Ga0207696_1021860
1109 Ga0207655_1000077
1110 Ga0207655_1008254
1111 Ga0207655_1017632
1112 Ga0207655_1027069
1113 Ga0207713_1000724
1114 Ga0207713_1014369
1115 Ga0207713_1014477
1116 Ga0207713_1043701
1117 Ga0207713_1062936
1118 Ga0207682_10000382
1119 Ga0207692_10134426
1120 Ga0207692_10470288
1121 Ga0207710_10048610
1122 Ga0207688_10134685
1123 Ga0207647_10057824
1124 Ga0207645_10004537
1125 Ga0207645_10353085
1126 Ga0207643_10022889
1127 Ga0207684_10001749
1128 Ga0207654_10473237
1129 Ga0207695_10009502
1130 Ga0207695_10399770
1131 Ga0207671_10019532
1132 Ga0207671_10212210
1133 Ga0207693_10049887
1134 Ga0207663_10404956
1135 Ga0207662_10049770
1136 Ga0207646_10077368
1137 Ga0207681_10010912
1138 Ga0207681_10071399
1139 Ga0207681_10102773
1140 Ga0207694_10102695
1141 Ga0207659_10387775
1142 Ga0207659_10582071
1143 Ga0207687_10115032
1144 Ga0207700_10015666
1145 Ga0207700_10097728
1146 Ga0207700_10651458
1147 Ga0207664_10141687
1148 Ga0207644_10063063
1149 Ga0207706_10336488
1150 Ga0207686_10193850
1151 Ga0207709_10072479
1152 Ga0207709_10080881
1153 Ga0207670_10221752
1154 Ga0207670_10362796
1155 Ga0207669_10002543
1156 Ga0207704_11017236
1157 Ga0207691_10055076
1158 Ga0207691_10055931
1159 Ga0207711_10290821
1160 Ga0207711_10325150
1161 Ga0207689_10195432
1162 Ga0207651_10029123
1163 Ga0207651_10033973
1164 Ga0207651_10785371
1165 Ga0207651_10817305
1166 Ga0207640_10388724
1167 Ga0207658_10228086
1168 Ga0207658_10606204
1169 Ga0207677_10543296
1170 Ga0207703_10416869
1171 Ga0207703_10736389
1172 Ga0207639_10073041
1173 Ga0207639_11038541
1174 Ga0207708_10244090
1175 Ga0207641_10461088
1176 Ga0207641_10966895
1177 Ga0207648_10015626
1178 Ga0207676_10105634
1179 Ga0207674_10028891
1180 Ga0207674_10775829
1181 Ga0207675_100976810
1182 Ga0207683_10020747
1183 Ga0207683_10324636
1184 Ga0207683_10492906
1185 Ga0209589_1000007
1186 Ga0209489_100008
1187 Ga0209700_100009
1188 Ga0207428_10149883
1189 Ga0207428_10481730
1190 Ga0207428_10500371
1191 Ga0207428_10505261
1192 Ga0268266_10061575
1193 Ga0268264_10000403
1194 Ga0268264_10000429
1195 Ga0268264_11288066
1196 Ga0265316_10196533
1197 Ga0307408_100009897
1198 Ga0307408_100040524
1199 Ga0307408_100816641
1200 Ga0307508_10122188
1201 Ga0307516_10070237
1202 Ga0307413_10556454
1203 Ga0307406_10482218
1204 Ga0307412_10021171
1205 Ga0307412_10858724
1206 Ga0307409_100207361
1207 Ga0307416_100704861
1208 Ga0307414_10018264
1209 Ga0307414_10738111
1210 Ga0307411_10748053
1211 Ga0307415_100685318
1212 Ga0307507_10073944
1213 Ga0315911_1000007
1214 Ga0373934_0249200
1215 Ga0373935_0401229
1216 Ga0373927_0025122
1217 Ga0373947_0308827
1218 Ga0373937_0058954
1219 Ga0373937_0194573
1220 Ga0373925_0019721
1221 Ga0373925_0146078
1222 Ga0395899_0012525
1223 Ga0395899_0244942
1224 Ga0395900_0061125
1225 Ga0395900_0168333
1226 Ga0395900_0302761
1227 Ga0395898_0274127
1228 Ga0436364_0017649
1229 Ga0436364_0607526
1230 Ga0395901_0118581
1231 Ga0395901_0351714
1232 Ga0436365_0247948
1233 Ga0436365_0615596
1234 Ga0436365_1690415
1235 Ga0436365_1912359
1236 Ga0436360_0251041
1237 Ga0436363_0106692
1238 Ga0436363_0710564
1239 Ga0436363_0957601
1240 Ga0439438_000163
1241 Ga0439438_000737
1242 Ga0439438_013856
1243 Ga0439447_000211
1244 Ga0439447_061219
1245 Ga0439447_086358
1246 Ga0439466_0018776
1247 Ga0439466_0050089
1248 Ga0451853_1495030
1249 Ga0439445_0111969
1250 Ga0439432_023075
1251 Ga0439451_000757
1252 Ga0439451_042068
1253 Ga0439452_001610
1254 Ga0439456_001175
1255 Ga0439456_004550
1256 Ga0439456_063682
1257 Ga0450911_000117
1258 Ga0450911_009912
1259 Ga0450920_022032
1260 Ga0450902_009128
1261 Ga0450903_000724
1262 Ga0450903_007618
1263 Ga0450903_016007
1264 Ga0450905_006389
1265 Ga0450905_025767
1266 Ga0450906_021269
1267 Ga0450907_000283
1268 Ga0450908_000101
1269 Ga0439434_0146557
1270 Ga0439460_0003018
1271 Ga0466966_0043244
1272 Ga0466961_0307696
1273 Ga0453684_0015372
1274 Ga0466968_0000008
1275 Ga0466970_0104087
1276 Ga0466957_0045017
1277 Ga0466960_0032713
1278 Ga0466959_0140759
1279 Ga0466959_0754691
1280 Ga0451576_0302602
1281 Ga0466958_0048891
1282 Ga0466958_0356370
1283 Ga0466967_0094486
1284 Ga0466967_0094767
1285 Ga0495617_000633
1286 Ga0495617_003137
1287 Ga0495617_033296
1288 Ga0495617_087949
1289 Ga0495627_001773
1290 Ga0495627_026356
1291 Ga0495603_0010415
1292 Ga0495603_0092043
1293 Ga0495590_0014969
1294 Ga0495590_0027762
1295 Ga0495590_0044585
1296 Ga0495591_000730
1297 Ga0495591_001059
1298 Ga0495629_0392073
1299 Ga0495638_0011540
1300 Ga0495638_0016359
1301 Ga0495638_0043614
1302 Ga0495638_0082168
1303 Ga0495638_0109477
1304 Ga0495638_0397002
1305 Ga0495653_0001150
1306 Ga0495650_0001328
1307 Ga0495650_0002139
1308 Ga0495650_0008143
1309 Ga0495650_0020467
1310 Ga0495650_0100398
1311 Ga0495580_0002934
1312 Ga0495605_0001099
1313 Ga0495605_0001937
1314 Ga0495605_0002177
1315 Ga0495605_0016277
1316 Ga0495605_0034203
1317 Ga0495605_0082552
1318 Ga0495639_0075898
1319 Ga0495584_0000851
1320 Ga0495584_0023748
1321 Ga0495584_0037424
1322 Ga0495584_0113452
1323 Ga0495585_0010531
1324 Ga0495594_0007401
1325 Ga0495594_0013066
1326 Ga0495596_0000421
1327 Ga0495607_0063801
1328 Ga0495607_0188944
1329 Ga0495607_0272920
1330 Ga0495583_0000172
1331 Ga0495583_0011494
1332 Ga0495583_0015244
1333 Ga0495583_0052429
1334 Ga0495606_0001019
1335 Ga0495610_0009130
1336 Ga0495610_0113762
1337 Ga0495616_0000456
1338 Ga0495616_0006807
1339 Ga0495616_0092756
1340 Ga0495620_0000006
1341 Ga0495620_0001273
1342 Ga0495620_0004743
1343 Ga0495630_0020504
1344 Ga0495630_0603503
1345 Ga0495631_0066030
1346 Ga0495631_0260185
1347 Ga0495632_0000031
1348 Ga0495632_0000170
1349 Ga0495632_0001021
1350 Ga0495632_0002096
1351 Ga0495637_0000799
1352 Ga0495637_0001764
1353 Ga0495637_0009093
1354 Ga0495637_0043837
1355 Ga0495643_0012198
1356 Ga0495643_0013461
1357 Ga0495643_0022047
1358 Ga0495643_0129090
1359 Ga0495644_0210516
1360 Ga0495648_0000267
1361 Ga0495648_0000402
1362 Ga0495648_0014286
1363 Ga0495648_0015925
1364 Ga0495648_0032837
1365 Ga0495666_0002052
1366 Ga0495666_0040601
1367 Ga0495642_0000584
1368 Ga0495642_0000977
1369 Ga0495654_0010877
1370 Ga0495654_0061793
1371 Ga0495654_0099023
1372 Ga0495654_0124773
1373 Ga0495665_0011202
1374 Ga0495665_0058750
1375 Ga0495587_0000835
1376 Ga0495598_0008123
1377 Ga0495609_0000552
1378 Ga0495609_0001596
1379 Ga0495609_0016775
1380 Ga0495609_0030749
1381 Ga0495621_0021407
1382 Ga0495621_0193580
1383 Ga0495597_0004922
1384 Ga0495597_0021913
1385 Ga0495597_0078768
1386 Ga0495622_0013456
1387 Ga0495622_0315722
1388 Ga0495633_0002829
1389 Ga0495633_0042079
1390 Ga0495633_0140577
1391 Ga0495656_0014112
1392 Ga0495656_0076937
1393 Ga0495668_0001425
1394 Ga0495634_0000347
1395 Ga0495611_0132362
1396 Ga0495625_0005230
1397 Ga0495625_0010607
1398 Ga0495625_0089038
1399 Ga0495625_0113577
1400 Ga0495625_0156972
1401 Ga0495635_0000402
1402 Ga0495635_0564407
1403 Ga0495659_0000252
1404 Ga0495659_0002938
1405 Ga0495659_0146539
1406 Ga0495661_0036598
1407 Ga0495661_0109816
1408 Ga0495661_0116931
1409 Ga0495661_0156942
1410 Ga0495588_0000444
1411 Ga0495588_0002335
1412 Ga0495588_0476177
1413 Ga0495646_0000541
1414 Ga0495658_0577562
1415 Ga0495669_0000022
1416 Ga0495669_0000576
1417 Ga0495669_0006562
1418 Ga0495669_0155276
1419 Ga0495624_0150196
1420 Ga0495624_0173755
1421 Ga0495670_0001231
1422 Ga0495670_0004594
1423 Ga0495670_0092196
1424 Ga0495670_0176837
1425 Ga0495671_0002464
1426 Ga0495671_0002792
1427 Ga0495649_0000106
1428 Ga0495649_0000811
1429 Ga0495649_0031264
1430 Ga0495589_0008767
1431 Ga0495589_0015375
1432 Ga0495589_0024430
1433 Ga0495660_0013968
1434 Ga0495660_0017097
1435 Ga0495660_0022090
1436 Ga0495660_0066028
1437 Ga0495660_0127284
1438 Ga0495660_0127579
1439 Ga0495660_0281446
1440 Ga0495604_0012438
1441 Ga0495604_0094408
1442 Ga0495636_0000436
1443 Ga0495636_0002142
1444 Ga0495674_0076560
1445 Ga0495672_0000357
1446 Ga0495672_0000987
1447 Ga0495672_0003208
1448 Ga0495672_0005169
1449 Ga0495672_0141779
1450 Ga0495672_0161133
1451 Ga0495672_0194306
1452 Ga0495676_0000456
1453 Ga0495683_0005131
1454 Ga0495683_0005677
1455 Ga0495683_0057323
1456 Ga0495683_0113173
1457 Ga0495683_0196426
1458 Ga0495687_000159
1459 Ga0495687_000343
1460 Ga0495687_002486
1461 Ga0495677_0000308
1462 Ga0495679_025105
1463 Ga0495685_054055
1464 Ga0495685_056544
1465 Ga0495673_0000142
1466 Ga0495673_0001971
1467 Ga0495673_0013732
1468 Ga0495673_0022217
1469 Ga0495681_0011182
1470 Ga0495681_0013602
1471 Ga0495681_0068702
1472 Ga0495681_0219752
1473 Ga0495593_0000536
1474 Ga0495593_0003207
1475 Ga0495593_0054980
1476 Ga0495593_0142471
1477 Ga0495602_0077339
1478 Ga0495614_0000445
1479 Ga0495626_0002671
1480 Ga0495626_0002800
1481 Ga0495626_0011624
1482 Ga0495626_0014962
1483 Ga0495626_0021804
1484 Ga0496102_0000444
1485 Ga0496102_0344646
1486 Ga0496103_0000290
1487 Ga0496103_0067436
1488 Ga0496103_0424747
1489 Ga0496106_0001400
1490 Ga0496106_0040227
1491 Ga0496106_0095899
1492 Ga0496107_0390987
1493 Ga0496108_0349077
1494 Ga0496110_0048556
1495 Ga0496112_0368077
1496 Ga0496112_0613369
1497 Ga0496114_0015450
1498 Ga0496114_0076715
1499 Ga0496114_0269582
1500 Ga0496114_0271380
1501 Ga0496114_0478191
1502 Ga0496115_0018008
1503 Ga0496115_0646931
1504 Ga0496116_0000231
1505 Ga0496116_0001738
1506 Ga0496116_0012086
1507 Ga0496116_0021642
1508 Ga0496117_0000428
1509 Ga0496117_0000460
1510 Ga0496117_0005335
1511 Ga0496117_0069886
1512 Ga0496117_0155803
1513 Ga0496117_0169612
1514 Ga0496118_0000106
1515 Ga0496118_0001373
1516 Ga0496118_0002522
1517 Ga0496118_0004391
1518 Ga0496118_0036942
1519 Ga0496118_0042526
1520 Ga0496118_0131345
1521 Ga0496118_0214010
1522 Ga0496119_0024932
1523 Ga0496119_0057100
1524 Ga0496119_0145051
1525 Ga0496121_0000233
1526 Ga0496121_0000602
1527 Ga0496121_0002550
1528 Ga0496121_0034085
1529 Ga0496121_0038513
1530 Ga0496121_0040873
1531 Ga0496121_0046322
1532 Ga0496121_0058950
1533 Ga0496121_0068058
1534 Ga0496121_0108695
1535 Ga0496121_0146496
1536 Ga0496121_0207410
1537 Ga0496121_0218056
1538 Ga0496121_0241898
1539 Ga0496121_0338216
1540 Ga0496121_0382764
1541 Ga0496122_0000582
1542 Ga0496122_0003924
1543 Ga0496122_0028198
1544 Ga0496122_0052736
1545 Ga0496122_0244818
1546 Ga0496122_0296592
1547 Ga0496122_0302168
1548 Ga0496123_0000479
1549 Ga0496123_0001070
1550 Ga0496123_0151128
1551 Ga0496123_0184946
1552 Ga0496124_0000036
1553 Ga0496124_0002300
1554 Ga0496124_0007825
1555 Ga0496124_0041675
1556 Ga0496124_0053031
1557 Ga0496124_0087639
1558 Ga0496124_0096438
1559 Ga0496124_0178078
1560 Ga0496125_0000038
1561 Ga0496125_0015470
1562 Ga0496125_0033974
1563 Ga0496125_0043559
1564 Ga0496125_0053328
1565 Ga0496125_0060589
1566 Ga0496125_0212054
1567 Ga0496125_0274507
1568 Ga0496126_0001857
1569 Ga0496126_0019278
1570 Ga0496126_0029405
1571 Ga0496126_0031802
1572 Ga0496126_0048088
1573 Ga0496126_0085695
1574 Ga0496126_0104389
1575 Ga0496126_0555464
1576 Ga0495678_004472
1577 Ga0495678_008649
1578 Ga0495678_014566
1579 Ga0495678_037128
1580 Ga0495678_042992
1581 Ga0495678_080193
1582 Ga0495682_0000057
1583 Ga0495682_0000497
1584 Ga0495682_0000755
1585 Ga0495682_0013167
1586 Ga0495682_0022002
1587 Ga0501033_0449075
1588 Ga0501038_0383047
1589 Ga0501039_0229305
1590 Ga0501041_0186625
1591 Ga0501047_0172843
1592 Ga0501047_0332511
1593 Ga0501047_0747653
1594 Ga0501072_0000980
1595 Ga0501076_0054908
1596 Ga0501081_0092147
1597 Ga0501083_0111255
1598 Ga0501083_0636818
1599 Ga0501035_0058359
1600 Ga0501044_0018701
1601 Ga0501044_0101349
1602 Ga0501045_0513342
1603 nmdc:mga03683_133221_c1
1604 nmdc:mga03683_306335_c1
1605 nmdc:mga03683_64866_c1
1606 nmdc:mga03683_65817_c1
1607 nmdc:mga03n38_10883_c1
1608 nmdc:mga03n38_187252_c1
1609 nmdc:mga03n38_246124_c1
1610 nmdc:mga03n38_30608_c1
1611 nmdc:mga00v17_190318_c1
1612 nmdc:mga00v17_230353_c1
1613 nmdc:mga00v17_2321_c1
1614 nmdc:mga00v17_36690_c2
1615 nmdc:mga00v17_445192_c1
1616 nmdc:mga00v17_97197_c1
1617 nmdc:mga0yw44_140905_c1
1618 nmdc:mga0yw44_4500_c1
1619 nmdc:mga0k408_164479_c1
1620 nmdc:mga0k408_80734_c1
1621 nmdc:mga06z11_20687_c1
1622 nmdc:mga06z11_339634_c1
1623 nmdc:mga07m45_123815_c1
1624 nmdc:mga07m45_43444_c1
1625 nmdc:mga07m45_9626_c1
1626 nmdc:mga05p37_305676_c1
1627 nmdc:mga09592_728_c1
1628 nmdc:mga0qj67_27874_c1
1629 nmdc:mga06r32_529118_c1
1630 nmdc:mga0n895_107513_c1
1631 nmdc:mga0n895_209856_c1
1632 nmdc:mga0n895_277879_c1
1633 nmdc:mga0n895_543892_c1
1634 nmdc:mga0rr50_481794_c1
1635 nmdc:mga08x19_84623_c2
1636 nmdc:mga0a205_751896_c1
1637 nmdc:mga0sz30_263700_c1
1638 Ga0500610_0000141
1639 Ga0500635_0085252
1640 Ga0500643_010084
1641 Ga0500643_044372
1642 Ga0500644_0003496
1643 Ga0500644_0008007
1644 Ga0500581_063378
1645 Ga0500651_0000099
1646 Ga0500651_0103858
1647 Ga0500566_0000214
1648 Ga0500566_0008235
1649 Ga0500650_0030296
1650 Ga0500556_0000216
1651 Ga0500560_003344
1652 Ga0500562_001385
1653 Ga0500569_006309
1654 Ga0500569_036810
1655 Ga0500571_000006
1656 Ga0500597_004806
1657 Ga0500608_065151
1658 Ga0500618_001190
1659 Ga0500642_0000012
1660 Ga0500642_0308788
1661 Ga0500652_000403
1662 Ga0500655_000056
1663 Ga0500658_0000091
1664 Ga0500658_0022293
1665 Ga0500659_0001844
1666 Ga0500559_0000167
1667 Ga0500568_0001627
1668 Ga0500574_000057
1669 Ga0500586_000481
1670 Ga0500604_0005154
1671 Ga0500616_0000515
1672 Ga0500616_0049606
1673 Ga0500619_034805
1674 Ga0500622_0002295
1675 Ga0500627_0075634
1676 Ga0500634_0012052
1677 Ga0500636_0009790
1678 Ga0500636_0049435
1679 Ga0500645_068054
1680 Ga0501084_0354427
1681 Ga0501082_0301212
1682 2501081030
1683 2511091713
1684 2511253439
1685 2511304909
1686 2511321771
1687 2511333784
1688 2511348987
1689 2511358901
1690 2511364442
1691 2513657826
1692 2513861489
1693 2513919824
1694 2517895162
1695 2524536290
1696 2558907290
1697 2600367572
1698 2603857415
1699 2643843375
1700 2643860166
1701 2644119994
1702 2644244089
1703 2644729872
1704 2671121806
1705 2692314982
1706 2728752229
1707 2739243704
1708 2739256962
1709 2792839136
1710 2793069117
1711 2809215350
1712 2842779386
1713 2847419960
1714 2857526795
1715 2885273886
1716 2885376491
1717 2893069958
1718 2894776802
1719 2903750673
1720 2904542158
1721 2904698323
1722 2904699998
1723 2906611830
1724 2906641048
1725 2906665489
1726 2908740648
1727 2908762924
1728 2913040589
1729 2917705674
1730 2919077694
1731 2922427466
1732 2929167443
1733 2931401255
1734 2935637125
1735 2939639189
1736 2941513788
1737 2941521750
1738 2941529680
1739 3005477182
1740 3007806933
1741 3007856538
1742 643604357
1743 8004021733
1744 8004023809
1745 8006978467
1746 8019560635
1747 8019570720
1748 8054507194
1749 8056139974
1750 8056691561

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

41

175

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2iht-assembly1.cif.gz_B carboxyethylarginine synthase from streptomyces clavuligerus: semet structure 0.832 2 171
4q9d-assembly1.cif.gz_A-2 x-ray structure of a putative thiamin diphosphate-dependent enzyme isolated from mycobacterium smegmatis 0.8233 10 171
1upa-assembly1.cif.gz_C carboxyethylarginine synthase from streptomyces clavuligerus (semet structure) 0.8215 5 172
3eya-assembly3.cif.gz_K structural basis for membrane binding and catalytic activation of the peripheral membrane enzyme pyruvate oxidase from escherichia coli 0.8188 11 172
1upc-assembly1.cif.gz_C carboxyethylarginine synthase from streptomyces clavuligerus 0.8186 5 171
ID Description Score Start End Superfamily
af_P58416_5_175_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9421 12 182 3.40.50.970
af_P58416_5_175_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9315 12 182 3.40.50.970
af_A4I3N7_199_405_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8606 4 186 3.40.50.970
af_Q57957_74_243_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8478 61 170 3.40.50.970
af_Q4D595_238_443_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8449 2 186 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A536SBB7-F1-model_v4 Aldehyde dehydrogenase 0.9989 9 108 GO:0016831
GO:0030976
GO:0044281
AF-A0A5E7MMF2-F1-model_v4 deleted 0.9974 1 194
AF-A0A7Y8C5T8-F1-model_v4 Aldehyde dehydrogenase 0.9973 1 198 GO:0016831
GO:0030976
GO:0044281
AF-A0A7H5R5M6-F1-model_v4 Aldehyde dehydrogenase 0.9967 1 198 GO:0016831
GO:0030976
GO:0044281
AF-A0A0F4XSL0-F1-model_v4 Aldehyde dehydrogenase 0.9956 1 198 GO:0016831
GO:0030976
GO:0044281

Map