F484337

General Info

Members Datasets Scaffolds Average Seq Length
875 409 1750 395

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0194555|Ga0501034_0194555_249_1610
Length 453
Sequence LPAAAAAICSIAAYQRTGARGLAGLRRNATVGHGNQQVPAAARPTGADKGGKKRMSAAATASTTVGQAPFDTKRLDAAMDEAGVDVIVATSKHNVQYLMGGHRAHFFDYMDAMGISRYLPVMVYPKGAPEKAAYFGHRLEGHQKQVKPLWTPTAETSTGGSTDAISKAIEYMRHAGIKPRRIGAELGFLPIDAGMVLRDAFPDAELKDAVFPLERLRLRKSEAELDLLRKASDLVIESMQAVIANHGPGTTKRELVEALRREEVNRGLTFEYCLIAAGASHNRAASDQKWEKGDVLSVDSGGNYHGYIGDVARMAIQGEPDAELEDLLADVDRVQQAAFNAVRAGAMGGDIYAAAEKALAASPNHNCMEFIAHGMGLVSHEAPHLTATGPIKYSDEDARRPLESGMVISVETTTLHPRRGFIKLEDTIAVTDKGYEMFGTGARGWNRGGTAAH

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
13 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
17 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
94 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
105 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
106 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
107 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
112 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
113 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
144 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
146 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
147 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
211 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
217 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
218 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
219 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
220 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
221 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
222 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
223 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
224 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
225 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
226 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
227 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
228 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
229 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
230 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
231 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
232 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
233 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
234 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
235 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
236 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
237 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
238 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
239 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
240 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
242 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
244 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
245 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
246 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
247 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
248 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
249 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
250 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
251 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
252 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
253 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
254 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
255 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
256 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
257 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
258 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
259 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
260 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
261 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
262 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
264 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
265 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
266 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
267 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
268 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
269 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
270 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
271 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
272 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
273 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
274 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
275 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
276 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
277 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
278 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
279 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
280 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
281 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
282 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
283 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
284 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
285 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
286 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
287 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
288 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
289 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
290 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
291 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
292 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
293 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
297 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
298 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
299 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
300 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
301 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
302 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
303 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
304 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
305 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
306 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
307 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
308 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
309 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
310 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
311 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
312 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
313 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
314 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
315 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
316 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
317 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
318 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
319 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
320 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
321 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
322 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
323 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
324 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
325 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
326 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
327 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
328 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
329 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
330 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
331 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
332 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
333 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
334 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
338 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
339 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
340 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
341 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
342 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
343 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
344 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
345 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
346 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
347 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
348 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
349 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
350 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
351 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
364 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
365 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
366 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
367 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
368 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
369 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
370 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
371 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
372 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
373 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
374 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
375 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
376 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
377 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
378 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
381 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
382 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
383 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
384 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
385 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
386 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
387 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
388 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
389 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
390 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
391 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
392 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
393 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
394 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
395 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
396 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
397 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
398 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
399 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
400 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
401 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
402 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
403 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
404 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
405 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
406 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
407 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
408 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
409 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.2
Nodule 0
Rhizoplane 9.37
Rhizosphere 84.69
Stem 0
Stem Tuber 0
Unclassified 2.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0194555 3300049571 Bacteria 1989
2 2214911850 2209111006 Bacteria 7117
3 ARcpr5oldR_c000028 3300000041 Bacteria 29588
4 ARSoilYngRDRAFT_c00197 3300000042 Bacteria 10090
5 ARcpr5yngRDRAFT_c000600 3300000043 Bacteria 4526
6 ARSoilOldRDRAFT_c000023 3300000044 Bacteria 34965
7 ARCol0oldRDRAFT_c00462 3300000045 Bacteria 3835
8 ARCol0yngRDRAFT_1000216 3300000652 Bacteria 9710
9 JGI24746J21847_1000047 3300001977 Bacteria 11979
10 JGI24739J22299_10000148 3300001989 Bacteria 22525
11 JGI24737J22298_10000458 3300001990 Bacteria 14018
12 JGI24737J22298_10003428 3300001990 Bacteria 5606
13 JGI24750J21931_1000011 3300002070 Bacteria 22441
14 JGI24745J21846_1000352 3300002073 Bacteria 3987
15 JGI24738J21930_10000236 3300002075 Bacteria 15024
16 JGI24749J21850_1000378 3300002076 Bacteria 6650
17 JGI24034J26672_10000483 3300002239 Bacteria 5147
18 JGI24742J22300_10000248 3300002244 Bacteria 8017
19 JGI25153J46596_10006082 3300003215 Bacteria 6197
20 JGI25404J52841_10002777 3300003659 Bacteria 3370
21 Ga0065712_10077915 3300005290 Bacteria 3425
22 Ga0065715_10088960 3300005293 Bacteria 20217
23 Ga0070658_10101492 3300005327 Bacteria 2379
24 Ga0070658_10163798 3300005327 Bacteria 1866
25 Ga0070676_10000536 3300005328 Bacteria 18324
26 Ga0070676_10096359 3300005328 Bacteria 1821
27 Ga0070683_100000144 3300005329 Bacteria 45900
28 Ga0070690_100028441 3300005330 Bacteria 3463
29 Ga0070670_100000437 3300005331 Bacteria 34047
30 Ga0070670_100284597 3300005331 Bacteria 1444
31 Ga0070677_10008501 3300005333 Bacteria 3457
32 Ga0068869_100000035 3300005334 Bacteria 55467
33 Ga0070666_10006881 3300005335 Bacteria 7005
34 Ga0070666_10033695 3300005335 Bacteria 3391
35 Ga0070680_100001482 3300005336 Bacteria 17052
36 Ga0070680_100081661 3300005336 Bacteria 2667
37 Ga0070682_100002219 3300005337 Bacteria 10771
38 Ga0070682_100013572 3300005337 Bacteria 4690
39 Ga0070660_100001344 3300005339 Bacteria 16702
40 Ga0070660_100008614 3300005339 Bacteria 7139
41 Ga0070660_100015576 3300005339 Bacteria 5494
42 Ga0070660_100018605 3300005339 Bacteria 5079
43 Ga0070660_100079997 3300005339 Bacteria 2564
44 Ga0070689_100011661 3300005340 Bacteria 6303
45 Ga0070689_100088268 3300005340 Bacteria 2440
46 Ga0070689_100198248 3300005340 Bacteria 1638
47 Ga0070691_10001234 3300005341 Bacteria 10769
48 Ga0070661_100000017 3300005344 Bacteria 153232
49 Ga0070661_100095415 3300005344 Bacteria 2206
50 Ga0070692_10000008 3300005345 Bacteria 47438
51 Ga0070692_10023193 3300005345 Bacteria 3038
52 Ga0070668_100000699 3300005347 Bacteria 22898
53 Ga0070668_100166882 3300005347 Bacteria 1790
54 Ga0070669_100000250 3300005353 Bacteria 44115
55 Ga0070675_100000246 3300005354 Bacteria 35225
56 Ga0070675_100086117 3300005354 Bacteria 2626
57 Ga0070671_100003025 3300005355 Bacteria 13092
58 Ga0070671_100053599 3300005355 Bacteria 3353
59 Ga0070674_100000355 3300005356 Bacteria 22844
60 Ga0070674_100003096 3300005356 Bacteria 9255
61 Ga0070673_100000032 3300005364 Bacteria 61665
62 Ga0070673_100128486 3300005364 Bacteria 2123
63 Ga0070688_100000669 3300005365 Bacteria 17042
64 Ga0070688_100048356 3300005365 Bacteria 2642
65 Ga0070659_100000214 3300005366 Bacteria 44422
66 Ga0070667_100000816 3300005367 Bacteria 29087
67 Ga0070667_100172263 3300005367 Bacteria 1911
68 Ga0070709_10008980 3300005434 Bacteria 5505
69 Ga0070714_100019217 3300005435 Bacteria 5561
70 Ga0070714_100124355 3300005435 Bacteria 2297
71 Ga0070710_10054171 3300005437 Bacteria 2262
72 Ga0070701_10000099 3300005438 Bacteria 24473
73 Ga0070705_100002586 3300005440 Bacteria 9071
74 Ga0070700_100000234 3300005441 Bacteria 30487
75 Ga0070694_100000247 3300005444 Bacteria 28607
76 Ga0070694_100071128 3300005444 Bacteria 2397
77 Ga0070663_100000201 3300005455 Bacteria 29751
78 Ga0070678_100003298 3300005456 Bacteria 8975
79 Ga0070678_100015051 3300005456 Bacteria 4902
80 Ga0070678_100015873 3300005456 Bacteria 4799
81 Ga0070678_100167147 3300005456 Bacteria 1788
82 Ga0070662_100009709 3300005457 Bacteria 6298
83 Ga0070662_100010369 3300005457 Bacteria 6110
84 Ga0070662_100034363 3300005457 Bacteria 3574
85 Ga0070662_100042269 3300005457 Bacteria 3255
86 Ga0070681_10000401 3300005458 Bacteria 35170
87 Ga0070681_10043121 3300005458 Bacteria 4520
88 Ga0070681_10066151 3300005458 Bacteria 3583
89 Ga0068867_100000190 3300005459 Bacteria 40626
90 Ga0068867_100182416 3300005459 Bacteria 1670
91 Ga0070685_10099511 3300005466 Bacteria 1773
92 Ga0070679_100000847 3300005530 Bacteria 26675
93 Ga0070679_100025113 3300005530 Bacteria 5844
94 Ga0070679_100095123 3300005530 Bacteria 2967
95 Ga0070679_100369821 3300005530 Bacteria 1381
96 Ga0070684_100000904 3300005535 Bacteria 21016
97 Ga0070684_100102582 3300005535 Bacteria 2557
98 Ga0070697_100022928 3300005536 Bacteria 4964
99 Ga0068853_100003019 3300005539 Bacteria 12851
100 Ga0070672_100000807 3300005543 Bacteria 18712
101 Ga0070672_100126358 3300005543 Bacteria 2098
102 Ga0070686_100037535 3300005544 Bacteria 3006
103 Ga0070695_100000406 3300005545 Bacteria 22313
104 Ga0070695_100011865 3300005545 Bacteria 5215
105 Ga0070696_100000304 3300005546 Bacteria 29759
106 Ga0070696_100215749 3300005546 Bacteria 1438
107 Ga0070693_100000546 3300005547 Bacteria 16772
108 Ga0070665_100020165 3300005548 Bacteria 6693
109 Ga0070704_100000385 3300005549 Bacteria 20151
110 Ga0070704_100003857 3300005549 Bacteria 8632
111 Ga0070704_100246707 3300005549 Bacteria 1464
112 Ga0068855_100019930 3300005563 Bacteria 8055
113 Ga0068855_100298209 3300005563 Bacteria 1785
114 Ga0070664_100000912 3300005564 Bacteria 23051
115 Ga0070664_100024388 3300005564 Bacteria 5002
116 Ga0070664_100249930 3300005564 Bacteria 1594
117 Ga0068857_100000494 3300005577 Bacteria 28282
118 Ga0068857_100299070 3300005577 Bacteria 1483
119 Ga0068854_100000139 3300005578 Bacteria 50270
120 Ga0068856_100005193 3300005614 Bacteria 12858
121 Ga0070702_100000177 3300005615 Bacteria 20344
122 Ga0070702_100011837 3300005615 Bacteria 4351
123 Ga0068852_100000193 3300005616 Bacteria 41505
124 Ga0068852_100258019 3300005616 Bacteria 1673
125 Ga0068859_100022588 3300005617 Bacteria 6308
126 Ga0068864_100000226 3300005618 Bacteria 50929
127 Ga0068864_100031549 3300005618 Bacteria 4496
128 Ga0068866_10000199 3300005718 Bacteria 28222
129 Ga0068861_100000328 3300005719 Bacteria 26783
130 Ga0068861_100050080 3300005719 Bacteria 3166
131 Ga0068870_10000388 3300005840 Bacteria 16520
132 Ga0068858_100096035 3300005842 Bacteria 2762
133 Ga0068858_100101757 3300005842 Bacteria 2680
134 Ga0068858_100302923 3300005842 Bacteria 1525
135 Ga0068860_100001525 3300005843 Bacteria 24947
136 Ga0068862_100000557 3300005844 Bacteria 38898
137 Ga0081455_10000035 3300005937 Bacteria 136366
138 Ga0081455_10000334 3300005937 Bacteria 61844
139 Ga0081455_10001717 3300005937 Bacteria 26511
140 Ga0081455_10002005 3300005937 Bacteria 24324
141 Ga0081538_10045637 3300005981 Bacteria 2713
142 Ga0081540_1000273 3300005983 Bacteria 53925
143 Ga0081540_1000508 3300005983 Bacteria 38223
144 Ga0081540_1010303 3300005983 Bacteria 6341
145 Ga0081539_10002061 3300005985 Bacteria 30119
146 Ga0070717_10003781 3300006028 Bacteria 10877
147 Ga0070717_10031627 3300006028 Bacteria 4259
148 Ga0075365_10008527 3300006038 Bacteria 5828
149 Ga0075363_100000067 3300006048 Bacteria 21390
150 Ga0075363_100004350 3300006048 Bacteria 6176
151 Ga0075364_10001020 3300006051 Bacteria 14868
152 Ga0075364_10003087 3300006051 Bacteria 9415
153 Ga0075364_10159905 3300006051 Bacteria 1520
154 Ga0070715_10022784 3300006163 Bacteria 2445
155 Ga0070716_100037734 3300006173 Bacteria 2671
156 Ga0070712_100037167 3300006175 Bacteria 3317
157 Ga0070712_100197056 3300006175 Bacteria 1580
158 Ga0075362_10014164 3300006177 Bacteria 3212
159 Ga0075367_10007937 3300006178 Bacteria 5470
160 Ga0075369_10026510 3300006186 Bacteria 2416
161 Ga0075366_10000504 3300006195 Bacteria 18137
162 Ga0075366_10019642 3300006195 Bacteria 3914
163 Ga0097621_100000049 3300006237 Bacteria 61062
164 Ga0097621_100103906 3300006237 Bacteria 2393
165 Ga0068871_100000097 3300006358 Bacteria 52015
166 Ga0068871_100005912 3300006358 Bacteria 8608
167 Ga0075428_100015574 3300006844 Bacteria 8429
168 Ga0075428_100075915 3300006844 Bacteria 3669
169 Ga0075428_100086529 3300006844 Bacteria 3418
170 Ga0075430_100003545 3300006846 Bacteria 13067
171 Ga0075431_100012917 3300006847 Bacteria 8429
172 Ga0075431_100015952 3300006847 Bacteria 7622
173 Ga0075431_100169438 3300006847 Bacteria 2244
174 Ga0075433_10003238 3300006852 Bacteria 12575
175 Ga0075433_10004405 3300006852 Bacteria 10960
176 Ga0075433_10066986 3300006852 Bacteria 3151
177 Ga0075433_10185132 3300006852 Bacteria 1853
178 Ga0075434_100000383 3300006871 Bacteria 32396
179 Ga0075434_100001135 3300006871 Bacteria 21932
180 Ga0075434_100004943 3300006871 Bacteria 12088
181 Ga0075434_100045346 3300006871 Bacteria 4361
182 Ga0075434_100078639 3300006871 Unclassified 3294
183 Ga0075434_100112130 3300006871 Bacteria 2738
184 Ga0075434_100207516 3300006871 Bacteria 1980
185 Ga0075429_100001354 3300006880 Bacteria 20025
186 Ga0068865_100000119 3300006881 Bacteria 39895
187 Ga0097620_100022587 3300006931 Bacteria 6308
188 Ga0075435_100042204 3300007076 Bacteria 3649
189 Ga0075435_100044400 3300007076 Bacteria 3560
190 Ga0075435_100065845 3300007076 Bacteria 2946
191 Ga0075435_100116724 3300007076 Bacteria 2224
192 Ga0075435_100276198 3300007076 Bacteria 1434
193 Ga0099794_10006887 3300007265 Bacteria 4632
194 Ga0099795_10045896 3300007788 Bacteria 1572
195 Ga0105251_10083889 3300009011 Unclassified 1470
196 Ga0105240_10061307 3300009093 Bacteria 4687
197 Ga0105240_10090342 3300009093 Bacteria 3744
198 Ga0105240_10104261 3300009093 Bacteria 3444
199 Ga0111539_10000237 3300009094 Bacteria 65638
200 Ga0111539_10001512 3300009094 Bacteria 31036
201 Ga0111539_10019347 3300009094 Bacteria 8406
202 Ga0111539_10020456 3300009094 Bacteria 8150
203 Ga0111539_10031942 3300009094 Bacteria 6396
204 Ga0111539_10037394 3300009094 Bacteria 5862
205 Ga0111539_10432102 3300009094 Bacteria 1533
206 Ga0105245_10000202 3300009098 Bacteria 57012
207 Ga0105245_10037311 3300009098 Bacteria 4320
208 Ga0105245_10049439 3300009098 Bacteria 3766
209 Ga0105247_10073689 3300009101 Bacteria 2140
210 Ga0114129_10016815 3300009147 Bacteria 10413
211 Ga0114129_10019143 3300009147 Bacteria 9751
212 Ga0114129_10064911 3300009147 Bacteria 5095
213 Ga0114129_10267543 3300009147 Bacteria 2288
214 Ga0105243_10001790 3300009148 Bacteria 18452
215 Ga0105243_10024923 3300009148 Bacteria 4566
216 Ga0105243_10026091 3300009148 Bacteria 4471
217 Ga0105243_10047764 3300009148 Bacteria 3372
218 Ga0105243_10055631 3300009148 Bacteria 3144
219 Ga0105241_10000430 3300009174 Bacteria 31789
220 Ga0105241_10176529 3300009174 Bacteria 1769
221 Ga0105242_10002429 3300009176 Bacteria 14632
222 Ga0105242_10084693 3300009176 Bacteria 2657
223 Ga0105242_10148172 3300009176 Bacteria 2044
224 Ga0105242_10320902 3300009176 Bacteria 1420
225 Ga0105248_10009999 3300009177 Bacteria 10442
226 Ga0105248_10098539 3300009177 Bacteria 3293
227 Ga0105248_10107382 3300009177 Bacteria 3148
228 Ga0105248_10138471 3300009177 Bacteria 2746
229 Ga0105248_10173476 3300009177 Bacteria 2430
230 Ga0105237_10011108 3300009545 Bacteria 9545
231 Ga0105237_10070367 3300009545 Bacteria 3495
232 Ga0105237_10193479 3300009545 Bacteria 2033
233 Ga0105238_10054694 3300009551 Bacteria 4007
234 Ga0105238_10081168 3300009551 Bacteria 3232
235 Ga0105249_10000215 3300009553 Bacteria 66439
236 Ga0105249_10039083 3300009553 Bacteria 4307
237 Ga0099796_10041257 3300010159 Bacteria 1562
238 Ga0105239_10048716 3300010375 Bacteria 4646
239 Ga0105239_10093337 3300010375 Bacteria 3323
240 Ga0105239_10177717 3300010375 Bacteria 2381
241 Ga0105246_10000019 3300011119 Bacteria 62666
242 Ga0157341_1002143 3300012494 Bacteria 1273
243 Ga0157369_10063474 3300013105 Bacteria 3979
244 Ga0157369_10344918 3300013105 Bacteria 1547
245 Ga0157374_10001742 3300013296 Bacteria 18255
246 Ga0157374_10065644 3300013296 Bacteria 3409
247 Ga0157374_10147067 3300013296 Bacteria 2289
248 Ga0157378_10002701 3300013297 Bacteria 15807
249 Ga0157378_10054488 3300013297 Bacteria 3560
250 Ga0163162_10001187 3300013306 Bacteria 24299
251 Ga0163162_10173415 3300013306 Bacteria 2281
252 Ga0157372_10123858 3300013307 Bacteria 2971
253 Ga0157375_10000135 3300013308 Bacteria 73281
254 Ga0157375_10010957 3300013308 Bacteria 7996
255 Ga0157375_10038137 3300013308 Bacteria 4611
256 Ga0157375_10121543 3300013308 Bacteria 2721
257 Ga0163163_10019264 3300014325 Bacteria 6406
258 Ga0163163_10027015 3300014325 Bacteria 5493
259 Ga0163163_10077956 3300014325 Bacteria 3309
260 Ga0157380_10000284 3300014326 Bacteria 30507
261 Ga0157377_10000507 3300014745 Bacteria 16565
262 Ga0157377_10108988 3300014745 Bacteria 1662
263 Ga0157377_10129703 3300014745 Unclassified 1538
264 Ga0157379_10000065 3300014968 Bacteria 67475
265 Ga0157379_10075984 3300014968 Bacteria 3008
266 Ga0157376_10000180 3300014969 Bacteria 43524
267 Ga0157376_10047121 3300014969 Bacteria 3558
268 Ga0163161_10001579 3300017792 Bacteria 16787
269 Ga0213876_10007223 3300021384 Bacteria 6056
270 Ga0213876_10055125 3300021384 Bacteria 2099
271 Ga0213876_10065862 3300021384 Bacteria 1912
272 Ga0213875_10000036 3300021388 Bacteria 166707
273 Ga0213875_10004891 3300021388 Bacteria 7273
274 Ga0213875_10005259 3300021388 Bacteria 6970
275 Ga0213875_10015816 3300021388 Bacteria 3667
276 Ga0207666_1000078 3300025271 Bacteria 16262
277 Ga0207673_1000034 3300025290 Bacteria 10698
278 Ga0209758_1003891 3300025297 Bacteria 13061
279 Ga0207697_10000370 3300025315 Bacteria 25198
280 Ga0207697_10045516 3300025315 Bacteria 1806
281 Ga0207653_10001699 3300025885 Bacteria 7037
282 Ga0207682_10000304 3300025893 Bacteria 22182
283 Ga0207682_10002800 3300025893 Bacteria 7711
284 Ga0207642_10000268 3300025899 Bacteria 15628
285 Ga0207710_10003846 3300025900 Bacteria 6638
286 Ga0207710_10047245 3300025900 Bacteria 1924
287 Ga0207710_10070181 3300025900 Bacteria 1605
288 Ga0207688_10000014 3300025901 Bacteria 59269
289 Ga0207688_10069237 3300025901 Bacteria 1999
290 Ga0207680_10019425 3300025903 Bacteria 3634
291 Ga0207680_10038238 3300025903 Bacteria 2777
292 Ga0207647_10004406 3300025904 Bacteria 10441
293 Ga0207645_10000160 3300025907 Bacteria 53155
294 Ga0207645_10032983 3300025907 Bacteria 3329
295 Ga0207643_10000009 3300025908 Bacteria 160496
296 Ga0207643_10050960 3300025908 Bacteria 2349
297 Ga0207705_10147461 3300025909 Bacteria 1761
298 Ga0207654_10000441 3300025911 Bacteria 23641
299 Ga0207707_10000554 3300025912 Bacteria 37851
300 Ga0207707_10009645 3300025912 Bacteria 8375
301 Ga0207695_10066763 3300025913 Bacteria 3692
302 Ga0207693_10015698 3300025915 Bacteria 6069
303 Ga0207693_10017770 3300025915 Bacteria 5671
304 Ga0207663_10148101 3300025916 Bacteria 1643
305 Ga0207660_10000161 3300025917 Bacteria 41972
306 Ga0207660_10005267 3300025917 Bacteria 8408
307 Ga0207660_10022608 3300025917 Bacteria 4238
308 Ga0207660_10176321 3300025917 Bacteria 1657
309 Ga0207660_10198592 3300025917 Bacteria 1566
310 Ga0207662_10001185 3300025918 Bacteria 12405
311 Ga0207657_10000980 3300025919 Bacteria 30300
312 Ga0207657_10010318 3300025919 Bacteria 9328
313 Ga0207657_10013878 3300025919 Bacteria 7884
314 Ga0207657_10033674 3300025919 Bacteria 4615
315 Ga0207657_10100903 3300025919 Bacteria 2396
316 Ga0207649_10000429 3300025920 Bacteria 30596
317 Ga0207652_10000364 3300025921 Bacteria 47007
318 Ga0207652_10092491 3300025921 Bacteria 2660
319 Ga0207652_10165419 3300025921 Bacteria 1983
320 Ga0207681_10000035 3300025923 Bacteria 161792
321 Ga0207681_10105436 3300025923 Bacteria 2041
322 Ga0207694_10089868 3300025924 Bacteria 2423
323 Ga0207650_10002514 3300025925 Bacteria 12729
324 Ga0207650_10032463 3300025925 Bacteria 3777
325 Ga0207659_10000027 3300025926 Bacteria 135454
326 Ga0207659_10038139 3300025926 Bacteria 3340
327 Ga0207687_10000551 3300025927 Bacteria 25176
328 Ga0207687_10017370 3300025927 Bacteria 4736
329 Ga0207687_10075011 3300025927 Bacteria 2426
330 Ga0207700_10004694 3300025928 Bacteria 8096
331 Ga0207664_10109439 3300025929 Bacteria 2296
332 Ga0207644_10027089 3300025931 Bacteria 3957
333 Ga0207644_10099165 3300025931 Bacteria 2185
334 Ga0207690_10000056 3300025932 Bacteria 101387
335 Ga0207706_10000307 3300025933 Bacteria 52944
336 Ga0207706_10035216 3300025933 Bacteria 4452
337 Ga0207686_10001402 3300025934 Bacteria 13707
338 Ga0207709_10000087 3300025935 Bacteria 155019
339 Ga0207709_10048524 3300025935 Bacteria 2587
340 Ga0207670_10000263 3300025936 Bacteria 32926
341 Ga0207670_10142421 3300025936 Bacteria 1769
342 Ga0207670_10145345 3300025936 Bacteria 1753
343 Ga0207669_10000052 3300025937 Bacteria 58284
344 Ga0207669_10001043 3300025937 Bacteria 11828
345 Ga0207704_10000063 3300025938 Bacteria 74699
346 Ga0207665_10000631 3300025939 Bacteria 23652
347 Ga0207691_10000167 3300025940 Bacteria 60999
348 Ga0207691_10015648 3300025940 Bacteria 7209
349 Ga0207711_10003718 3300025941 Bacteria 13149
350 Ga0207711_10016598 3300025941 Bacteria 6115
351 Ga0207711_10091108 3300025941 Bacteria 2681
352 Ga0207711_10112257 3300025941 Bacteria 2425
353 Ga0207689_10000155 3300025942 Bacteria 59178
354 Ga0207689_10026648 3300025942 Bacteria 4842
355 Ga0207661_10000072 3300025944 Bacteria 69126
356 Ga0207679_10000057 3300025945 Bacteria 104912
357 Ga0207679_10022611 3300025945 Bacteria 4284
358 Ga0207679_10209784 3300025945 Bacteria 1633
359 Ga0207667_10113025 3300025949 Bacteria 2800
360 Ga0207651_10000087 3300025960 Bacteria 41160
361 Ga0207712_10000122 3300025961 Bacteria 83730
362 Ga0207712_10048341 3300025961 Bacteria 2959
363 Ga0207668_10000084 3300025972 Bacteria 70850
364 Ga0207668_10137350 3300025972 Bacteria 1875
365 Ga0207640_10000878 3300025981 Bacteria 17041
366 Ga0207658_10004557 3300025986 Bacteria 9613
367 Ga0207658_10066439 3300025986 Bacteria 2713
368 Ga0207677_10000549 3300026023 Bacteria 23737
369 Ga0207703_10005829 3300026035 Bacteria 9867
370 Ga0207639_10001925 3300026041 Bacteria 13946
371 Ga0207639_10047666 3300026041 Bacteria 3240
372 Ga0207678_10000187 3300026067 Bacteria 53154
373 Ga0207678_10027526 3300026067 Bacteria 4961
374 Ga0207678_10283287 3300026067 Bacteria 1423
375 Ga0207708_10000158 3300026075 Bacteria 53154
376 Ga0207708_10002641 3300026075 Bacteria 13186
377 Ga0207702_10001960 3300026078 Bacteria 20035
378 Ga0207641_10000896 3300026088 Bacteria 31014
379 Ga0207648_10001167 3300026089 Bacteria 29390
380 Ga0207648_10073603 3300026089 Bacteria 2977
381 Ga0207676_10000089 3300026095 Bacteria 82462
382 Ga0207676_10017237 3300026095 Bacteria 5234
383 Ga0207674_10001478 3300026116 Bacteria 30348
384 Ga0207675_100000229 3300026118 Bacteria 52966
385 Ga0207675_100035022 3300026118 Bacteria 4682
386 Ga0207675_100096224 3300026118 Bacteria 2787
387 Ga0207675_100232617 3300026118 Bacteria 1778
388 Ga0207683_10000525 3300026121 Bacteria 35508
389 Ga0207683_10012130 3300026121 Bacteria 7358
390 Ga0207683_10013329 3300026121 Bacteria 7009
391 Ga0207683_10093760 3300026121 Bacteria 2675
392 Ga0207698_10079904 3300026142 Bacteria 2632
393 Ga0209966_1004655 3300027695 Bacteria 2333
394 Ga0209998_10001626 3300027717 Bacteria 5388
395 Ga0209998_10008350 3300027717 Bacteria 2145
396 Ga0209813_10008028 3300027866 Bacteria 2652
397 Ga0209974_10003008 3300027876 Bacteria 6101
398 Ga0207428_10000037 3300027907 Bacteria 218857
399 Ga0207428_10000308 3300027907 Bacteria 64810
400 Ga0207428_10000474 3300027907 Bacteria 48360
401 Ga0207428_10004340 3300027907 Bacteria 13544
402 Ga0207428_10082981 3300027907 Bacteria 2500
403 Ga0207428_10285985 3300027907 Bacteria 1223
404 Ga0268266_10027053 3300028379 Bacteria 4880
405 Ga0268265_10000195 3300028380 Bacteria 70871
406 Ga0268264_10000526 3300028381 Bacteria 48503
407 Ga0265318_10026921 3300028577 Bacteria 2263
408 Ga0265330_10003043 3300031235 Bacteria 8895
409 Ga0265325_10000736 3300031241 Bacteria 23678
410 Ga0265325_10002965 3300031241 Bacteria 11271
411 Ga0265325_10059395 3300031241 Bacteria 1944
412 Ga0265340_10007723 3300031247 Bacteria 5833
413 Ga0265340_10030040 3300031247 Bacteria 2726
414 Ga0265340_10038107 3300031247 Bacteria 2379
415 Ga0265340_10054756 3300031247 Unclassified 1923
416 Ga0265339_10002683 3300031249 Bacteria 12647
417 Ga0265339_10005391 3300031249 Bacteria 8520
418 Ga0265316_10028411 3300031344 Bacteria 4615
419 Ga0265313_10000686 3300031595 Bacteria 34918
420 Ga0265313_10002425 3300031595 Bacteria 16114
421 Ga0265313_10034340 3300031595 Bacteria 2566
422 Ga0265313_10041281 3300031595 Bacteria 2275
423 Ga0265314_10003780 3300031711 Bacteria 14466
424 Ga0265342_10000940 3300031712 Bacteria 28973
425 Ga0265342_10029185 3300031712 Bacteria 3427
426 Ga0307516_10170409 3300031730 Bacteria 1918
427 Ga0307416_100110063 3300032002 Bacteria 2425
428 Ga0316583_10000161 3300032133 Bacteria 16491
429 Ga0373930_0000020 3300034816 Bacteria 15356
430 Ga0373948_0007286 3300034817 Bacteria 1857
431 Ga0373958_0000533 3300034819 Bacteria 4759
432 Ga0373938_0000748 3300034957 Bacteria 5254
433 Ga0373938_0003083 3300034957 Bacteria 2703
434 Ga0373938_0010826 3300034957 Bacteria 1685
435 Ga0373926_0026868 3300035083 Bacteria 2015
436 Ga0373928_0001398 3300035084 Bacteria 4709
437 Ga0373929_0001728 3300035085 Bacteria 4107
438 Ga0373929_0023497 3300035085 Bacteria 1267
439 Ga0373940_0012281 3300035088 Bacteria 2050
440 Ga0373944_0022038 3300035089 Bacteria 1849
441 Ga0373949_0001003 3300035090 Bacteria 8717
442 Ga0373951_0000547 3300035091 Bacteria 10574
443 Ga0373952_0000114 3300035092 Bacteria 10971
444 Ga0373952_0000713 3300035092 Bacteria 5943
445 Ga0373952_0011513 3300035092 Bacteria 1727
446 Ga0373923_0026514 3300035111 Unclassified 2306
447 Ga0373923_0027294 3300035111 Bacteria 2277
448 Ga0373932_0001186 3300035112 Bacteria 7459
449 Ga0373932_0002300 3300035112 Bacteria 4857
450 Ga0373936_0044291 3300035113 Bacteria 1790
451 Ga0373939_0000261 3300035114 Bacteria 14162
452 Ga0373939_0000360 3300035114 Bacteria 11493
453 Ga0373939_0015309 3300035114 Bacteria 2005
454 Ga0373939_0026560 3300035114 Bacteria 1633
455 Ga0373939_0026739 3300035114 Bacteria 1629
456 Ga0373941_0001573 3300035115 Bacteria 4850
457 Ga0373941_0003505 3300035115 Bacteria 3560
458 Ga0373945_0014921 3300035116 Unclassified 2608
459 Ga0373953_0001943 3300035117 Bacteria 6145
460 Ga0373954_0009797 3300035118 Bacteria 4217
461 Ga0373954_0106355 3300035118 Bacteria 1355
462 Ga0373956_0011124 3300035119 Bacteria 3705
463 Ga0373960_0005720 3300035121 Bacteria 2889
464 Ga0373943_0026319 3300035170 Bacteria 2724
465 Ga0373943_0054850 3300035170 Bacteria 1972
466 Ga0373946_0001059 3300035171 Bacteria 9481
467 Ga0373946_0011634 3300035171 Bacteria 3288
468 Ga0373955_0010587 3300035172 Bacteria 4361
469 Ga0373942_0001477 3300035207 Bacteria 6050
470 Ga0373942_0021784 3300035207 Bacteria 1620
471 Ga0373961_0001845 3300035241 Bacteria 5795
472 Ga0373961_0016474 3300035241 Bacteria 1905
473 Ga0373961_0038048 3300035241 Bacteria 1377
474 Ga0373962_0000273 3300035242 Bacteria 11116
475 Ga0373962_0000354 3300035242 Bacteria 10085
476 Ga0373962_0002468 3300035242 Bacteria 4394
477 Ga0373962_0013630 3300035242 Bacteria 2061
478 Ga0373931_0000082 3300035691 Bacteria 44600
479 Ga0373931_0000349 3300035691 Bacteria 19042
480 Ga0373931_0004798 3300035691 Bacteria 6206
481 Ga0373931_0007665 3300035691 Bacteria 5092
482 Ga0373931_0010622 3300035691 Bacteria 4427
483 Ga0373931_0019726 3300035691 Bacteria 3368
484 Ga0373931_0169353 3300035691 Bacteria 1286
485 Ga0373935_0030470 3300035692 Bacteria 3344
486 Ga0373935_0235628 3300035692 Bacteria 1276
487 Ga0373927_0011970 3300035695 Bacteria 5772
488 Ga0373927_0027655 3300035695 Bacteria 3702
489 Ga0373933_0010438 3300035724 Bacteria 5091
490 Ga0373933_0031487 3300035724 Bacteria 3077
491 Ga0373947_0092400 3300035725 Bacteria 1889
492 Ga0373937_0005292 3300036401 Bacteria 11025
493 Ga0373937_0046004 3300036401 Bacteria 3989
494 Ga0373937_0059287 3300036401 Bacteria 3518
495 Ga0373925_0008940 3300037068 Bacteria 7298
496 Ga0395899_0043667 3300037312 Bacteria 3343
497 Ga0395900_0008255 3300037418 Bacteria 10721
498 Ga0395898_0011916 3300037466 Bacteria 9006
499 Ga0395898_0058574 3300037466 Bacteria 3749
500 Ga0436364_0042410 3300037853 Bacteria 5745
501 Ga0436364_1081807 3300037853 Bacteria 6043
502 Ga0436364_1438746 3300037853 Bacteria 6947
503 Ga0436364_1468088 3300037853 Bacteria 6606
504 Ga0436364_1519785 3300037853 Bacteria 1743
505 Ga0395901_0009281 3300038443 Bacteria 9972
506 Ga0395901_0014372 3300038443 Bacteria 8058
507 Ga0436365_0082040 3300039437 Bacteria 17561
508 Ga0436365_0111605 3300039437 Bacteria 1646
509 Ga0436365_0382370 3300039437 Bacteria 1426
510 Ga0436365_0681305 3300039437 Bacteria 60949
511 Ga0436365_1083195 3300039437 Bacteria 12022
512 Ga0436365_1821084 3300039437 Bacteria 3523
513 Ga0436360_0879832 3300039438 Bacteria 1534
514 Ga0436360_1377787 3300039438 Bacteria 7589
515 Ga0436363_0009391 3300039450 Bacteria 1360
516 Ga0436363_0161687 3300039450 Bacteria 12768
517 Ga0436363_1541908 3300039450 Bacteria 10722
518 Ga0436362_0162442 3300039453 Bacteria 2703
519 Ga0436362_0553154 3300039453 Bacteria 1768
520 Ga0439435_0001296 3300042436 Bacteria 4550
521 Ga0451577_0216659 3300042876 Bacteria 1730
522 Ga0466963_0012592 3300044694 Bacteria 5181
523 Ga0466957_0080562 3300044842 Bacteria 2027
524 Ga0451576_0324453 3300045051 Bacteria 1611
525 Ga0466967_0002811 3300045976 Bacteria 11040
526 Ga0495592_0007677 3300046454 Bacteria 8074
527 Ga0495592_0070656 3300046454 Bacteria 2542
528 Ga0495603_0021405 3300046455 Bacteria 3916
529 Ga0495603_0093763 3300046455 Bacteria 1754
530 Ga0495629_0000222 3300046459 Bacteria 50600
531 Ga0495629_0052056 3300046459 Bacteria 2865
532 Ga0495638_0012011 3300046460 Bacteria 5951
533 Ga0495653_0010023 3300046463 Bacteria 7752
534 Ga0495653_0023195 3300046463 Bacteria 5018
535 Ga0495653_0038994 3300046463 Bacteria 3725
536 Ga0495580_0053106 3300046472 Unclassified 2860
537 Ga0495582_0008516 3300046473 Bacteria 5657
538 Ga0495582_0046380 3300046473 Bacteria 2393
539 Ga0495639_0022264 3300046475 Bacteria 2779
540 Ga0495662_0009876 3300046476 Bacteria 4688
541 Ga0495662_0061554 3300046476 Bacteria 1813
542 Ga0495664_0003233 3300046477 Bacteria 8850
543 Ga0495664_0010134 3300046477 Bacteria 5287
544 Ga0495584_0062720 3300046491 Bacteria 1868
545 Ga0495585_0001425 3300046492 Bacteria 18789
546 Ga0495594_0017544 3300046499 Bacteria 3783
547 Ga0495607_0007148 3300046501 Bacteria 7759
548 Ga0495608_0002323 3300046511 Bacteria 13726
549 Ga0495618_0006486 3300046514 Bacteria 7103
550 Ga0495618_0038120 3300046514 Bacteria 3019
551 Ga0495628_0052569 3300046516 Bacteria 3217
552 Ga0495630_0022903 3300046517 Bacteria 4614
553 Ga0495630_0060675 3300046517 Bacteria 2839
554 Ga0495644_0036776 3300046523 Bacteria 1847
555 Ga0495663_0007802 3300046525 Bacteria 2960
556 Ga0495652_0039358 3300046529 Bacteria 4088
557 Ga0495652_0064234 3300046529 Unclassified 3088
558 Ga0495665_0003071 3300046531 Bacteria 9032
559 Ga0495640_0014607 3300046533 Bacteria 5934
560 Ga0495640_0019242 3300046533 Bacteria 5043
561 Ga0495586_0006088 3300046535 Bacteria 6450
562 Ga0495587_0006576 3300046536 Bacteria 7568
563 Ga0495587_0027102 3300046536 Bacteria 3490
564 Ga0495645_0042950 3300046543 Bacteria 3297
565 Ga0495645_0182476 3300046543 Unclassified 1436
566 Ga0495622_0030347 3300046557 Bacteria 2526
567 Ga0495633_0012776 3300046558 Bacteria 4451
568 Ga0495667_0002675 3300046559 Bacteria 11909
569 Ga0495667_0036283 3300046559 Bacteria 3291
570 Ga0495667_0045829 3300046559 Bacteria 2893
571 Ga0495656_0000262 3300046615 Bacteria 18537
572 Ga0495634_0247436 3300046642 Bacteria 1092
573 Ga0495611_0105796 3300046648 Bacteria 1308
574 Ga0495635_0002537 3300046663 Bacteria 12495
575 Ga0495635_0022257 3300046663 Bacteria 4414
576 Ga0495635_0026204 3300046663 Bacteria 4060
577 Ga0495659_0035550 3300046664 Bacteria 1756
578 Ga0495588_0096918 3300046674 Bacteria 1547
579 Ga0495588_0106132 3300046674 Bacteria 1478
580 Ga0495657_0004771 3300046675 Bacteria 10810
581 Ga0495599_0044497 3300046678 Unclassified 2784
582 Ga0495623_0001394 3300046679 Bacteria 16421
583 Ga0495646_0001135 3300046680 Bacteria 15537
584 Ga0495646_0005931 3300046680 Bacteria 7743
585 Ga0495647_0023826 3300046681 Bacteria 2223
586 Ga0495658_0000656 3300046683 Bacteria 18755
587 Ga0495658_0031947 3300046683 Bacteria 2871
588 Ga0495669_0042184 3300046684 Bacteria 2028
589 Ga0495613_0004890 3300046689 Bacteria 10065
590 Ga0495613_0104216 3300046689 Bacteria 2048
591 Ga0495624_0045764 3300046690 Bacteria 2784
592 Ga0495670_0001048 3300046691 Bacteria 13379
593 Ga0495589_0020646 3300046794 Bacteria 3369
594 Ga0495600_0000708 3300046809 Bacteria 17501
595 Ga0495600_0053589 3300046809 Unclassified 2634
596 Ga0495581_0051335 3300047315 Bacteria 2381
597 Ga0495604_0007332 3300047317 Bacteria 8734
598 Ga0495604_0055541 3300047317 Bacteria 3052
599 Ga0495604_0085072 3300047317 Unclassified 2360
600 Ga0495674_0002023 3300047319 Bacteria 19947
601 Ga0495674_0012846 3300047319 Bacteria 7886
602 Ga0495674_0034748 3300047319 Bacteria 4555
603 Ga0495680_0005048 3300047322 Bacteria 12467
604 Ga0495680_0009889 3300047322 Bacteria 8550
605 Ga0495680_0036049 3300047322 Bacteria 3976
606 Ga0495680_0075886 3300047322 Bacteria 2550
607 Ga0495680_0082645 3300047322 Bacteria 2423
608 Ga0495675_0003495 3300047444 Bacteria 9466
609 Ga0495685_023674 3300047447 Bacteria 2115
610 Ga0495684_0034946 3300047471 Unclassified 3856
611 Ga0495684_0039323 3300047471 Bacteria 3625
612 Ga0495684_0100293 3300047471 Bacteria 2189
613 Ga0495593_0027256 3300047673 Unclassified 3146
614 Ga0495614_0005475 3300048089 Bacteria 5723
615 Ga0496100_0000189 3300048903 Bacteria 34151
616 Ga0496100_0003289 3300048903 Bacteria 8406
617 Ga0496100_0056512 3300048903 Bacteria 2568
618 Ga0496100_0241831 3300048903 Bacteria 1332
619 Ga0496101_0000367 3300048904 Bacteria 29989
620 Ga0496101_0006104 3300048904 Bacteria 7738
621 Ga0496101_0025023 3300048904 Bacteria 4138
622 Ga0496101_0042260 3300048904 Bacteria 3253
623 Ga0496101_0083363 3300048904 Bacteria 2366
624 Ga0496101_0154907 3300048904 Bacteria 1755
625 Ga0496102_0005220 3300048905 Bacteria 11029
626 Ga0496102_0033628 3300048905 Bacteria 4608
627 Ga0496102_0175045 3300048905 Bacteria 2020
628 Ga0496102_0355312 3300048905 Bacteria 1379
629 Ga0496103_0000191 3300048906 Bacteria 61198
630 Ga0496103_0017260 3300048906 Bacteria 4318
631 Ga0496103_0062818 3300048906 Bacteria 2312
632 Ga0496103_0145580 3300048906 Bacteria 1516
633 Ga0496104_0001732 3300048907 Bacteria 18840
634 Ga0496104_0007873 3300048907 Bacteria 9448
635 Ga0496104_0012704 3300048907 Bacteria 7584
636 Ga0496104_0024056 3300048907 Bacteria 5605
637 Ga0496104_0040580 3300048907 Bacteria 4363
638 Ga0496104_0116753 3300048907 Bacteria 2561
639 Ga0496104_0120100 3300048907 Bacteria 2523
640 Ga0496104_0245885 3300048907 Bacteria 1701
641 Ga0496104_0266899 3300048907 Bacteria 1624
642 Ga0496105_0005921 3300048908 Bacteria 9329
643 Ga0496105_0006935 3300048908 Bacteria 8725
644 Ga0496105_0027857 3300048908 Bacteria 4620
645 Ga0496105_0065949 3300048908 Bacteria 2988
646 Ga0496105_0190767 3300048908 Bacteria 1675
647 Ga0496105_0207117 3300048908 Bacteria 1599
648 Ga0496106_0000736 3300048909 Bacteria 23593
649 Ga0496106_0006742 3300048909 Bacteria 8505
650 Ga0496106_0022228 3300048909 Bacteria 4711
651 Ga0496106_0050896 3300048909 Bacteria 3122
652 Ga0496107_0000080 3300048910 Bacteria 46272
653 Ga0496107_0009754 3300048910 Bacteria 6658
654 Ga0496107_0020206 3300048910 Bacteria 4702
655 Ga0496107_0080633 3300048910 Bacteria 2373
656 Ga0496108_0004997 3300048911 Bacteria 10716
657 Ga0496108_0011343 3300048911 Bacteria 7243
658 Ga0496108_0013886 3300048911 Bacteria 6569
659 Ga0496108_0056745 3300048911 Bacteria 3291
660 Ga0496108_0143255 3300048911 Bacteria 2059
661 Ga0496108_0213679 3300048911 Bacteria 1674
662 Ga0496109_0000737 3300048912 Bacteria 27192
663 Ga0496109_0004059 3300048912 Bacteria 12236
664 Ga0496109_0012672 3300048912 Bacteria 7286
665 Ga0496109_0014904 3300048912 Bacteria 6765
666 Ga0496109_0071671 3300048912 Bacteria 3182
667 Ga0496109_0184503 3300048912 Bacteria 1960
668 Ga0496110_0004764 3300048913 Bacteria 10568
669 Ga0496110_0008628 3300048913 Bacteria 8208
670 Ga0496110_0053052 3300048913 Bacteria 3563
671 Ga0496110_0059722 3300048913 Bacteria 3362
672 Ga0496110_0095102 3300048913 Bacteria 2668
673 Ga0496110_0128793 3300048913 Bacteria 2284
674 Ga0496110_0209328 3300048913 Bacteria 1773
675 Ga0496111_0054930 3300048914 Bacteria 2880
676 Ga0496112_0005238 3300048915 Bacteria 11164
677 Ga0496112_0006007 3300048915 Bacteria 10597
678 Ga0496112_0011317 3300048915 Bacteria 8139
679 Ga0496112_0085596 3300048915 Bacteria 3119
680 Ga0496112_0140628 3300048915 Bacteria 2383
681 Ga0496112_0214508 3300048915 Bacteria 1881
682 Ga0496113_0000721 3300048916 Bacteria 16927
683 Ga0496113_0070468 3300048916 Bacteria 2657
684 Ga0496113_0125918 3300048916 Bacteria 2006
685 Ga0496114_0007885 3300048917 Bacteria 8425
686 Ga0496114_0012419 3300048917 Bacteria 6816
687 Ga0496114_0081237 3300048917 Bacteria 2738
688 Ga0496114_0157848 3300048917 Bacteria 1970
689 Ga0496115_0009214 3300048918 Bacteria 7328
690 Ga0496115_0011820 3300048918 Bacteria 6558
691 Ga0496115_0022768 3300048918 Bacteria 4857
692 Ga0496115_0054167 3300048918 Bacteria 3220
693 Ga0496115_0090169 3300048918 Bacteria 2504
694 Ga0496115_0142283 3300048918 Bacteria 1979
695 Ga0496115_0268068 3300048918 Bacteria 1403
696 Ga0496115_0293172 3300048918 Bacteria 1334
697 Ga0496126_0082271 3300048929 Bacteria 2845
698 Ga0501032_0075038 3300049569 Bacteria 2252
699 Ga0501032_0078917 3300049569 Bacteria 2192
700 Ga0501033_0009844 3300049570 Bacteria 7335
701 Ga0501033_0013241 3300049570 Bacteria 6285
702 Ga0501033_0043223 3300049570 Unclassified 3357
703 Ga0501033_0143541 3300049570 Bacteria 1725
704 Ga0501034_0000179 3300049571 Bacteria 118832
705 Ga0501034_0114814 3300049571 Bacteria 2681
706 Ga0501036_0006144 3300049572 Bacteria 9743
707 Ga0501036_0092711 3300049572 Unclassified 2552
708 Ga0501036_0403367 3300049572 Bacteria 1140
709 Ga0501037_0013431 3300049573 Bacteria 6031
710 Ga0501037_0018756 3300049573 Bacteria 5098
711 Ga0501037_0179169 3300049573 Unclassified 1504
712 Ga0501038_0094084 3300049574 Bacteria 2505
713 Ga0501038_0191730 3300049574 Bacteria 1644
714 Ga0501038_0199287 3300049574 Bacteria 1607
715 Ga0501039_0020089 3300049575 Bacteria 5120
716 Ga0501040_0030724 3300049576 Plasmid 3629
717 Ga0501041_0017371 3300049577 Unclassified 4282
718 Ga0501041_0046816 3300049577 Bacteria 2632
719 Ga0501043_0002639 3300049579 Bacteria 15071
720 Ga0501043_0106904 3300049579 Bacteria 2197
721 Ga0501043_0141756 3300049579 Bacteria 1882
722 Ga0501046_0016711 3300049580 Bacteria 6138
723 Ga0501046_0064687 3300049580 Bacteria 2855
724 Ga0501046_0066331 3300049580 Bacteria 2813
725 Ga0501046_0087289 3300049580 Unclassified 2404
726 Ga0501046_0227714 3300049580 Bacteria 1378
727 Ga0501047_0000179 3300049581 Bacteria 77520
728 Ga0501047_0021161 3300049581 Bacteria 6246
729 Ga0501047_0033499 3300049581 Bacteria 4959
730 Ga0501047_0218050 3300049581 Bacteria 1764
731 Ga0501047_0293072 3300049581 Bacteria 1471
732 Ga0501047_0420676 3300049581 Bacteria 1167
733 Ga0501048_0000186 3300049582 Bacteria 39708
734 Ga0501048_0029390 3300049582 Bacteria 3986
735 Ga0501048_0110234 3300049582 Unclassified 1943
736 Ga0501067_0058527 3300049583 Bacteria 2134
737 Ga0501068_0001337 3300049584 Bacteria 13064
738 Ga0501068_0003407 3300049584 Bacteria 8553
739 Ga0501068_0143718 3300049584 Bacteria 1496
740 Ga0501069_0001008 3300049585 Bacteria 13412
741 Ga0501069_0032140 3300049585 Bacteria 2888
742 Ga0501069_0048727 3300049585 Bacteria 2353
743 Ga0501069_0112231 3300049585 Bacteria 1553
744 Ga0501070_0010383 3300049586 Bacteria 7871
745 Ga0501070_0013337 3300049586 Bacteria 6931
746 Ga0501070_0014762 3300049586 Bacteria 6572
747 Ga0501070_0061304 3300049586 Bacteria 3116
748 Ga0501070_0095375 3300049586 Bacteria 2461
749 Ga0501070_0233838 3300049586 Bacteria 1505
750 Ga0501070_0265012 3300049586 Bacteria 1404
751 Ga0501070_0334450 3300049586 Bacteria 1230
752 Ga0501071_0003435 3300049587 Bacteria 9896
753 Ga0501071_0111296 3300049587 Bacteria 2024
754 Ga0501072_0004155 3300049588 Bacteria 10962
755 Ga0501072_0018948 3300049588 Bacteria 5312
756 Ga0501072_0151952 3300049588 Bacteria 1846
757 Ga0501072_0270645 3300049588 Bacteria 1352
758 Ga0501073_0031790 3300049589 Bacteria 3765
759 Ga0501073_0040224 3300049589 Bacteria 3310
760 Ga0501073_0094157 3300049589 Bacteria 2080
761 Ga0501074_0007477 3300049590 Bacteria 7903
762 Ga0501074_0057800 3300049590 Bacteria 2794
763 Ga0501075_0041152 3300049591 Plasmid 3462
764 Ga0501076_0033449 3300049592 Plasmid 4014
765 Ga0501077_0008142 3300049593 Bacteria 6480
766 Ga0501077_0090259 3300049593 Unclassified 1942
767 Ga0501079_0024207 3300049741 Plasmid 4660
768 Ga0501079_0029459 3300049741 Bacteria 4215
769 Ga0501080_0003746 3300049742 Bacteria 13425
770 Ga0501080_0017590 3300049742 Bacteria 6611
771 Ga0501080_0045771 3300049742 Bacteria 4073
772 Ga0501080_0091199 3300049742 Bacteria 2830
773 Ga0501080_0096237 3300049742 Bacteria 2748
774 Ga0501080_0181325 3300049742 Unclassified 1937
775 Ga0501081_0004954 3300049743 Bacteria 8565
776 Ga0501083_0000655 3300049744 Bacteria 22415
777 Ga0501083_0006706 3300049744 Bacteria 8171
778 Ga0501083_0094598 3300049744 Bacteria 1972
779 Ga0501035_0006782 3300049822 Bacteria 10702
780 Ga0501035_0081040 3300049822 Bacteria 2865
781 Ga0501035_0119352 3300049822 Bacteria 2306
782 Ga0501035_0222207 3300049822 Bacteria 1612
783 Ga0501044_0001177 3300049823 Bacteria 30995
784 Ga0501044_0031038 3300049823 Bacteria 5626
785 Ga0501044_0031595 3300049823 Bacteria 5572
786 Ga0501044_0099079 3300049823 Bacteria 2933
787 Ga0501044_0121121 3300049823 Bacteria 2617
788 Ga0501044_0127448 3300049823 Bacteria 2542
789 Ga0501044_0130313 3300049823 Bacteria 2509
790 Ga0501044_0145055 3300049823 Bacteria 2360
791 Ga0501044_0170873 3300049823 Bacteria 2145
792 Ga0501044_0194393 3300049823 Bacteria 1989
793 Ga0501044_0266306 3300049823 Bacteria 1651
794 Ga0501045_0010460 3300049824 Bacteria 6497
795 nmdc:mga03683_30152_c1 3300050489 Bacteria 2169
796 nmdc:mga03n38_5935_c1 3300050490 Bacteria 4200
797 nmdc:mga00v17_7308_c1 3300050491 Bacteria 5887
798 nmdc:mga0yw44_4151_c1 3300050492 Bacteria 6582
799 nmdc:mga0k408_58227_c1 3300050493 Bacteria 2244
800 nmdc:mga06z11_377_c1 3300050494 Bacteria 16781
801 nmdc:mga05p37_125683_c1 3300050507 Bacteria 3149
802 nmdc:mga05p37_18_c1 3300050507 Bacteria 128997
803 nmdc:mga05p37_217936_c1 3300050507 Bacteria 2304
804 nmdc:mga05p37_46780_c1 3300050507 Bacteria 5320
805 nmdc:mga05p37_47186_c1 3300050507 Bacteria 5297
806 nmdc:mga05p37_53401_c1 3300050507 Bacteria 4969
807 nmdc:mga05p37_5632_c1 3300050507 Bacteria 14723
808 nmdc:mga05p37_83478_c1 3300050507 Bacteria 3936
809 nmdc:mga09592_1148_c1 3300050508 Bacteria 21118
810 nmdc:mga09592_2614_c1 3300050508 Bacteria 14574
811 nmdc:mga09592_78382_c1 3300050508 Bacteria 2812
812 nmdc:mga0qj67_2133_c1 3300050509 Bacteria 14087
813 nmdc:mga0qj67_3210_c1 3300050509 Bacteria 11775
814 nmdc:mga06r32_1490_c1 3300050510 Bacteria 21045
815 nmdc:mga06r32_28343_c1 3300050510 Bacteria 5239
816 nmdc:mga06r32_42116_c1 3300050510 Bacteria 4341
817 nmdc:mga06r32_4222_c1 3300050510 Bacteria 12874
818 nmdc:mga06r32_79315_c1 3300050510 Bacteria 3194
819 nmdc:mga08y16_13723_c1 3300050511 Bacteria 8530
820 nmdc:mga08y16_373179_c1 3300050511 Bacteria 1463
821 nmdc:mga08y16_46145_c1 3300050511 Bacteria 4563
822 nmdc:mga08y16_738_c1 3300050511 Bacteria 31085
823 nmdc:mga0n895_11497_c1 3300050512 Bacteria 7900
824 nmdc:mga0n895_15640_c1 3300050512 Bacteria 6928
825 nmdc:mga0n895_315183_c1 3300050512 Bacteria 1585
826 nmdc:mga0n895_3959_c1 3300050512 Bacteria 12040
827 nmdc:mga0n895_50746_c1 3300050512 Bacteria 4068
828 nmdc:mga0n895_562_c1 3300050512 Bacteria 25458
829 nmdc:mga0n895_76804_c1 3300050512 Unclassified 3321
830 nmdc:mga0n895_842_c1 3300050512 Bacteria 22003
831 nmdc:mga0rr50_13949_c1 3300050513 Bacteria 5251
832 nmdc:mga0rr50_16284_c1 3300050513 Bacteria 4933
833 nmdc:mga0rr50_28329_c1 3300050513 Bacteria 3936
834 nmdc:mga0rr50_55666_c1 3300050513 Bacteria 2952
835 nmdc:mga0rr50_67088_c1 3300050513 Bacteria 2724
836 nmdc:mga0a205_1040_c1 3300050515 Bacteria 23115
837 nmdc:mga0a205_10488_c1 3300050515 Bacteria 8513
838 nmdc:mga0a205_127895_c1 3300050515 Bacteria 2440
839 nmdc:mga0a205_1490_c1 3300050515 Bacteria 19971
840 nmdc:mga0a205_65303_c1 3300050515 Bacteria 3516
841 nmdc:mga0a205_78970_c1 3300050515 Bacteria 3179
842 Ga0495601_0012889 3300053077 Bacteria 5018
843 Ga0495601_0024831 3300053077 Bacteria 3691
844 Ga0495601_0063256 3300053077 Bacteria 2352
845 Ga0495612_0001058 3300053078 Bacteria 11257
846 Ga0495612_0007993 3300053078 Bacteria 4307
847 Ga0495612_0021372 3300053078 Unclassified 2596
848 Ga0495612_0032006 3300053078 Bacteria 2124
849 Ga0495595_0000762 3300053084 Bacteria 12239
850 Ga0495595_0018683 3300053084 Bacteria 2998
851 Ga0495595_0053418 3300053084 Bacteria 1877
852 Ga0495619_0000271 3300053085 Bacteria 37662
853 Ga0495619_0002564 3300053085 Bacteria 11890
854 Ga0495619_0007587 3300053085 Bacteria 6868
855 Ga0495619_0022184 3300053085 Bacteria 4060
856 Ga0495619_0033071 3300053085 Unclassified 3357
857 Ga0500643_002339 3300053087 Bacteria 9915
858 Ga0500644_0001151 3300053088 Bacteria 7690
859 Ga0500651_0001961 3300053093 Bacteria 10665
860 Ga0500577_0030480 3300053142 Bacteria 1879
861 Ga0500616_0000006 3300053153 Bacteria 944738
862 Ga0500616_0028465 3300053153 Bacteria 3079
863 Ga0500616_0043385 3300053153 Bacteria 2403
864 Ga0500645_000282 3300053730 Bacteria 36379
865 Ga0501084_0007143 3300054114 Bacteria 9199
866 Ga0501084_0018993 3300054114 Bacteria 5723
867 Ga0501084_0042646 3300054114 Bacteria 3795
868 Ga0501084_0127780 3300054114 Bacteria 2139
869 Ga0501082_0000046 3300060353 Bacteria 86307
870 Ga0501082_0007938 3300060353 Bacteria 9169
871 Ga0501082_0083677 3300060353 Bacteria 2753
872 Ga0501082_0102845 3300060353 Bacteria 2471
873 Ga0530510_0021090 3300061734 Plasmid 4636
874 2643756542 2643221547 Bacteria 4740017
875 2937844477 2937843397 Bacteria 5256375
876 Ga0501034_0194555
877 2214911850
878 ARcpr5oldR_c000028
879 ARSoilYngRDRAFT_c00197
880 ARcpr5yngRDRAFT_c000600
881 ARSoilOldRDRAFT_c000023
882 ARCol0oldRDRAFT_c00462
883 ARCol0yngRDRAFT_1000216
884 JGI24746J21847_1000047
885 JGI24739J22299_10000148
886 JGI24737J22298_10000458
887 JGI24737J22298_10003428
888 JGI24750J21931_1000011
889 JGI24745J21846_1000352
890 JGI24738J21930_10000236
891 JGI24749J21850_1000378
892 JGI24034J26672_10000483
893 JGI24742J22300_10000248
894 JGI25153J46596_10006082
895 JGI25404J52841_10002777
896 Ga0065712_10077915
897 Ga0065715_10088960
898 Ga0070658_10101492
899 Ga0070658_10163798
900 Ga0070676_10000536
901 Ga0070676_10096359
902 Ga0070683_100000144
903 Ga0070690_100028441
904 Ga0070670_100000437
905 Ga0070670_100284597
906 Ga0070677_10008501
907 Ga0068869_100000035
908 Ga0070666_10006881
909 Ga0070666_10033695
910 Ga0070680_100001482
911 Ga0070680_100081661
912 Ga0070682_100002219
913 Ga0070682_100013572
914 Ga0070660_100001344
915 Ga0070660_100008614
916 Ga0070660_100015576
917 Ga0070660_100018605
918 Ga0070660_100079997
919 Ga0070689_100011661
920 Ga0070689_100088268
921 Ga0070689_100198248
922 Ga0070691_10001234
923 Ga0070661_100000017
924 Ga0070661_100095415
925 Ga0070692_10000008
926 Ga0070692_10023193
927 Ga0070668_100000699
928 Ga0070668_100166882
929 Ga0070669_100000250
930 Ga0070675_100000246
931 Ga0070675_100086117
932 Ga0070671_100003025
933 Ga0070671_100053599
934 Ga0070674_100000355
935 Ga0070674_100003096
936 Ga0070673_100000032
937 Ga0070673_100128486
938 Ga0070688_100000669
939 Ga0070688_100048356
940 Ga0070659_100000214
941 Ga0070667_100000816
942 Ga0070667_100172263
943 Ga0070709_10008980
944 Ga0070714_100019217
945 Ga0070714_100124355
946 Ga0070710_10054171
947 Ga0070701_10000099
948 Ga0070705_100002586
949 Ga0070700_100000234
950 Ga0070694_100000247
951 Ga0070694_100071128
952 Ga0070663_100000201
953 Ga0070678_100003298
954 Ga0070678_100015051
955 Ga0070678_100015873
956 Ga0070678_100167147
957 Ga0070662_100009709
958 Ga0070662_100010369
959 Ga0070662_100034363
960 Ga0070662_100042269
961 Ga0070681_10000401
962 Ga0070681_10043121
963 Ga0070681_10066151
964 Ga0068867_100000190
965 Ga0068867_100182416
966 Ga0070685_10099511
967 Ga0070679_100000847
968 Ga0070679_100025113
969 Ga0070679_100095123
970 Ga0070679_100369821
971 Ga0070684_100000904
972 Ga0070684_100102582
973 Ga0070697_100022928
974 Ga0068853_100003019
975 Ga0070672_100000807
976 Ga0070672_100126358
977 Ga0070686_100037535
978 Ga0070695_100000406
979 Ga0070695_100011865
980 Ga0070696_100000304
981 Ga0070696_100215749
982 Ga0070693_100000546
983 Ga0070665_100020165
984 Ga0070704_100000385
985 Ga0070704_100003857
986 Ga0070704_100246707
987 Ga0068855_100019930
988 Ga0068855_100298209
989 Ga0070664_100000912
990 Ga0070664_100024388
991 Ga0070664_100249930
992 Ga0068857_100000494
993 Ga0068857_100299070
994 Ga0068854_100000139
995 Ga0068856_100005193
996 Ga0070702_100000177
997 Ga0070702_100011837
998 Ga0068852_100000193
999 Ga0068852_100258019
1000 Ga0068859_100022588
1001 Ga0068864_100000226
1002 Ga0068864_100031549
1003 Ga0068866_10000199
1004 Ga0068861_100000328
1005 Ga0068861_100050080
1006 Ga0068870_10000388
1007 Ga0068858_100096035
1008 Ga0068858_100101757
1009 Ga0068858_100302923
1010 Ga0068860_100001525
1011 Ga0068862_100000557
1012 Ga0081455_10000035
1013 Ga0081455_10000334
1014 Ga0081455_10001717
1015 Ga0081455_10002005
1016 Ga0081538_10045637
1017 Ga0081540_1000273
1018 Ga0081540_1000508
1019 Ga0081540_1010303
1020 Ga0081539_10002061
1021 Ga0070717_10003781
1022 Ga0070717_10031627
1023 Ga0075365_10008527
1024 Ga0075363_100000067
1025 Ga0075363_100004350
1026 Ga0075364_10001020
1027 Ga0075364_10003087
1028 Ga0075364_10159905
1029 Ga0070715_10022784
1030 Ga0070716_100037734
1031 Ga0070712_100037167
1032 Ga0070712_100197056
1033 Ga0075362_10014164
1034 Ga0075367_10007937
1035 Ga0075369_10026510
1036 Ga0075366_10000504
1037 Ga0075366_10019642
1038 Ga0097621_100000049
1039 Ga0097621_100103906
1040 Ga0068871_100000097
1041 Ga0068871_100005912
1042 Ga0075428_100015574
1043 Ga0075428_100075915
1044 Ga0075428_100086529
1045 Ga0075430_100003545
1046 Ga0075431_100012917
1047 Ga0075431_100015952
1048 Ga0075431_100169438
1049 Ga0075433_10003238
1050 Ga0075433_10004405
1051 Ga0075433_10066986
1052 Ga0075433_10185132
1053 Ga0075434_100000383
1054 Ga0075434_100001135
1055 Ga0075434_100004943
1056 Ga0075434_100045346
1057 Ga0075434_100078639
1058 Ga0075434_100112130
1059 Ga0075434_100207516
1060 Ga0075429_100001354
1061 Ga0068865_100000119
1062 Ga0097620_100022587
1063 Ga0075435_100042204
1064 Ga0075435_100044400
1065 Ga0075435_100065845
1066 Ga0075435_100116724
1067 Ga0075435_100276198
1068 Ga0099794_10006887
1069 Ga0099795_10045896
1070 Ga0105251_10083889
1071 Ga0105240_10061307
1072 Ga0105240_10090342
1073 Ga0105240_10104261
1074 Ga0111539_10000237
1075 Ga0111539_10001512
1076 Ga0111539_10019347
1077 Ga0111539_10020456
1078 Ga0111539_10031942
1079 Ga0111539_10037394
1080 Ga0111539_10432102
1081 Ga0105245_10000202
1082 Ga0105245_10037311
1083 Ga0105245_10049439
1084 Ga0105247_10073689
1085 Ga0114129_10016815
1086 Ga0114129_10019143
1087 Ga0114129_10064911
1088 Ga0114129_10267543
1089 Ga0105243_10001790
1090 Ga0105243_10024923
1091 Ga0105243_10026091
1092 Ga0105243_10047764
1093 Ga0105243_10055631
1094 Ga0105241_10000430
1095 Ga0105241_10176529
1096 Ga0105242_10002429
1097 Ga0105242_10084693
1098 Ga0105242_10148172
1099 Ga0105242_10320902
1100 Ga0105248_10009999
1101 Ga0105248_10098539
1102 Ga0105248_10107382
1103 Ga0105248_10138471
1104 Ga0105248_10173476
1105 Ga0105237_10011108
1106 Ga0105237_10070367
1107 Ga0105237_10193479
1108 Ga0105238_10054694
1109 Ga0105238_10081168
1110 Ga0105249_10000215
1111 Ga0105249_10039083
1112 Ga0099796_10041257
1113 Ga0105239_10048716
1114 Ga0105239_10093337
1115 Ga0105239_10177717
1116 Ga0105246_10000019
1117 Ga0157341_1002143
1118 Ga0157369_10063474
1119 Ga0157369_10344918
1120 Ga0157374_10001742
1121 Ga0157374_10065644
1122 Ga0157374_10147067
1123 Ga0157378_10002701
1124 Ga0157378_10054488
1125 Ga0163162_10001187
1126 Ga0163162_10173415
1127 Ga0157372_10123858
1128 Ga0157375_10000135
1129 Ga0157375_10010957
1130 Ga0157375_10038137
1131 Ga0157375_10121543
1132 Ga0163163_10019264
1133 Ga0163163_10027015
1134 Ga0163163_10077956
1135 Ga0157380_10000284
1136 Ga0157377_10000507
1137 Ga0157377_10108988
1138 Ga0157377_10129703
1139 Ga0157379_10000065
1140 Ga0157379_10075984
1141 Ga0157376_10000180
1142 Ga0157376_10047121
1143 Ga0163161_10001579
1144 Ga0213876_10007223
1145 Ga0213876_10055125
1146 Ga0213876_10065862
1147 Ga0213875_10000036
1148 Ga0213875_10004891
1149 Ga0213875_10005259
1150 Ga0213875_10015816
1151 Ga0207666_1000078
1152 Ga0207673_1000034
1153 Ga0209758_1003891
1154 Ga0207697_10000370
1155 Ga0207697_10045516
1156 Ga0207653_10001699
1157 Ga0207682_10000304
1158 Ga0207682_10002800
1159 Ga0207642_10000268
1160 Ga0207710_10003846
1161 Ga0207710_10047245
1162 Ga0207710_10070181
1163 Ga0207688_10000014
1164 Ga0207688_10069237
1165 Ga0207680_10019425
1166 Ga0207680_10038238
1167 Ga0207647_10004406
1168 Ga0207645_10000160
1169 Ga0207645_10032983
1170 Ga0207643_10000009
1171 Ga0207643_10050960
1172 Ga0207705_10147461
1173 Ga0207654_10000441
1174 Ga0207707_10000554
1175 Ga0207707_10009645
1176 Ga0207695_10066763
1177 Ga0207693_10015698
1178 Ga0207693_10017770
1179 Ga0207663_10148101
1180 Ga0207660_10000161
1181 Ga0207660_10005267
1182 Ga0207660_10022608
1183 Ga0207660_10176321
1184 Ga0207660_10198592
1185 Ga0207662_10001185
1186 Ga0207657_10000980
1187 Ga0207657_10010318
1188 Ga0207657_10013878
1189 Ga0207657_10033674
1190 Ga0207657_10100903
1191 Ga0207649_10000429
1192 Ga0207652_10000364
1193 Ga0207652_10092491
1194 Ga0207652_10165419
1195 Ga0207681_10000035
1196 Ga0207681_10105436
1197 Ga0207694_10089868
1198 Ga0207650_10002514
1199 Ga0207650_10032463
1200 Ga0207659_10000027
1201 Ga0207659_10038139
1202 Ga0207687_10000551
1203 Ga0207687_10017370
1204 Ga0207687_10075011
1205 Ga0207700_10004694
1206 Ga0207664_10109439
1207 Ga0207644_10027089
1208 Ga0207644_10099165
1209 Ga0207690_10000056
1210 Ga0207706_10000307
1211 Ga0207706_10035216
1212 Ga0207686_10001402
1213 Ga0207709_10000087
1214 Ga0207709_10048524
1215 Ga0207670_10000263
1216 Ga0207670_10142421
1217 Ga0207670_10145345
1218 Ga0207669_10000052
1219 Ga0207669_10001043
1220 Ga0207704_10000063
1221 Ga0207665_10000631
1222 Ga0207691_10000167
1223 Ga0207691_10015648
1224 Ga0207711_10003718
1225 Ga0207711_10016598
1226 Ga0207711_10091108
1227 Ga0207711_10112257
1228 Ga0207689_10000155
1229 Ga0207689_10026648
1230 Ga0207661_10000072
1231 Ga0207679_10000057
1232 Ga0207679_10022611
1233 Ga0207679_10209784
1234 Ga0207667_10113025
1235 Ga0207651_10000087
1236 Ga0207712_10000122
1237 Ga0207712_10048341
1238 Ga0207668_10000084
1239 Ga0207668_10137350
1240 Ga0207640_10000878
1241 Ga0207658_10004557
1242 Ga0207658_10066439
1243 Ga0207677_10000549
1244 Ga0207703_10005829
1245 Ga0207639_10001925
1246 Ga0207639_10047666
1247 Ga0207678_10000187
1248 Ga0207678_10027526
1249 Ga0207678_10283287
1250 Ga0207708_10000158
1251 Ga0207708_10002641
1252 Ga0207702_10001960
1253 Ga0207641_10000896
1254 Ga0207648_10001167
1255 Ga0207648_10073603
1256 Ga0207676_10000089
1257 Ga0207676_10017237
1258 Ga0207674_10001478
1259 Ga0207675_100000229
1260 Ga0207675_100035022
1261 Ga0207675_100096224
1262 Ga0207675_100232617
1263 Ga0207683_10000525
1264 Ga0207683_10012130
1265 Ga0207683_10013329
1266 Ga0207683_10093760
1267 Ga0207698_10079904
1268 Ga0209966_1004655
1269 Ga0209998_10001626
1270 Ga0209998_10008350
1271 Ga0209813_10008028
1272 Ga0209974_10003008
1273 Ga0207428_10000037
1274 Ga0207428_10000308
1275 Ga0207428_10000474
1276 Ga0207428_10004340
1277 Ga0207428_10082981
1278 Ga0207428_10285985
1279 Ga0268266_10027053
1280 Ga0268265_10000195
1281 Ga0268264_10000526
1282 Ga0265318_10026921
1283 Ga0265330_10003043
1284 Ga0265325_10000736
1285 Ga0265325_10002965
1286 Ga0265325_10059395
1287 Ga0265340_10007723
1288 Ga0265340_10030040
1289 Ga0265340_10038107
1290 Ga0265340_10054756
1291 Ga0265339_10002683
1292 Ga0265339_10005391
1293 Ga0265316_10028411
1294 Ga0265313_10000686
1295 Ga0265313_10002425
1296 Ga0265313_10034340
1297 Ga0265313_10041281
1298 Ga0265314_10003780
1299 Ga0265342_10000940
1300 Ga0265342_10029185
1301 Ga0307516_10170409
1302 Ga0307416_100110063
1303 Ga0316583_10000161
1304 Ga0373930_0000020
1305 Ga0373948_0007286
1306 Ga0373958_0000533
1307 Ga0373938_0000748
1308 Ga0373938_0003083
1309 Ga0373938_0010826
1310 Ga0373926_0026868
1311 Ga0373928_0001398
1312 Ga0373929_0001728
1313 Ga0373929_0023497
1314 Ga0373940_0012281
1315 Ga0373944_0022038
1316 Ga0373949_0001003
1317 Ga0373951_0000547
1318 Ga0373952_0000114
1319 Ga0373952_0000713
1320 Ga0373952_0011513
1321 Ga0373923_0026514
1322 Ga0373923_0027294
1323 Ga0373932_0001186
1324 Ga0373932_0002300
1325 Ga0373936_0044291
1326 Ga0373939_0000261
1327 Ga0373939_0000360
1328 Ga0373939_0015309
1329 Ga0373939_0026560
1330 Ga0373939_0026739
1331 Ga0373941_0001573
1332 Ga0373941_0003505
1333 Ga0373945_0014921
1334 Ga0373953_0001943
1335 Ga0373954_0009797
1336 Ga0373954_0106355
1337 Ga0373956_0011124
1338 Ga0373960_0005720
1339 Ga0373943_0026319
1340 Ga0373943_0054850
1341 Ga0373946_0001059
1342 Ga0373946_0011634
1343 Ga0373955_0010587
1344 Ga0373942_0001477
1345 Ga0373942_0021784
1346 Ga0373961_0001845
1347 Ga0373961_0016474
1348 Ga0373961_0038048
1349 Ga0373962_0000273
1350 Ga0373962_0000354
1351 Ga0373962_0002468
1352 Ga0373962_0013630
1353 Ga0373931_0000082
1354 Ga0373931_0000349
1355 Ga0373931_0004798
1356 Ga0373931_0007665
1357 Ga0373931_0010622
1358 Ga0373931_0019726
1359 Ga0373931_0169353
1360 Ga0373935_0030470
1361 Ga0373935_0235628
1362 Ga0373927_0011970
1363 Ga0373927_0027655
1364 Ga0373933_0010438
1365 Ga0373933_0031487
1366 Ga0373947_0092400
1367 Ga0373937_0005292
1368 Ga0373937_0046004
1369 Ga0373937_0059287
1370 Ga0373925_0008940
1371 Ga0395899_0043667
1372 Ga0395900_0008255
1373 Ga0395898_0011916
1374 Ga0395898_0058574
1375 Ga0436364_0042410
1376 Ga0436364_1081807
1377 Ga0436364_1438746
1378 Ga0436364_1468088
1379 Ga0436364_1519785
1380 Ga0395901_0009281
1381 Ga0395901_0014372
1382 Ga0436365_0082040
1383 Ga0436365_0111605
1384 Ga0436365_0382370
1385 Ga0436365_0681305
1386 Ga0436365_1083195
1387 Ga0436365_1821084
1388 Ga0436360_0879832
1389 Ga0436360_1377787
1390 Ga0436363_0009391
1391 Ga0436363_0161687
1392 Ga0436363_1541908
1393 Ga0436362_0162442
1394 Ga0436362_0553154
1395 Ga0439435_0001296
1396 Ga0451577_0216659
1397 Ga0466963_0012592
1398 Ga0466957_0080562
1399 Ga0451576_0324453
1400 Ga0466967_0002811
1401 Ga0495592_0007677
1402 Ga0495592_0070656
1403 Ga0495603_0021405
1404 Ga0495603_0093763
1405 Ga0495629_0000222
1406 Ga0495629_0052056
1407 Ga0495638_0012011
1408 Ga0495653_0010023
1409 Ga0495653_0023195
1410 Ga0495653_0038994
1411 Ga0495580_0053106
1412 Ga0495582_0008516
1413 Ga0495582_0046380
1414 Ga0495639_0022264
1415 Ga0495662_0009876
1416 Ga0495662_0061554
1417 Ga0495664_0003233
1418 Ga0495664_0010134
1419 Ga0495584_0062720
1420 Ga0495585_0001425
1421 Ga0495594_0017544
1422 Ga0495607_0007148
1423 Ga0495608_0002323
1424 Ga0495618_0006486
1425 Ga0495618_0038120
1426 Ga0495628_0052569
1427 Ga0495630_0022903
1428 Ga0495630_0060675
1429 Ga0495644_0036776
1430 Ga0495663_0007802
1431 Ga0495652_0039358
1432 Ga0495652_0064234
1433 Ga0495665_0003071
1434 Ga0495640_0014607
1435 Ga0495640_0019242
1436 Ga0495586_0006088
1437 Ga0495587_0006576
1438 Ga0495587_0027102
1439 Ga0495645_0042950
1440 Ga0495645_0182476
1441 Ga0495622_0030347
1442 Ga0495633_0012776
1443 Ga0495667_0002675
1444 Ga0495667_0036283
1445 Ga0495667_0045829
1446 Ga0495656_0000262
1447 Ga0495634_0247436
1448 Ga0495611_0105796
1449 Ga0495635_0002537
1450 Ga0495635_0022257
1451 Ga0495635_0026204
1452 Ga0495659_0035550
1453 Ga0495588_0096918
1454 Ga0495588_0106132
1455 Ga0495657_0004771
1456 Ga0495599_0044497
1457 Ga0495623_0001394
1458 Ga0495646_0001135
1459 Ga0495646_0005931
1460 Ga0495647_0023826
1461 Ga0495658_0000656
1462 Ga0495658_0031947
1463 Ga0495669_0042184
1464 Ga0495613_0004890
1465 Ga0495613_0104216
1466 Ga0495624_0045764
1467 Ga0495670_0001048
1468 Ga0495589_0020646
1469 Ga0495600_0000708
1470 Ga0495600_0053589
1471 Ga0495581_0051335
1472 Ga0495604_0007332
1473 Ga0495604_0055541
1474 Ga0495604_0085072
1475 Ga0495674_0002023
1476 Ga0495674_0012846
1477 Ga0495674_0034748
1478 Ga0495680_0005048
1479 Ga0495680_0009889
1480 Ga0495680_0036049
1481 Ga0495680_0075886
1482 Ga0495680_0082645
1483 Ga0495675_0003495
1484 Ga0495685_023674
1485 Ga0495684_0034946
1486 Ga0495684_0039323
1487 Ga0495684_0100293
1488 Ga0495593_0027256
1489 Ga0495614_0005475
1490 Ga0496100_0000189
1491 Ga0496100_0003289
1492 Ga0496100_0056512
1493 Ga0496100_0241831
1494 Ga0496101_0000367
1495 Ga0496101_0006104
1496 Ga0496101_0025023
1497 Ga0496101_0042260
1498 Ga0496101_0083363
1499 Ga0496101_0154907
1500 Ga0496102_0005220
1501 Ga0496102_0033628
1502 Ga0496102_0175045
1503 Ga0496102_0355312
1504 Ga0496103_0000191
1505 Ga0496103_0017260
1506 Ga0496103_0062818
1507 Ga0496103_0145580
1508 Ga0496104_0001732
1509 Ga0496104_0007873
1510 Ga0496104_0012704
1511 Ga0496104_0024056
1512 Ga0496104_0040580
1513 Ga0496104_0116753
1514 Ga0496104_0120100
1515 Ga0496104_0245885
1516 Ga0496104_0266899
1517 Ga0496105_0005921
1518 Ga0496105_0006935
1519 Ga0496105_0027857
1520 Ga0496105_0065949
1521 Ga0496105_0190767
1522 Ga0496105_0207117
1523 Ga0496106_0000736
1524 Ga0496106_0006742
1525 Ga0496106_0022228
1526 Ga0496106_0050896
1527 Ga0496107_0000080
1528 Ga0496107_0009754
1529 Ga0496107_0020206
1530 Ga0496107_0080633
1531 Ga0496108_0004997
1532 Ga0496108_0011343
1533 Ga0496108_0013886
1534 Ga0496108_0056745
1535 Ga0496108_0143255
1536 Ga0496108_0213679
1537 Ga0496109_0000737
1538 Ga0496109_0004059
1539 Ga0496109_0012672
1540 Ga0496109_0014904
1541 Ga0496109_0071671
1542 Ga0496109_0184503
1543 Ga0496110_0004764
1544 Ga0496110_0008628
1545 Ga0496110_0053052
1546 Ga0496110_0059722
1547 Ga0496110_0095102
1548 Ga0496110_0128793
1549 Ga0496110_0209328
1550 Ga0496111_0054930
1551 Ga0496112_0005238
1552 Ga0496112_0006007
1553 Ga0496112_0011317
1554 Ga0496112_0085596
1555 Ga0496112_0140628
1556 Ga0496112_0214508
1557 Ga0496113_0000721
1558 Ga0496113_0070468
1559 Ga0496113_0125918
1560 Ga0496114_0007885
1561 Ga0496114_0012419
1562 Ga0496114_0081237
1563 Ga0496114_0157848
1564 Ga0496115_0009214
1565 Ga0496115_0011820
1566 Ga0496115_0022768
1567 Ga0496115_0054167
1568 Ga0496115_0090169
1569 Ga0496115_0142283
1570 Ga0496115_0268068
1571 Ga0496115_0293172
1572 Ga0496126_0082271
1573 Ga0501032_0075038
1574 Ga0501032_0078917
1575 Ga0501033_0009844
1576 Ga0501033_0013241
1577 Ga0501033_0043223
1578 Ga0501033_0143541
1579 Ga0501034_0000179
1580 Ga0501034_0114814
1581 Ga0501036_0006144
1582 Ga0501036_0092711
1583 Ga0501036_0403367
1584 Ga0501037_0013431
1585 Ga0501037_0018756
1586 Ga0501037_0179169
1587 Ga0501038_0094084
1588 Ga0501038_0191730
1589 Ga0501038_0199287
1590 Ga0501039_0020089
1591 Ga0501040_0030724
1592 Ga0501041_0017371
1593 Ga0501041_0046816
1594 Ga0501043_0002639
1595 Ga0501043_0106904
1596 Ga0501043_0141756
1597 Ga0501046_0016711
1598 Ga0501046_0064687
1599 Ga0501046_0066331
1600 Ga0501046_0087289
1601 Ga0501046_0227714
1602 Ga0501047_0000179
1603 Ga0501047_0021161
1604 Ga0501047_0033499
1605 Ga0501047_0218050
1606 Ga0501047_0293072
1607 Ga0501047_0420676
1608 Ga0501048_0000186
1609 Ga0501048_0029390
1610 Ga0501048_0110234
1611 Ga0501067_0058527
1612 Ga0501068_0001337
1613 Ga0501068_0003407
1614 Ga0501068_0143718
1615 Ga0501069_0001008
1616 Ga0501069_0032140
1617 Ga0501069_0048727
1618 Ga0501069_0112231
1619 Ga0501070_0010383
1620 Ga0501070_0013337
1621 Ga0501070_0014762
1622 Ga0501070_0061304
1623 Ga0501070_0095375
1624 Ga0501070_0233838
1625 Ga0501070_0265012
1626 Ga0501070_0334450
1627 Ga0501071_0003435
1628 Ga0501071_0111296
1629 Ga0501072_0004155
1630 Ga0501072_0018948
1631 Ga0501072_0151952
1632 Ga0501072_0270645
1633 Ga0501073_0031790
1634 Ga0501073_0040224
1635 Ga0501073_0094157
1636 Ga0501074_0007477
1637 Ga0501074_0057800
1638 Ga0501075_0041152
1639 Ga0501076_0033449
1640 Ga0501077_0008142
1641 Ga0501077_0090259
1642 Ga0501079_0024207
1643 Ga0501079_0029459
1644 Ga0501080_0003746
1645 Ga0501080_0017590
1646 Ga0501080_0045771
1647 Ga0501080_0091199
1648 Ga0501080_0096237
1649 Ga0501080_0181325
1650 Ga0501081_0004954
1651 Ga0501083_0000655
1652 Ga0501083_0006706
1653 Ga0501083_0094598
1654 Ga0501035_0006782
1655 Ga0501035_0081040
1656 Ga0501035_0119352
1657 Ga0501035_0222207
1658 Ga0501044_0001177
1659 Ga0501044_0031038
1660 Ga0501044_0031595
1661 Ga0501044_0099079
1662 Ga0501044_0121121
1663 Ga0501044_0127448
1664 Ga0501044_0130313
1665 Ga0501044_0145055
1666 Ga0501044_0170873
1667 Ga0501044_0194393
1668 Ga0501044_0266306
1669 Ga0501045_0010460
1670 nmdc:mga03683_30152_c1
1671 nmdc:mga03n38_5935_c1
1672 nmdc:mga00v17_7308_c1
1673 nmdc:mga0yw44_4151_c1
1674 nmdc:mga0k408_58227_c1
1675 nmdc:mga06z11_377_c1
1676 nmdc:mga05p37_125683_c1
1677 nmdc:mga05p37_18_c1
1678 nmdc:mga05p37_217936_c1
1679 nmdc:mga05p37_46780_c1
1680 nmdc:mga05p37_47186_c1
1681 nmdc:mga05p37_53401_c1
1682 nmdc:mga05p37_5632_c1
1683 nmdc:mga05p37_83478_c1
1684 nmdc:mga09592_1148_c1
1685 nmdc:mga09592_2614_c1
1686 nmdc:mga09592_78382_c1
1687 nmdc:mga0qj67_2133_c1
1688 nmdc:mga0qj67_3210_c1
1689 nmdc:mga06r32_1490_c1
1690 nmdc:mga06r32_28343_c1
1691 nmdc:mga06r32_42116_c1
1692 nmdc:mga06r32_4222_c1
1693 nmdc:mga06r32_79315_c1
1694 nmdc:mga08y16_13723_c1
1695 nmdc:mga08y16_373179_c1
1696 nmdc:mga08y16_46145_c1
1697 nmdc:mga08y16_738_c1
1698 nmdc:mga0n895_11497_c1
1699 nmdc:mga0n895_15640_c1
1700 nmdc:mga0n895_315183_c1
1701 nmdc:mga0n895_3959_c1
1702 nmdc:mga0n895_50746_c1
1703 nmdc:mga0n895_562_c1
1704 nmdc:mga0n895_76804_c1
1705 nmdc:mga0n895_842_c1
1706 nmdc:mga0rr50_13949_c1
1707 nmdc:mga0rr50_16284_c1
1708 nmdc:mga0rr50_28329_c1
1709 nmdc:mga0rr50_55666_c1
1710 nmdc:mga0rr50_67088_c1
1711 nmdc:mga0a205_1040_c1
1712 nmdc:mga0a205_10488_c1
1713 nmdc:mga0a205_127895_c1
1714 nmdc:mga0a205_1490_c1
1715 nmdc:mga0a205_65303_c1
1716 nmdc:mga0a205_78970_c1
1717 Ga0495601_0012889
1718 Ga0495601_0024831
1719 Ga0495601_0063256
1720 Ga0495612_0001058
1721 Ga0495612_0007993
1722 Ga0495612_0021372
1723 Ga0495612_0032006
1724 Ga0495595_0000762
1725 Ga0495595_0018683
1726 Ga0495595_0053418
1727 Ga0495619_0000271
1728 Ga0495619_0002564
1729 Ga0495619_0007587
1730 Ga0495619_0022184
1731 Ga0495619_0033071
1732 Ga0500643_002339
1733 Ga0500644_0001151
1734 Ga0500651_0001961
1735 Ga0500577_0030480
1736 Ga0500616_0000006
1737 Ga0500616_0028465
1738 Ga0500616_0043385
1739 Ga0500645_000282
1740 Ga0501084_0007143
1741 Ga0501084_0018993
1742 Ga0501084_0042646
1743 Ga0501084_0127780
1744 Ga0501082_0000046
1745 Ga0501082_0007938
1746 Ga0501082_0083677
1747 Ga0501082_0102845
1748 Ga0530510_0021090
1749 2643756542
1750 2937844477

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

226

432

0.88

PF01321

Creatinase_N

Creatinase/Prolidase N-terminal domain

72

219

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wy2-assembly1.cif.gz_B crystal structure of the prolidase from pyrococcus horikoshii ot3 0.876 17 385
5cnx-assembly1.cif.gz_C crystal structure of xaa-pro aminopeptidase from escherichia coli k12 0.8758 17 394
1wn1-assembly1.cif.gz_A crystal structure of dipeptiase from pyrococcus horikoshii ot3 0.873 17 392
5giu-assembly1.cif.gz_A-2 crystal structure of xaa-pro peptidase from deinococcus radiodurans, metal-free active site 0.869 17 385
5cnx-assembly1.cif.gz_C crystal structure of xaa-pro aminopeptidase from escherichia coli k12 0.8645 17 394
ID Description Score Start End Superfamily
1wy2A02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.8871 163 385 3.90.230.10
af_Q4CSP6_205_383_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.8798 165 303 3.90.230.10
1pv9B02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.8797 163 385 3.90.230.10
2howB02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.8794 164 390 3.90.230.10
af_I6YDN6_135_371_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.8691 165 390 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A529TU98-F1-model_v4 deleted 0.9773 101 393
AF-A0A849I9G4-F1-model_v4 Aminopeptidase P family protein 0.9744 13 392 GO:0004177
AF-A0A529TU98-F1-model_v4 deleted 0.974 101 393
AF-A0A2N1R7S1-F1-model_v4 Aminopeptidase P family protein 0.9625 11 392
AF-A0A527ZGN3-F1-model_v4 Aminopeptidase P family protein 0.956 139 338 GO:0004177

Map