F484347
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 876 | 466 | 1752 | 306 |
Family's Representative Sequence
| Representative Sequence | 3300002067|JGI24735J21928_10027115|JGI24735J21928_100271152 |
| Length | 333 |
| Sequence | MAGLVPAIHASIRGEGRASNAEGGCVSFPDITPELRAAMPALRGRLLANQSLAELTWFRVGGPAQVLFTPADAEDLAYFLGHLSSHIPIYVLGVGSNLIVRDGGLEGVAIRLSPRGFGEVTADGDVLTAGAAALDRRVAEAAEGFRLGGLEFYFGIPGTIGGALRMNAGANGSETKDVLIEAEGVGRDGSRHRLSLADMKFTYRNSXVDSSIIFTRARFRGRHNPPEAIRARMNEVQSHRETAQPIREKTGGSTFKNPPGHSAWKLIDVAGCRGLRIGGAQVSEMHCNFLINTGDASAHDIETLGETVRERVKAHSGIELQWEIKRIGQGGET |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 36 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 42 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 43 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 44 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 45 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 47 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 48 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 52 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 53 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 54 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 62 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 81 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 132 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 133 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 134 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 138 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 139 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 141 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 142 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 143 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 144 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 145 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 146 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 147 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 148 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 149 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 150 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 151 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 152 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 153 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 154 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 155 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 156 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 157 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 158 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 159 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 160 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 161 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 162 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 164 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 165 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 167 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 169 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 170 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 171 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 175 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 178 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 179 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 180 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 181 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 182 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 183 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 184 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 185 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 186 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 187 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 188 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 189 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 255 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 256 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 257 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 258 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 259 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 260 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 263 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 264 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 265 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 266 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 267 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 268 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 269 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 270 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 271 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 272 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 273 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 274 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 275 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 276 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 277 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 309 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 310 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 311 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 312 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 313 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 314 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 322 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 326 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 327 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 329 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 330 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 331 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 332 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 333 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 334 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 335 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 336 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 337 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 338 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 339 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 340 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 341 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 342 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 343 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 344 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 345 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 346 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 347 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 348 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 349 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 350 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 351 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 352 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 353 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 355 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 356 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 357 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 358 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 359 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 360 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 361 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 362 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 363 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 364 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 366 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 368 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 369 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 370 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 371 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 372 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 373 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 374 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 375 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 376 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 377 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 378 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 379 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 380 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 381 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 382 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 383 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 384 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 385 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 386 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 387 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 388 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 389 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 390 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 391 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 392 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 393 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 394 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 395 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 396 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 397 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 398 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 399 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 400 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 401 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 402 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 403 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 404 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 405 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 406 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 407 | 2904699407 | |||
| 408 | 2906610324 | |||
| 409 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 410 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 411 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 412 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 413 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 414 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 415 | 2922368715 | |||
| 416 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 417 | 2922425934 | |||
| 418 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 419 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 420 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 421 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 422 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 423 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 424 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 425 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 426 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 427 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 428 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 429 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 430 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 431 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 432 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 433 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 434 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 435 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 436 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 437 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 438 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 439 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 440 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 441 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 442 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 443 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 444 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 445 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 446 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 447 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 448 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 449 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 450 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 451 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 452 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 453 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 454 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 455 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 456 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 457 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 458 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 459 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 460 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 461 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 462 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 463 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 464 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 465 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 466 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.99 |
| Metatranscriptomes | 0.11 |
| Isolates | 10.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.16 |
| Nodule | 9.25 |
| Rhizoplane | 6.05 |
| Rhizosphere | 64.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10027115 | 3300002067 | Bacteria | 1718 |
| 2 | JGI24740J21852_10002709 | 3300001979 | Bacteria | 7951 |
| 3 | JGI25406J46586_10000580 | 3300003203 | Bacteria | 17278 |
| 4 | JGI25406J46586_10003218 | 3300003203 | Bacteria | 7680 |
| 5 | JGI25153J46596_10026817 | 3300003215 | Bacteria | 2031 |
| 6 | Ga0065165_1004626 | 3300005262 | Bacteria | 8358 |
| 7 | Ga0070658_10345549 | 3300005327 | Bacteria | 1273 |
| 8 | Ga0070676_10075380 | 3300005328 | Bacteria | 2034 |
| 9 | Ga0070680_100035140 | 3300005336 | Bacteria | 4045 |
| 10 | Ga0068868_100222858 | 3300005338 | Bacteria | 1579 |
| 11 | Ga0070661_100073464 | 3300005344 | Bacteria | 2518 |
| 12 | Ga0070668_100013894 | 3300005347 | Bacteria | 6021 |
| 13 | Ga0070668_100124046 | 3300005347 | Bacteria | 2067 |
| 14 | Ga0070669_100097454 | 3300005353 | Bacteria | 2213 |
| 15 | Ga0070675_100136583 | 3300005354 | Bacteria | 2093 |
| 16 | Ga0070667_100002825 | 3300005367 | Bacteria | 14992 |
| 17 | Ga0070667_100232022 | 3300005367 | Bacteria | 1646 |
| 18 | Ga0070709_10001417 | 3300005434 | Bacteria | 12994 |
| 19 | Ga0070709_10007249 | 3300005434 | Bacteria | 6077 |
| 20 | Ga0070709_10074270 | 3300005434 | Bacteria | 2203 |
| 21 | Ga0070709_10078605 | 3300005434 | Bacteria | 2147 |
| 22 | Ga0070714_100000678 | 3300005435 | Bacteria | 24075 |
| 23 | Ga0070714_100018262 | 3300005435 | Bacteria | 5694 |
| 24 | Ga0070714_100048804 | 3300005435 | Bacteria | 3601 |
| 25 | Ga0070714_100073222 | 3300005435 | Bacteria | 2968 |
| 26 | Ga0070714_100143902 | 3300005435 | Bacteria | 2143 |
| 27 | Ga0070714_100537798 | 3300005435 | Bacteria | 1117 |
| 28 | Ga0070713_100022313 | 3300005436 | Bacteria | 4890 |
| 29 | Ga0070713_100094802 | 3300005436 | Bacteria | 2574 |
| 30 | Ga0070713_100193256 | 3300005436 | Bacteria | 1835 |
| 31 | Ga0070713_100441823 | 3300005436 | Bacteria | 1220 |
| 32 | Ga0070710_10000633 | 3300005437 | Bacteria | 16752 |
| 33 | Ga0070710_10002407 | 3300005437 | Bacteria | 8862 |
| 34 | Ga0070711_100001478 | 3300005439 | Bacteria | 12909 |
| 35 | Ga0070711_100002216 | 3300005439 | Bacteria | 11029 |
| 36 | Ga0070711_100011186 | 3300005439 | Bacteria | 5564 |
| 37 | Ga0070711_100027775 | 3300005439 | Bacteria | 3718 |
| 38 | Ga0070711_100063136 | 3300005439 | Bacteria | 2584 |
| 39 | Ga0070711_100242665 | 3300005439 | Bacteria | 1409 |
| 40 | Ga0070663_100047179 | 3300005455 | Bacteria | 3051 |
| 41 | Ga0070663_100062516 | 3300005455 | Bacteria | 2684 |
| 42 | Ga0070663_100149106 | 3300005455 | Bacteria | 1792 |
| 43 | Ga0070662_100126252 | 3300005457 | Bacteria | 1967 |
| 44 | Ga0070662_100301890 | 3300005457 | Bacteria | 1301 |
| 45 | Ga0070679_100024858 | 3300005530 | Bacteria | 5870 |
| 46 | Ga0070679_100128043 | 3300005530 | Bacteria | 2520 |
| 47 | Ga0070684_100005206 | 3300005535 | Bacteria | 9945 |
| 48 | Ga0070684_100287733 | 3300005535 | Bacteria | 1506 |
| 49 | Ga0070684_100300141 | 3300005535 | Bacteria | 1474 |
| 50 | Ga0068853_100010311 | 3300005539 | Bacteria | 7556 |
| 51 | Ga0068853_100020454 | 3300005539 | Bacteria | 5504 |
| 52 | Ga0068853_100038556 | 3300005539 | Bacteria | 4071 |
| 53 | Ga0070693_100191171 | 3300005547 | Bacteria | 1324 |
| 54 | Ga0070665_100002023 | 3300005548 | Bacteria | 22800 |
| 55 | Ga0070665_100028235 | 3300005548 | Bacteria | 5651 |
| 56 | Ga0068855_100038269 | 3300005563 | Bacteria | 5699 |
| 57 | Ga0068855_100049698 | 3300005563 | Bacteria | 4944 |
| 58 | Ga0068855_100061366 | 3300005563 | Bacteria | 4393 |
| 59 | Ga0068855_100079756 | 3300005563 | Bacteria | 3796 |
| 60 | Ga0068855_100436494 | 3300005563 | Bacteria | 1431 |
| 61 | Ga0068857_100012881 | 3300005577 | Bacteria | 7286 |
| 62 | Ga0068857_100028021 | 3300005577 | Bacteria | 4968 |
| 63 | Ga0068857_100102380 | 3300005577 | Bacteria | 2570 |
| 64 | Ga0068854_100054912 | 3300005578 | Bacteria | 2866 |
| 65 | Ga0068856_100042057 | 3300005614 | Bacteria | 4494 |
| 66 | Ga0068856_100096425 | 3300005614 | Bacteria | 2946 |
| 67 | Ga0070702_100068321 | 3300005615 | Bacteria | 2091 |
| 68 | Ga0068852_100164733 | 3300005616 | Bacteria | 2073 |
| 69 | Ga0068859_100002355 | 3300005617 | Bacteria | 19231 |
| 70 | Ga0068859_100069977 | 3300005617 | Bacteria | 3544 |
| 71 | Ga0068864_100047790 | 3300005618 | Bacteria | 3677 |
| 72 | Ga0068864_100129816 | 3300005618 | Bacteria | 2262 |
| 73 | Ga0068861_100032076 | 3300005719 | Bacteria | 3865 |
| 74 | Ga0068851_10001608 | 3300005834 | Bacteria | 9920 |
| 75 | Ga0068863_100050347 | 3300005841 | Bacteria | 3949 |
| 76 | Ga0068858_100021103 | 3300005842 | Bacteria | 6084 |
| 77 | Ga0068858_100293748 | 3300005842 | Bacteria | 1549 |
| 78 | Ga0068860_100000254 | 3300005843 | Bacteria | 79465 |
| 79 | Ga0068860_100008657 | 3300005843 | Bacteria | 10138 |
| 80 | Ga0068860_100051464 | 3300005843 | Bacteria | 3919 |
| 81 | Ga0068862_100070303 | 3300005844 | Bacteria | 3022 |
| 82 | Ga0068862_100250986 | 3300005844 | Bacteria | 1612 |
| 83 | Ga0068862_100271018 | 3300005844 | Bacteria | 1552 |
| 84 | Ga0081455_10018234 | 3300005937 | Bacteria | 6696 |
| 85 | Ga0081455_10042135 | 3300005937 | Bacteria | 4008 |
| 86 | Ga0081455_10053511 | 3300005937 | Bacteria | 3448 |
| 87 | Ga0081455_10146067 | 3300005937 | Bacteria | 1829 |
| 88 | Ga0081538_10040034 | 3300005981 | Bacteria | 2995 |
| 89 | Ga0081540_1001143 | 3300005983 | Bacteria | 23424 |
| 90 | Ga0081540_1003272 | 3300005983 | Bacteria | 12881 |
| 91 | Ga0081540_1009836 | 3300005983 | Bacteria | 6542 |
| 92 | Ga0081540_1018033 | 3300005983 | Bacteria | 4346 |
| 93 | Ga0081540_1032645 | 3300005983 | Bacteria | 2839 |
| 94 | Ga0081540_1034529 | 3300005983 | Bacteria | 2726 |
| 95 | Ga0081539_10000191 | 3300005985 | Bacteria | 142387 |
| 96 | Ga0081539_10000321 | 3300005985 | Bacteria | 106887 |
| 97 | Ga0070717_10000355 | 3300006028 | Bacteria | 29408 |
| 98 | Ga0070717_10045372 | 3300006028 | Bacteria | 3593 |
| 99 | Ga0070717_10073801 | 3300006028 | Bacteria | 2852 |
| 100 | Ga0075365_10126376 | 3300006038 | Bacteria | 1767 |
| 101 | Ga0075368_10035510 | 3300006042 | Bacteria | 1945 |
| 102 | Ga0070715_10000078 | 3300006163 | Bacteria | 27243 |
| 103 | Ga0070715_10058855 | 3300006163 | Bacteria | 1679 |
| 104 | Ga0070716_100003281 | 3300006173 | Bacteria | 7598 |
| 105 | Ga0070716_100026542 | 3300006173 | Bacteria | 3103 |
| 106 | Ga0070712_100011086 | 3300006175 | Bacteria | 5706 |
| 107 | Ga0070712_100035217 | 3300006175 | Bacteria | 3398 |
| 108 | Ga0070712_100212976 | 3300006175 | Bacteria | 1525 |
| 109 | Ga0075362_10032986 | 3300006177 | Bacteria | 2250 |
| 110 | Ga0075367_10085301 | 3300006178 | Bacteria | 1916 |
| 111 | Ga0075367_10093767 | 3300006178 | Bacteria | 1829 |
| 112 | Ga0075369_10030560 | 3300006186 | Bacteria | 2269 |
| 113 | Ga0075366_10031599 | 3300006195 | Bacteria | 3116 |
| 114 | Ga0075366_10180883 | 3300006195 | Bacteria | 1281 |
| 115 | Ga0097621_100001594 | 3300006237 | Bacteria | 15517 |
| 116 | Ga0075370_10122191 | 3300006353 | Bacteria | 1517 |
| 117 | Ga0068871_100000187 | 3300006358 | Bacteria | 42079 |
| 118 | Ga0068871_100114894 | 3300006358 | Bacteria | 2268 |
| 119 | Ga0068871_100520825 | 3300006358 | Bacteria | 1074 |
| 120 | Ga0075434_100192327 | 3300006871 | Bacteria | 2061 |
| 121 | Ga0075434_100478919 | 3300006871 | Bacteria | 1266 |
| 122 | Ga0075429_100274420 | 3300006880 | Bacteria | 1476 |
| 123 | Ga0097620_100002355 | 3300006931 | Bacteria | 19231 |
| 124 | Ga0097620_100069979 | 3300006931 | Bacteria | 3544 |
| 125 | Ga0099824_1021336 | 3300006942 | Bacteria | 4546 |
| 126 | Ga0099822_1000022 | 3300006943 | Bacteria | 64942 |
| 127 | Ga0105240_10022325 | 3300009093 | Bacteria | 8392 |
| 128 | Ga0105240_10048232 | 3300009093 | Bacteria | 5384 |
| 129 | Ga0105240_10095268 | 3300009093 | Bacteria | 3630 |
| 130 | Ga0105240_10312007 | 3300009093 | Bacteria | 1796 |
| 131 | Ga0105240_10349464 | 3300009093 | Bacteria | 1678 |
| 132 | Ga0105247_10140225 | 3300009101 | Bacteria | 1583 |
| 133 | Ga0105247_10163988 | 3300009101 | Bacteria | 1473 |
| 134 | Ga0105247_10194057 | 3300009101 | Bacteria | 1361 |
| 135 | Ga0105241_10020915 | 3300009174 | Bacteria | 4836 |
| 136 | Ga0105241_10056932 | 3300009174 | Bacteria | 2998 |
| 137 | Ga0105248_10206743 | 3300009177 | Bacteria | 2212 |
| 138 | Ga0105248_10263515 | 3300009177 | Bacteria | 1940 |
| 139 | Ga0105248_10507073 | 3300009177 | Bacteria | 1360 |
| 140 | Ga0105238_10035119 | 3300009551 | Bacteria | 5099 |
| 141 | Ga0105238_10038148 | 3300009551 | Bacteria | 4881 |
| 142 | Ga0105238_10059830 | 3300009551 | Bacteria | 3815 |
| 143 | Ga0105238_10206407 | 3300009551 | Bacteria | 1941 |
| 144 | Ga0105238_10355522 | 3300009551 | Bacteria | 1454 |
| 145 | Ga0105238_10568854 | 3300009551 | Bacteria | 1139 |
| 146 | Ga0105249_10285302 | 3300009553 | Bacteria | 1650 |
| 147 | Ga0105239_10028113 | 3300010375 | Bacteria | 6188 |
| 148 | Ga0105239_10053854 | 3300010375 | Bacteria | 4412 |
| 149 | Ga0105239_10056278 | 3300010375 | Bacteria | 4314 |
| 150 | Ga0105239_10090525 | 3300010375 | Bacteria | 3375 |
| 151 | Ga0105239_10102158 | 3300010375 | Bacteria | 3173 |
| 152 | Ga0105239_10111939 | 3300010375 | Bacteria | 3026 |
| 153 | Ga0105239_10118056 | 3300010375 | Bacteria | 2944 |
| 154 | Ga0105246_10056010 | 3300011119 | Bacteria | 2723 |
| 155 | Ga0105246_10400177 | 3300011119 | Bacteria | 1140 |
| 156 | Ga0157370_10044147 | 3300013104 | Bacteria | 4286 |
| 157 | Ga0157370_10451017 | 3300013104 | Bacteria | 1182 |
| 158 | Ga0157369_10012925 | 3300013105 | Bacteria | 9461 |
| 159 | Ga0157369_10043079 | 3300013105 | Bacteria | 4921 |
| 160 | Ga0157369_10577027 | 3300013105 | Bacteria | 1162 |
| 161 | Ga0157374_10032938 | 3300013296 | Bacteria | 4723 |
| 162 | Ga0157374_10073258 | 3300013296 | Bacteria | 3233 |
| 163 | Ga0157378_10092926 | 3300013297 | Bacteria | 2745 |
| 164 | Ga0163162_10072401 | 3300013306 | Bacteria | 3501 |
| 165 | Ga0157375_10329304 | 3300013308 | Bacteria | 1692 |
| 166 | Ga0157380_10005003 | 3300014326 | Bacteria | 9242 |
| 167 | Ga0157376_10016873 | 3300014969 | Bacteria | 5555 |
| 168 | Ga0206353_11993804 | 3300020082 | Bacteria | 1445 |
| 169 | Ga0213874_10030551 | 3300021377 | Bacteria | 1553 |
| 170 | Ga0209677_103126 | 3300025253 | Bacteria | 5624 |
| 171 | Ga0209148_1000424 | 3300025254 | Bacteria | 47087 |
| 172 | Ga0209455_1002609 | 3300025272 | Bacteria | 6856 |
| 173 | Ga0209455_1003259 | 3300025272 | Bacteria | 5843 |
| 174 | Ga0209455_1003833 | 3300025272 | Bacteria | 5147 |
| 175 | Ga0209758_1006158 | 3300025297 | Bacteria | 8788 |
| 176 | Ga0209758_1015210 | 3300025297 | Bacteria | 4008 |
| 177 | Ga0209758_1051017 | 3300025297 | Bacteria | 1444 |
| 178 | Ga0207656_10005032 | 3300025321 | Bacteria | 4645 |
| 179 | Ga0207656_10126493 | 3300025321 | Bacteria | 1194 |
| 180 | Ga0207692_10002540 | 3300025898 | Bacteria | 7010 |
| 181 | Ga0207692_10005603 | 3300025898 | Bacteria | 5039 |
| 182 | Ga0207692_10009587 | 3300025898 | Bacteria | 4051 |
| 183 | Ga0207710_10104909 | 3300025900 | Bacteria | 1337 |
| 184 | Ga0207647_10044552 | 3300025904 | Bacteria | 2771 |
| 185 | Ga0207647_10047587 | 3300025904 | Bacteria | 2666 |
| 186 | Ga0207685_10037090 | 3300025905 | Bacteria | 1792 |
| 187 | Ga0207685_10051652 | 3300025905 | Bacteria | 1589 |
| 188 | Ga0207699_10000390 | 3300025906 | Bacteria | 22928 |
| 189 | Ga0207699_10041162 | 3300025906 | Bacteria | 2667 |
| 190 | Ga0207699_10042253 | 3300025906 | Bacteria | 2639 |
| 191 | Ga0207699_10059991 | 3300025906 | Bacteria | 2282 |
| 192 | Ga0207699_10078773 | 3300025906 | Bacteria | 2036 |
| 193 | Ga0207645_10047695 | 3300025907 | Bacteria | 2735 |
| 194 | Ga0207643_10046129 | 3300025908 | Bacteria | 2463 |
| 195 | Ga0207705_10287390 | 3300025909 | Bacteria | 1260 |
| 196 | Ga0207654_10000323 | 3300025911 | Bacteria | 28628 |
| 197 | Ga0207654_10044099 | 3300025911 | Bacteria | 2531 |
| 198 | Ga0207707_10000178 | 3300025912 | Bacteria | 66057 |
| 199 | Ga0207707_10026300 | 3300025912 | Bacteria | 5086 |
| 200 | Ga0207707_10051598 | 3300025912 | Bacteria | 3582 |
| 201 | Ga0207695_10000497 | 3300025913 | Bacteria | 83894 |
| 202 | Ga0207695_10053725 | 3300025913 | Bacteria | 4211 |
| 203 | Ga0207695_10094476 | 3300025913 | Bacteria | 2997 |
| 204 | Ga0207695_10206404 | 3300025913 | Bacteria | 1877 |
| 205 | Ga0207671_10009091 | 3300025914 | Bacteria | 8349 |
| 206 | Ga0207671_10120899 | 3300025914 | Bacteria | 2002 |
| 207 | Ga0207693_10003503 | 3300025915 | Bacteria | 13399 |
| 208 | Ga0207693_10010089 | 3300025915 | Bacteria | 7672 |
| 209 | Ga0207693_10018008 | 3300025915 | Bacteria | 5629 |
| 210 | Ga0207693_10018488 | 3300025915 | Bacteria | 5551 |
| 211 | Ga0207693_10296888 | 3300025915 | Bacteria | 1266 |
| 212 | Ga0207663_10006434 | 3300025916 | Bacteria | 6008 |
| 213 | Ga0207663_10014546 | 3300025916 | Bacteria | 4312 |
| 214 | Ga0207663_10021194 | 3300025916 | Bacteria | 3696 |
| 215 | Ga0207663_10274823 | 3300025916 | Bacteria | 1249 |
| 216 | Ga0207660_10098702 | 3300025917 | Bacteria | 2179 |
| 217 | Ga0207657_10029030 | 3300025919 | Bacteria | 5040 |
| 218 | Ga0207657_10517855 | 3300025919 | Bacteria | 934 |
| 219 | Ga0207652_10019378 | 3300025921 | Bacteria | 5594 |
| 220 | Ga0207652_10055858 | 3300025921 | Bacteria | 3397 |
| 221 | Ga0207652_10212256 | 3300025921 | Bacteria | 1743 |
| 222 | Ga0207652_10520426 | 3300025921 | Bacteria | 1070 |
| 223 | Ga0207681_10012277 | 3300025923 | Bacteria | 5283 |
| 224 | Ga0207681_10063702 | 3300025923 | Bacteria | 2543 |
| 225 | Ga0207681_10224707 | 3300025923 | Bacteria | 1454 |
| 226 | Ga0207694_10000212 | 3300025924 | Bacteria | 56506 |
| 227 | Ga0207694_10324074 | 3300025924 | Bacteria | 1272 |
| 228 | Ga0207650_10110677 | 3300025925 | Bacteria | 2125 |
| 229 | Ga0207650_10459274 | 3300025925 | Bacteria | 1061 |
| 230 | Ga0207687_10146388 | 3300025927 | Bacteria | 1798 |
| 231 | Ga0207700_10012153 | 3300025928 | Bacteria | 5537 |
| 232 | Ga0207700_10021574 | 3300025928 | Bacteria | 4401 |
| 233 | Ga0207700_10031891 | 3300025928 | Bacteria | 3750 |
| 234 | Ga0207700_10158137 | 3300025928 | Bacteria | 1880 |
| 235 | Ga0207700_10164177 | 3300025928 | Bacteria | 1847 |
| 236 | Ga0207664_10148771 | 3300025929 | Bacteria | 1988 |
| 237 | Ga0207644_10292129 | 3300025931 | Bacteria | 1311 |
| 238 | Ga0207690_10125891 | 3300025932 | Bacteria | 1868 |
| 239 | Ga0207690_10345078 | 3300025932 | Bacteria | 1176 |
| 240 | Ga0207709_10045101 | 3300025935 | Bacteria | 2668 |
| 241 | Ga0207665_10000361 | 3300025939 | Bacteria | 31561 |
| 242 | Ga0207665_10132205 | 3300025939 | Bacteria | 1773 |
| 243 | Ga0207665_10252552 | 3300025939 | Bacteria | 1303 |
| 244 | Ga0207711_10071760 | 3300025941 | Bacteria | 3005 |
| 245 | Ga0207711_10380882 | 3300025941 | Bacteria | 1309 |
| 246 | Ga0207689_10192800 | 3300025942 | Bacteria | 1681 |
| 247 | Ga0207661_10004270 | 3300025944 | Bacteria | 10004 |
| 248 | Ga0207661_10354884 | 3300025944 | Bacteria | 1323 |
| 249 | Ga0207679_10005298 | 3300025945 | Bacteria | 8091 |
| 250 | Ga0207679_10082436 | 3300025945 | Bacteria | 2462 |
| 251 | Ga0207679_10439769 | 3300025945 | Bacteria | 1155 |
| 252 | Ga0207667_10037608 | 3300025949 | Bacteria | 5172 |
| 253 | Ga0207667_10047369 | 3300025949 | Bacteria | 4550 |
| 254 | Ga0207651_10037284 | 3300025960 | Bacteria | 3184 |
| 255 | Ga0207668_10001774 | 3300025972 | Bacteria | 12598 |
| 256 | Ga0207668_10076711 | 3300025972 | Bacteria | 2407 |
| 257 | Ga0207668_10086130 | 3300025972 | Bacteria | 2294 |
| 258 | Ga0207640_10016944 | 3300025981 | Bacteria | 4251 |
| 259 | Ga0207640_10085163 | 3300025981 | Bacteria | 2173 |
| 260 | Ga0207703_10126978 | 3300026035 | Bacteria | 2197 |
| 261 | Ga0207639_10002809 | 3300026041 | Bacteria | 11682 |
| 262 | Ga0207639_10010472 | 3300026041 | Bacteria | 6423 |
| 263 | Ga0207639_10065321 | 3300026041 | Bacteria | 2824 |
| 264 | Ga0207678_10042373 | 3300026067 | Bacteria | 3943 |
| 265 | Ga0207678_10093916 | 3300026067 | Bacteria | 2562 |
| 266 | Ga0207678_10098556 | 3300026067 | Bacteria | 2497 |
| 267 | Ga0207678_10325072 | 3300026067 | Bacteria | 1324 |
| 268 | Ga0207678_10435243 | 3300026067 | Bacteria | 1139 |
| 269 | Ga0207678_10600210 | 3300026067 | Bacteria | 965 |
| 270 | Ga0207702_10000003 | 3300026078 | Bacteria | 434196 |
| 271 | Ga0207641_10174404 | 3300026088 | Bacteria | 1965 |
| 272 | Ga0207676_10114976 | 3300026095 | Bacteria | 2258 |
| 273 | Ga0207674_10004756 | 3300026116 | Bacteria | 16280 |
| 274 | Ga0207674_10057562 | 3300026116 | Bacteria | 3940 |
| 275 | Ga0207674_10082897 | 3300026116 | Bacteria | 3207 |
| 276 | Ga0207675_100033143 | 3300026118 | Bacteria | 4813 |
| 277 | Ga0207675_100201522 | 3300026118 | Bacteria | 1912 |
| 278 | Ga0207675_100255536 | 3300026118 | Bacteria | 1697 |
| 279 | Ga0207683_10046756 | 3300026121 | Bacteria | 3789 |
| 280 | Ga0207683_10088917 | 3300026121 | Bacteria | 2749 |
| 281 | Ga0207683_10119774 | 3300026121 | Bacteria | 2362 |
| 282 | Ga0207683_10185080 | 3300026121 | Bacteria | 1889 |
| 283 | Ga0207683_10213368 | 3300026121 | Bacteria | 1757 |
| 284 | Ga0207698_10054008 | 3300026142 | Bacteria | 3088 |
| 285 | Ga0209589_1000006 | 3300027357 | Bacteria | 436292 |
| 286 | Ga0209489_100007 | 3300027361 | Bacteria | 436292 |
| 287 | Ga0209700_100008 | 3300027363 | Bacteria | 436292 |
| 288 | Ga0268266_10001115 | 3300028379 | Bacteria | 33566 |
| 289 | Ga0268266_10006027 | 3300028379 | Bacteria | 11179 |
| 290 | Ga0268266_10025765 | 3300028379 | Bacteria | 5004 |
| 291 | Ga0268266_10039703 | 3300028379 | Bacteria | 4009 |
| 292 | Ga0268266_10064115 | 3300028379 | Bacteria | 3173 |
| 293 | Ga0268266_10254562 | 3300028379 | Bacteria | 1625 |
| 294 | Ga0268265_10010132 | 3300028380 | Bacteria | 6365 |
| 295 | Ga0268265_10060191 | 3300028380 | Bacteria | 2909 |
| 296 | Ga0268264_10000093 | 3300028381 | Bacteria | 232057 |
| 297 | Ga0268264_10013096 | 3300028381 | Bacteria | 6820 |
| 298 | Ga0307515_10039862 | 3300028794 | Bacteria | 7450 |
| 299 | Ga0307515_10231953 | 3300028794 | Bacteria | 1636 |
| 300 | Ga0307511_10057782 | 3300030521 | Bacteria | 3010 |
| 301 | Ga0265330_10015314 | 3300031235 | Bacteria | 3549 |
| 302 | Ga0265332_10026695 | 3300031238 | Bacteria | 2532 |
| 303 | Ga0265328_10071431 | 3300031239 | Bacteria | 1276 |
| 304 | Ga0265325_10005212 | 3300031241 | Bacteria | 8068 |
| 305 | Ga0265329_10048276 | 3300031242 | Bacteria | 1358 |
| 306 | Ga0265340_10002779 | 3300031247 | Bacteria | 9978 |
| 307 | Ga0307513_10156811 | 3300031456 | Bacteria | 2175 |
| 308 | Ga0307509_10148592 | 3300031507 | Bacteria | 2264 |
| 309 | Ga0307509_10162576 | 3300031507 | Bacteria | 2127 |
| 310 | Ga0307408_100166051 | 3300031548 | Bacteria | 1758 |
| 311 | Ga0307508_10000034 | 3300031616 | Bacteria | 160115 |
| 312 | Ga0307508_10047091 | 3300031616 | Bacteria | 3847 |
| 313 | Ga0307508_10057194 | 3300031616 | Bacteria | 3451 |
| 314 | Ga0265342_10006824 | 3300031712 | Bacteria | 8440 |
| 315 | Ga0265342_10009227 | 3300031712 | Bacteria | 6978 |
| 316 | Ga0307516_10095646 | 3300031730 | Bacteria | 2792 |
| 317 | Ga0307507_10022844 | 3300033179 | Bacteria | 6890 |
| 318 | Ga0307510_10036621 | 3300033180 | Bacteria | 5458 |
| 319 | Ga0315911_1000010 | 3300033442 | Bacteria | 322197 |
| 320 | Ga0373926_0011513 | 3300035083 | Bacteria | 2977 |
| 321 | Ga0373934_0009105 | 3300035086 | Bacteria | 3714 |
| 322 | Ga0373934_0034650 | 3300035086 | Bacteria | 1984 |
| 323 | Ga0373944_0010032 | 3300035089 | Bacteria | 2576 |
| 324 | Ga0373952_0014882 | 3300035092 | Bacteria | 1563 |
| 325 | Ga0373923_0002407 | 3300035111 | Bacteria | 5748 |
| 326 | Ga0373936_0016254 | 3300035113 | Bacteria | 2862 |
| 327 | Ga0373953_0001359 | 3300035117 | Bacteria | 7040 |
| 328 | Ga0373953_0010088 | 3300035117 | Bacteria | 3275 |
| 329 | Ga0373953_0010516 | 3300035117 | Bacteria | 3223 |
| 330 | Ga0373954_0004556 | 3300035118 | Bacteria | 5968 |
| 331 | Ga0373956_0003668 | 3300035119 | Bacteria | 6201 |
| 332 | Ga0373957_0001068 | 3300035120 | Bacteria | 7227 |
| 333 | Ga0373943_0007994 | 3300035170 | Bacteria | 4747 |
| 334 | Ga0373955_0000880 | 3300035172 | Bacteria | 12889 |
| 335 | Ga0373924_0012841 | 3300035410 | Bacteria | 3136 |
| 336 | Ga0373924_0023108 | 3300035410 | Bacteria | 2435 |
| 337 | Ga0373935_0018309 | 3300035692 | Bacteria | 4258 |
| 338 | Ga0373927_0009651 | 3300035695 | Bacteria | 6471 |
| 339 | Ga0373927_0012044 | 3300035695 | Bacteria | 5753 |
| 340 | Ga0373927_0062867 | 3300035695 | Bacteria | 2401 |
| 341 | Ga0373927_0066443 | 3300035695 | Bacteria | 2333 |
| 342 | Ga0373933_0002191 | 3300035724 | Bacteria | 11169 |
| 343 | Ga0373933_0038369 | 3300035724 | Bacteria | 2814 |
| 344 | Ga0373933_0097404 | 3300035724 | Bacteria | 1822 |
| 345 | Ga0373933_0169902 | 3300035724 | Bacteria | 1387 |
| 346 | Ga0373947_0140362 | 3300035725 | Bacteria | 1549 |
| 347 | Ga0373937_0006578 | 3300036401 | Bacteria | 10035 |
| 348 | Ga0373937_0022213 | 3300036401 | Bacteria | 5702 |
| 349 | Ga0373937_0051281 | 3300036401 | Bacteria | 3782 |
| 350 | Ga0373925_0045644 | 3300037068 | Bacteria | 3255 |
| 351 | Ga0395900_0086570 | 3300037418 | Bacteria | 3220 |
| 352 | Ga0395898_0031255 | 3300037466 | Bacteria | 5322 |
| 353 | Ga0395898_0134726 | 3300037466 | Bacteria | 2365 |
| 354 | Ga0395905_0162178 | 3300037471 | Bacteria | 2101 |
| 355 | Ga0395905_0169899 | 3300037471 | Bacteria | 2048 |
| 356 | Ga0395901_0015985 | 3300038443 | Bacteria | 7647 |
| 357 | Ga0395901_0060097 | 3300038443 | Bacteria | 3954 |
| 358 | Ga0400483_108494 | 3300039062 | Bacteria | 4669 |
| 359 | Ga0400483_110392 | 3300039062 | Bacteria | 37401 |
| 360 | Ga0400483_151200 | 3300039062 | Bacteria | 17559 |
| 361 | Ga0400483_193036 | 3300039062 | Bacteria | 3660 |
| 362 | Ga0436365_0487598 | 3300039437 | Bacteria | 1139 |
| 363 | Ga0436365_1446014 | 3300039437 | Bacteria | 2887 |
| 364 | Ga0436365_1446425 | 3300039437 | Bacteria | 5355 |
| 365 | Ga0436365_1701898 | 3300039437 | Bacteria | 2070 |
| 366 | Ga0436365_1714523 | 3300039437 | Bacteria | 1910 |
| 367 | Ga0436365_1936932 | 3300039437 | Bacteria | 1810 |
| 368 | Ga0436360_0953942 | 3300039438 | Bacteria | 4699 |
| 369 | Ga0436360_0973324 | 3300039438 | Bacteria | 3801 |
| 370 | Ga0436363_0302413 | 3300039450 | Bacteria | 1568 |
| 371 | Ga0436362_0646134 | 3300039453 | Bacteria | 7178 |
| 372 | Ga0451807_0866641 | 3300041486 | Bacteria | 1641 |
| 373 | Ga0439435_0005933 | 3300042436 | Bacteria | 2717 |
| 374 | Ga0439459_0023512 | 3300042438 | Bacteria | 1202 |
| 375 | Ga0466965_0180922 | 3300044683 | Bacteria | 1112 |
| 376 | Ga0466963_0091098 | 3300044694 | Bacteria | 2076 |
| 377 | Ga0466957_0029287 | 3300044842 | Bacteria | 3282 |
| 378 | Ga0466967_0040069 | 3300045976 | Bacteria | 4031 |
| 379 | Ga0495617_032623 | 3300046452 | Bacteria | 1748 |
| 380 | Ga0495592_0008207 | 3300046454 | Bacteria | 7841 |
| 381 | Ga0495592_0029636 | 3300046454 | Bacteria | 4143 |
| 382 | Ga0495592_0125717 | 3300046454 | Bacteria | 1799 |
| 383 | Ga0495603_0061679 | 3300046455 | Bacteria | 2214 |
| 384 | Ga0495603_0086657 | 3300046455 | Bacteria | 1833 |
| 385 | Ga0495603_0088431 | 3300046455 | Bacteria | 1813 |
| 386 | Ga0495629_0006765 | 3300046459 | Bacteria | 8473 |
| 387 | Ga0495629_0018324 | 3300046459 | Bacteria | 5012 |
| 388 | Ga0495629_0047563 | 3300046459 | Bacteria | 3009 |
| 389 | Ga0495638_0001021 | 3300046460 | Bacteria | 27811 |
| 390 | Ga0495638_0102154 | 3300046460 | Bacteria | 1713 |
| 391 | Ga0495638_0126696 | 3300046460 | Bacteria | 1504 |
| 392 | Ga0495641_0006337 | 3300046461 | Bacteria | 7689 |
| 393 | Ga0495641_0018952 | 3300046461 | Bacteria | 3536 |
| 394 | Ga0495651_0003972 | 3300046462 | Bacteria | 11306 |
| 395 | Ga0495651_0008150 | 3300046462 | Bacteria | 8034 |
| 396 | Ga0495653_0012753 | 3300046463 | Bacteria | 6862 |
| 397 | Ga0495653_0025837 | 3300046463 | Bacteria | 4712 |
| 398 | Ga0495580_0284450 | 3300046472 | Bacteria | 1128 |
| 399 | Ga0495582_0024440 | 3300046473 | Bacteria | 3306 |
| 400 | Ga0495639_0002472 | 3300046475 | Bacteria | 8065 |
| 401 | Ga0495639_0027091 | 3300046475 | Bacteria | 2536 |
| 402 | Ga0495639_0080635 | 3300046475 | Bacteria | 1515 |
| 403 | Ga0495662_0121133 | 3300046476 | Bacteria | 1284 |
| 404 | Ga0495664_0065658 | 3300046477 | Bacteria | 2163 |
| 405 | Ga0495584_0078966 | 3300046491 | Bacteria | 1656 |
| 406 | Ga0495585_0047515 | 3300046492 | Bacteria | 2390 |
| 407 | Ga0495594_0046705 | 3300046499 | Bacteria | 2378 |
| 408 | Ga0495596_0019838 | 3300046500 | Bacteria | 2757 |
| 409 | Ga0495607_0052733 | 3300046501 | Bacteria | 2354 |
| 410 | Ga0495606_0021592 | 3300046507 | Bacteria | 4713 |
| 411 | Ga0495606_0050798 | 3300046507 | Bacteria | 2709 |
| 412 | Ga0495606_0204293 | 3300046507 | Bacteria | 1124 |
| 413 | Ga0495606_0247399 | 3300046507 | Bacteria | 991 |
| 414 | Ga0495608_0025279 | 3300046511 | Bacteria | 4053 |
| 415 | Ga0495608_0297531 | 3300046511 | Bacteria | 999 |
| 416 | Ga0495610_0013797 | 3300046512 | Bacteria | 4780 |
| 417 | Ga0495616_0117031 | 3300046513 | Bacteria | 1233 |
| 418 | Ga0495628_0005097 | 3300046516 | Bacteria | 11546 |
| 419 | Ga0495628_0076574 | 3300046516 | Bacteria | 2603 |
| 420 | Ga0495630_0060622 | 3300046517 | Bacteria | 2840 |
| 421 | Ga0495631_0122414 | 3300046518 | Bacteria | 1119 |
| 422 | Ga0495643_0063690 | 3300046522 | Bacteria | 1949 |
| 423 | Ga0495643_0187015 | 3300046522 | Bacteria | 1002 |
| 424 | Ga0495648_0002765 | 3300046524 | Bacteria | 15842 |
| 425 | Ga0495652_0036021 | 3300046529 | Bacteria | 4304 |
| 426 | Ga0495652_0036122 | 3300046529 | Bacteria | 4297 |
| 427 | Ga0495652_0140267 | 3300046529 | Bacteria | 1901 |
| 428 | Ga0495640_0034231 | 3300046533 | Bacteria | 3604 |
| 429 | Ga0495640_0036139 | 3300046533 | Bacteria | 3491 |
| 430 | Ga0495640_0043919 | 3300046533 | Bacteria | 3109 |
| 431 | Ga0495587_0018218 | 3300046536 | Bacteria | 4355 |
| 432 | Ga0495587_0078413 | 3300046536 | Bacteria | 1916 |
| 433 | Ga0495587_0156150 | 3300046536 | Bacteria | 1299 |
| 434 | Ga0495609_0047335 | 3300046538 | Bacteria | 1924 |
| 435 | Ga0495609_0060831 | 3300046538 | Bacteria | 1669 |
| 436 | Ga0495621_0021779 | 3300046539 | Bacteria | 2117 |
| 437 | Ga0495645_0020761 | 3300046543 | Bacteria | 4744 |
| 438 | Ga0495645_0057669 | 3300046543 | Bacteria | 2818 |
| 439 | Ga0495633_0104201 | 3300046558 | Bacteria | 1316 |
| 440 | Ga0495667_0005829 | 3300046559 | Bacteria | 8350 |
| 441 | Ga0495667_0038334 | 3300046559 | Bacteria | 3191 |
| 442 | Ga0495667_0126163 | 3300046559 | Bacteria | 1651 |
| 443 | Ga0495668_0020542 | 3300046616 | Bacteria | 3797 |
| 444 | Ga0495668_0100746 | 3300046616 | Bacteria | 1580 |
| 445 | Ga0495668_0117104 | 3300046616 | Bacteria | 1457 |
| 446 | Ga0495634_0015616 | 3300046642 | Bacteria | 5449 |
| 447 | Ga0495634_0180564 | 3300046642 | Bacteria | 1321 |
| 448 | Ga0495611_0063207 | 3300046648 | Bacteria | 1684 |
| 449 | Ga0495625_0104873 | 3300046660 | Bacteria | 1937 |
| 450 | Ga0495625_0134358 | 3300046660 | Bacteria | 1673 |
| 451 | Ga0495625_0283504 | 3300046660 | Bacteria | 1065 |
| 452 | Ga0495635_0003846 | 3300046663 | Bacteria | 10429 |
| 453 | Ga0495635_0273525 | 3300046663 | Bacteria | 1135 |
| 454 | Ga0495588_0014080 | 3300046674 | Bacteria | 3823 |
| 455 | Ga0495588_0054866 | 3300046674 | Bacteria | 2056 |
| 456 | Ga0495657_0003492 | 3300046675 | Bacteria | 12822 |
| 457 | Ga0495657_0006927 | 3300046675 | Bacteria | 8808 |
| 458 | Ga0495657_0068527 | 3300046675 | Bacteria | 2324 |
| 459 | Ga0495657_0135230 | 3300046675 | Bacteria | 1541 |
| 460 | Ga0495599_0001556 | 3300046678 | Bacteria | 13209 |
| 461 | Ga0495599_0022511 | 3300046678 | Bacteria | 3935 |
| 462 | Ga0495623_0002296 | 3300046679 | Bacteria | 12741 |
| 463 | Ga0495623_0009107 | 3300046679 | Bacteria | 6440 |
| 464 | Ga0495623_0122808 | 3300046679 | Bacteria | 1562 |
| 465 | Ga0495646_0001918 | 3300046680 | Bacteria | 12509 |
| 466 | Ga0495646_0011250 | 3300046680 | Bacteria | 5683 |
| 467 | Ga0495669_0059741 | 3300046684 | Bacteria | 1722 |
| 468 | Ga0495613_0030472 | 3300046689 | Bacteria | 4007 |
| 469 | Ga0495613_0032215 | 3300046689 | Bacteria | 3893 |
| 470 | Ga0495613_0054197 | 3300046689 | Bacteria | 2949 |
| 471 | Ga0495670_0093478 | 3300046691 | Bacteria | 1541 |
| 472 | Ga0495670_0169746 | 3300046691 | Bacteria | 1148 |
| 473 | Ga0495649_0062818 | 3300046694 | Bacteria | 1996 |
| 474 | Ga0495600_0002229 | 3300046809 | Bacteria | 11033 |
| 475 | Ga0495600_0077649 | 3300046809 | Bacteria | 2168 |
| 476 | Ga0495600_0088708 | 3300046809 | Bacteria | 2017 |
| 477 | Ga0495581_0016881 | 3300047315 | Bacteria | 4243 |
| 478 | Ga0495604_0005469 | 3300047317 | Bacteria | 10075 |
| 479 | Ga0495604_0007916 | 3300047317 | Bacteria | 8417 |
| 480 | Ga0495604_0064832 | 3300047317 | Bacteria | 2782 |
| 481 | Ga0495674_0020768 | 3300047319 | Bacteria | 6080 |
| 482 | Ga0495674_0021792 | 3300047319 | Bacteria | 5921 |
| 483 | Ga0495674_0060078 | 3300047319 | Bacteria | 3317 |
| 484 | Ga0495674_0087826 | 3300047319 | Bacteria | 2660 |
| 485 | Ga0495672_0139134 | 3300047320 | Bacteria | 1270 |
| 486 | Ga0495676_0029475 | 3300047321 | Bacteria | 4672 |
| 487 | Ga0495680_0012862 | 3300047322 | Bacteria | 7332 |
| 488 | Ga0495680_0032224 | 3300047322 | Bacteria | 4257 |
| 489 | Ga0495683_0066605 | 3300047323 | Bacteria | 1774 |
| 490 | Ga0495675_0002807 | 3300047444 | Bacteria | 10441 |
| 491 | Ga0495675_0003321 | 3300047444 | Bacteria | 9678 |
| 492 | Ga0495681_0082699 | 3300047470 | Bacteria | 1430 |
| 493 | Ga0495684_0000893 | 3300047471 | Bacteria | 24119 |
| 494 | Ga0495684_0009436 | 3300047471 | Bacteria | 7533 |
| 495 | Ga0495684_0043713 | 3300047471 | Bacteria | 3431 |
| 496 | Ga0495686_0073671 | 3300047472 | Bacteria | 2097 |
| 497 | Ga0495686_0083618 | 3300047472 | Bacteria | 1946 |
| 498 | Ga0495593_0005088 | 3300047673 | Bacteria | 7774 |
| 499 | Ga0495602_0030283 | 3300048088 | Bacteria | 5136 |
| 500 | Ga0495602_0049097 | 3300048088 | Bacteria | 3783 |
| 501 | Ga0495602_0073245 | 3300048088 | Bacteria | 2916 |
| 502 | Ga0495602_0086090 | 3300048088 | Bacteria | 2624 |
| 503 | Ga0496100_0026796 | 3300048903 | Bacteria | 3537 |
| 504 | Ga0496100_0054241 | 3300048903 | Bacteria | 2614 |
| 505 | Ga0496100_0279396 | 3300048903 | Bacteria | 1244 |
| 506 | Ga0496101_0005889 | 3300048904 | Bacteria | 7849 |
| 507 | Ga0496101_0040575 | 3300048904 | Bacteria | 3315 |
| 508 | Ga0496101_0138157 | 3300048904 | Bacteria | 1856 |
| 509 | Ga0496102_0018779 | 3300048905 | Bacteria | 6081 |
| 510 | Ga0496102_0079901 | 3300048905 | Bacteria | 3012 |
| 511 | Ga0496102_0162404 | 3300048905 | Bacteria | 2102 |
| 512 | Ga0496102_0222773 | 3300048905 | Bacteria | 1778 |
| 513 | Ga0496102_0262307 | 3300048905 | Bacteria | 1629 |
| 514 | Ga0496102_0512470 | 3300048905 | Bacteria | 1122 |
| 515 | Ga0496103_0005710 | 3300048906 | Bacteria | 7435 |
| 516 | Ga0496103_0067665 | 3300048906 | Bacteria | 2231 |
| 517 | Ga0496104_0015916 | 3300048907 | Bacteria | 6825 |
| 518 | Ga0496104_0119316 | 3300048907 | Bacteria | 2532 |
| 519 | Ga0496105_0034901 | 3300048908 | Bacteria | 4138 |
| 520 | Ga0496105_0051207 | 3300048908 | Bacteria | 3411 |
| 521 | Ga0496105_0171635 | 3300048908 | Bacteria | 1777 |
| 522 | Ga0496106_0000649 | 3300048909 | Bacteria | 24884 |
| 523 | Ga0496106_0032306 | 3300048909 | Bacteria | 3902 |
| 524 | Ga0496106_0049265 | 3300048909 | Bacteria | 3173 |
| 525 | Ga0496106_0226889 | 3300048909 | Bacteria | 1490 |
| 526 | Ga0496107_0037532 | 3300048910 | Bacteria | 3477 |
| 527 | Ga0496107_0051082 | 3300048910 | Bacteria | 2981 |
| 528 | Ga0496107_0173474 | 3300048910 | Bacteria | 1600 |
| 529 | Ga0496108_0065905 | 3300048911 | Bacteria | 3053 |
| 530 | Ga0496109_0044561 | 3300048912 | Bacteria | 4024 |
| 531 | Ga0496109_0174830 | 3300048912 | Bacteria | 2015 |
| 532 | Ga0496110_0013275 | 3300048913 | Bacteria | 6803 |
| 533 | Ga0496110_0021544 | 3300048913 | Bacteria | 5460 |
| 534 | Ga0496110_0051830 | 3300048913 | Bacteria | 3606 |
| 535 | Ga0496110_0100133 | 3300048913 | Bacteria | 2598 |
| 536 | Ga0496110_0199664 | 3300048913 | Bacteria | 1817 |
| 537 | Ga0496110_0431895 | 3300048913 | Bacteria | 1200 |
| 538 | Ga0496111_0203791 | 3300048914 | Bacteria | 1470 |
| 539 | Ga0496111_0282788 | 3300048914 | Bacteria | 1230 |
| 540 | Ga0496112_0000008 | 3300048915 | Bacteria | 310323 |
| 541 | Ga0496112_0035784 | 3300048915 | Bacteria | 4839 |
| 542 | Ga0496113_0013405 | 3300048916 | Bacteria | 5553 |
| 543 | Ga0496113_0066226 | 3300048916 | Bacteria | 2735 |
| 544 | Ga0496113_0083617 | 3300048916 | Bacteria | 2449 |
| 545 | Ga0496113_0092620 | 3300048916 | Bacteria | 2331 |
| 546 | Ga0496114_0015763 | 3300048917 | Bacteria | 6082 |
| 547 | Ga0496114_0028100 | 3300048917 | Bacteria | 4613 |
| 548 | Ga0496114_0071880 | 3300048917 | Bacteria | 2908 |
| 549 | Ga0496114_0195583 | 3300048917 | Bacteria | 1770 |
| 550 | Ga0496115_0007272 | 3300048918 | Bacteria | 8144 |
| 551 | Ga0496115_0142336 | 3300048918 | Bacteria | 1979 |
| 552 | Ga0496115_0306974 | 3300048918 | Bacteria | 1300 |
| 553 | Ga0496116_0003364 | 3300048919 | Bacteria | 15879 |
| 554 | Ga0496117_0035578 | 3300048920 | Bacteria | 3736 |
| 555 | Ga0496117_0047573 | 3300048920 | Bacteria | 3074 |
| 556 | Ga0496117_0166291 | 3300048920 | Bacteria | 1286 |
| 557 | Ga0496118_0095087 | 3300048921 | Bacteria | 2035 |
| 558 | Ga0496118_0099053 | 3300048921 | Bacteria | 1977 |
| 559 | Ga0496118_0156878 | 3300048921 | Bacteria | 1414 |
| 560 | Ga0496118_0205002 | 3300048921 | Bacteria | 1163 |
| 561 | Ga0496120_0060061 | 3300048923 | Bacteria | 2128 |
| 562 | Ga0496120_0070691 | 3300048923 | Bacteria | 1919 |
| 563 | Ga0496121_0000476 | 3300048924 | Bacteria | 78015 |
| 564 | Ga0496121_0001497 | 3300048924 | Bacteria | 39336 |
| 565 | Ga0496121_0001742 | 3300048924 | Bacteria | 35564 |
| 566 | Ga0496121_0003089 | 3300048924 | Bacteria | 24095 |
| 567 | Ga0496121_0015642 | 3300048924 | Bacteria | 7916 |
| 568 | Ga0496121_0017380 | 3300048924 | Bacteria | 7352 |
| 569 | Ga0496121_0037277 | 3300048924 | Bacteria | 4321 |
| 570 | Ga0496121_0050475 | 3300048924 | Bacteria | 3514 |
| 571 | Ga0496121_0050757 | 3300048924 | Bacteria | 3501 |
| 572 | Ga0496121_0077328 | 3300048924 | Bacteria | 2650 |
| 573 | Ga0496121_0124804 | 3300048924 | Bacteria | 1937 |
| 574 | Ga0496121_0267741 | 3300048924 | Bacteria | 1176 |
| 575 | Ga0496121_0281920 | 3300048924 | Bacteria | 1136 |
| 576 | Ga0496122_0024662 | 3300048925 | Bacteria | 5257 |
| 577 | Ga0496122_0189533 | 3300048925 | Bacteria | 1216 |
| 578 | Ga0496124_0001128 | 3300048927 | Bacteria | 42017 |
| 579 | Ga0496124_0127389 | 3300048927 | Bacteria | 2027 |
| 580 | Ga0496125_0000154 | 3300048928 | Bacteria | 152240 |
| 581 | Ga0496125_0118101 | 3300048928 | Bacteria | 1900 |
| 582 | Ga0496126_0002744 | 3300048929 | Bacteria | 23267 |
| 583 | Ga0496126_0006113 | 3300048929 | Bacteria | 13500 |
| 584 | Ga0496126_0007435 | 3300048929 | Bacteria | 12015 |
| 585 | Ga0496126_0015910 | 3300048929 | Bacteria | 7552 |
| 586 | Ga0496126_0020832 | 3300048929 | Bacteria | 6418 |
| 587 | Ga0496126_0032430 | 3300048929 | Bacteria | 4920 |
| 588 | Ga0496126_0039244 | 3300048929 | Bacteria | 4396 |
| 589 | Ga0496126_0134713 | 3300048929 | Bacteria | 2132 |
| 590 | Ga0496126_0140461 | 3300048929 | Bacteria | 2079 |
| 591 | Ga0496126_0182221 | 3300048929 | Bacteria | 1783 |
| 592 | Ga0496126_0199175 | 3300048929 | Bacteria | 1692 |
| 593 | Ga0496126_0200806 | 3300048929 | Bacteria | 1684 |
| 594 | Ga0496126_0214027 | 3300048929 | Bacteria | 1621 |
| 595 | Ga0496126_0281315 | 3300048929 | Bacteria | 1378 |
| 596 | Ga0495682_0026452 | 3300049460 | Bacteria | 2154 |
| 597 | Ga0501031_0009852 | 3300049568 | Bacteria | 6221 |
| 598 | Ga0501031_0022023 | 3300049568 | Bacteria | 4153 |
| 599 | Ga0501032_0003534 | 3300049569 | Bacteria | 11926 |
| 600 | Ga0501032_0046657 | 3300049569 | Bacteria | 2927 |
| 601 | Ga0501033_0000249 | 3300049570 | Bacteria | 52045 |
| 602 | Ga0501033_0036543 | 3300049570 | Bacteria | 3680 |
| 603 | Ga0501033_0057802 | 3300049570 | Bacteria | 2865 |
| 604 | Ga0501033_0169880 | 3300049570 | Bacteria | 1566 |
| 605 | Ga0501033_0191694 | 3300049570 | Bacteria | 1462 |
| 606 | Ga0501034_0001938 | 3300049571 | Bacteria | 26206 |
| 607 | Ga0501034_0063839 | 3300049571 | Bacteria | 3696 |
| 608 | Ga0501034_0150382 | 3300049571 | Bacteria | 2304 |
| 609 | Ga0501034_0276657 | 3300049571 | Bacteria | 1618 |
| 610 | Ga0501036_0004433 | 3300049572 | Bacteria | 11343 |
| 611 | Ga0501036_0005117 | 3300049572 | Bacteria | 10599 |
| 612 | Ga0501036_0026547 | 3300049572 | Bacteria | 4889 |
| 613 | Ga0501036_0190494 | 3300049572 | Bacteria | 1725 |
| 614 | Ga0501037_0000112 | 3300049573 | Bacteria | 75698 |
| 615 | Ga0501037_0025895 | 3300049573 | Bacteria | 4332 |
| 616 | Ga0501037_0091560 | 3300049573 | Bacteria | 2199 |
| 617 | Ga0501037_0152526 | 3300049573 | Bacteria | 1651 |
| 618 | Ga0501038_0000160 | 3300049574 | Bacteria | 57443 |
| 619 | Ga0501038_0049308 | 3300049574 | Bacteria | 3641 |
| 620 | Ga0501039_0011683 | 3300049575 | Bacteria | 6689 |
| 621 | Ga0501040_0002958 | 3300049576 | Bacteria | 10996 |
| 622 | Ga0501042_0074151 | 3300049578 | Bacteria | 2435 |
| 623 | Ga0501043_0000278 | 3300049579 | Bacteria | 46214 |
| 624 | Ga0501043_0022578 | 3300049579 | Bacteria | 4933 |
| 625 | Ga0501046_0000937 | 3300049580 | Bacteria | 28581 |
| 626 | Ga0501046_0008812 | 3300049580 | Bacteria | 8763 |
| 627 | Ga0501047_0000275 | 3300049581 | Bacteria | 59536 |
| 628 | Ga0501047_0003622 | 3300049581 | Bacteria | 14557 |
| 629 | Ga0501047_0009938 | 3300049581 | Bacteria | 8998 |
| 630 | Ga0501047_0018665 | 3300049581 | Bacteria | 6650 |
| 631 | Ga0501047_0099683 | 3300049581 | Bacteria | 2784 |
| 632 | Ga0501047_0101290 | 3300049581 | Bacteria | 2760 |
| 633 | Ga0501047_0102492 | 3300049581 | Bacteria | 2741 |
| 634 | Ga0501047_0265762 | 3300049581 | Bacteria | 1562 |
| 635 | Ga0501047_0347074 | 3300049581 | Bacteria | 1321 |
| 636 | Ga0501048_0001248 | 3300049582 | Bacteria | 19253 |
| 637 | Ga0501048_0011414 | 3300049582 | Bacteria | 6626 |
| 638 | Ga0501048_0068204 | 3300049582 | Bacteria | 2513 |
| 639 | Ga0501067_0000258 | 3300049583 | Bacteria | 28937 |
| 640 | Ga0501067_0022138 | 3300049583 | Bacteria | 3516 |
| 641 | Ga0501068_0004146 | 3300049584 | Bacteria | 7852 |
| 642 | Ga0501068_0084222 | 3300049584 | Bacteria | 1955 |
| 643 | Ga0501070_0002548 | 3300049586 | Bacteria | 15964 |
| 644 | Ga0501070_0024977 | 3300049586 | Bacteria | 5011 |
| 645 | Ga0501070_0032601 | 3300049586 | Bacteria | 4360 |
| 646 | Ga0501070_0053073 | 3300049586 | Bacteria | 3364 |
| 647 | Ga0501070_0093858 | 3300049586 | Bacteria | 2482 |
| 648 | Ga0501071_0206207 | 3300049587 | Bacteria | 1477 |
| 649 | Ga0501072_0002502 | 3300049588 | Bacteria | 13767 |
| 650 | Ga0501072_0002947 | 3300049588 | Bacteria | 12810 |
| 651 | Ga0501072_0006863 | 3300049588 | Bacteria | 8639 |
| 652 | Ga0501073_0000103 | 3300049589 | Bacteria | 53962 |
| 653 | Ga0501073_0014367 | 3300049589 | Bacteria | 5752 |
| 654 | Ga0501073_0039136 | 3300049589 | Bacteria | 3361 |
| 655 | Ga0501073_0086595 | 3300049589 | Bacteria | 2179 |
| 656 | Ga0501073_0180032 | 3300049589 | Bacteria | 1463 |
| 657 | Ga0501074_0000456 | 3300049590 | Bacteria | 24566 |
| 658 | Ga0501074_0001612 | 3300049590 | Bacteria | 15274 |
| 659 | Ga0501074_0057260 | 3300049590 | Bacteria | 2808 |
| 660 | Ga0501074_0057827 | 3300049590 | Bacteria | 2794 |
| 661 | Ga0501074_0081415 | 3300049590 | Bacteria | 2322 |
| 662 | Ga0501075_0003570 | 3300049591 | Bacteria | 10418 |
| 663 | Ga0501076_0053630 | 3300049592 | Bacteria | 3195 |
| 664 | Ga0501079_0000451 | 3300049741 | Bacteria | 26871 |
| 665 | Ga0501079_0124241 | 3300049741 | Bacteria | 2007 |
| 666 | Ga0501080_0000082 | 3300049742 | Bacteria | 63972 |
| 667 | Ga0501080_0002998 | 3300049742 | Bacteria | 14886 |
| 668 | Ga0501080_0034657 | 3300049742 | Bacteria | 4714 |
| 669 | Ga0501081_0192605 | 3300049743 | Bacteria | 1477 |
| 670 | Ga0501083_0013394 | 3300049744 | Bacteria | 5732 |
| 671 | Ga0501083_0013677 | 3300049744 | Bacteria | 5675 |
| 672 | Ga0501083_0053952 | 3300049744 | Bacteria | 2698 |
| 673 | Ga0501083_0268914 | 3300049744 | Bacteria | 1109 |
| 674 | Ga0501035_0000766 | 3300049822 | Bacteria | 34513 |
| 675 | Ga0501035_0004610 | 3300049822 | Bacteria | 13074 |
| 676 | Ga0501035_0110139 | 3300049822 | Bacteria | 2413 |
| 677 | Ga0501035_0164948 | 3300049822 | Bacteria | 1916 |
| 678 | Ga0501035_0231809 | 3300049822 | Bacteria | 1573 |
| 679 | Ga0501044_0000418 | 3300049823 | Bacteria | 52554 |
| 680 | Ga0501044_0028251 | 3300049823 | Bacteria | 5921 |
| 681 | Ga0501044_0034063 | 3300049823 | Bacteria | 5345 |
| 682 | Ga0501044_0124034 | 3300049823 | Bacteria | 2581 |
| 683 | Ga0501044_0124517 | 3300049823 | Bacteria | 2576 |
| 684 | Ga0501044_0189651 | 3300049823 | Bacteria | 2019 |
| 685 | Ga0501045_0003999 | 3300049824 | Bacteria | 10152 |
| 686 | Ga0501045_0012804 | 3300049824 | Bacteria | 5910 |
| 687 | Ga0501045_0054354 | 3300049824 | Bacteria | 2927 |
| 688 | nmdc:mga03683_35265_c1 | 3300050489 | Bacteria | 2028 |
| 689 | nmdc:mga00v17_38224_c1 | 3300050491 | Bacteria | 2869 |
| 690 | nmdc:mga0yw44_11164_c1 | 3300050492 | Bacteria | 4621 |
| 691 | nmdc:mga0yw44_1397_c1 | 3300050492 | Bacteria | 9573 |
| 692 | nmdc:mga0yw44_20742_c1 | 3300050492 | Bacteria | 3653 |
| 693 | nmdc:mga0yw44_21662_c1 | 3300050492 | Bacteria | 2327 |
| 694 | nmdc:mga0k408_163396_c1 | 3300050493 | Bacteria | 1327 |
| 695 | nmdc:mga06z11_84367_c1 | 3300050494 | Bacteria | 1712 |
| 696 | nmdc:mga06z11_96152_c1 | 3300050494 | Bacteria | 1617 |
| 697 | nmdc:mga07m45_45292_c1 | 3300050496 | Bacteria | 2470 |
| 698 | nmdc:mga05p37_62404_c1 | 3300050507 | Bacteria | 4586 |
| 699 | nmdc:mga08y16_184530_c1 | 3300050511 | Bacteria | 2165 |
| 700 | nmdc:mga0n895_58282_c1 | 3300050512 | Bacteria | 3807 |
| 701 | nmdc:mga0rr50_138146_c1 | 3300050513 | Bacteria | 1958 |
| 702 | nmdc:mga0rr50_27857_c1 | 3300050513 | Bacteria | 3963 |
| 703 | nmdc:mga0a205_387614_c1 | 3300050515 | Bacteria | 1262 |
| 704 | Ga0495601_0009529 | 3300053077 | Bacteria | 5749 |
| 705 | Ga0495612_0030040 | 3300053078 | Bacteria | 2189 |
| 706 | Ga0500635_0033309 | 3300053080 | Bacteria | 1680 |
| 707 | Ga0495655_0015009 | 3300053083 | Bacteria | 1637 |
| 708 | Ga0495595_0002085 | 3300053084 | Bacteria | 7774 |
| 709 | Ga0495619_0005598 | 3300053085 | Bacteria | 7970 |
| 710 | Ga0495619_0104527 | 3300053085 | Bacteria | 1930 |
| 711 | Ga0495619_0105479 | 3300053085 | Bacteria | 1921 |
| 712 | Ga0495619_0257420 | 3300053085 | Bacteria | 1209 |
| 713 | Ga0500578_0082036 | 3300053086 | Bacteria | 2050 |
| 714 | Ga0500643_005226 | 3300053087 | Bacteria | 5646 |
| 715 | Ga0500643_060145 | 3300053087 | Bacteria | 1068 |
| 716 | Ga0500644_0112491 | 3300053088 | Bacteria | 1050 |
| 717 | Ga0500647_0094389 | 3300053091 | Bacteria | 1431 |
| 718 | Ga0500647_0134900 | 3300053091 | Bacteria | 1162 |
| 719 | Ga0500566_0000157 | 3300053094 | Bacteria | 34534 |
| 720 | Ga0500566_0000185 | 3300053094 | Bacteria | 32171 |
| 721 | Ga0500566_0001146 | 3300053094 | Bacteria | 15389 |
| 722 | Ga0500566_0001213 | 3300053094 | Bacteria | 15085 |
| 723 | Ga0500566_0068124 | 3300053094 | Bacteria | 2002 |
| 724 | Ga0500566_0102983 | 3300053094 | Bacteria | 1562 |
| 725 | Ga0500641_0004632 | 3300053096 | Bacteria | 4861 |
| 726 | Ga0500650_0004834 | 3300053098 | Bacteria | 4933 |
| 727 | Ga0500556_0006938 | 3300053104 | Bacteria | 3227 |
| 728 | Ga0500562_044263 | 3300053108 | Bacteria | 1185 |
| 729 | Ga0500569_007652 | 3300053109 | Bacteria | 2434 |
| 730 | Ga0500572_000384 | 3300053111 | Bacteria | 15705 |
| 731 | Ga0500594_0016712 | 3300053118 | Bacteria | 1787 |
| 732 | Ga0500595_003818 | 3300053119 | Bacteria | 6928 |
| 733 | Ga0500595_006228 | 3300053119 | Bacteria | 5095 |
| 734 | Ga0500595_022133 | 3300053119 | Bacteria | 2256 |
| 735 | Ga0500595_075549 | 3300053119 | Bacteria | 993 |
| 736 | Ga0500607_081709 | 3300053121 | Bacteria | 1646 |
| 737 | Ga0500608_000908 | 3300053122 | Bacteria | 10662 |
| 738 | Ga0500608_056020 | 3300053122 | Bacteria | 1889 |
| 739 | Ga0500614_001219 | 3300053123 | Bacteria | 6263 |
| 740 | Ga0500652_000531 | 3300053131 | Bacteria | 13423 |
| 741 | Ga0500658_0004847 | 3300053134 | Bacteria | 5018 |
| 742 | Ga0500658_0155431 | 3300053134 | Bacteria | 1033 |
| 743 | Ga0500559_0000863 | 3300053136 | Bacteria | 19480 |
| 744 | Ga0500559_0002089 | 3300053136 | Bacteria | 10664 |
| 745 | Ga0500559_0004212 | 3300053136 | Bacteria | 6885 |
| 746 | Ga0500559_0049182 | 3300053136 | Bacteria | 1856 |
| 747 | Ga0500568_0002109 | 3300053139 | Bacteria | 12007 |
| 748 | Ga0500568_0018137 | 3300053139 | Bacteria | 3088 |
| 749 | Ga0500573_0093412 | 3300053140 | Bacteria | 1697 |
| 750 | Ga0500577_0000693 | 3300053142 | Bacteria | 8639 |
| 751 | Ga0500603_002337 | 3300053150 | Bacteria | 4164 |
| 752 | Ga0500603_061618 | 3300053150 | Bacteria | 1050 |
| 753 | Ga0500604_0005246 | 3300053151 | Bacteria | 3425 |
| 754 | Ga0500616_0000180 | 3300053153 | Bacteria | 106053 |
| 755 | Ga0500619_020846 | 3300053154 | Bacteria | 1879 |
| 756 | Ga0500620_013290 | 3300053155 | Bacteria | 2267 |
| 757 | Ga0500622_0012310 | 3300053156 | Bacteria | 4635 |
| 758 | Ga0500627_0030591 | 3300053158 | Bacteria | 2255 |
| 759 | Ga0500630_137357 | 3300053159 | Bacteria | 1057 |
| 760 | Ga0500633_0115050 | 3300053160 | Bacteria | 998 |
| 761 | Ga0500634_0039122 | 3300053161 | Bacteria | 2578 |
| 762 | Ga0500638_001014 | 3300053162 | Bacteria | 8145 |
| 763 | Ga0500639_000010 | 3300053163 | Bacteria | 136747 |
| 764 | Ga0500636_0001916 | 3300053177 | Bacteria | 11425 |
| 765 | Ga0500637_0000121 | 3300053178 | Bacteria | 28204 |
| 766 | Ga0500637_0029199 | 3300053178 | Bacteria | 3057 |
| 767 | Ga0500609_006195 | 3300053731 | Bacteria | 1630 |
| 768 | Ga0500596_000760 | 3300053735 | Bacteria | 6344 |
| 769 | Ga0500596_002495 | 3300053735 | Bacteria | 3628 |
| 770 | Ga0500601_000076 | 3300053737 | Bacteria | 20083 |
| 771 | Ga0501084_0003972 | 3300054114 | Bacteria | 12046 |
| 772 | Ga0501084_0039395 | 3300054114 | Bacteria | 3953 |
| 773 | Ga0500661_000452 | 3300055283 | Bacteria | 7586 |
| 774 | Ga0501082_0029862 | 3300060353 | Bacteria | 4696 |
| 775 | Ga0501082_0070440 | 3300060353 | Bacteria | 3011 |
| 776 | Ga0501082_0089240 | 3300060353 | Bacteria | 2661 |
| 777 | Ga0530510_0066561 | 3300061734 | Bacteria | 2612 |
| 778 | 2509148873 | 2508501128 | Bacteria | 8613869 |
| 779 | 2513655024 | 2513237096 | Bacteria | 8722461 |
| 780 | 2513677794 | 2513237098 | Bacteria | 9902361 |
| 781 | 2513697430 | 2513237101 | Bacteria | 7952346 |
| 782 | 2513716916 | 2513237104 | Bacteria | 10034502 |
| 783 | 2513861039 | 2513237137 | Bacteria | 9558895 |
| 784 | 2513892083 | 2513237141 | Bacteria | 8496279 |
| 785 | 2513915953 | 2513237145 | Bacteria | 8979722 |
| 786 | 2517100589 | 2517093001 | Bacteria | 9002274 |
| 787 | 2517894741 | 2517572143 | Bacteria | 9484767 |
| 788 | 2524438187 | 2524023205 | Bacteria | 8918781 |
| 789 | 2524464073 | 2524023210 | Bacteria | 9029266 |
| 790 | 2524534490 | 2524023228 | Bacteria | 10118060 |
| 791 | 2528849822 | 2528768022 | Bacteria | 10457665 |
| 792 | 2603862619 | 2602042107 | Bacteria | 6226103 |
| 793 | 2617350774 | 2617270735 | Bacteria | 9163226 |
| 794 | 2644287350 | 2643221651 | Bacteria | 4798932 |
| 795 | 2671119155 | 2667528175 | Bacteria | 7532676 |
| 796 | 2728747604 | 2728368998 | Bacteria | 8720350 |
| 797 | 2738744680 | 2738541281 | Bacteria | 5112672 |
| 798 | 2739353910 | 2738543032 | Bacteria | 5115625 |
| 799 | 2745076931 | 2744054633 | Bacteria | 8678936 |
| 800 | 2793071216 | 2791355197 | Bacteria | 8420563 |
| 801 | 2824668264 | 2824661429 | Bacteria | 9877870 |
| 802 | 2824780544 | 2824773399 | Bacteria | 8360218 |
| 803 | 2841960220 | 2841957949 | Bacteria | 8652217 |
| 804 | 2857529967 | 2857524615 | Bacteria | 6615449 |
| 805 | 2874612591 | 2874604998 | Bacteria | 7834745 |
| 806 | 2876812895 | 2876808645 | Bacteria | 8824342 |
| 807 | 2879101351 | 2879099564 | Bacteria | 10442239 |
| 808 | 2879118032 | 2879110137 | Bacteria | 8907982 |
| 809 | 2881370679 | 2881364244 | Bacteria | 7710352 |
| 810 | 2885378764 | 2885374607 | Bacteria | 8927485 |
| 811 | 2885384488 | 2885383462 | Bacteria | 9473874 |
| 812 | 2889033620 | 2889033259 | Bacteria | 9099371 |
| 813 | 2893069390 | 2893066018 | Bacteria | 6158120 |
| 814 | 2903751424 | 2903748898 | Bacteria | 9972761 |
| 815 | 2903773624 | 2903768456 | Bacteria | 9749579 |
| 816 | 2904697725 | 2904690495 | Bacteria | 9412302 |
| 817 | 2904705787 | |||
| 818 | 2906611461 | |||
| 819 | 2906641701 | 2906635258 | Bacteria | 8601019 |
| 820 | 2906660803 | 2906660503 | Bacteria | 8595048 |
| 821 | 2908745053 | 2908739725 | Bacteria | 8628932 |
| 822 | 2908757178 | 2908756301 | Bacteria | 8864324 |
| 823 | 2919077179 | 2919073203 | Bacteria | 6531949 |
| 824 | 2922366989 | 2922361189 | Bacteria | 7436256 |
| 825 | 2922371194 | |||
| 826 | 2922390230 | 2922386360 | Bacteria | 7017218 |
| 827 | 2922427896 | |||
| 828 | 2929619578 | 2929615660 | Bacteria | 9193770 |
| 829 | 2929627952 | 2929624759 | Bacteria | 9339455 |
| 830 | 2932785908 | 2932784394 | Bacteria | 9704911 |
| 831 | 2932817279 | 2932809354 | Bacteria | 9135765 |
| 832 | 2932826876 | 2932818245 | Bacteria | 9955613 |
| 833 | 2932830952 | 2932828146 | Bacteria | 9745859 |
| 834 | 2933581498 | 2933577622 | Bacteria | 9116884 |
| 835 | 2935621017 | 2935616580 | Bacteria | 9032984 |
| 836 | 2935632176 | 2935630451 | Bacteria | 8169952 |
| 837 | 2935640093 | 2935638405 | Bacteria | 10015038 |
| 838 | 2935667068 | 2935665750 | Bacteria | 9571747 |
| 839 | 2935690200 | 2935684952 | Bacteria | 9590419 |
| 840 | 2935699714 | 2935694250 | Bacteria | 9291695 |
| 841 | 2935704824 | 2935703347 | Bacteria | 10242284 |
| 842 | 2935718103 | 2935713505 | Bacteria | 9608509 |
| 843 | 2935726747 | 2935722832 | Bacteria | 9608746 |
| 844 | 2935735516 | 2935732158 | Bacteria | 9706831 |
| 845 | 2935745213 | 2935741537 | Bacteria | 9707219 |
| 846 | 2935755211 | 2935750917 | Bacteria | 9590372 |
| 847 | 2935762272 | 2935760218 | Bacteria | 9817913 |
| 848 | 2935803774 | 2935801545 | Bacteria | 9301974 |
| 849 | 2935811690 | 2935810662 | Bacteria | 9401221 |
| 850 | 2935829576 | 2935827899 | Bacteria | 10038562 |
| 851 | 2935843090 | 2935837841 | Bacteria | 9454360 |
| 852 | 2935858824 | 2935855204 | Bacteria | 9035059 |
| 853 | 2935866778 | 2935864058 | Bacteria | 9784707 |
| 854 | 2935876909 | 2935873716 | Bacteria | 9632195 |
| 855 | 2935962046 | 2935959822 | Bacteria | 7869783 |
| 856 | 2935993454 | 2935992306 | Bacteria | 9802711 |
| 857 | 2936004349 | 2936002035 | Bacteria | 9362176 |
| 858 | 2936038272 | 2936037263 | Bacteria | 9446081 |
| 859 | 2940561508 | 2940556831 | Bacteria | 9590747 |
| 860 | 2941508124 | 2941507105 | Bacteria | 8166816 |
| 861 | 2941515371 | 2941515067 | Bacteria | 8166720 |
| 862 | 2941524054 | 2941523033 | Bacteria | 8169134 |
| 863 | 2941544314 | 2941538514 | Bacteria | 9402094 |
| 864 | 3005477606 | 3005474847 | Bacteria | 9259049 |
| 865 | 8006933611 | 8006933436 | Bacteria | 10410654 |
| 866 | 8006966525 | 8006964411 | Bacteria | 8966052 |
| 867 | 8006983284 | 8006973647 | Bacteria | 10679141 |
| 868 | 8016516433 | 8016511872 | Bacteria | 9921665 |
| 869 | 8017060104 | 8017057580 | Bacteria | 10023680 |
| 870 | 8019559548 | 8019555841 | Bacteria | 9642137 |
| 871 | 8019579614 | 8019576017 | Bacteria | 10049540 |
| 872 | 8019587325 | 8019586578 | Bacteria | 10212056 |
| 873 | 8019604016 | 8019597564 | Bacteria | 10041141 |
| 874 | 8019614512 | 8019608314 | Bacteria | 10042931 |
| 875 | 8055749164 | 8055742211 | Bacteria | 9226248 |
| 876 | 8056682384 | 8056681323 | Bacteria | 8472857 |
| 877 | JGI24735J21928_10027115 | |||
| 878 | JGI24740J21852_10002709 | |||
| 879 | JGI25406J46586_10000580 | |||
| 880 | JGI25406J46586_10003218 | |||
| 881 | JGI25153J46596_10026817 | |||
| 882 | Ga0065165_1004626 | |||
| 883 | Ga0070658_10345549 | |||
| 884 | Ga0070676_10075380 | |||
| 885 | Ga0070680_100035140 | |||
| 886 | Ga0068868_100222858 | |||
| 887 | Ga0070661_100073464 | |||
| 888 | Ga0070668_100013894 | |||
| 889 | Ga0070668_100124046 | |||
| 890 | Ga0070669_100097454 | |||
| 891 | Ga0070675_100136583 | |||
| 892 | Ga0070667_100002825 | |||
| 893 | Ga0070667_100232022 | |||
| 894 | Ga0070709_10001417 | |||
| 895 | Ga0070709_10007249 | |||
| 896 | Ga0070709_10074270 | |||
| 897 | Ga0070709_10078605 | |||
| 898 | Ga0070714_100000678 | |||
| 899 | Ga0070714_100018262 | |||
| 900 | Ga0070714_100048804 | |||
| 901 | Ga0070714_100073222 | |||
| 902 | Ga0070714_100143902 | |||
| 903 | Ga0070714_100537798 | |||
| 904 | Ga0070713_100022313 | |||
| 905 | Ga0070713_100094802 | |||
| 906 | Ga0070713_100193256 | |||
| 907 | Ga0070713_100441823 | |||
| 908 | Ga0070710_10000633 | |||
| 909 | Ga0070710_10002407 | |||
| 910 | Ga0070711_100001478 | |||
| 911 | Ga0070711_100002216 | |||
| 912 | Ga0070711_100011186 | |||
| 913 | Ga0070711_100027775 | |||
| 914 | Ga0070711_100063136 | |||
| 915 | Ga0070711_100242665 | |||
| 916 | Ga0070663_100047179 | |||
| 917 | Ga0070663_100062516 | |||
| 918 | Ga0070663_100149106 | |||
| 919 | Ga0070662_100126252 | |||
| 920 | Ga0070662_100301890 | |||
| 921 | Ga0070679_100024858 | |||
| 922 | Ga0070679_100128043 | |||
| 923 | Ga0070684_100005206 | |||
| 924 | Ga0070684_100287733 | |||
| 925 | Ga0070684_100300141 | |||
| 926 | Ga0068853_100010311 | |||
| 927 | Ga0068853_100020454 | |||
| 928 | Ga0068853_100038556 | |||
| 929 | Ga0070693_100191171 | |||
| 930 | Ga0070665_100002023 | |||
| 931 | Ga0070665_100028235 | |||
| 932 | Ga0068855_100038269 | |||
| 933 | Ga0068855_100049698 | |||
| 934 | Ga0068855_100061366 | |||
| 935 | Ga0068855_100079756 | |||
| 936 | Ga0068855_100436494 | |||
| 937 | Ga0068857_100012881 | |||
| 938 | Ga0068857_100028021 | |||
| 939 | Ga0068857_100102380 | |||
| 940 | Ga0068854_100054912 | |||
| 941 | Ga0068856_100042057 | |||
| 942 | Ga0068856_100096425 | |||
| 943 | Ga0070702_100068321 | |||
| 944 | Ga0068852_100164733 | |||
| 945 | Ga0068859_100002355 | |||
| 946 | Ga0068859_100069977 | |||
| 947 | Ga0068864_100047790 | |||
| 948 | Ga0068864_100129816 | |||
| 949 | Ga0068861_100032076 | |||
| 950 | Ga0068851_10001608 | |||
| 951 | Ga0068863_100050347 | |||
| 952 | Ga0068858_100021103 | |||
| 953 | Ga0068858_100293748 | |||
| 954 | Ga0068860_100000254 | |||
| 955 | Ga0068860_100008657 | |||
| 956 | Ga0068860_100051464 | |||
| 957 | Ga0068862_100070303 | |||
| 958 | Ga0068862_100250986 | |||
| 959 | Ga0068862_100271018 | |||
| 960 | Ga0081455_10018234 | |||
| 961 | Ga0081455_10042135 | |||
| 962 | Ga0081455_10053511 | |||
| 963 | Ga0081455_10146067 | |||
| 964 | Ga0081538_10040034 | |||
| 965 | Ga0081540_1001143 | |||
| 966 | Ga0081540_1003272 | |||
| 967 | Ga0081540_1009836 | |||
| 968 | Ga0081540_1018033 | |||
| 969 | Ga0081540_1032645 | |||
| 970 | Ga0081540_1034529 | |||
| 971 | Ga0081539_10000191 | |||
| 972 | Ga0081539_10000321 | |||
| 973 | Ga0070717_10000355 | |||
| 974 | Ga0070717_10045372 | |||
| 975 | Ga0070717_10073801 | |||
| 976 | Ga0075365_10126376 | |||
| 977 | Ga0075368_10035510 | |||
| 978 | Ga0070715_10000078 | |||
| 979 | Ga0070715_10058855 | |||
| 980 | Ga0070716_100003281 | |||
| 981 | Ga0070716_100026542 | |||
| 982 | Ga0070712_100011086 | |||
| 983 | Ga0070712_100035217 | |||
| 984 | Ga0070712_100212976 | |||
| 985 | Ga0075362_10032986 | |||
| 986 | Ga0075367_10085301 | |||
| 987 | Ga0075367_10093767 | |||
| 988 | Ga0075369_10030560 | |||
| 989 | Ga0075366_10031599 | |||
| 990 | Ga0075366_10180883 | |||
| 991 | Ga0097621_100001594 | |||
| 992 | Ga0075370_10122191 | |||
| 993 | Ga0068871_100000187 | |||
| 994 | Ga0068871_100114894 | |||
| 995 | Ga0068871_100520825 | |||
| 996 | Ga0075434_100192327 | |||
| 997 | Ga0075434_100478919 | |||
| 998 | Ga0075429_100274420 | |||
| 999 | Ga0097620_100002355 | |||
| 1000 | Ga0097620_100069979 | |||
| 1001 | Ga0099824_1021336 | |||
| 1002 | Ga0099822_1000022 | |||
| 1003 | Ga0105240_10022325 | |||
| 1004 | Ga0105240_10048232 | |||
| 1005 | Ga0105240_10095268 | |||
| 1006 | Ga0105240_10312007 | |||
| 1007 | Ga0105240_10349464 | |||
| 1008 | Ga0105247_10140225 | |||
| 1009 | Ga0105247_10163988 | |||
| 1010 | Ga0105247_10194057 | |||
| 1011 | Ga0105241_10020915 | |||
| 1012 | Ga0105241_10056932 | |||
| 1013 | Ga0105248_10206743 | |||
| 1014 | Ga0105248_10263515 | |||
| 1015 | Ga0105248_10507073 | |||
| 1016 | Ga0105238_10035119 | |||
| 1017 | Ga0105238_10038148 | |||
| 1018 | Ga0105238_10059830 | |||
| 1019 | Ga0105238_10206407 | |||
| 1020 | Ga0105238_10355522 | |||
| 1021 | Ga0105238_10568854 | |||
| 1022 | Ga0105249_10285302 | |||
| 1023 | Ga0105239_10028113 | |||
| 1024 | Ga0105239_10053854 | |||
| 1025 | Ga0105239_10056278 | |||
| 1026 | Ga0105239_10090525 | |||
| 1027 | Ga0105239_10102158 | |||
| 1028 | Ga0105239_10111939 | |||
| 1029 | Ga0105239_10118056 | |||
| 1030 | Ga0105246_10056010 | |||
| 1031 | Ga0105246_10400177 | |||
| 1032 | Ga0157370_10044147 | |||
| 1033 | Ga0157370_10451017 | |||
| 1034 | Ga0157369_10012925 | |||
| 1035 | Ga0157369_10043079 | |||
| 1036 | Ga0157369_10577027 | |||
| 1037 | Ga0157374_10032938 | |||
| 1038 | Ga0157374_10073258 | |||
| 1039 | Ga0157378_10092926 | |||
| 1040 | Ga0163162_10072401 | |||
| 1041 | Ga0157375_10329304 | |||
| 1042 | Ga0157380_10005003 | |||
| 1043 | Ga0157376_10016873 | |||
| 1044 | Ga0206353_11993804 | |||
| 1045 | Ga0213874_10030551 | |||
| 1046 | Ga0209677_103126 | |||
| 1047 | Ga0209148_1000424 | |||
| 1048 | Ga0209455_1002609 | |||
| 1049 | Ga0209455_1003259 | |||
| 1050 | Ga0209455_1003833 | |||
| 1051 | Ga0209758_1006158 | |||
| 1052 | Ga0209758_1015210 | |||
| 1053 | Ga0209758_1051017 | |||
| 1054 | Ga0207656_10005032 | |||
| 1055 | Ga0207656_10126493 | |||
| 1056 | Ga0207692_10002540 | |||
| 1057 | Ga0207692_10005603 | |||
| 1058 | Ga0207692_10009587 | |||
| 1059 | Ga0207710_10104909 | |||
| 1060 | Ga0207647_10044552 | |||
| 1061 | Ga0207647_10047587 | |||
| 1062 | Ga0207685_10037090 | |||
| 1063 | Ga0207685_10051652 | |||
| 1064 | Ga0207699_10000390 | |||
| 1065 | Ga0207699_10041162 | |||
| 1066 | Ga0207699_10042253 | |||
| 1067 | Ga0207699_10059991 | |||
| 1068 | Ga0207699_10078773 | |||
| 1069 | Ga0207645_10047695 | |||
| 1070 | Ga0207643_10046129 | |||
| 1071 | Ga0207705_10287390 | |||
| 1072 | Ga0207654_10000323 | |||
| 1073 | Ga0207654_10044099 | |||
| 1074 | Ga0207707_10000178 | |||
| 1075 | Ga0207707_10026300 | |||
| 1076 | Ga0207707_10051598 | |||
| 1077 | Ga0207695_10000497 | |||
| 1078 | Ga0207695_10053725 | |||
| 1079 | Ga0207695_10094476 | |||
| 1080 | Ga0207695_10206404 | |||
| 1081 | Ga0207671_10009091 | |||
| 1082 | Ga0207671_10120899 | |||
| 1083 | Ga0207693_10003503 | |||
| 1084 | Ga0207693_10010089 | |||
| 1085 | Ga0207693_10018008 | |||
| 1086 | Ga0207693_10018488 | |||
| 1087 | Ga0207693_10296888 | |||
| 1088 | Ga0207663_10006434 | |||
| 1089 | Ga0207663_10014546 | |||
| 1090 | Ga0207663_10021194 | |||
| 1091 | Ga0207663_10274823 | |||
| 1092 | Ga0207660_10098702 | |||
| 1093 | Ga0207657_10029030 | |||
| 1094 | Ga0207657_10517855 | |||
| 1095 | Ga0207652_10019378 | |||
| 1096 | Ga0207652_10055858 | |||
| 1097 | Ga0207652_10212256 | |||
| 1098 | Ga0207652_10520426 | |||
| 1099 | Ga0207681_10012277 | |||
| 1100 | Ga0207681_10063702 | |||
| 1101 | Ga0207681_10224707 | |||
| 1102 | Ga0207694_10000212 | |||
| 1103 | Ga0207694_10324074 | |||
| 1104 | Ga0207650_10110677 | |||
| 1105 | Ga0207650_10459274 | |||
| 1106 | Ga0207687_10146388 | |||
| 1107 | Ga0207700_10012153 | |||
| 1108 | Ga0207700_10021574 | |||
| 1109 | Ga0207700_10031891 | |||
| 1110 | Ga0207700_10158137 | |||
| 1111 | Ga0207700_10164177 | |||
| 1112 | Ga0207664_10148771 | |||
| 1113 | Ga0207644_10292129 | |||
| 1114 | Ga0207690_10125891 | |||
| 1115 | Ga0207690_10345078 | |||
| 1116 | Ga0207709_10045101 | |||
| 1117 | Ga0207665_10000361 | |||
| 1118 | Ga0207665_10132205 | |||
| 1119 | Ga0207665_10252552 | |||
| 1120 | Ga0207711_10071760 | |||
| 1121 | Ga0207711_10380882 | |||
| 1122 | Ga0207689_10192800 | |||
| 1123 | Ga0207661_10004270 | |||
| 1124 | Ga0207661_10354884 | |||
| 1125 | Ga0207679_10005298 | |||
| 1126 | Ga0207679_10082436 | |||
| 1127 | Ga0207679_10439769 | |||
| 1128 | Ga0207667_10037608 | |||
| 1129 | Ga0207667_10047369 | |||
| 1130 | Ga0207651_10037284 | |||
| 1131 | Ga0207668_10001774 | |||
| 1132 | Ga0207668_10076711 | |||
| 1133 | Ga0207668_10086130 | |||
| 1134 | Ga0207640_10016944 | |||
| 1135 | Ga0207640_10085163 | |||
| 1136 | Ga0207703_10126978 | |||
| 1137 | Ga0207639_10002809 | |||
| 1138 | Ga0207639_10010472 | |||
| 1139 | Ga0207639_10065321 | |||
| 1140 | Ga0207678_10042373 | |||
| 1141 | Ga0207678_10093916 | |||
| 1142 | Ga0207678_10098556 | |||
| 1143 | Ga0207678_10325072 | |||
| 1144 | Ga0207678_10435243 | |||
| 1145 | Ga0207678_10600210 | |||
| 1146 | Ga0207702_10000003 | |||
| 1147 | Ga0207641_10174404 | |||
| 1148 | Ga0207676_10114976 | |||
| 1149 | Ga0207674_10004756 | |||
| 1150 | Ga0207674_10057562 | |||
| 1151 | Ga0207674_10082897 | |||
| 1152 | Ga0207675_100033143 | |||
| 1153 | Ga0207675_100201522 | |||
| 1154 | Ga0207675_100255536 | |||
| 1155 | Ga0207683_10046756 | |||
| 1156 | Ga0207683_10088917 | |||
| 1157 | Ga0207683_10119774 | |||
| 1158 | Ga0207683_10185080 | |||
| 1159 | Ga0207683_10213368 | |||
| 1160 | Ga0207698_10054008 | |||
| 1161 | Ga0209589_1000006 | |||
| 1162 | Ga0209489_100007 | |||
| 1163 | Ga0209700_100008 | |||
| 1164 | Ga0268266_10001115 | |||
| 1165 | Ga0268266_10006027 | |||
| 1166 | Ga0268266_10025765 | |||
| 1167 | Ga0268266_10039703 | |||
| 1168 | Ga0268266_10064115 | |||
| 1169 | Ga0268266_10254562 | |||
| 1170 | Ga0268265_10010132 | |||
| 1171 | Ga0268265_10060191 | |||
| 1172 | Ga0268264_10000093 | |||
| 1173 | Ga0268264_10013096 | |||
| 1174 | Ga0307515_10039862 | |||
| 1175 | Ga0307515_10231953 | |||
| 1176 | Ga0307511_10057782 | |||
| 1177 | Ga0265330_10015314 | |||
| 1178 | Ga0265332_10026695 | |||
| 1179 | Ga0265328_10071431 | |||
| 1180 | Ga0265325_10005212 | |||
| 1181 | Ga0265329_10048276 | |||
| 1182 | Ga0265340_10002779 | |||
| 1183 | Ga0307513_10156811 | |||
| 1184 | Ga0307509_10148592 | |||
| 1185 | Ga0307509_10162576 | |||
| 1186 | Ga0307408_100166051 | |||
| 1187 | Ga0307508_10000034 | |||
| 1188 | Ga0307508_10047091 | |||
| 1189 | Ga0307508_10057194 | |||
| 1190 | Ga0265342_10006824 | |||
| 1191 | Ga0265342_10009227 | |||
| 1192 | Ga0307516_10095646 | |||
| 1193 | Ga0307507_10022844 | |||
| 1194 | Ga0307510_10036621 | |||
| 1195 | Ga0315911_1000010 | |||
| 1196 | Ga0373926_0011513 | |||
| 1197 | Ga0373934_0009105 | |||
| 1198 | Ga0373934_0034650 | |||
| 1199 | Ga0373944_0010032 | |||
| 1200 | Ga0373952_0014882 | |||
| 1201 | Ga0373923_0002407 | |||
| 1202 | Ga0373936_0016254 | |||
| 1203 | Ga0373953_0001359 | |||
| 1204 | Ga0373953_0010088 | |||
| 1205 | Ga0373953_0010516 | |||
| 1206 | Ga0373954_0004556 | |||
| 1207 | Ga0373956_0003668 | |||
| 1208 | Ga0373957_0001068 | |||
| 1209 | Ga0373943_0007994 | |||
| 1210 | Ga0373955_0000880 | |||
| 1211 | Ga0373924_0012841 | |||
| 1212 | Ga0373924_0023108 | |||
| 1213 | Ga0373935_0018309 | |||
| 1214 | Ga0373927_0009651 | |||
| 1215 | Ga0373927_0012044 | |||
| 1216 | Ga0373927_0062867 | |||
| 1217 | Ga0373927_0066443 | |||
| 1218 | Ga0373933_0002191 | |||
| 1219 | Ga0373933_0038369 | |||
| 1220 | Ga0373933_0097404 | |||
| 1221 | Ga0373933_0169902 | |||
| 1222 | Ga0373947_0140362 | |||
| 1223 | Ga0373937_0006578 | |||
| 1224 | Ga0373937_0022213 | |||
| 1225 | Ga0373937_0051281 | |||
| 1226 | Ga0373925_0045644 | |||
| 1227 | Ga0395900_0086570 | |||
| 1228 | Ga0395898_0031255 | |||
| 1229 | Ga0395898_0134726 | |||
| 1230 | Ga0395905_0162178 | |||
| 1231 | Ga0395905_0169899 | |||
| 1232 | Ga0395901_0015985 | |||
| 1233 | Ga0395901_0060097 | |||
| 1234 | Ga0400483_108494 | |||
| 1235 | Ga0400483_110392 | |||
| 1236 | Ga0400483_151200 | |||
| 1237 | Ga0400483_193036 | |||
| 1238 | Ga0436365_0487598 | |||
| 1239 | Ga0436365_1446014 | |||
| 1240 | Ga0436365_1446425 | |||
| 1241 | Ga0436365_1701898 | |||
| 1242 | Ga0436365_1714523 | |||
| 1243 | Ga0436365_1936932 | |||
| 1244 | Ga0436360_0953942 | |||
| 1245 | Ga0436360_0973324 | |||
| 1246 | Ga0436363_0302413 | |||
| 1247 | Ga0436362_0646134 | |||
| 1248 | Ga0451807_0866641 | |||
| 1249 | Ga0439435_0005933 | |||
| 1250 | Ga0439459_0023512 | |||
| 1251 | Ga0466965_0180922 | |||
| 1252 | Ga0466963_0091098 | |||
| 1253 | Ga0466957_0029287 | |||
| 1254 | Ga0466967_0040069 | |||
| 1255 | Ga0495617_032623 | |||
| 1256 | Ga0495592_0008207 | |||
| 1257 | Ga0495592_0029636 | |||
| 1258 | Ga0495592_0125717 | |||
| 1259 | Ga0495603_0061679 | |||
| 1260 | Ga0495603_0086657 | |||
| 1261 | Ga0495603_0088431 | |||
| 1262 | Ga0495629_0006765 | |||
| 1263 | Ga0495629_0018324 | |||
| 1264 | Ga0495629_0047563 | |||
| 1265 | Ga0495638_0001021 | |||
| 1266 | Ga0495638_0102154 | |||
| 1267 | Ga0495638_0126696 | |||
| 1268 | Ga0495641_0006337 | |||
| 1269 | Ga0495641_0018952 | |||
| 1270 | Ga0495651_0003972 | |||
| 1271 | Ga0495651_0008150 | |||
| 1272 | Ga0495653_0012753 | |||
| 1273 | Ga0495653_0025837 | |||
| 1274 | Ga0495580_0284450 | |||
| 1275 | Ga0495582_0024440 | |||
| 1276 | Ga0495639_0002472 | |||
| 1277 | Ga0495639_0027091 | |||
| 1278 | Ga0495639_0080635 | |||
| 1279 | Ga0495662_0121133 | |||
| 1280 | Ga0495664_0065658 | |||
| 1281 | Ga0495584_0078966 | |||
| 1282 | Ga0495585_0047515 | |||
| 1283 | Ga0495594_0046705 | |||
| 1284 | Ga0495596_0019838 | |||
| 1285 | Ga0495607_0052733 | |||
| 1286 | Ga0495606_0021592 | |||
| 1287 | Ga0495606_0050798 | |||
| 1288 | Ga0495606_0204293 | |||
| 1289 | Ga0495606_0247399 | |||
| 1290 | Ga0495608_0025279 | |||
| 1291 | Ga0495608_0297531 | |||
| 1292 | Ga0495610_0013797 | |||
| 1293 | Ga0495616_0117031 | |||
| 1294 | Ga0495628_0005097 | |||
| 1295 | Ga0495628_0076574 | |||
| 1296 | Ga0495630_0060622 | |||
| 1297 | Ga0495631_0122414 | |||
| 1298 | Ga0495643_0063690 | |||
| 1299 | Ga0495643_0187015 | |||
| 1300 | Ga0495648_0002765 | |||
| 1301 | Ga0495652_0036021 | |||
| 1302 | Ga0495652_0036122 | |||
| 1303 | Ga0495652_0140267 | |||
| 1304 | Ga0495640_0034231 | |||
| 1305 | Ga0495640_0036139 | |||
| 1306 | Ga0495640_0043919 | |||
| 1307 | Ga0495587_0018218 | |||
| 1308 | Ga0495587_0078413 | |||
| 1309 | Ga0495587_0156150 | |||
| 1310 | Ga0495609_0047335 | |||
| 1311 | Ga0495609_0060831 | |||
| 1312 | Ga0495621_0021779 | |||
| 1313 | Ga0495645_0020761 | |||
| 1314 | Ga0495645_0057669 | |||
| 1315 | Ga0495633_0104201 | |||
| 1316 | Ga0495667_0005829 | |||
| 1317 | Ga0495667_0038334 | |||
| 1318 | Ga0495667_0126163 | |||
| 1319 | Ga0495668_0020542 | |||
| 1320 | Ga0495668_0100746 | |||
| 1321 | Ga0495668_0117104 | |||
| 1322 | Ga0495634_0015616 | |||
| 1323 | Ga0495634_0180564 | |||
| 1324 | Ga0495611_0063207 | |||
| 1325 | Ga0495625_0104873 | |||
| 1326 | Ga0495625_0134358 | |||
| 1327 | Ga0495625_0283504 | |||
| 1328 | Ga0495635_0003846 | |||
| 1329 | Ga0495635_0273525 | |||
| 1330 | Ga0495588_0014080 | |||
| 1331 | Ga0495588_0054866 | |||
| 1332 | Ga0495657_0003492 | |||
| 1333 | Ga0495657_0006927 | |||
| 1334 | Ga0495657_0068527 | |||
| 1335 | Ga0495657_0135230 | |||
| 1336 | Ga0495599_0001556 | |||
| 1337 | Ga0495599_0022511 | |||
| 1338 | Ga0495623_0002296 | |||
| 1339 | Ga0495623_0009107 | |||
| 1340 | Ga0495623_0122808 | |||
| 1341 | Ga0495646_0001918 | |||
| 1342 | Ga0495646_0011250 | |||
| 1343 | Ga0495669_0059741 | |||
| 1344 | Ga0495613_0030472 | |||
| 1345 | Ga0495613_0032215 | |||
| 1346 | Ga0495613_0054197 | |||
| 1347 | Ga0495670_0093478 | |||
| 1348 | Ga0495670_0169746 | |||
| 1349 | Ga0495649_0062818 | |||
| 1350 | Ga0495600_0002229 | |||
| 1351 | Ga0495600_0077649 | |||
| 1352 | Ga0495600_0088708 | |||
| 1353 | Ga0495581_0016881 | |||
| 1354 | Ga0495604_0005469 | |||
| 1355 | Ga0495604_0007916 | |||
| 1356 | Ga0495604_0064832 | |||
| 1357 | Ga0495674_0020768 | |||
| 1358 | Ga0495674_0021792 | |||
| 1359 | Ga0495674_0060078 | |||
| 1360 | Ga0495674_0087826 | |||
| 1361 | Ga0495672_0139134 | |||
| 1362 | Ga0495676_0029475 | |||
| 1363 | Ga0495680_0012862 | |||
| 1364 | Ga0495680_0032224 | |||
| 1365 | Ga0495683_0066605 | |||
| 1366 | Ga0495675_0002807 | |||
| 1367 | Ga0495675_0003321 | |||
| 1368 | Ga0495681_0082699 | |||
| 1369 | Ga0495684_0000893 | |||
| 1370 | Ga0495684_0009436 | |||
| 1371 | Ga0495684_0043713 | |||
| 1372 | Ga0495686_0073671 | |||
| 1373 | Ga0495686_0083618 | |||
| 1374 | Ga0495593_0005088 | |||
| 1375 | Ga0495602_0030283 | |||
| 1376 | Ga0495602_0049097 | |||
| 1377 | Ga0495602_0073245 | |||
| 1378 | Ga0495602_0086090 | |||
| 1379 | Ga0496100_0026796 | |||
| 1380 | Ga0496100_0054241 | |||
| 1381 | Ga0496100_0279396 | |||
| 1382 | Ga0496101_0005889 | |||
| 1383 | Ga0496101_0040575 | |||
| 1384 | Ga0496101_0138157 | |||
| 1385 | Ga0496102_0018779 | |||
| 1386 | Ga0496102_0079901 | |||
| 1387 | Ga0496102_0162404 | |||
| 1388 | Ga0496102_0222773 | |||
| 1389 | Ga0496102_0262307 | |||
| 1390 | Ga0496102_0512470 | |||
| 1391 | Ga0496103_0005710 | |||
| 1392 | Ga0496103_0067665 | |||
| 1393 | Ga0496104_0015916 | |||
| 1394 | Ga0496104_0119316 | |||
| 1395 | Ga0496105_0034901 | |||
| 1396 | Ga0496105_0051207 | |||
| 1397 | Ga0496105_0171635 | |||
| 1398 | Ga0496106_0000649 | |||
| 1399 | Ga0496106_0032306 | |||
| 1400 | Ga0496106_0049265 | |||
| 1401 | Ga0496106_0226889 | |||
| 1402 | Ga0496107_0037532 | |||
| 1403 | Ga0496107_0051082 | |||
| 1404 | Ga0496107_0173474 | |||
| 1405 | Ga0496108_0065905 | |||
| 1406 | Ga0496109_0044561 | |||
| 1407 | Ga0496109_0174830 | |||
| 1408 | Ga0496110_0013275 | |||
| 1409 | Ga0496110_0021544 | |||
| 1410 | Ga0496110_0051830 | |||
| 1411 | Ga0496110_0100133 | |||
| 1412 | Ga0496110_0199664 | |||
| 1413 | Ga0496110_0431895 | |||
| 1414 | Ga0496111_0203791 | |||
| 1415 | Ga0496111_0282788 | |||
| 1416 | Ga0496112_0000008 | |||
| 1417 | Ga0496112_0035784 | |||
| 1418 | Ga0496113_0013405 | |||
| 1419 | Ga0496113_0066226 | |||
| 1420 | Ga0496113_0083617 | |||
| 1421 | Ga0496113_0092620 | |||
| 1422 | Ga0496114_0015763 | |||
| 1423 | Ga0496114_0028100 | |||
| 1424 | Ga0496114_0071880 | |||
| 1425 | Ga0496114_0195583 | |||
| 1426 | Ga0496115_0007272 | |||
| 1427 | Ga0496115_0142336 | |||
| 1428 | Ga0496115_0306974 | |||
| 1429 | Ga0496116_0003364 | |||
| 1430 | Ga0496117_0035578 | |||
| 1431 | Ga0496117_0047573 | |||
| 1432 | Ga0496117_0166291 | |||
| 1433 | Ga0496118_0095087 | |||
| 1434 | Ga0496118_0099053 | |||
| 1435 | Ga0496118_0156878 | |||
| 1436 | Ga0496118_0205002 | |||
| 1437 | Ga0496120_0060061 | |||
| 1438 | Ga0496120_0070691 | |||
| 1439 | Ga0496121_0000476 | |||
| 1440 | Ga0496121_0001497 | |||
| 1441 | Ga0496121_0001742 | |||
| 1442 | Ga0496121_0003089 | |||
| 1443 | Ga0496121_0015642 | |||
| 1444 | Ga0496121_0017380 | |||
| 1445 | Ga0496121_0037277 | |||
| 1446 | Ga0496121_0050475 | |||
| 1447 | Ga0496121_0050757 | |||
| 1448 | Ga0496121_0077328 | |||
| 1449 | Ga0496121_0124804 | |||
| 1450 | Ga0496121_0267741 | |||
| 1451 | Ga0496121_0281920 | |||
| 1452 | Ga0496122_0024662 | |||
| 1453 | Ga0496122_0189533 | |||
| 1454 | Ga0496124_0001128 | |||
| 1455 | Ga0496124_0127389 | |||
| 1456 | Ga0496125_0000154 | |||
| 1457 | Ga0496125_0118101 | |||
| 1458 | Ga0496126_0002744 | |||
| 1459 | Ga0496126_0006113 | |||
| 1460 | Ga0496126_0007435 | |||
| 1461 | Ga0496126_0015910 | |||
| 1462 | Ga0496126_0020832 | |||
| 1463 | Ga0496126_0032430 | |||
| 1464 | Ga0496126_0039244 | |||
| 1465 | Ga0496126_0134713 | |||
| 1466 | Ga0496126_0140461 | |||
| 1467 | Ga0496126_0182221 | |||
| 1468 | Ga0496126_0199175 | |||
| 1469 | Ga0496126_0200806 | |||
| 1470 | Ga0496126_0214027 | |||
| 1471 | Ga0496126_0281315 | |||
| 1472 | Ga0495682_0026452 | |||
| 1473 | Ga0501031_0009852 | |||
| 1474 | Ga0501031_0022023 | |||
| 1475 | Ga0501032_0003534 | |||
| 1476 | Ga0501032_0046657 | |||
| 1477 | Ga0501033_0000249 | |||
| 1478 | Ga0501033_0036543 | |||
| 1479 | Ga0501033_0057802 | |||
| 1480 | Ga0501033_0169880 | |||
| 1481 | Ga0501033_0191694 | |||
| 1482 | Ga0501034_0001938 | |||
| 1483 | Ga0501034_0063839 | |||
| 1484 | Ga0501034_0150382 | |||
| 1485 | Ga0501034_0276657 | |||
| 1486 | Ga0501036_0004433 | |||
| 1487 | Ga0501036_0005117 | |||
| 1488 | Ga0501036_0026547 | |||
| 1489 | Ga0501036_0190494 | |||
| 1490 | Ga0501037_0000112 | |||
| 1491 | Ga0501037_0025895 | |||
| 1492 | Ga0501037_0091560 | |||
| 1493 | Ga0501037_0152526 | |||
| 1494 | Ga0501038_0000160 | |||
| 1495 | Ga0501038_0049308 | |||
| 1496 | Ga0501039_0011683 | |||
| 1497 | Ga0501040_0002958 | |||
| 1498 | Ga0501042_0074151 | |||
| 1499 | Ga0501043_0000278 | |||
| 1500 | Ga0501043_0022578 | |||
| 1501 | Ga0501046_0000937 | |||
| 1502 | Ga0501046_0008812 | |||
| 1503 | Ga0501047_0000275 | |||
| 1504 | Ga0501047_0003622 | |||
| 1505 | Ga0501047_0009938 | |||
| 1506 | Ga0501047_0018665 | |||
| 1507 | Ga0501047_0099683 | |||
| 1508 | Ga0501047_0101290 | |||
| 1509 | Ga0501047_0102492 | |||
| 1510 | Ga0501047_0265762 | |||
| 1511 | Ga0501047_0347074 | |||
| 1512 | Ga0501048_0001248 | |||
| 1513 | Ga0501048_0011414 | |||
| 1514 | Ga0501048_0068204 | |||
| 1515 | Ga0501067_0000258 | |||
| 1516 | Ga0501067_0022138 | |||
| 1517 | Ga0501068_0004146 | |||
| 1518 | Ga0501068_0084222 | |||
| 1519 | Ga0501070_0002548 | |||
| 1520 | Ga0501070_0024977 | |||
| 1521 | Ga0501070_0032601 | |||
| 1522 | Ga0501070_0053073 | |||
| 1523 | Ga0501070_0093858 | |||
| 1524 | Ga0501071_0206207 | |||
| 1525 | Ga0501072_0002502 | |||
| 1526 | Ga0501072_0002947 | |||
| 1527 | Ga0501072_0006863 | |||
| 1528 | Ga0501073_0000103 | |||
| 1529 | Ga0501073_0014367 | |||
| 1530 | Ga0501073_0039136 | |||
| 1531 | Ga0501073_0086595 | |||
| 1532 | Ga0501073_0180032 | |||
| 1533 | Ga0501074_0000456 | |||
| 1534 | Ga0501074_0001612 | |||
| 1535 | Ga0501074_0057260 | |||
| 1536 | Ga0501074_0057827 | |||
| 1537 | Ga0501074_0081415 | |||
| 1538 | Ga0501075_0003570 | |||
| 1539 | Ga0501076_0053630 | |||
| 1540 | Ga0501079_0000451 | |||
| 1541 | Ga0501079_0124241 | |||
| 1542 | Ga0501080_0000082 | |||
| 1543 | Ga0501080_0002998 | |||
| 1544 | Ga0501080_0034657 | |||
| 1545 | Ga0501081_0192605 | |||
| 1546 | Ga0501083_0013394 | |||
| 1547 | Ga0501083_0013677 | |||
| 1548 | Ga0501083_0053952 | |||
| 1549 | Ga0501083_0268914 | |||
| 1550 | Ga0501035_0000766 | |||
| 1551 | Ga0501035_0004610 | |||
| 1552 | Ga0501035_0110139 | |||
| 1553 | Ga0501035_0164948 | |||
| 1554 | Ga0501035_0231809 | |||
| 1555 | Ga0501044_0000418 | |||
| 1556 | Ga0501044_0028251 | |||
| 1557 | Ga0501044_0034063 | |||
| 1558 | Ga0501044_0124034 | |||
| 1559 | Ga0501044_0124517 | |||
| 1560 | Ga0501044_0189651 | |||
| 1561 | Ga0501045_0003999 | |||
| 1562 | Ga0501045_0012804 | |||
| 1563 | Ga0501045_0054354 | |||
| 1564 | nmdc:mga03683_35265_c1 | |||
| 1565 | nmdc:mga00v17_38224_c1 | |||
| 1566 | nmdc:mga0yw44_11164_c1 | |||
| 1567 | nmdc:mga0yw44_1397_c1 | |||
| 1568 | nmdc:mga0yw44_20742_c1 | |||
| 1569 | nmdc:mga0yw44_21662_c1 | |||
| 1570 | nmdc:mga0k408_163396_c1 | |||
| 1571 | nmdc:mga06z11_84367_c1 | |||
| 1572 | nmdc:mga06z11_96152_c1 | |||
| 1573 | nmdc:mga07m45_45292_c1 | |||
| 1574 | nmdc:mga05p37_62404_c1 | |||
| 1575 | nmdc:mga08y16_184530_c1 | |||
| 1576 | nmdc:mga0n895_58282_c1 | |||
| 1577 | nmdc:mga0rr50_138146_c1 | |||
| 1578 | nmdc:mga0rr50_27857_c1 | |||
| 1579 | nmdc:mga0a205_387614_c1 | |||
| 1580 | Ga0495601_0009529 | |||
| 1581 | Ga0495612_0030040 | |||
| 1582 | Ga0500635_0033309 | |||
| 1583 | Ga0495655_0015009 | |||
| 1584 | Ga0495595_0002085 | |||
| 1585 | Ga0495619_0005598 | |||
| 1586 | Ga0495619_0104527 | |||
| 1587 | Ga0495619_0105479 | |||
| 1588 | Ga0495619_0257420 | |||
| 1589 | Ga0500578_0082036 | |||
| 1590 | Ga0500643_005226 | |||
| 1591 | Ga0500643_060145 | |||
| 1592 | Ga0500644_0112491 | |||
| 1593 | Ga0500647_0094389 | |||
| 1594 | Ga0500647_0134900 | |||
| 1595 | Ga0500566_0000157 | |||
| 1596 | Ga0500566_0000185 | |||
| 1597 | Ga0500566_0001146 | |||
| 1598 | Ga0500566_0001213 | |||
| 1599 | Ga0500566_0068124 | |||
| 1600 | Ga0500566_0102983 | |||
| 1601 | Ga0500641_0004632 | |||
| 1602 | Ga0500650_0004834 | |||
| 1603 | Ga0500556_0006938 | |||
| 1604 | Ga0500562_044263 | |||
| 1605 | Ga0500569_007652 | |||
| 1606 | Ga0500572_000384 | |||
| 1607 | Ga0500594_0016712 | |||
| 1608 | Ga0500595_003818 | |||
| 1609 | Ga0500595_006228 | |||
| 1610 | Ga0500595_022133 | |||
| 1611 | Ga0500595_075549 | |||
| 1612 | Ga0500607_081709 | |||
| 1613 | Ga0500608_000908 | |||
| 1614 | Ga0500608_056020 | |||
| 1615 | Ga0500614_001219 | |||
| 1616 | Ga0500652_000531 | |||
| 1617 | Ga0500658_0004847 | |||
| 1618 | Ga0500658_0155431 | |||
| 1619 | Ga0500559_0000863 | |||
| 1620 | Ga0500559_0002089 | |||
| 1621 | Ga0500559_0004212 | |||
| 1622 | Ga0500559_0049182 | |||
| 1623 | Ga0500568_0002109 | |||
| 1624 | Ga0500568_0018137 | |||
| 1625 | Ga0500573_0093412 | |||
| 1626 | Ga0500577_0000693 | |||
| 1627 | Ga0500603_002337 | |||
| 1628 | Ga0500603_061618 | |||
| 1629 | Ga0500604_0005246 | |||
| 1630 | Ga0500616_0000180 | |||
| 1631 | Ga0500619_020846 | |||
| 1632 | Ga0500620_013290 | |||
| 1633 | Ga0500622_0012310 | |||
| 1634 | Ga0500627_0030591 | |||
| 1635 | Ga0500630_137357 | |||
| 1636 | Ga0500633_0115050 | |||
| 1637 | Ga0500634_0039122 | |||
| 1638 | Ga0500638_001014 | |||
| 1639 | Ga0500639_000010 | |||
| 1640 | Ga0500636_0001916 | |||
| 1641 | Ga0500637_0000121 | |||
| 1642 | Ga0500637_0029199 | |||
| 1643 | Ga0500609_006195 | |||
| 1644 | Ga0500596_000760 | |||
| 1645 | Ga0500596_002495 | |||
| 1646 | Ga0500601_000076 | |||
| 1647 | Ga0501084_0003972 | |||
| 1648 | Ga0501084_0039395 | |||
| 1649 | Ga0500661_000452 | |||
| 1650 | Ga0501082_0029862 | |||
| 1651 | Ga0501082_0070440 | |||
| 1652 | Ga0501082_0089240 | |||
| 1653 | Ga0530510_0066561 | |||
| 1654 | 2509148873 | |||
| 1655 | 2513655024 | |||
| 1656 | 2513677794 | |||
| 1657 | 2513697430 | |||
| 1658 | 2513716916 | |||
| 1659 | 2513861039 | |||
| 1660 | 2513892083 | |||
| 1661 | 2513915953 | |||
| 1662 | 2517100589 | |||
| 1663 | 2517894741 | |||
| 1664 | 2524438187 | |||
| 1665 | 2524464073 | |||
| 1666 | 2524534490 | |||
| 1667 | 2528849822 | |||
| 1668 | 2603862619 | |||
| 1669 | 2617350774 | |||
| 1670 | 2644287350 | |||
| 1671 | 2671119155 | |||
| 1672 | 2728747604 | |||
| 1673 | 2738744680 | |||
| 1674 | 2739353910 | |||
| 1675 | 2745076931 | |||
| 1676 | 2793071216 | |||
| 1677 | 2824668264 | |||
| 1678 | 2824780544 | |||
| 1679 | 2841960220 | |||
| 1680 | 2857529967 | |||
| 1681 | 2874612591 | |||
| 1682 | 2876812895 | |||
| 1683 | 2879101351 | |||
| 1684 | 2879118032 | |||
| 1685 | 2881370679 | |||
| 1686 | 2885378764 | |||
| 1687 | 2885384488 | |||
| 1688 | 2889033620 | |||
| 1689 | 2893069390 | |||
| 1690 | 2903751424 | |||
| 1691 | 2903773624 | |||
| 1692 | 2904697725 | |||
| 1693 | 2904705787 | |||
| 1694 | 2906611461 | |||
| 1695 | 2906641701 | |||
| 1696 | 2906660803 | |||
| 1697 | 2908745053 | |||
| 1698 | 2908757178 | |||
| 1699 | 2919077179 | |||
| 1700 | 2922366989 | |||
| 1701 | 2922371194 | |||
| 1702 | 2922390230 | |||
| 1703 | 2922427896 | |||
| 1704 | 2929619578 | |||
| 1705 | 2929627952 | |||
| 1706 | 2932785908 | |||
| 1707 | 2932817279 | |||
| 1708 | 2932826876 | |||
| 1709 | 2932830952 | |||
| 1710 | 2933581498 | |||
| 1711 | 2935621017 | |||
| 1712 | 2935632176 | |||
| 1713 | 2935640093 | |||
| 1714 | 2935667068 | |||
| 1715 | 2935690200 | |||
| 1716 | 2935699714 | |||
| 1717 | 2935704824 | |||
| 1718 | 2935718103 | |||
| 1719 | 2935726747 | |||
| 1720 | 2935735516 | |||
| 1721 | 2935745213 | |||
| 1722 | 2935755211 | |||
| 1723 | 2935762272 | |||
| 1724 | 2935803774 | |||
| 1725 | 2935811690 | |||
| 1726 | 2935829576 | |||
| 1727 | 2935843090 | |||
| 1728 | 2935858824 | |||
| 1729 | 2935866778 | |||
| 1730 | 2935876909 | |||
| 1731 | 2935962046 | |||
| 1732 | 2935993454 | |||
| 1733 | 2936004349 | |||
| 1734 | 2936038272 | |||
| 1735 | 2940561508 | |||
| 1736 | 2941508124 | |||
| 1737 | 2941515371 | |||
| 1738 | 2941524054 | |||
| 1739 | 2941544314 | |||
| 1740 | 3005477606 | |||
| 1741 | 8006933611 | |||
| 1742 | 8006966525 | |||
| 1743 | 8006983284 | |||
| 1744 | 8016516433 | |||
| 1745 | 8017060104 | |||
| 1746 | 8019559548 | |||
| 1747 | 8019579614 | |||
| 1748 | 8019587325 | |||
| 1749 | 8019604016 | |||
| 1750 | 8019614512 | |||
| 1751 | 8055749164 | |||
| 1752 | 8056682384 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4pyt-assembly1.cif.gz_A | crystal structure of a murb family ep-udp-n-acetylglucosamine reductase | 0.9458 | 8 | 304 |
| 3tx1-assembly1.cif.gz_A | x-ray crystal structure of listeria monocytogenes egd-e udp-n-acetylenolpyruvylglucosamine reductase (murb) | 0.9434 | 10 | 306 |
| 1hsk-assembly1.cif.gz_A | crystal structure of s. aureus murb | 0.9395 | 6 | 307 |
| 3tx1-assembly1.cif.gz_A | x-ray crystal structure of listeria monocytogenes egd-e udp-n-acetylenolpyruvylglucosamine reductase (murb) | 0.9372 | 10 | 306 |
| 4pyt-assembly1.cif.gz_A | crystal structure of a murb family ep-udp-n-acetylglucosamine reductase | 0.9277 | 8 | 304 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tx1A03 | Alpha Beta;Alpha-Beta Complex;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1;UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain | 0.9818 | 225 | 306 | 3.90.78.10 |
| 4pytA02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9501 | 94 | 219 | 3.30.465.10 |
| 3tx1A02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9328 | 94 | 219 | 3.30.465.10 |
| 4pytA02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9287 | 94 | 219 | 3.30.465.10 |
| 3tx1A02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9256 | 94 | 219 | 3.30.465.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A442AS35-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase (UDP-N-acetylmuramate dehydrogenase) | 0.9976 | 103 | 202 |
GO:0005829
GO:0008762 GO:0050660 GO:0071555 |
| AF-A0A3N5RV35-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase | 0.9909 | 227 | 304 |
GO:0005829
GO:0008762 GO:0050660 GO:0071555 |
| AF-A0A7W2GW92-F1-model_v4 | deleted | 0.9905 | 1 | 308 |
|
| AF-A0A0Q6EY45-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) | 0.9881 | 6 | 306 |
GO:0005829
GO:0008360 GO:0008762 GO:0009252 GO:0051301 GO:0071555 GO:0071949 |
| AF-A0A7W2GW92-F1-model_v4 | deleted | 0.9873 | 1 | 308 |
|