F484361

General Info

Members Datasets Scaffolds Average Seq Length
876 284 1752 159

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0187687|Ga0451576_0187687_757_1335
Length 192
Sequence MAPAPGARARRVRRSADAIFESESLRRSDVSGREVDMATESKWRHHGVRVVRSDQLDTRTPQTPGMDRAAAITYARMGAESLWAGTVVIHPKAKTGAHHHGPVESVIYVVSGRARMKWGERLEFTAEAGPGDFIYVPPYVPHQEINASDSEPLSCVLCRSGKDPVVVNLDLPNVEPNPENVPWVDSIHPPPN

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
125 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
196 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
197 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
198 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
199 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
200 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
216 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
217 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
222 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
229 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
230 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
231 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
232 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
233 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
234 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
235 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
236 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
241 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
242 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
264 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
270 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
271 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
272 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 0
Rhizoplane 4.57
Rhizosphere 93.95
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0187687 3300045051 Bacteria 2159
2 JGI24752J21851_1039947 3300001976 Bacteria 627
3 JGI24747J21853_1020088 3300001978 Bacteria 723
4 JGI24743J22301_10012420 3300001991 Bacteria 1549
5 JGI24750J21931_1041320 3300002070 Bacteria 701
6 JGI24749J21850_1005279 3300002076 Bacteria 1813
7 JGI24744J21845_10055969 3300002077 Bacteria 724
8 Ga0058863_11718871 3300004799 Bacteria 1544
9 Ga0058862_12751779 3300004803 Bacteria 747
10 Ga0065715_10162694 3300005293 Bacteria 1614
11 Ga0065715_10171170 3300005293 Bacteria 1546
12 Ga0065715_10365467 3300005293 Bacteria 929
13 Ga0070658_10017688 3300005327 Bacteria 5702
14 Ga0070658_10018601 3300005327 Bacteria 5564
15 Ga0070658_10036568 3300005327 Bacteria 3957
16 Ga0070658_10110787 3300005327 Bacteria 2274
17 Ga0070658_10796618 3300005327 Bacteria 821
18 Ga0070676_10000769 3300005328 Bacteria 15777
19 Ga0070676_10005593 3300005328 Bacteria 6694
20 Ga0070676_10032653 3300005328 Bacteria 2983
21 Ga0070676_10283966 3300005328 Bacteria 1116
22 Ga0070676_10744773 3300005328 Bacteria 719
23 Ga0070683_100019402 3300005329 Bacteria 6038
24 Ga0070683_100058588 3300005329 Bacteria 3577
25 Ga0070683_100129952 3300005329 Bacteria 2383
26 Ga0070690_100009005 3300005330 Bacteria 5771
27 Ga0070670_100000274 3300005331 Bacteria 45804
28 Ga0070670_100021437 3300005331 Bacteria 5559
29 Ga0070670_100052188 3300005331 Bacteria 3512
30 Ga0070670_100097188 3300005331 Bacteria 2533
31 Ga0070670_100138970 3300005331 Bacteria 2100
32 Ga0070670_101327314 3300005331 Bacteria 659
33 Ga0070670_101686592 3300005331 Bacteria 583
34 Ga0070677_10000132 3300005333 Bacteria 24789
35 Ga0070677_10009216 3300005333 Bacteria 3344
36 Ga0070677_10135884 3300005333 Bacteria 1128
37 Ga0070677_10192830 3300005333 Bacteria 978
38 Ga0070677_10429711 3300005333 Bacteria 702
39 Ga0068869_100001694 3300005334 Bacteria 13168
40 Ga0068869_100007694 3300005334 Bacteria 6902
41 Ga0068869_100208930 3300005334 Bacteria 1542
42 Ga0070666_10006650 3300005335 Bacteria 7108
43 Ga0070666_10007688 3300005335 Bacteria 6654
44 Ga0070666_10094719 3300005335 Bacteria 2054
45 Ga0070666_10290317 3300005335 Bacteria 1163
46 Ga0070666_10410922 3300005335 Bacteria 974
47 Ga0070680_100109620 3300005336 Bacteria 2297
48 Ga0070680_100238453 3300005336 Bacteria 1537
49 Ga0070680_100376219 3300005336 Bacteria 1209
50 Ga0070680_100616184 3300005336 Bacteria 932
51 Ga0070682_100899525 3300005337 Bacteria 727
52 Ga0068868_100005576 3300005338 Bacteria 8850
53 Ga0068868_100028710 3300005338 Bacteria 4256
54 Ga0068868_100045229 3300005338 Bacteria 3444
55 Ga0068868_101232518 3300005338 Bacteria 693
56 Ga0068868_101393863 3300005338 Bacteria 653
57 Ga0070660_100004956 3300005339 Bacteria 9207
58 Ga0070660_100018533 3300005339 Bacteria 5088
59 Ga0070660_100602224 3300005339 Bacteria 919
60 Ga0070689_100008003 3300005340 Bacteria 7418
61 Ga0070689_100033049 3300005340 Bacteria 3939
62 Ga0070661_100004644 3300005344 Bacteria 9458
63 Ga0070661_100010175 3300005344 Bacteria 6534
64 Ga0070661_100027132 3300005344 Bacteria 4122
65 Ga0070661_100055801 3300005344 Bacteria 2892
66 Ga0070661_100135124 3300005344 Bacteria 1855
67 Ga0070661_100161595 3300005344 Bacteria 1697
68 Ga0070661_100173153 3300005344 Bacteria 1640
69 Ga0070661_100248233 3300005344 Bacteria 1373
70 Ga0070692_10037400 3300005345 Bacteria 2468
71 Ga0070668_100000394 3300005347 Bacteria 29015
72 Ga0070668_100007010 3300005347 Bacteria 8351
73 Ga0070668_100011160 3300005347 Bacteria 6688
74 Ga0070668_100016216 3300005347 Bacteria 5573
75 Ga0070668_100065340 3300005347 Bacteria 2822
76 Ga0070668_100359662 3300005347 Bacteria 1234
77 Ga0070668_100559299 3300005347 Bacteria 996
78 Ga0070668_101249069 3300005347 Bacteria 674
79 Ga0070669_100005562 3300005353 Bacteria 9102
80 Ga0070669_100006708 3300005353 Bacteria 8287
81 Ga0070669_100050895 3300005353 Bacteria 3026
82 Ga0070669_100052789 3300005353 Bacteria 2975
83 Ga0070669_100097767 3300005353 Bacteria 2210
84 Ga0070669_100098531 3300005353 Bacteria 2202
85 Ga0070669_100110841 3300005353 Bacteria 2082
86 Ga0070669_100203979 3300005353 Bacteria 1557
87 Ga0070669_100667379 3300005353 Bacteria 876
88 Ga0070669_100844652 3300005353 Bacteria 780
89 Ga0070675_100008918 3300005354 Bacteria 7792
90 Ga0070675_100008929 3300005354 Bacteria 7786
91 Ga0070675_100032421 3300005354 Bacteria 4228
92 Ga0070675_100094815 3300005354 Bacteria 2505
93 Ga0070675_100317873 3300005354 Bacteria 1375
94 Ga0070675_100332358 3300005354 Bacteria 1344
95 Ga0070675_100392373 3300005354 Bacteria 1237
96 Ga0070671_100013129 3300005355 Bacteria 6674
97 Ga0070671_100079129 3300005355 Bacteria 2747
98 Ga0070671_100206170 3300005355 Bacteria 1667
99 Ga0070671_100383170 3300005355 Bacteria 1202
100 Ga0070671_100472906 3300005355 Bacteria 1076
101 Ga0070674_100001114 3300005356 Bacteria 14095
102 Ga0070674_100036339 3300005356 Bacteria 3306
103 Ga0070674_100069827 3300005356 Bacteria 2479
104 Ga0070674_100120733 3300005356 Unclassified 1940
105 Ga0070674_100398011 3300005356 Bacteria 1124
106 Ga0070673_100002042 3300005364 Bacteria 12186
107 Ga0070673_100020047 3300005364 Bacteria 4815
108 Ga0070673_100074203 3300005364 Bacteria 2741
109 Ga0070673_100091659 3300005364 Bacteria 2485
110 Ga0070673_100133514 3300005364 Bacteria 2086
111 Ga0070673_100163834 3300005364 Bacteria 1893
112 Ga0070673_100226902 3300005364 Bacteria 1619
113 Ga0070688_100003905 3300005365 Bacteria 7733
114 Ga0070659_100006210 3300005366 Bacteria 8630
115 Ga0070659_100064486 3300005366 Bacteria 2899
116 Ga0070659_100067006 3300005366 Bacteria 2846
117 Ga0070659_100071001 3300005366 Bacteria 2768
118 Ga0070659_100589158 3300005366 Bacteria 955
119 Ga0070667_100002746 3300005367 Bacteria 15229
120 Ga0070667_100010007 3300005367 Bacteria 7858
121 Ga0070667_100021181 3300005367 Bacteria 5401
122 Ga0070667_100127045 3300005367 Bacteria 2222
123 Ga0070667_100156797 3300005367 Bacteria 2003
124 Ga0070667_100213734 3300005367 Bacteria 1715
125 Ga0070667_100248565 3300005367 Bacteria 1590
126 Ga0070667_100422096 3300005367 Bacteria 1216
127 Ga0070667_101109627 3300005367 Bacteria 739
128 Ga0070667_101129898 3300005367 Bacteria 733
129 Ga0070714_100033301 3300005435 Bacteria 4307
130 Ga0070714_100062644 3300005435 Bacteria 3197
131 Ga0070714_100109749 3300005435 Bacteria 2441
132 Ga0070713_100012321 3300005436 Bacteria 6267
133 Ga0070710_10007894 3300005437 Bacteria 5169
134 Ga0070710_10218269 3300005437 Bacteria 1212
135 Ga0070701_10066184 3300005438 Bacteria 1920
136 Ga0070711_100105943 3300005439 Bacteria 2054
137 Ga0070711_100691827 3300005439 Bacteria 858
138 Ga0070711_100720342 3300005439 Bacteria 841
139 Ga0070711_100928130 3300005439 Bacteria 744
140 Ga0070700_100021916 3300005441 Bacteria 3719
141 Ga0070700_100204956 3300005441 Bacteria 1388
142 Ga0070700_100625458 3300005441 Bacteria 847
143 Ga0070694_100682336 3300005444 Bacteria 834
144 Ga0070663_100010255 3300005455 Bacteria 5836
145 Ga0070663_100019255 3300005455 Bacteria 4494
146 Ga0070663_100043787 3300005455 Bacteria 3152
147 Ga0070663_100076206 3300005455 Bacteria 2452
148 Ga0070663_100190761 3300005455 Bacteria 1595
149 Ga0070678_100000982 3300005456 Bacteria 14738
150 Ga0070678_100001348 3300005456 Bacteria 13061
151 Ga0070678_100085937 3300005456 Bacteria 2398
152 Ga0070678_100299571 3300005456 Bacteria 1366
153 Ga0070662_100001081 3300005457 Bacteria 16613
154 Ga0070662_100083792 3300005457 Bacteria 2380
155 Ga0070662_100223556 3300005457 Bacteria 1503
156 Ga0070662_100259751 3300005457 Bacteria 1399
157 Ga0070681_10001160 3300005458 Bacteria 22748
158 Ga0070681_10939589 3300005458 Bacteria 784
159 Ga0070681_11030478 3300005458 Bacteria 743
160 Ga0068867_100003590 3300005459 Bacteria 10912
161 Ga0068867_100009061 3300005459 Bacteria 7021
162 Ga0068867_100010823 3300005459 Bacteria 6434
163 Ga0068867_100019400 3300005459 Bacteria 4846
164 Ga0068867_100077601 3300005459 Bacteria 2496
165 Ga0068867_100384660 3300005459 Bacteria 1179
166 Ga0068867_100501068 3300005459 Bacteria 1044
167 Ga0070685_10002380 3300005466 Bacteria 9680
168 Ga0070706_100281817 3300005467 Bacteria 1551
169 Ga0070706_101135846 3300005467 Bacteria 719
170 Ga0070698_100772739 3300005471 Bacteria 904
171 Ga0070698_101251665 3300005471 Bacteria 692
172 Ga0070699_100093099 3300005518 Bacteria 2637
173 Ga0070679_100019147 3300005530 Bacteria 6651
174 Ga0070679_100178590 3300005530 Bacteria 2096
175 Ga0070679_100696648 3300005530 Bacteria 958
176 Ga0070684_100040000 3300005535 Bacteria 4034
177 Ga0070684_100043995 3300005535 Bacteria 3860
178 Ga0070684_100093491 3300005535 Bacteria 2677
179 Ga0070684_100499945 3300005535 Bacteria 1126
180 Ga0068853_100002757 3300005539 Bacteria 13266
181 Ga0068853_100056192 3300005539 Bacteria 3393
182 Ga0068853_100074913 3300005539 Bacteria 2953
183 Ga0068853_100366468 3300005539 Bacteria 1343
184 Ga0068853_100542898 3300005539 Bacteria 1101
185 Ga0068853_101410792 3300005539 Bacteria 674
186 Ga0068853_101952992 3300005539 Bacteria 569
187 Ga0070672_100000914 3300005543 Bacteria 17688
188 Ga0070672_100007295 3300005543 Bacteria 7493
189 Ga0070672_100012306 3300005543 Bacteria 6000
190 Ga0070672_100022564 3300005543 Bacteria 4626
191 Ga0070672_100042554 3300005543 Bacteria 3498
192 Ga0070672_100075834 3300005543 Bacteria 2685
193 Ga0070672_100105320 3300005543 Bacteria 2293
194 Ga0070672_100228126 3300005543 Bacteria 1564
195 Ga0070672_101066203 3300005543 Bacteria 717
196 Ga0070686_100085731 3300005544 Bacteria 2095
197 Ga0070696_100004065 3300005546 Bacteria 9755
198 Ga0070693_100691402 3300005547 Bacteria 746
199 Ga0070665_100002542 3300005548 Bacteria 20041
200 Ga0070665_100012901 3300005548 Bacteria 8416
201 Ga0070665_100121697 3300005548 Bacteria 2611
202 Ga0070665_100305035 3300005548 Bacteria 1595
203 Ga0070665_100578305 3300005548 Bacteria 1136
204 Ga0070665_100637102 3300005548 Bacteria 1079
205 Ga0070665_101173044 3300005548 Bacteria 779
206 Ga0068855_100003908 3300005563 Bacteria 18194
207 Ga0068855_100019019 3300005563 Bacteria 8257
208 Ga0068855_100040144 3300005563 Bacteria 5556
209 Ga0068855_100057251 3300005563 Bacteria 4570
210 Ga0068855_100453030 3300005563 Bacteria 1400
211 Ga0070664_100002998 3300005564 Bacteria 13657
212 Ga0070664_100013440 3300005564 Bacteria 6666
213 Ga0070664_100083468 3300005564 Bacteria 2756
214 Ga0070664_100084498 3300005564 Bacteria 2740
215 Ga0070664_100094788 3300005564 Bacteria 2588
216 Ga0070664_100345226 3300005564 Bacteria 1353
217 Ga0070664_101033582 3300005564 Bacteria 773
218 Ga0070664_101553058 3300005564 Bacteria 627
219 Ga0068857_100008373 3300005577 Bacteria 8937
220 Ga0068857_100010671 3300005577 Bacteria 7991
221 Ga0068857_100065029 3300005577 Bacteria 3243
222 Ga0068857_100399942 3300005577 Bacteria 1278
223 Ga0068854_100002321 3300005578 Bacteria 11730
224 Ga0068854_100055101 3300005578 Bacteria 2861
225 Ga0068854_100115025 3300005578 Bacteria 2035
226 Ga0068854_100163739 3300005578 Bacteria 1725
227 Ga0068854_100196971 3300005578 Bacteria 1581
228 Ga0068854_100322409 3300005578 Bacteria 1256
229 Ga0068856_100001379 3300005614 Bacteria 25540
230 Ga0068856_100022222 3300005614 Bacteria 6167
231 Ga0068856_100365263 3300005614 Bacteria 1462
232 Ga0068856_101572557 3300005614 Bacteria 671
233 Ga0070702_100133372 3300005615 Bacteria 1572
234 Ga0068852_100002000 3300005616 Bacteria 13901
235 Ga0068852_100002691 3300005616 Bacteria 12273
236 Ga0068852_100024896 3300005616 Bacteria 4843
237 Ga0068852_100067303 3300005616 Bacteria 3131
238 Ga0068852_100088668 3300005616 Bacteria 2763
239 Ga0068852_100138091 3300005616 Bacteria 2253
240 Ga0068852_100213207 3300005616 Bacteria 1833
241 Ga0068852_100328423 3300005616 Bacteria 1487
242 Ga0068859_100006523 3300005617 Bacteria 11850
243 Ga0068859_100084366 3300005617 Bacteria 3222
244 Ga0068859_100243236 3300005617 Bacteria 1889
245 Ga0068859_100824334 3300005617 Bacteria 1014
246 Ga0068864_100005598 3300005618 Bacteria 10299
247 Ga0068864_100007903 3300005618 Bacteria 8763
248 Ga0068864_100009458 3300005618 Bacteria 8043
249 Ga0068864_100009678 3300005618 Bacteria 7951
250 Ga0068864_100018419 3300005618 Bacteria 5834
251 Ga0068864_100310185 3300005618 Bacteria 1479
252 Ga0068864_100807004 3300005618 Bacteria 922
253 Ga0068866_10057543 3300005718 Bacteria 2004
254 Ga0068866_10063584 3300005718 Bacteria 1924
255 Ga0068866_10195641 3300005718 Bacteria 1204
256 Ga0068861_100001362 3300005719 Bacteria 15368
257 Ga0068861_100001763 3300005719 Bacteria 13905
258 Ga0068861_100012929 3300005719 Bacteria 5828
259 Ga0068861_100052360 3300005719 Bacteria 3102
260 Ga0068861_100235924 3300005719 Bacteria 1553
261 Ga0068861_100261518 3300005719 Bacteria 1482
262 Ga0068861_100751837 3300005719 Bacteria 911
263 Ga0068851_10007676 3300005834 Bacteria 4962
264 Ga0068851_10010234 3300005834 Bacteria 4374
265 Ga0068851_10026215 3300005834 Bacteria 2863
266 Ga0068851_10028777 3300005834 Bacteria 2746
267 Ga0068851_10078842 3300005834 Bacteria 1716
268 Ga0068851_10387280 3300005834 Bacteria 820
269 Ga0068851_10489637 3300005834 Bacteria 736
270 Ga0068870_10017237 3300005840 Bacteria 3467
271 Ga0068870_10027358 3300005840 Bacteria 2851
272 Ga0068863_100002100 3300005841 Bacteria 19742
273 Ga0068863_100013029 3300005841 Bacteria 8018
274 Ga0068863_100026961 3300005841 Bacteria 5479
275 Ga0068863_100087053 3300005841 Bacteria 2960
276 Ga0068863_100195704 3300005841 Bacteria 1943
277 Ga0068863_100264682 3300005841 Bacteria 1663
278 Ga0068858_100000612 3300005842 Bacteria 37346
279 Ga0068858_100055030 3300005842 Bacteria 3678
280 Ga0068858_100097393 3300005842 Bacteria 2742
281 Ga0068858_100150477 3300005842 Bacteria 2188
282 Ga0068858_100507461 3300005842 Bacteria 1165
283 Ga0068860_100011838 3300005843 Bacteria 8598
284 Ga0068860_100023346 3300005843 Bacteria 5978
285 Ga0068860_100044277 3300005843 Bacteria 4242
286 Ga0068860_100065973 3300005843 Bacteria 3437
287 Ga0068860_100200958 3300005843 Bacteria 1931
288 Ga0068860_101109312 3300005843 Bacteria 811
289 Ga0068860_101391817 3300005843 Bacteria 723
290 Ga0068862_100002076 3300005844 Bacteria 18077
291 Ga0068862_100013014 3300005844 Bacteria 6880
292 Ga0068862_100043495 3300005844 Bacteria 3830
293 Ga0068862_100088427 3300005844 Bacteria 2695
294 Ga0068862_100092127 3300005844 Bacteria 2641
295 Ga0068862_102264194 3300005844 Bacteria 555
296 Ga0081455_10317106 3300005937 Bacteria 1112
297 Ga0075363_100230016 3300006048 Bacteria 1064
298 Ga0075364_10000494 3300006051 Bacteria 20067
299 Ga0075362_10242392 3300006177 Bacteria 885
300 Ga0075367_10046720 3300006178 Bacteria 2545
301 Ga0075369_10000250 3300006186 Bacteria 15991
302 Ga0097621_100079081 3300006237 Bacteria 2733
303 Ga0097621_100099569 3300006237 Bacteria 2443
304 Ga0097621_100225486 3300006237 Bacteria 1634
305 Ga0068871_100003825 3300006358 Bacteria 10375
306 Ga0068871_100118990 3300006358 Bacteria 2229
307 Ga0068871_100213997 3300006358 Bacteria 1668
308 Ga0068871_100473592 3300006358 Bacteria 1125
309 Ga0068871_101040792 3300006358 Bacteria 764
310 Ga0068871_101311839 3300006358 Bacteria 681
311 Ga0075428_100103504 3300006844 Bacteria 3104
312 Ga0075428_100160557 3300006844 Bacteria 2440
313 Ga0075428_100347659 3300006844 Bacteria 1592
314 Ga0075428_100586531 3300006844 Bacteria 1191
315 Ga0075430_100020888 3300006846 Bacteria 5567
316 Ga0075431_100159632 3300006847 Bacteria 2319
317 Ga0075434_100070066 3300006871 Bacteria 3497
318 Ga0075434_100184957 3300006871 Bacteria 2104
319 Ga0075434_100651911 3300006871 Bacteria 1071
320 Ga0068865_100023951 3300006881 Bacteria 4001
321 Ga0068865_100127465 3300006881 Bacteria 1902
322 Ga0068865_100128349 3300006881 Bacteria 1896
323 Ga0068865_100411915 3300006881 Bacteria 1109
324 Ga0075436_100529516 3300006914 Bacteria 864
325 Ga0075436_100706649 3300006914 Bacteria 747
326 Ga0097620_100006521 3300006931 Bacteria 11850
327 Ga0097620_100084360 3300006931 Bacteria 3222
328 Ga0097620_100243229 3300006931 Bacteria 1889
329 Ga0097620_100824340 3300006931 Bacteria 1014
330 Ga0075435_100379716 3300007076 Bacteria 1214
331 Ga0075435_100446474 3300007076 Bacteria 1115
332 Ga0075435_101082020 3300007076 Bacteria 701
333 Ga0105250_10027260 3300009092 Bacteria 2302
334 Ga0105240_10102436 3300009093 Bacteria 3479
335 Ga0105240_10166930 3300009093 Bacteria 2610
336 Ga0105240_10522447 3300009093 Bacteria 1317
337 Ga0111539_10053252 3300009094 Bacteria 4817
338 Ga0111539_10183588 3300009094 Bacteria 2443
339 Ga0111539_11341682 3300009094 Bacteria 830
340 Ga0111539_11399555 3300009094 Bacteria 811
341 Ga0105245_10200008 3300009098 Bacteria 1918
342 Ga0105245_10470611 3300009098 Bacteria 1268
343 Ga0105247_10010766 3300009101 Bacteria 5525
344 Ga0114129_10354316 3300009147 Bacteria 1943
345 Ga0114129_10480688 3300009147 Bacteria 1625
346 Ga0105243_10118295 3300009148 Bacteria 2229
347 Ga0105243_10321304 3300009148 Bacteria 1411
348 Ga0105243_10336876 3300009148 Bacteria 1380
349 Ga0105241_10121350 3300009174 Bacteria 2105
350 Ga0105241_10143629 3300009174 Bacteria 1946
351 Ga0105241_11041971 3300009174 Bacteria 767
352 Ga0105242_10428620 3300009176 Bacteria 1241
353 Ga0105248_10015240 3300009177 Bacteria 8473
354 Ga0105248_10025258 3300009177 Bacteria 6606
355 Ga0105248_10072760 3300009177 Bacteria 3863
356 Ga0105248_10147483 3300009177 Bacteria 2655
357 Ga0105248_10397237 3300009177 Bacteria 1552
358 Ga0105248_10657051 3300009177 Bacteria 1183
359 Ga0105248_10834945 3300009177 Bacteria 1040
360 Ga0105237_10173559 3300009545 Bacteria 2156
361 Ga0105237_10183286 3300009545 Bacteria 2094
362 Ga0105238_10075696 3300009551 Bacteria 3357
363 Ga0105238_10412946 3300009551 Bacteria 1344
364 Ga0105238_10626678 3300009551 Bacteria 1085
365 Ga0105238_10628665 3300009551 Bacteria 1083
366 Ga0105249_10020425 3300009553 Bacteria 5922
367 Ga0105249_10074146 3300009553 Bacteria 3149
368 Ga0105249_10128452 3300009553 Bacteria 2417
369 Ga0105249_10464426 3300009553 Bacteria 1306
370 Ga0105249_10855570 3300009553 Bacteria 975
371 Ga0105239_10082015 3300010375 Bacteria 3550
372 Ga0105239_10981235 3300010375 Bacteria 971
373 Ga0105246_10329619 3300011119 Bacteria 1244
374 Ga0157373_10001932 3300013100 Bacteria 15747
375 Ga0157373_10337764 3300013100 Bacteria 1073
376 Ga0157371_10000303 3300013102 Bacteria 64643
377 Ga0157371_10043784 3300013102 Bacteria 3188
378 Ga0157371_10096730 3300013102 Bacteria 2092
379 Ga0157370_10011858 3300013104 Bacteria 9092
380 Ga0157370_10108577 3300013104 Bacteria 2594
381 Ga0157370_10183907 3300013104 Bacteria 1941
382 Ga0157369_10135579 3300013105 Bacteria 2607
383 Ga0157369_10217825 3300013105 Bacteria 1999
384 Ga0157369_10891388 3300013105 Bacteria 912
385 Ga0157369_12357950 3300013105 Bacteria 539
386 Ga0157374_10063682 3300013296 Bacteria 3459
387 Ga0157374_10103382 3300013296 Bacteria 2733
388 Ga0157374_10142988 3300013296 Bacteria 2323
389 Ga0157374_10361450 3300013296 Bacteria 1444
390 Ga0157374_10554585 3300013296 Bacteria 1157
391 Ga0157374_11116787 3300013296 Bacteria 809
392 Ga0157378_10004675 3300013297 Bacteria 12013
393 Ga0157378_10090675 3300013297 Bacteria 2778
394 Ga0157378_10436705 3300013297 Bacteria 1297
395 Ga0157378_10718677 3300013297 Bacteria 1020
396 Ga0157378_10754127 3300013297 Bacteria 996
397 Ga0163162_10078494 3300013306 Bacteria 3367
398 Ga0163162_10089116 3300013306 Bacteria 3165
399 Ga0163162_10431489 3300013306 Bacteria 1450
400 Ga0163162_10736234 3300013306 Bacteria 1106
401 Ga0163162_12199454 3300013306 Bacteria 633
402 Ga0157372_10001717 3300013307 Bacteria 23775
403 Ga0157372_10002828 3300013307 Bacteria 18755
404 Ga0157372_10007943 3300013307 Bacteria 11276
405 Ga0157372_10011850 3300013307 Bacteria 9287
406 Ga0157372_10049411 3300013307 Bacteria 4677
407 Ga0157372_10148713 3300013307 Bacteria 2702
408 Ga0157372_10310060 3300013307 Bacteria 1837
409 Ga0157375_10002602 3300013308 Bacteria 15664
410 Ga0157375_10049121 3300013308 Bacteria 4132
411 Ga0157375_10300981 3300013308 Bacteria 1767
412 Ga0157375_10484297 3300013308 Bacteria 1402
413 Ga0157375_10860866 3300013308 Bacteria 1052
414 Ga0157375_10862526 3300013308 Bacteria 1051
415 Ga0157375_10937588 3300013308 Bacteria 1008
416 Ga0157375_11246719 3300013308 Bacteria 873
417 Ga0163163_10001190 3300014325 Bacteria 22057
418 Ga0163163_10010520 3300014325 Bacteria 8325
419 Ga0163163_10025908 3300014325 Bacteria 5596
420 Ga0163163_10029634 3300014325 Bacteria 5267
421 Ga0163163_10575587 3300014325 Bacteria 1189
422 Ga0163163_12136756 3300014325 Bacteria 619
423 Ga0157380_10005687 3300014326 Bacteria 8720
424 Ga0157380_10006810 3300014326 Bacteria 8075
425 Ga0157380_10290053 3300014326 Bacteria 1502
426 Ga0157380_10439444 3300014326 Bacteria 1250
427 Ga0182008_10177367 3300014497 Bacteria 1077
428 Ga0157377_10000871 3300014745 Bacteria 12560
429 Ga0157377_10712551 3300014745 Bacteria 730
430 Ga0157379_10000105 3300014968 Bacteria 57976
431 Ga0157379_10005162 3300014968 Bacteria 11213
432 Ga0157379_10008015 3300014968 Bacteria 9165
433 Ga0157379_10058207 3300014968 Bacteria 3455
434 Ga0157379_10378272 3300014968 Bacteria 1299
435 Ga0157376_10003620 3300014969 Bacteria 10665
436 Ga0157376_10087209 3300014969 Bacteria 2693
437 Ga0157376_10237184 3300014969 Bacteria 1697
438 Ga0157376_10427683 3300014969 Bacteria 1286
439 Ga0157376_10500411 3300014969 Bacteria 1194
440 Ga0163161_10019913 3300017792 Bacteria 4706
441 Ga0163161_10023041 3300017792 Bacteria 4388
442 Ga0163161_10545575 3300017792 Bacteria 950
443 Ga0163161_10632561 3300017792 Bacteria 885
444 Ga0163161_10728437 3300017792 Bacteria 828
445 Ga0154015_1059651 3300020610 Bacteria 2744
446 Ga0213876_10139857 3300021384 Bacteria 1287
447 Ga0224712_10005960 3300022467 Bacteria 3439
448 Ga0207697_10000471 3300025315 Bacteria 22740
449 Ga0207697_10058323 3300025315 Bacteria 1603
450 Ga0207656_10006239 3300025321 Bacteria 4271
451 Ga0207656_10012737 3300025321 Bacteria 3202
452 Ga0207656_10230369 3300025321 Bacteria 903
453 Ga0207682_10000044 3300025893 Bacteria 51808
454 Ga0207682_10001806 3300025893 Bacteria 9787
455 Ga0207682_10073389 3300025893 Bacteria 1453
456 Ga0207692_10004583 3300025898 Bacteria 5481
457 Ga0207692_10710185 3300025898 Bacteria 653
458 Ga0207642_10057585 3300025899 Bacteria 1789
459 Ga0207642_10066733 3300025899 Bacteria 1696
460 Ga0207642_10188137 3300025899 Bacteria 1131
461 Ga0207710_10033039 3300025900 Bacteria 2268
462 Ga0207688_10091693 3300025901 Bacteria 1745
463 Ga0207688_10100088 3300025901 Bacteria 1673
464 Ga0207680_10002742 3300025903 Bacteria 8238
465 Ga0207680_10019059 3300025903 Bacteria 3663
466 Ga0207680_10047447 3300025903 Bacteria 2545
467 Ga0207680_10103464 3300025903 Bacteria 1834
468 Ga0207699_10029083 3300025906 Bacteria 3078
469 Ga0207645_10001325 3300025907 Bacteria 20333
470 Ga0207645_10004314 3300025907 Bacteria 10544
471 Ga0207645_10013037 3300025907 Bacteria 5616
472 Ga0207645_10061294 3300025907 Bacteria 2402
473 Ga0207645_10155820 3300025907 Bacteria 1492
474 Ga0207645_10624679 3300025907 Bacteria 732
475 Ga0207643_10000161 3300025908 Bacteria 46356
476 Ga0207643_10016622 3300025908 Bacteria 4013
477 Ga0207705_10158344 3300025909 Bacteria 1700
478 Ga0207705_10159353 3300025909 Bacteria 1695
479 Ga0207705_10517182 3300025909 Bacteria 927
480 Ga0207705_10631640 3300025909 Bacteria 833
481 Ga0207684_10413045 3300025910 Bacteria 1160
482 Ga0207654_10438270 3300025911 Bacteria 914
483 Ga0207707_10282532 3300025912 Bacteria 1437
484 Ga0207707_10454226 3300025912 Bacteria 1096
485 Ga0207707_10791781 3300025912 Bacteria 790
486 Ga0207695_10041552 3300025913 Bacteria 4921
487 Ga0207695_10043837 3300025913 Bacteria 4763
488 Ga0207671_10507887 3300025914 Bacteria 961
489 Ga0207663_10151028 3300025916 Bacteria 1629
490 Ga0207663_11143859 3300025916 Bacteria 626
491 Ga0207660_10321431 3300025917 Bacteria 1236
492 Ga0207662_10070704 3300025918 Bacteria 2111
493 Ga0207657_10001114 3300025919 Bacteria 28498
494 Ga0207657_10019069 3300025919 Bacteria 6526
495 Ga0207657_10023158 3300025919 Bacteria 5790
496 Ga0207649_10003803 3300025920 Bacteria 8235
497 Ga0207649_10011530 3300025920 Bacteria 4875
498 Ga0207649_10056800 3300025920 Bacteria 2445
499 Ga0207649_10094126 3300025920 Bacteria 1968
500 Ga0207649_10203692 3300025920 Bacteria 1399
501 Ga0207649_10239984 3300025920 Bacteria 1300
502 Ga0207652_10009211 3300025921 Bacteria 7942
503 Ga0207652_10026593 3300025921 Bacteria 4821
504 Ga0207652_10066497 3300025921 Bacteria 3124
505 Ga0207652_10444666 3300025921 Bacteria 1169
506 Ga0207646_10786979 3300025922 Bacteria 848
507 Ga0207681_10006193 3300025923 Bacteria 7340
508 Ga0207681_10049513 3300025923 Bacteria 2840
509 Ga0207681_10094130 3300025923 Bacteria 2146
510 Ga0207681_10182954 3300025923 Unclassified 1598
511 Ga0207681_10190649 3300025923 Bacteria 1568
512 Ga0207681_10274609 3300025923 Bacteria 1324
513 Ga0207694_10061823 3300025924 Bacteria 2915
514 Ga0207694_10895945 3300025924 Bacteria 750
515 Ga0207650_10001658 3300025925 Bacteria 15859
516 Ga0207650_10006587 3300025925 Bacteria 7916
517 Ga0207650_10057166 3300025925 Bacteria 2900
518 Ga0207650_10060690 3300025925 Bacteria 2822
519 Ga0207650_10113441 3300025925 Bacteria 2101
520 Ga0207650_10238504 3300025925 Bacteria 1469
521 Ga0207650_10331078 3300025925 Bacteria 1249
522 Ga0207650_10640552 3300025925 Bacteria 895
523 Ga0207659_10001994 3300025926 Bacteria 12084
524 Ga0207659_10002849 3300025926 Bacteria 10309
525 Ga0207659_10003224 3300025926 Bacteria 9757
526 Ga0207659_10083486 3300025926 Bacteria 2368
527 Ga0207659_10165217 3300025926 Bacteria 1741
528 Ga0207659_10323128 3300025926 Bacteria 1273
529 Ga0207687_10306653 3300025927 Bacteria 1280
530 Ga0207700_10331872 3300025928 Bacteria 1320
531 Ga0207700_11272342 3300025928 Bacteria 656
532 Ga0207664_10024542 3300025929 Bacteria 4532
533 Ga0207664_10036152 3300025929 Bacteria 3816
534 Ga0207664_10327191 3300025929 Bacteria 1353
535 Ga0207644_10004238 3300025931 Bacteria 9309
536 Ga0207644_10045418 3300025931 Bacteria 3125
537 Ga0207644_10121670 3300025931 Bacteria 1987
538 Ga0207644_10699571 3300025931 Bacteria 845
539 Ga0207644_10728657 3300025931 Bacteria 827
540 Ga0207644_10754011 3300025931 Bacteria 813
541 Ga0207690_10001868 3300025932 Bacteria 12937
542 Ga0207690_10061917 3300025932 Bacteria 2545
543 Ga0207690_10092030 3300025932 Bacteria 2145
544 Ga0207690_11574561 3300025932 Bacteria 549
545 Ga0207706_10000023 3300025933 Bacteria 153979
546 Ga0207706_10050271 3300025933 Bacteria 3684
547 Ga0207706_10112789 3300025933 Bacteria 2392
548 Ga0207706_11095769 3300025933 Bacteria 666
549 Ga0207709_10531951 3300025935 Bacteria 922
550 Ga0207670_10386246 3300025936 Bacteria 1116
551 Ga0207669_10005949 3300025937 Bacteria 5526
552 Ga0207669_10016174 3300025937 Bacteria 3784
553 Ga0207669_10025077 3300025937 Bacteria 3215
554 Ga0207669_10058700 3300025937 Bacteria 2349
555 Ga0207669_10889296 3300025937 Bacteria 743
556 Ga0207704_10026968 3300025938 Bacteria 3160
557 Ga0207704_10041359 3300025938 Bacteria 2702
558 Ga0207704_10781205 3300025938 Bacteria 796
559 Ga0207691_10000022 3300025940 Bacteria 132936
560 Ga0207691_10000224 3300025940 Bacteria 55186
561 Ga0207691_10009118 3300025940 Bacteria 9523
562 Ga0207691_10032316 3300025940 Bacteria 4880
563 Ga0207691_10059374 3300025940 Bacteria 3478
564 Ga0207691_10067215 3300025940 Bacteria 3241
565 Ga0207691_10358264 3300025940 Bacteria 1247
566 Ga0207691_10451591 3300025940 Bacteria 1094
567 Ga0207691_11104910 3300025940 Bacteria 659
568 Ga0207711_10012405 3300025941 Bacteria 7085
569 Ga0207711_10028404 3300025941 Bacteria 4707
570 Ga0207711_10178994 3300025941 Bacteria 1927
571 Ga0207711_10205488 3300025941 Bacteria 1798
572 Ga0207711_10277556 3300025941 Bacteria 1543
573 Ga0207711_10946343 3300025941 Bacteria 800
574 Ga0207689_10000147 3300025942 Bacteria 60540
575 Ga0207689_10002088 3300025942 Bacteria 18853
576 Ga0207689_10011258 3300025942 Bacteria 7676
577 Ga0207661_10015607 3300025944 Bacteria 5594
578 Ga0207661_10151896 3300025944 Bacteria 2002
579 Ga0207661_10243076 3300025944 Bacteria 1598
580 Ga0207679_10008603 3300025945 Bacteria 6506
581 Ga0207679_10076457 3300025945 Bacteria 2544
582 Ga0207679_10079241 3300025945 Bacteria 2504
583 Ga0207679_10100532 3300025945 Bacteria 2260
584 Ga0207679_10836373 3300025945 Bacteria 840
585 Ga0207679_11085889 3300025945 Bacteria 734
586 Ga0207667_10007723 3300025949 Bacteria 12857
587 Ga0207667_10012582 3300025949 Bacteria 9733
588 Ga0207667_10012658 3300025949 Bacteria 9696
589 Ga0207667_10043293 3300025949 Bacteria 4779
590 Ga0207667_10060678 3300025949 Bacteria 3958
591 Ga0207667_10426822 3300025949 Bacteria 1348
592 Ga0207667_11072368 3300025949 Bacteria 790
593 Ga0207651_10005388 3300025960 Bacteria 6561
594 Ga0207651_10008537 3300025960 Bacteria 5539
595 Ga0207651_10012431 3300025960 Bacteria 4818
596 Ga0207651_10021607 3300025960 Bacteria 3915
597 Ga0207651_10031308 3300025960 Bacteria 3398
598 Ga0207651_10747120 3300025960 Bacteria 864
599 Ga0207712_10012882 3300025961 Bacteria 5352
600 Ga0207712_10018851 3300025961 Bacteria 4499
601 Ga0207712_10548820 3300025961 Bacteria 994
602 Ga0207668_10003779 3300025972 Bacteria 8919
603 Ga0207668_10016076 3300025972 Bacteria 4662
604 Ga0207668_10021387 3300025972 Bacteria 4126
605 Ga0207668_10028298 3300025972 Bacteria 3663
606 Ga0207668_10112766 3300025972 Bacteria 2043
607 Ga0207668_10448573 3300025972 Bacteria 1100
608 Ga0207668_10545576 3300025972 Bacteria 1003
609 Ga0207668_10786096 3300025972 Bacteria 842
610 Ga0207668_11790681 3300025972 Bacteria 554
611 Ga0207640_10009290 3300025981 Bacteria 5500
612 Ga0207640_10021612 3300025981 Bacteria 3838
613 Ga0207640_10062054 3300025981 Bacteria 2478
614 Ga0207640_10083873 3300025981 Bacteria 2186
615 Ga0207640_10091620 3300025981 Bacteria 2106
616 Ga0207640_10406551 3300025981 Bacteria 1110
617 Ga0207640_11333567 3300025981 Bacteria 641
618 Ga0207658_10006239 3300025986 Bacteria 8145
619 Ga0207658_10008453 3300025986 Bacteria 7006
620 Ga0207658_10011567 3300025986 Bacteria 6007
621 Ga0207658_10041400 3300025986 Bacteria 3335
622 Ga0207658_10047658 3300025986 Bacteria 3137
623 Ga0207658_10068524 3300025986 Bacteria 2677
624 Ga0207658_10086932 3300025986 Bacteria 2413
625 Ga0207658_10284877 3300025986 Bacteria 1418
626 Ga0207658_10363502 3300025986 Bacteria 1263
627 Ga0207677_10009797 3300026023 Bacteria 5398
628 Ga0207677_10012063 3300026023 Bacteria 4951
629 Ga0207677_10017587 3300026023 Bacteria 4268
630 Ga0207677_10246566 3300026023 Bacteria 1448
631 Ga0207703_10008603 3300026035 Bacteria 8057
632 Ga0207703_10070477 3300026035 Bacteria 2885
633 Ga0207703_10111517 3300026035 Bacteria 2335
634 Ga0207703_10188286 3300026035 Bacteria 1826
635 Ga0207703_10558159 3300026035 Unclassified 1080
636 Ga0207639_10006189 3300026041 Bacteria 8128
637 Ga0207639_10026571 3300026041 Bacteria 4207
638 Ga0207639_10061326 3300026041 Bacteria 2904
639 Ga0207639_10452391 3300026041 Bacteria 1166
640 Ga0207639_10570097 3300026041 Bacteria 1041
641 Ga0207639_10794483 3300026041 Bacteria 882
642 Ga0207639_11001765 3300026041 Bacteria 782
643 Ga0207678_10002769 3300026067 Bacteria 15871
644 Ga0207678_10017478 3300026067 Bacteria 6297
645 Ga0207678_10021448 3300026067 Bacteria 5663
646 Ga0207678_10035040 3300026067 Bacteria 4370
647 Ga0207678_10073764 3300026067 Bacteria 2924
648 Ga0207678_10255117 3300026067 Bacteria 1502
649 Ga0207708_10000330 3300026075 Bacteria 37297
650 Ga0207708_10022570 3300026075 Bacteria 4753
651 Ga0207708_10238624 3300026075 Bacteria 1462
652 Ga0207708_10276330 3300026075 Bacteria 1360
653 Ga0207702_10129038 3300026078 Bacteria 2273
654 Ga0207702_10129152 3300026078 Bacteria 2272
655 Ga0207702_10811243 3300026078 Bacteria 925
656 Ga0207641_10004344 3300026088 Bacteria 12299
657 Ga0207641_10006556 3300026088 Bacteria 9784
658 Ga0207641_10010037 3300026088 Bacteria 7788
659 Ga0207641_10137293 3300026088 Bacteria 2202
660 Ga0207641_10197281 3300026088 Bacteria 1853
661 Ga0207641_10208816 3300026088 Bacteria 1805
662 Ga0207641_10581078 3300026088 Bacteria 1095
663 Ga0207641_11545843 3300026088 Bacteria 665
664 Ga0207641_12293335 3300026088 Bacteria 539
665 Ga0207648_10003749 3300026089 Bacteria 15887
666 Ga0207648_10008541 3300026089 Bacteria 9910
667 Ga0207648_10017870 3300026089 Bacteria 6435
668 Ga0207648_10034621 3300026089 Bacteria 4452
669 Ga0207648_10062181 3300026089 Bacteria 3256
670 Ga0207648_10410106 3300026089 Bacteria 1229
671 Ga0207648_10521893 3300026089 Bacteria 1088
672 Ga0207676_10004846 3300026095 Bacteria 9538
673 Ga0207676_10009364 3300026095 Bacteria 6971
674 Ga0207676_10045405 3300026095 Bacteria 3394
675 Ga0207676_10062168 3300026095 Bacteria 2960
676 Ga0207676_10543500 3300026095 Bacteria 1109
677 Ga0207676_10565440 3300026095 Bacteria 1088
678 Ga0207676_11271944 3300026095 Bacteria 730
679 Ga0207676_11595296 3300026095 Bacteria 650
680 Ga0207676_11738167 3300026095 Unclassified 622
681 Ga0207674_10000775 3300026116 Bacteria 41699
682 Ga0207674_10002604 3300026116 Bacteria 22638
683 Ga0207674_10003926 3300026116 Bacteria 18101
684 Ga0207674_10007754 3300026116 Bacteria 12490
685 Ga0207674_10092555 3300026116 Bacteria 3012
686 Ga0207675_100000632 3300026118 Bacteria 34518
687 Ga0207675_100003092 3300026118 Bacteria 16306
688 Ga0207675_100008081 3300026118 Bacteria 9909
689 Ga0207675_100016851 3300026118 Bacteria 6826
690 Ga0207675_100051806 3300026118 Bacteria 3830
691 Ga0207675_100072589 3300026118 Bacteria 3219
692 Ga0207675_100287668 3300026118 Bacteria 1598
693 Ga0207675_100851294 3300026118 Bacteria 927
694 Ga0207675_102020633 3300026118 Unclassified 594
695 Ga0207683_10000283 3300026121 Bacteria 45381
696 Ga0207683_10001343 3300026121 Bacteria 22211
697 Ga0207683_10003645 3300026121 Bacteria 13401
698 Ga0207683_10034269 3300026121 Bacteria 4412
699 Ga0207683_10126863 3300026121 Bacteria 2293
700 Ga0207683_11275720 3300026121 Bacteria 680
701 Ga0207698_10006776 3300026142 Bacteria 7161
702 Ga0207698_10015332 3300026142 Bacteria 5128
703 Ga0207698_10065023 3300026142 Bacteria 2862
704 Ga0207698_10114264 3300026142 Bacteria 2270
705 Ga0207698_10280324 3300026142 Bacteria 1541
706 Ga0207698_10663535 3300026142 Bacteria 1034
707 Ga0207698_11201807 3300026142 Bacteria 772
708 Ga0209983_1084532 3300027665 Bacteria 712
709 Ga0209998_10029941 3300027717 Bacteria 1201
710 Ga0209974_10005746 3300027876 Bacteria 4350
711 Ga0207428_10541739 3300027907 Bacteria 842
712 Ga0207428_10878303 3300027907 Bacteria 634
713 Ga0268266_10003808 3300028379 Bacteria 14754
714 Ga0268266_10028908 3300028379 Bacteria 4710
715 Ga0268266_10099851 3300028379 Bacteria 2556
716 Ga0268266_10126500 3300028379 Bacteria 2281
717 Ga0268266_10245694 3300028379 Bacteria 1653
718 Ga0268266_10431102 3300028379 Bacteria 1251
719 Ga0268266_10486078 3300028379 Bacteria 1177
720 Ga0268266_11053747 3300028379 Bacteria 787
721 Ga0268266_11062613 3300028379 Bacteria 783
722 Ga0268266_11120210 3300028379 Bacteria 761
723 Ga0268265_10004417 3300028380 Bacteria 9769
724 Ga0268265_10043968 3300028380 Bacteria 3324
725 Ga0268265_10058560 3300028380 Bacteria 2942
726 Ga0268265_10066854 3300028380 Bacteria 2780
727 Ga0268265_10806234 3300028380 Bacteria 915
728 Ga0268264_10010306 3300028381 Bacteria 7733
729 Ga0268264_10020581 3300028381 Bacteria 5390
730 Ga0268264_10052267 3300028381 Bacteria 3407
731 Ga0268264_10147980 3300028381 Bacteria 2102
732 Ga0268264_10208457 3300028381 Bacteria 1792
733 Ga0268264_11634814 3300028381 Bacteria 655
734 Ga0265330_10004514 3300031235 Bacteria 7057
735 Ga0265332_10000141 3300031238 Bacteria 59136
736 Ga0265325_10016639 3300031241 Bacteria 4106
737 Ga0265339_10029144 3300031249 Bacteria 3134
738 Ga0265331_10000972 3300031250 Bacteria 22763
739 Ga0265327_10003882 3300031251 Bacteria 13769
740 Ga0265316_10086543 3300031344 Bacteria 2395
741 Ga0307408_100556982 3300031548 Bacteria 1012
742 Ga0265342_10005713 3300031712 Bacteria 9406
743 Ga0307405_10989691 3300031731 Bacteria 717
744 Ga0307413_10001971 3300031824 Bacteria 8145
745 Ga0307413_10976608 3300031824 Bacteria 724
746 Ga0307410_10010067 3300031852 Bacteria 5339
747 Ga0307406_10004583 3300031901 Bacteria 7523
748 Ga0307406_10061367 3300031901 Bacteria 2428
749 Ga0307407_10003221 3300031903 Bacteria 6631
750 Ga0307407_10622466 3300031903 Bacteria 806
751 Ga0307412_10013605 3300031911 Bacteria 4776
752 Ga0307412_10197398 3300031911 Bacteria 1526
753 Ga0307409_100010408 3300031995 Bacteria 5782
754 Ga0307409_100052609 3300031995 Bacteria 3124
755 Ga0307409_100064535 3300031995 Bacteria 2877
756 Ga0307416_100002070 3300032002 Bacteria 11304
757 Ga0307414_10013575 3300032004 Bacteria 4855
758 Ga0307411_10011160 3300032005 Bacteria 4833
759 Ga0307415_100054808 3300032126 Bacteria 2724
760 Ga0373950_0050516 3300034818 Bacteria 816
761 Ga0373939_0194589 3300035114 Bacteria 764
762 Ga0373960_0244622 3300035121 Bacteria 650
763 Ga0373943_0133270 3300035170 Bacteria 1332
764 Ga0373946_0066304 3300035171 Bacteria 1548
765 Ga0373935_1305636 3300035692 Bacteria 542
766 Ga0373927_0020040 3300035695 Bacteria 4386
767 Ga0373927_0149403 3300035695 Bacteria 1530
768 Ga0373927_0234179 3300035695 Bacteria 1207
769 Ga0373947_0609784 3300035725 Bacteria 744
770 Ga0373937_0177543 3300036401 Bacteria 1999
771 Ga0395900_0041433 3300037418 Bacteria 4747
772 Ga0395900_0134464 3300037418 Bacteria 2533
773 Ga0395900_0273378 3300037418 Bacteria 1684
774 Ga0395898_0032291 3300037466 Bacteria 5225
775 Ga0395898_0039327 3300037466 Bacteria 4682
776 Ga0395898_0736931 3300037466 Bacteria 927
777 Ga0395905_0011436 3300037471 Bacteria 8576
778 Ga0395905_0057778 3300037471 Bacteria 3629
779 Ga0395905_0145394 3300037471 Bacteria 2231
780 Ga0395901_0018072 3300038443 Bacteria 7196
781 Ga0395901_0080725 3300038443 Bacteria 3397
782 Ga0395901_0102297 3300038443 Bacteria 3007
783 Ga0395901_0706468 3300038443 Bacteria 1005
784 Ga0436361_0497952 3300039447 Bacteria 1088
785 Ga0451787_352292 3300041441 Bacteria 609
786 Ga0451791_1618681 3300041451 Bacteria 755
787 Ga0451853_2765974 3300041512 Bacteria 1001
788 Ga0450896_024507 3300042133 Bacteria 894
789 Ga0439435_0033489 3300042436 Bacteria 1407
790 Ga0453683_0240231 3300044673 Bacteria 1154
791 Ga0466963_0576970 3300044694 Bacteria 794
792 Ga0466960_0135938 3300044901 Bacteria 1302
793 Ga0466967_1203478 3300045976 Bacteria 755
794 Ga0495629_0101132 3300046459 Bacteria 2012
795 Ga0495580_0026495 3300046472 Bacteria 4226
796 Ga0495598_0082323 3300046537 Bacteria 1035
797 Ga0495621_0012018 3300046539 Bacteria 2693
798 Ga0495621_0094697 3300046539 Bacteria 1130
799 Ga0495621_0164018 3300046539 Bacteria 880
800 Ga0495645_0219254 3300046543 Bacteria 1280
801 Ga0495599_0753419 3300046678 Bacteria 559
802 Ga0495647_0472048 3300046681 Bacteria 582
803 Ga0496100_0095140 3300048903 Bacteria 2041
804 Ga0496100_0989548 3300048903 Bacteria 662
805 Ga0496101_0223571 3300048904 Bacteria 1461
806 Ga0496101_0278742 3300048904 Bacteria 1306
807 Ga0496102_0025261 3300048905 Bacteria 5287
808 Ga0496102_0254880 3300048905 Bacteria 1654
809 Ga0496102_1452203 3300048905 Bacteria 605
810 Ga0496103_0033857 3300048906 Bacteria 3123
811 Ga0496103_0163935 3300048906 Bacteria 1426
812 Ga0496104_0042538 3300048907 Bacteria 4264
813 Ga0496104_0723726 3300048907 Bacteria 903
814 Ga0496104_0827611 3300048907 Bacteria 831
815 Ga0496105_0003965 3300048908 Bacteria 11077
816 Ga0496105_0627400 3300048908 Bacteria 831
817 Ga0496106_0003978 3300048909 Bacteria 11045
818 Ga0496106_1017183 3300048909 Bacteria 651
819 Ga0496107_0017734 3300048910 Bacteria 5010
820 Ga0496107_0067797 3300048910 Bacteria 2589
821 Ga0496108_0004799 3300048911 Bacteria 10905
822 Ga0496108_1094493 3300048911 Bacteria 677
823 Ga0496109_0005301 3300048912 Bacteria 10776
824 Ga0496109_0032060 3300048912 Bacteria 4721
825 Ga0496109_0068827 3300048912 Bacteria 3245
826 Ga0496110_0085364 3300048913 Bacteria 2818
827 Ga0496110_0125219 3300048913 Bacteria 2318
828 Ga0496110_0441705 3300048913 Bacteria 1186
829 Ga0496110_0644977 3300048913 Bacteria 959
830 Ga0496111_0053084 3300048914 Bacteria 2928
831 Ga0496111_0206944 3300048914 Bacteria 1458
832 Ga0496112_0003208 3300048915 Bacteria 13462
833 Ga0496112_0575784 3300048915 Bacteria 1059
834 Ga0496113_0009900 3300048916 Bacteria 6280
835 Ga0496113_0195815 3300048916 Bacteria 1605
836 Ga0496113_0278327 3300048916 Bacteria 1338
837 Ga0496113_0591320 3300048916 Bacteria 889
838 Ga0496114_0034466 3300048917 Bacteria 4177
839 Ga0496114_0163843 3300048917 Bacteria 1935
840 Ga0496114_0431513 3300048917 Bacteria 1167
841 Ga0496119_0078771 3300048922 Bacteria 1905
842 Ga0501034_0240414 3300049571 Bacteria 1757
843 Ga0501047_0357560 3300049581 Bacteria 1296
844 Ga0501067_0102919 3300049583 Bacteria 1586
845 Ga0501069_0157360 3300049585 Bacteria 1308
846 Ga0501073_0004503 3300049589 Bacteria 10470
847 Ga0501075_0666380 3300049591 Bacteria 793
848 Ga0501079_0386242 3300049741 Bacteria 1098
849 Ga0501080_0006277 3300049742 Bacteria 10668
850 Ga0501080_0063267 3300049742 Bacteria 3444
851 nmdc:mga03683_326798_c1 3300050489 Bacteria 723
852 nmdc:mga03n38_12267_c1 3300050490 Bacteria 3218
853 nmdc:mga00v17_264_c1 3300050491 Bacteria 30927
854 nmdc:mga06z11_71553_c1 3300050494 Bacteria 1836
855 nmdc:mga05p37_372262_c1 3300050507 Bacteria 1676
856 nmdc:mga05p37_7464_c1 3300050507 Bacteria 2419
857 nmdc:mga09592_14083_c1 3300050508 Bacteria 6529
858 nmdc:mga0qj67_479308_c1 3300050509 Bacteria 1001
859 nmdc:mga0qj67_7494_c1 3300050509 Bacteria 8058
860 nmdc:mga06r32_230215_c1 3300050510 Bacteria 1841
861 nmdc:mga08y16_144437_c1 3300050511 Bacteria 2473
862 nmdc:mga08y16_571109_c1 3300050511 Bacteria 1143
863 nmdc:mga0n895_1037716_c1 3300050512 Bacteria 799
864 nmdc:mga0n895_149246_c1 3300050512 Bacteria 2367
865 nmdc:mga0n895_1590944_c1 3300050512 Bacteria 618
866 nmdc:mga0n895_689121_c1 3300050512 Bacteria 1018
867 nmdc:mga0n895_825838_c1 3300050512 Bacteria 916
868 nmdc:mga0rr50_125018_c1 3300050513 Bacteria 2052
869 nmdc:mga0rr50_313508_c1 3300050513 Bacteria 1314
870 nmdc:mga0sz30_509_c1 3300050516 Bacteria 14494
871 Ga0495601_0368569 3300053077 Bacteria 933
872 Ga0495595_0022102 3300053084 Bacteria 2789
873 Ga0495595_0546880 3300053084 Bacteria 591
874 Ga0495619_0442441 3300053085 Bacteria 896
875 Ga0495619_0630544 3300053085 Bacteria 732
876 Ga0530510_0157164 3300061734 Bacteria 1681
877 Ga0451576_0187687
878 JGI24752J21851_1039947
879 JGI24747J21853_1020088
880 JGI24743J22301_10012420
881 JGI24750J21931_1041320
882 JGI24749J21850_1005279
883 JGI24744J21845_10055969
884 Ga0058863_11718871
885 Ga0058862_12751779
886 Ga0065715_10162694
887 Ga0065715_10171170
888 Ga0065715_10365467
889 Ga0070658_10017688
890 Ga0070658_10018601
891 Ga0070658_10036568
892 Ga0070658_10110787
893 Ga0070658_10796618
894 Ga0070676_10000769
895 Ga0070676_10005593
896 Ga0070676_10032653
897 Ga0070676_10283966
898 Ga0070676_10744773
899 Ga0070683_100019402
900 Ga0070683_100058588
901 Ga0070683_100129952
902 Ga0070690_100009005
903 Ga0070670_100000274
904 Ga0070670_100021437
905 Ga0070670_100052188
906 Ga0070670_100097188
907 Ga0070670_100138970
908 Ga0070670_101327314
909 Ga0070670_101686592
910 Ga0070677_10000132
911 Ga0070677_10009216
912 Ga0070677_10135884
913 Ga0070677_10192830
914 Ga0070677_10429711
915 Ga0068869_100001694
916 Ga0068869_100007694
917 Ga0068869_100208930
918 Ga0070666_10006650
919 Ga0070666_10007688
920 Ga0070666_10094719
921 Ga0070666_10290317
922 Ga0070666_10410922
923 Ga0070680_100109620
924 Ga0070680_100238453
925 Ga0070680_100376219
926 Ga0070680_100616184
927 Ga0070682_100899525
928 Ga0068868_100005576
929 Ga0068868_100028710
930 Ga0068868_100045229
931 Ga0068868_101232518
932 Ga0068868_101393863
933 Ga0070660_100004956
934 Ga0070660_100018533
935 Ga0070660_100602224
936 Ga0070689_100008003
937 Ga0070689_100033049
938 Ga0070661_100004644
939 Ga0070661_100010175
940 Ga0070661_100027132
941 Ga0070661_100055801
942 Ga0070661_100135124
943 Ga0070661_100161595
944 Ga0070661_100173153
945 Ga0070661_100248233
946 Ga0070692_10037400
947 Ga0070668_100000394
948 Ga0070668_100007010
949 Ga0070668_100011160
950 Ga0070668_100016216
951 Ga0070668_100065340
952 Ga0070668_100359662
953 Ga0070668_100559299
954 Ga0070668_101249069
955 Ga0070669_100005562
956 Ga0070669_100006708
957 Ga0070669_100050895
958 Ga0070669_100052789
959 Ga0070669_100097767
960 Ga0070669_100098531
961 Ga0070669_100110841
962 Ga0070669_100203979
963 Ga0070669_100667379
964 Ga0070669_100844652
965 Ga0070675_100008918
966 Ga0070675_100008929
967 Ga0070675_100032421
968 Ga0070675_100094815
969 Ga0070675_100317873
970 Ga0070675_100332358
971 Ga0070675_100392373
972 Ga0070671_100013129
973 Ga0070671_100079129
974 Ga0070671_100206170
975 Ga0070671_100383170
976 Ga0070671_100472906
977 Ga0070674_100001114
978 Ga0070674_100036339
979 Ga0070674_100069827
980 Ga0070674_100120733
981 Ga0070674_100398011
982 Ga0070673_100002042
983 Ga0070673_100020047
984 Ga0070673_100074203
985 Ga0070673_100091659
986 Ga0070673_100133514
987 Ga0070673_100163834
988 Ga0070673_100226902
989 Ga0070688_100003905
990 Ga0070659_100006210
991 Ga0070659_100064486
992 Ga0070659_100067006
993 Ga0070659_100071001
994 Ga0070659_100589158
995 Ga0070667_100002746
996 Ga0070667_100010007
997 Ga0070667_100021181
998 Ga0070667_100127045
999 Ga0070667_100156797
1000 Ga0070667_100213734
1001 Ga0070667_100248565
1002 Ga0070667_100422096
1003 Ga0070667_101109627
1004 Ga0070667_101129898
1005 Ga0070714_100033301
1006 Ga0070714_100062644
1007 Ga0070714_100109749
1008 Ga0070713_100012321
1009 Ga0070710_10007894
1010 Ga0070710_10218269
1011 Ga0070701_10066184
1012 Ga0070711_100105943
1013 Ga0070711_100691827
1014 Ga0070711_100720342
1015 Ga0070711_100928130
1016 Ga0070700_100021916
1017 Ga0070700_100204956
1018 Ga0070700_100625458
1019 Ga0070694_100682336
1020 Ga0070663_100010255
1021 Ga0070663_100019255
1022 Ga0070663_100043787
1023 Ga0070663_100076206
1024 Ga0070663_100190761
1025 Ga0070678_100000982
1026 Ga0070678_100001348
1027 Ga0070678_100085937
1028 Ga0070678_100299571
1029 Ga0070662_100001081
1030 Ga0070662_100083792
1031 Ga0070662_100223556
1032 Ga0070662_100259751
1033 Ga0070681_10001160
1034 Ga0070681_10939589
1035 Ga0070681_11030478
1036 Ga0068867_100003590
1037 Ga0068867_100009061
1038 Ga0068867_100010823
1039 Ga0068867_100019400
1040 Ga0068867_100077601
1041 Ga0068867_100384660
1042 Ga0068867_100501068
1043 Ga0070685_10002380
1044 Ga0070706_100281817
1045 Ga0070706_101135846
1046 Ga0070698_100772739
1047 Ga0070698_101251665
1048 Ga0070699_100093099
1049 Ga0070679_100019147
1050 Ga0070679_100178590
1051 Ga0070679_100696648
1052 Ga0070684_100040000
1053 Ga0070684_100043995
1054 Ga0070684_100093491
1055 Ga0070684_100499945
1056 Ga0068853_100002757
1057 Ga0068853_100056192
1058 Ga0068853_100074913
1059 Ga0068853_100366468
1060 Ga0068853_100542898
1061 Ga0068853_101410792
1062 Ga0068853_101952992
1063 Ga0070672_100000914
1064 Ga0070672_100007295
1065 Ga0070672_100012306
1066 Ga0070672_100022564
1067 Ga0070672_100042554
1068 Ga0070672_100075834
1069 Ga0070672_100105320
1070 Ga0070672_100228126
1071 Ga0070672_101066203
1072 Ga0070686_100085731
1073 Ga0070696_100004065
1074 Ga0070693_100691402
1075 Ga0070665_100002542
1076 Ga0070665_100012901
1077 Ga0070665_100121697
1078 Ga0070665_100305035
1079 Ga0070665_100578305
1080 Ga0070665_100637102
1081 Ga0070665_101173044
1082 Ga0068855_100003908
1083 Ga0068855_100019019
1084 Ga0068855_100040144
1085 Ga0068855_100057251
1086 Ga0068855_100453030
1087 Ga0070664_100002998
1088 Ga0070664_100013440
1089 Ga0070664_100083468
1090 Ga0070664_100084498
1091 Ga0070664_100094788
1092 Ga0070664_100345226
1093 Ga0070664_101033582
1094 Ga0070664_101553058
1095 Ga0068857_100008373
1096 Ga0068857_100010671
1097 Ga0068857_100065029
1098 Ga0068857_100399942
1099 Ga0068854_100002321
1100 Ga0068854_100055101
1101 Ga0068854_100115025
1102 Ga0068854_100163739
1103 Ga0068854_100196971
1104 Ga0068854_100322409
1105 Ga0068856_100001379
1106 Ga0068856_100022222
1107 Ga0068856_100365263
1108 Ga0068856_101572557
1109 Ga0070702_100133372
1110 Ga0068852_100002000
1111 Ga0068852_100002691
1112 Ga0068852_100024896
1113 Ga0068852_100067303
1114 Ga0068852_100088668
1115 Ga0068852_100138091
1116 Ga0068852_100213207
1117 Ga0068852_100328423
1118 Ga0068859_100006523
1119 Ga0068859_100084366
1120 Ga0068859_100243236
1121 Ga0068859_100824334
1122 Ga0068864_100005598
1123 Ga0068864_100007903
1124 Ga0068864_100009458
1125 Ga0068864_100009678
1126 Ga0068864_100018419
1127 Ga0068864_100310185
1128 Ga0068864_100807004
1129 Ga0068866_10057543
1130 Ga0068866_10063584
1131 Ga0068866_10195641
1132 Ga0068861_100001362
1133 Ga0068861_100001763
1134 Ga0068861_100012929
1135 Ga0068861_100052360
1136 Ga0068861_100235924
1137 Ga0068861_100261518
1138 Ga0068861_100751837
1139 Ga0068851_10007676
1140 Ga0068851_10010234
1141 Ga0068851_10026215
1142 Ga0068851_10028777
1143 Ga0068851_10078842
1144 Ga0068851_10387280
1145 Ga0068851_10489637
1146 Ga0068870_10017237
1147 Ga0068870_10027358
1148 Ga0068863_100002100
1149 Ga0068863_100013029
1150 Ga0068863_100026961
1151 Ga0068863_100087053
1152 Ga0068863_100195704
1153 Ga0068863_100264682
1154 Ga0068858_100000612
1155 Ga0068858_100055030
1156 Ga0068858_100097393
1157 Ga0068858_100150477
1158 Ga0068858_100507461
1159 Ga0068860_100011838
1160 Ga0068860_100023346
1161 Ga0068860_100044277
1162 Ga0068860_100065973
1163 Ga0068860_100200958
1164 Ga0068860_101109312
1165 Ga0068860_101391817
1166 Ga0068862_100002076
1167 Ga0068862_100013014
1168 Ga0068862_100043495
1169 Ga0068862_100088427
1170 Ga0068862_100092127
1171 Ga0068862_102264194
1172 Ga0081455_10317106
1173 Ga0075363_100230016
1174 Ga0075364_10000494
1175 Ga0075362_10242392
1176 Ga0075367_10046720
1177 Ga0075369_10000250
1178 Ga0097621_100079081
1179 Ga0097621_100099569
1180 Ga0097621_100225486
1181 Ga0068871_100003825
1182 Ga0068871_100118990
1183 Ga0068871_100213997
1184 Ga0068871_100473592
1185 Ga0068871_101040792
1186 Ga0068871_101311839
1187 Ga0075428_100103504
1188 Ga0075428_100160557
1189 Ga0075428_100347659
1190 Ga0075428_100586531
1191 Ga0075430_100020888
1192 Ga0075431_100159632
1193 Ga0075434_100070066
1194 Ga0075434_100184957
1195 Ga0075434_100651911
1196 Ga0068865_100023951
1197 Ga0068865_100127465
1198 Ga0068865_100128349
1199 Ga0068865_100411915
1200 Ga0075436_100529516
1201 Ga0075436_100706649
1202 Ga0097620_100006521
1203 Ga0097620_100084360
1204 Ga0097620_100243229
1205 Ga0097620_100824340
1206 Ga0075435_100379716
1207 Ga0075435_100446474
1208 Ga0075435_101082020
1209 Ga0105250_10027260
1210 Ga0105240_10102436
1211 Ga0105240_10166930
1212 Ga0105240_10522447
1213 Ga0111539_10053252
1214 Ga0111539_10183588
1215 Ga0111539_11341682
1216 Ga0111539_11399555
1217 Ga0105245_10200008
1218 Ga0105245_10470611
1219 Ga0105247_10010766
1220 Ga0114129_10354316
1221 Ga0114129_10480688
1222 Ga0105243_10118295
1223 Ga0105243_10321304
1224 Ga0105243_10336876
1225 Ga0105241_10121350
1226 Ga0105241_10143629
1227 Ga0105241_11041971
1228 Ga0105242_10428620
1229 Ga0105248_10015240
1230 Ga0105248_10025258
1231 Ga0105248_10072760
1232 Ga0105248_10147483
1233 Ga0105248_10397237
1234 Ga0105248_10657051
1235 Ga0105248_10834945
1236 Ga0105237_10173559
1237 Ga0105237_10183286
1238 Ga0105238_10075696
1239 Ga0105238_10412946
1240 Ga0105238_10626678
1241 Ga0105238_10628665
1242 Ga0105249_10020425
1243 Ga0105249_10074146
1244 Ga0105249_10128452
1245 Ga0105249_10464426
1246 Ga0105249_10855570
1247 Ga0105239_10082015
1248 Ga0105239_10981235
1249 Ga0105246_10329619
1250 Ga0157373_10001932
1251 Ga0157373_10337764
1252 Ga0157371_10000303
1253 Ga0157371_10043784
1254 Ga0157371_10096730
1255 Ga0157370_10011858
1256 Ga0157370_10108577
1257 Ga0157370_10183907
1258 Ga0157369_10135579
1259 Ga0157369_10217825
1260 Ga0157369_10891388
1261 Ga0157369_12357950
1262 Ga0157374_10063682
1263 Ga0157374_10103382
1264 Ga0157374_10142988
1265 Ga0157374_10361450
1266 Ga0157374_10554585
1267 Ga0157374_11116787
1268 Ga0157378_10004675
1269 Ga0157378_10090675
1270 Ga0157378_10436705
1271 Ga0157378_10718677
1272 Ga0157378_10754127
1273 Ga0163162_10078494
1274 Ga0163162_10089116
1275 Ga0163162_10431489
1276 Ga0163162_10736234
1277 Ga0163162_12199454
1278 Ga0157372_10001717
1279 Ga0157372_10002828
1280 Ga0157372_10007943
1281 Ga0157372_10011850
1282 Ga0157372_10049411
1283 Ga0157372_10148713
1284 Ga0157372_10310060
1285 Ga0157375_10002602
1286 Ga0157375_10049121
1287 Ga0157375_10300981
1288 Ga0157375_10484297
1289 Ga0157375_10860866
1290 Ga0157375_10862526
1291 Ga0157375_10937588
1292 Ga0157375_11246719
1293 Ga0163163_10001190
1294 Ga0163163_10010520
1295 Ga0163163_10025908
1296 Ga0163163_10029634
1297 Ga0163163_10575587
1298 Ga0163163_12136756
1299 Ga0157380_10005687
1300 Ga0157380_10006810
1301 Ga0157380_10290053
1302 Ga0157380_10439444
1303 Ga0182008_10177367
1304 Ga0157377_10000871
1305 Ga0157377_10712551
1306 Ga0157379_10000105
1307 Ga0157379_10005162
1308 Ga0157379_10008015
1309 Ga0157379_10058207
1310 Ga0157379_10378272
1311 Ga0157376_10003620
1312 Ga0157376_10087209
1313 Ga0157376_10237184
1314 Ga0157376_10427683
1315 Ga0157376_10500411
1316 Ga0163161_10019913
1317 Ga0163161_10023041
1318 Ga0163161_10545575
1319 Ga0163161_10632561
1320 Ga0163161_10728437
1321 Ga0154015_1059651
1322 Ga0213876_10139857
1323 Ga0224712_10005960
1324 Ga0207697_10000471
1325 Ga0207697_10058323
1326 Ga0207656_10006239
1327 Ga0207656_10012737
1328 Ga0207656_10230369
1329 Ga0207682_10000044
1330 Ga0207682_10001806
1331 Ga0207682_10073389
1332 Ga0207692_10004583
1333 Ga0207692_10710185
1334 Ga0207642_10057585
1335 Ga0207642_10066733
1336 Ga0207642_10188137
1337 Ga0207710_10033039
1338 Ga0207688_10091693
1339 Ga0207688_10100088
1340 Ga0207680_10002742
1341 Ga0207680_10019059
1342 Ga0207680_10047447
1343 Ga0207680_10103464
1344 Ga0207699_10029083
1345 Ga0207645_10001325
1346 Ga0207645_10004314
1347 Ga0207645_10013037
1348 Ga0207645_10061294
1349 Ga0207645_10155820
1350 Ga0207645_10624679
1351 Ga0207643_10000161
1352 Ga0207643_10016622
1353 Ga0207705_10158344
1354 Ga0207705_10159353
1355 Ga0207705_10517182
1356 Ga0207705_10631640
1357 Ga0207684_10413045
1358 Ga0207654_10438270
1359 Ga0207707_10282532
1360 Ga0207707_10454226
1361 Ga0207707_10791781
1362 Ga0207695_10041552
1363 Ga0207695_10043837
1364 Ga0207671_10507887
1365 Ga0207663_10151028
1366 Ga0207663_11143859
1367 Ga0207660_10321431
1368 Ga0207662_10070704
1369 Ga0207657_10001114
1370 Ga0207657_10019069
1371 Ga0207657_10023158
1372 Ga0207649_10003803
1373 Ga0207649_10011530
1374 Ga0207649_10056800
1375 Ga0207649_10094126
1376 Ga0207649_10203692
1377 Ga0207649_10239984
1378 Ga0207652_10009211
1379 Ga0207652_10026593
1380 Ga0207652_10066497
1381 Ga0207652_10444666
1382 Ga0207646_10786979
1383 Ga0207681_10006193
1384 Ga0207681_10049513
1385 Ga0207681_10094130
1386 Ga0207681_10182954
1387 Ga0207681_10190649
1388 Ga0207681_10274609
1389 Ga0207694_10061823
1390 Ga0207694_10895945
1391 Ga0207650_10001658
1392 Ga0207650_10006587
1393 Ga0207650_10057166
1394 Ga0207650_10060690
1395 Ga0207650_10113441
1396 Ga0207650_10238504
1397 Ga0207650_10331078
1398 Ga0207650_10640552
1399 Ga0207659_10001994
1400 Ga0207659_10002849
1401 Ga0207659_10003224
1402 Ga0207659_10083486
1403 Ga0207659_10165217
1404 Ga0207659_10323128
1405 Ga0207687_10306653
1406 Ga0207700_10331872
1407 Ga0207700_11272342
1408 Ga0207664_10024542
1409 Ga0207664_10036152
1410 Ga0207664_10327191
1411 Ga0207644_10004238
1412 Ga0207644_10045418
1413 Ga0207644_10121670
1414 Ga0207644_10699571
1415 Ga0207644_10728657
1416 Ga0207644_10754011
1417 Ga0207690_10001868
1418 Ga0207690_10061917
1419 Ga0207690_10092030
1420 Ga0207690_11574561
1421 Ga0207706_10000023
1422 Ga0207706_10050271
1423 Ga0207706_10112789
1424 Ga0207706_11095769
1425 Ga0207709_10531951
1426 Ga0207670_10386246
1427 Ga0207669_10005949
1428 Ga0207669_10016174
1429 Ga0207669_10025077
1430 Ga0207669_10058700
1431 Ga0207669_10889296
1432 Ga0207704_10026968
1433 Ga0207704_10041359
1434 Ga0207704_10781205
1435 Ga0207691_10000022
1436 Ga0207691_10000224
1437 Ga0207691_10009118
1438 Ga0207691_10032316
1439 Ga0207691_10059374
1440 Ga0207691_10067215
1441 Ga0207691_10358264
1442 Ga0207691_10451591
1443 Ga0207691_11104910
1444 Ga0207711_10012405
1445 Ga0207711_10028404
1446 Ga0207711_10178994
1447 Ga0207711_10205488
1448 Ga0207711_10277556
1449 Ga0207711_10946343
1450 Ga0207689_10000147
1451 Ga0207689_10002088
1452 Ga0207689_10011258
1453 Ga0207661_10015607
1454 Ga0207661_10151896
1455 Ga0207661_10243076
1456 Ga0207679_10008603
1457 Ga0207679_10076457
1458 Ga0207679_10079241
1459 Ga0207679_10100532
1460 Ga0207679_10836373
1461 Ga0207679_11085889
1462 Ga0207667_10007723
1463 Ga0207667_10012582
1464 Ga0207667_10012658
1465 Ga0207667_10043293
1466 Ga0207667_10060678
1467 Ga0207667_10426822
1468 Ga0207667_11072368
1469 Ga0207651_10005388
1470 Ga0207651_10008537
1471 Ga0207651_10012431
1472 Ga0207651_10021607
1473 Ga0207651_10031308
1474 Ga0207651_10747120
1475 Ga0207712_10012882
1476 Ga0207712_10018851
1477 Ga0207712_10548820
1478 Ga0207668_10003779
1479 Ga0207668_10016076
1480 Ga0207668_10021387
1481 Ga0207668_10028298
1482 Ga0207668_10112766
1483 Ga0207668_10448573
1484 Ga0207668_10545576
1485 Ga0207668_10786096
1486 Ga0207668_11790681
1487 Ga0207640_10009290
1488 Ga0207640_10021612
1489 Ga0207640_10062054
1490 Ga0207640_10083873
1491 Ga0207640_10091620
1492 Ga0207640_10406551
1493 Ga0207640_11333567
1494 Ga0207658_10006239
1495 Ga0207658_10008453
1496 Ga0207658_10011567
1497 Ga0207658_10041400
1498 Ga0207658_10047658
1499 Ga0207658_10068524
1500 Ga0207658_10086932
1501 Ga0207658_10284877
1502 Ga0207658_10363502
1503 Ga0207677_10009797
1504 Ga0207677_10012063
1505 Ga0207677_10017587
1506 Ga0207677_10246566
1507 Ga0207703_10008603
1508 Ga0207703_10070477
1509 Ga0207703_10111517
1510 Ga0207703_10188286
1511 Ga0207703_10558159
1512 Ga0207639_10006189
1513 Ga0207639_10026571
1514 Ga0207639_10061326
1515 Ga0207639_10452391
1516 Ga0207639_10570097
1517 Ga0207639_10794483
1518 Ga0207639_11001765
1519 Ga0207678_10002769
1520 Ga0207678_10017478
1521 Ga0207678_10021448
1522 Ga0207678_10035040
1523 Ga0207678_10073764
1524 Ga0207678_10255117
1525 Ga0207708_10000330
1526 Ga0207708_10022570
1527 Ga0207708_10238624
1528 Ga0207708_10276330
1529 Ga0207702_10129038
1530 Ga0207702_10129152
1531 Ga0207702_10811243
1532 Ga0207641_10004344
1533 Ga0207641_10006556
1534 Ga0207641_10010037
1535 Ga0207641_10137293
1536 Ga0207641_10197281
1537 Ga0207641_10208816
1538 Ga0207641_10581078
1539 Ga0207641_11545843
1540 Ga0207641_12293335
1541 Ga0207648_10003749
1542 Ga0207648_10008541
1543 Ga0207648_10017870
1544 Ga0207648_10034621
1545 Ga0207648_10062181
1546 Ga0207648_10410106
1547 Ga0207648_10521893
1548 Ga0207676_10004846
1549 Ga0207676_10009364
1550 Ga0207676_10045405
1551 Ga0207676_10062168
1552 Ga0207676_10543500
1553 Ga0207676_10565440
1554 Ga0207676_11271944
1555 Ga0207676_11595296
1556 Ga0207676_11738167
1557 Ga0207674_10000775
1558 Ga0207674_10002604
1559 Ga0207674_10003926
1560 Ga0207674_10007754
1561 Ga0207674_10092555
1562 Ga0207675_100000632
1563 Ga0207675_100003092
1564 Ga0207675_100008081
1565 Ga0207675_100016851
1566 Ga0207675_100051806
1567 Ga0207675_100072589
1568 Ga0207675_100287668
1569 Ga0207675_100851294
1570 Ga0207675_102020633
1571 Ga0207683_10000283
1572 Ga0207683_10001343
1573 Ga0207683_10003645
1574 Ga0207683_10034269
1575 Ga0207683_10126863
1576 Ga0207683_11275720
1577 Ga0207698_10006776
1578 Ga0207698_10015332
1579 Ga0207698_10065023
1580 Ga0207698_10114264
1581 Ga0207698_10280324
1582 Ga0207698_10663535
1583 Ga0207698_11201807
1584 Ga0209983_1084532
1585 Ga0209998_10029941
1586 Ga0209974_10005746
1587 Ga0207428_10541739
1588 Ga0207428_10878303
1589 Ga0268266_10003808
1590 Ga0268266_10028908
1591 Ga0268266_10099851
1592 Ga0268266_10126500
1593 Ga0268266_10245694
1594 Ga0268266_10431102
1595 Ga0268266_10486078
1596 Ga0268266_11053747
1597 Ga0268266_11062613
1598 Ga0268266_11120210
1599 Ga0268265_10004417
1600 Ga0268265_10043968
1601 Ga0268265_10058560
1602 Ga0268265_10066854
1603 Ga0268265_10806234
1604 Ga0268264_10010306
1605 Ga0268264_10020581
1606 Ga0268264_10052267
1607 Ga0268264_10147980
1608 Ga0268264_10208457
1609 Ga0268264_11634814
1610 Ga0265330_10004514
1611 Ga0265332_10000141
1612 Ga0265325_10016639
1613 Ga0265339_10029144
1614 Ga0265331_10000972
1615 Ga0265327_10003882
1616 Ga0265316_10086543
1617 Ga0307408_100556982
1618 Ga0265342_10005713
1619 Ga0307405_10989691
1620 Ga0307413_10001971
1621 Ga0307413_10976608
1622 Ga0307410_10010067
1623 Ga0307406_10004583
1624 Ga0307406_10061367
1625 Ga0307407_10003221
1626 Ga0307407_10622466
1627 Ga0307412_10013605
1628 Ga0307412_10197398
1629 Ga0307409_100010408
1630 Ga0307409_100052609
1631 Ga0307409_100064535
1632 Ga0307416_100002070
1633 Ga0307414_10013575
1634 Ga0307411_10011160
1635 Ga0307415_100054808
1636 Ga0373950_0050516
1637 Ga0373939_0194589
1638 Ga0373960_0244622
1639 Ga0373943_0133270
1640 Ga0373946_0066304
1641 Ga0373935_1305636
1642 Ga0373927_0020040
1643 Ga0373927_0149403
1644 Ga0373927_0234179
1645 Ga0373947_0609784
1646 Ga0373937_0177543
1647 Ga0395900_0041433
1648 Ga0395900_0134464
1649 Ga0395900_0273378
1650 Ga0395898_0032291
1651 Ga0395898_0039327
1652 Ga0395898_0736931
1653 Ga0395905_0011436
1654 Ga0395905_0057778
1655 Ga0395905_0145394
1656 Ga0395901_0018072
1657 Ga0395901_0080725
1658 Ga0395901_0102297
1659 Ga0395901_0706468
1660 Ga0436361_0497952
1661 Ga0451787_352292
1662 Ga0451791_1618681
1663 Ga0451853_2765974
1664 Ga0450896_024507
1665 Ga0439435_0033489
1666 Ga0453683_0240231
1667 Ga0466963_0576970
1668 Ga0466960_0135938
1669 Ga0466967_1203478
1670 Ga0495629_0101132
1671 Ga0495580_0026495
1672 Ga0495598_0082323
1673 Ga0495621_0012018
1674 Ga0495621_0094697
1675 Ga0495621_0164018
1676 Ga0495645_0219254
1677 Ga0495599_0753419
1678 Ga0495647_0472048
1679 Ga0496100_0095140
1680 Ga0496100_0989548
1681 Ga0496101_0223571
1682 Ga0496101_0278742
1683 Ga0496102_0025261
1684 Ga0496102_0254880
1685 Ga0496102_1452203
1686 Ga0496103_0033857
1687 Ga0496103_0163935
1688 Ga0496104_0042538
1689 Ga0496104_0723726
1690 Ga0496104_0827611
1691 Ga0496105_0003965
1692 Ga0496105_0627400
1693 Ga0496106_0003978
1694 Ga0496106_1017183
1695 Ga0496107_0017734
1696 Ga0496107_0067797
1697 Ga0496108_0004799
1698 Ga0496108_1094493
1699 Ga0496109_0005301
1700 Ga0496109_0032060
1701 Ga0496109_0068827
1702 Ga0496110_0085364
1703 Ga0496110_0125219
1704 Ga0496110_0441705
1705 Ga0496110_0644977
1706 Ga0496111_0053084
1707 Ga0496111_0206944
1708 Ga0496112_0003208
1709 Ga0496112_0575784
1710 Ga0496113_0009900
1711 Ga0496113_0195815
1712 Ga0496113_0278327
1713 Ga0496113_0591320
1714 Ga0496114_0034466
1715 Ga0496114_0163843
1716 Ga0496114_0431513
1717 Ga0496119_0078771
1718 Ga0501034_0240414
1719 Ga0501047_0357560
1720 Ga0501067_0102919
1721 Ga0501069_0157360
1722 Ga0501073_0004503
1723 Ga0501075_0666380
1724 Ga0501079_0386242
1725 Ga0501080_0006277
1726 Ga0501080_0063267
1727 nmdc:mga03683_326798_c1
1728 nmdc:mga03n38_12267_c1
1729 nmdc:mga00v17_264_c1
1730 nmdc:mga06z11_71553_c1
1731 nmdc:mga05p37_372262_c1
1732 nmdc:mga05p37_7464_c1
1733 nmdc:mga09592_14083_c1
1734 nmdc:mga0qj67_479308_c1
1735 nmdc:mga0qj67_7494_c1
1736 nmdc:mga06r32_230215_c1
1737 nmdc:mga08y16_144437_c1
1738 nmdc:mga08y16_571109_c1
1739 nmdc:mga0n895_1037716_c1
1740 nmdc:mga0n895_149246_c1
1741 nmdc:mga0n895_1590944_c1
1742 nmdc:mga0n895_689121_c1
1743 nmdc:mga0n895_825838_c1
1744 nmdc:mga0rr50_125018_c1
1745 nmdc:mga0rr50_313508_c1
1746 nmdc:mga0sz30_509_c1
1747 Ga0495601_0368569
1748 Ga0495595_0022102
1749 Ga0495595_0546880
1750 Ga0495619_0442441
1751 Ga0495619_0630544
1752 Ga0530510_0157164

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

85

158

0.9

PF00190

Cupin_1

Cupin

79

177

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6a55-assembly1.cif.gz_B crystal structure of dddk mutant y122a 0.913 46 124
2pyt-assembly1.cif.gz_B crystal structure of a putative ethanolamine utilization protein q (eutq, stm2468) from salmonella typhimurium lt2 at 1.90 a resolution 0.9095 46 124
7zyb-assembly1.cif.gz_A bekdgf with ca 0.9022 46 127
3nst-assembly1.cif.gz_A crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans 0.8922 46 124
6o2d-assembly1.cif.gz_A schizosaccharomyces pombe cnp3 cupin domain 0.8867 41 126
ID Description Score Start End Superfamily
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9176 44 125 2.60.120.10
3nvcA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9098 46 124 2.60.120.10
af_Q2G2A6_62_177_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9038 46 126 2.60.120.10
af_Q59013_3_123_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9015 45 124 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8924 46 126 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7W1NSL9-F1-model_v4 Cupin domain-containing protein 0.9402 46 125
AF-A0A1T3NQY4-F1-model_v4 Cupin 2 conserved barrel domain-containing protein 0.9234 46 125
AF-A0A2E2VFP7-F1-model_v4 Cupin type-2 domain-containing protein 0.9231 46 124
AF-A0A6N8V5M9-F1-model_v4 Cupin domain-containing protein 0.923 46 124
AF-A0A327HQN2-F1-model_v4 Cupin 0.9225 46 124

Map