F484387
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 877 | 427 | 1754 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10020809|Ga0111539_100208094 |
| Length | 302 |
| Sequence | VQGWKAGRLEGGNVHFSLPAFHFRLSAFQPSRLATRRPPHGHALMNLELDGRRVLVTGGSKGIGLACARAFLAEGARVAIASRSQANLALARAELGEVTTFAADFTDAAAARSVVDRVEAELGPLDVLVTSAGAARRTPPDELDPAAWRAAMDAKFFTYVNVIDPVVKLMAARGRGAIVNIIGSGGKVASPIHLPGGAANAALMLATVGLANAYAAKGVRVVGINPGLTRTTRVAEGMQAEAARLGISEADALKRSVDRIPLGRLAEAEEIAAAVVFAASPRASYLTGTIITMDGASAPVVV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 79 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 82 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 83 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 84 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 197 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 200 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 202 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 203 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 204 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 205 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 206 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 208 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 209 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 210 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 211 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 212 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 214 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 215 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 216 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 217 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 218 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 220 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 223 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 230 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 231 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 234 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 235 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 236 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 237 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 238 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 239 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 240 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 241 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 242 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 243 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 244 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 245 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 246 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 247 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 248 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 249 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 250 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 251 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 252 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 253 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 286 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 287 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 290 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 291 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 292 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 293 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 294 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 295 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 296 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 297 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 298 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 299 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 300 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 301 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 302 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 303 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 304 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 305 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 306 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 336 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 337 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 338 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 339 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 340 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 341 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 342 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 350 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 353 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 354 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 355 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 356 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 357 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 358 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 359 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 360 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 361 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 362 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 363 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 364 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 365 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 366 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 369 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 370 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 371 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 372 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 373 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 374 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 375 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 376 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 377 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 378 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 379 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 380 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 381 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 382 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 383 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 384 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 385 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 386 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 387 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 388 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 389 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 390 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 391 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 392 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 393 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 394 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 395 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 396 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 397 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 398 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 399 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 400 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 401 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 402 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 403 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 404 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 405 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 406 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 407 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 408 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 409 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 410 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 411 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 412 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 413 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 414 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 415 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 416 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 417 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 418 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 419 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 420 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 421 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 422 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 423 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 424 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 425 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 426 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 427 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.27 |
| Metatranscriptomes | 0 |
| Isolates | 6.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.67 |
| Nodule | 3.19 |
| Rhizoplane | 2.05 |
| Rhizosphere | 81.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0111539_10020809 | 3300009094 | Bacteria | 8077 |
| 2 | JGI24740J21852_10005269 | 3300001979 | Bacteria | 5490 |
| 3 | JGI24740J21852_10005831 | 3300001979 | Bacteria | 5169 |
| 4 | JGI25406J46586_10013352 | 3300003203 | Bacteria | 3530 |
| 5 | JGI25165J46597_1000068 | 3300003214 | Bacteria | 196201 |
| 6 | JGI25165J46597_1011288 | 3300003214 | Bacteria | 1279 |
| 7 | rootL2_10015947 | 3300003322 | Bacteria | 13949 |
| 8 | rootL2_10039598 | 3300003322 | Bacteria | 1109 |
| 9 | rootH1_10050301 | 3300003323 | Bacteria | 5866 |
| 10 | Ga0055534_1000177 | 3300003784 | Bacteria | 47626 |
| 11 | Ga0065165_1030548 | 3300005262 | Bacteria | 1712 |
| 12 | Ga0065715_10224002 | 3300005293 | Bacteria | 1260 |
| 13 | Ga0070658_10003204 | 3300005327 | Bacteria | 13509 |
| 14 | Ga0070676_10002219 | 3300005328 | Bacteria | 9906 |
| 15 | Ga0070676_10010326 | 3300005328 | Bacteria | 5065 |
| 16 | Ga0070676_10081565 | 3300005328 | Bacteria | 1963 |
| 17 | Ga0070676_10158689 | 3300005328 | Bacteria | 1454 |
| 18 | Ga0070676_10402453 | 3300005328 | Bacteria | 953 |
| 19 | Ga0070690_100089753 | 3300005330 | Bacteria | 2022 |
| 20 | Ga0070690_100345048 | 3300005330 | Bacteria | 1079 |
| 21 | Ga0070670_100005632 | 3300005331 | Bacteria | 10572 |
| 22 | Ga0070670_100018764 | 3300005331 | Bacteria | 5931 |
| 23 | Ga0070670_100082894 | 3300005331 | Bacteria | 2755 |
| 24 | Ga0070670_100092231 | 3300005331 | Bacteria | 2604 |
| 25 | Ga0070670_100121827 | 3300005331 | Bacteria | 2250 |
| 26 | Ga0070670_100307995 | 3300005331 | Bacteria | 1386 |
| 27 | Ga0068869_100000049 | 3300005334 | Bacteria | 50658 |
| 28 | Ga0068869_100066950 | 3300005334 | Bacteria | 2648 |
| 29 | Ga0068869_100094043 | 3300005334 | Bacteria | 2259 |
| 30 | Ga0068869_100270917 | 3300005334 | Bacteria | 1362 |
| 31 | Ga0070666_10001467 | 3300005335 | Bacteria | 14317 |
| 32 | Ga0070666_10053367 | 3300005335 | Bacteria | 2726 |
| 33 | Ga0070680_100082820 | 3300005336 | Bacteria | 2649 |
| 34 | Ga0070680_100203286 | 3300005336 | Bacteria | 1671 |
| 35 | Ga0070680_100240963 | 3300005336 | Bacteria | 1528 |
| 36 | Ga0070680_100353786 | 3300005336 | Bacteria | 1249 |
| 37 | Ga0070682_100151200 | 3300005337 | Bacteria | 1593 |
| 38 | Ga0068868_100011885 | 3300005338 | Bacteria | 6349 |
| 39 | Ga0068868_100394359 | 3300005338 | Bacteria | 1193 |
| 40 | Ga0070689_100000283 | 3300005340 | Bacteria | 29408 |
| 41 | Ga0070689_100358808 | 3300005340 | Bacteria | 1224 |
| 42 | Ga0070691_10004163 | 3300005341 | Bacteria | 6569 |
| 43 | Ga0070661_100001480 | 3300005344 | Bacteria | 16303 |
| 44 | Ga0070661_100109787 | 3300005344 | Bacteria | 2059 |
| 45 | Ga0070661_100143642 | 3300005344 | Bacteria | 1800 |
| 46 | Ga0070692_10014210 | 3300005345 | Bacteria | 3732 |
| 47 | Ga0070692_10126836 | 3300005345 | Bacteria | 1430 |
| 48 | Ga0070692_10146202 | 3300005345 | Bacteria | 1342 |
| 49 | Ga0070668_100000226 | 3300005347 | Bacteria | 36448 |
| 50 | Ga0070668_100001385 | 3300005347 | Bacteria | 17406 |
| 51 | Ga0070668_100011277 | 3300005347 | Bacteria | 6656 |
| 52 | Ga0070668_100014493 | 3300005347 | Bacteria | 5891 |
| 53 | Ga0070668_100023107 | 3300005347 | Bacteria | 4700 |
| 54 | Ga0070669_100000543 | 3300005353 | Bacteria | 28149 |
| 55 | Ga0070669_100002751 | 3300005353 | Bacteria | 12688 |
| 56 | Ga0070669_100032928 | 3300005353 | Bacteria | 3746 |
| 57 | Ga0070669_100035642 | 3300005353 | Bacteria | 3605 |
| 58 | Ga0070669_100041271 | 3300005353 | Bacteria | 3356 |
| 59 | Ga0070669_100266065 | 3300005353 | Unclassified | 1369 |
| 60 | Ga0070675_100031607 | 3300005354 | Bacteria | 4281 |
| 61 | Ga0070675_100057127 | 3300005354 | Bacteria | 3217 |
| 62 | Ga0070675_100643024 | 3300005354 | Bacteria | 964 |
| 63 | Ga0070671_100163421 | 3300005355 | Bacteria | 1882 |
| 64 | Ga0070671_100216508 | 3300005355 | Bacteria | 1625 |
| 65 | Ga0070674_100030681 | 3300005356 | Bacteria | 3555 |
| 66 | Ga0070674_100211396 | 3300005356 | Bacteria | 1504 |
| 67 | Ga0070673_100002455 | 3300005364 | Bacteria | 11297 |
| 68 | Ga0070673_100057674 | 3300005364 | Bacteria | 3068 |
| 69 | Ga0070673_100091109 | 3300005364 | Bacteria | 2492 |
| 70 | Ga0070673_100141753 | 3300005364 | Bacteria | 2028 |
| 71 | Ga0070673_100193792 | 3300005364 | Bacteria | 1747 |
| 72 | Ga0070673_100387060 | 3300005364 | Bacteria | 1248 |
| 73 | Ga0070688_100064275 | 3300005365 | Bacteria | 2328 |
| 74 | Ga0070688_100372035 | 3300005365 | Bacteria | 1051 |
| 75 | Ga0070659_100000895 | 3300005366 | Bacteria | 21810 |
| 76 | Ga0070659_100090431 | 3300005366 | Bacteria | 2453 |
| 77 | Ga0070659_100440690 | 3300005366 | Bacteria | 1104 |
| 78 | Ga0070667_100002122 | 3300005367 | Bacteria | 17483 |
| 79 | Ga0070667_100026787 | 3300005367 | Bacteria | 4797 |
| 80 | Ga0070667_100067245 | 3300005367 | Bacteria | 3046 |
| 81 | Ga0070667_100387842 | 3300005367 | Bacteria | 1270 |
| 82 | Ga0070703_10086260 | 3300005406 | Bacteria | 1080 |
| 83 | Ga0070714_100026265 | 3300005435 | Bacteria | 4811 |
| 84 | Ga0070714_100162985 | 3300005435 | Bacteria | 2018 |
| 85 | Ga0070710_10038552 | 3300005437 | Bacteria | 2625 |
| 86 | Ga0070701_10000223 | 3300005438 | Bacteria | 17845 |
| 87 | Ga0070701_10008350 | 3300005438 | Bacteria | 4475 |
| 88 | Ga0070711_100266496 | 3300005439 | Bacteria | 1350 |
| 89 | Ga0070705_100006703 | 3300005440 | Bacteria | 5661 |
| 90 | Ga0070705_100009255 | 3300005440 | Bacteria | 4893 |
| 91 | Ga0070705_100011771 | 3300005440 | Bacteria | 4426 |
| 92 | Ga0070700_100000271 | 3300005441 | Bacteria | 27566 |
| 93 | Ga0070700_100001230 | 3300005441 | Bacteria | 12698 |
| 94 | Ga0070700_100005910 | 3300005441 | Bacteria | 6506 |
| 95 | Ga0070700_100038712 | 3300005441 | Bacteria | 2908 |
| 96 | Ga0070700_100198310 | 3300005441 | Bacteria | 1408 |
| 97 | Ga0070694_100043047 | 3300005444 | Bacteria | 3018 |
| 98 | Ga0070694_100078796 | 3300005444 | Bacteria | 2286 |
| 99 | Ga0070708_100218937 | 3300005445 | Bacteria | 1785 |
| 100 | Ga0070708_100458333 | 3300005445 | Bacteria | 1203 |
| 101 | Ga0070663_100399210 | 3300005455 | Bacteria | 1124 |
| 102 | Ga0070678_100001554 | 3300005456 | Bacteria | 12280 |
| 103 | Ga0070678_100119340 | 3300005456 | Bacteria | 2077 |
| 104 | Ga0070678_100231583 | 3300005456 | Bacteria | 1540 |
| 105 | Ga0070678_100584107 | 3300005456 | Bacteria | 996 |
| 106 | Ga0070662_100095584 | 3300005457 | Bacteria | 2240 |
| 107 | Ga0070662_100170916 | 3300005457 | Unclassified | 1707 |
| 108 | Ga0070662_100400306 | 3300005457 | Bacteria | 1133 |
| 109 | Ga0070681_10004036 | 3300005458 | Bacteria | 13848 |
| 110 | Ga0070681_10008003 | 3300005458 | Bacteria | 10348 |
| 111 | Ga0070681_10048165 | 3300005458 | Bacteria | 4260 |
| 112 | Ga0070681_10059949 | 3300005458 | Bacteria | 3784 |
| 113 | Ga0070681_10527605 | 3300005458 | Bacteria | 1094 |
| 114 | Ga0068867_100000383 | 3300005459 | Bacteria | 29506 |
| 115 | Ga0068867_100000440 | 3300005459 | Bacteria | 27583 |
| 116 | Ga0068867_100000940 | 3300005459 | Bacteria | 19803 |
| 117 | Ga0068867_100039903 | 3300005459 | Bacteria | 3423 |
| 118 | Ga0070706_100000388 | 3300005467 | Bacteria | 52771 |
| 119 | Ga0070706_100038959 | 3300005467 | Bacteria | 4387 |
| 120 | Ga0070707_100261619 | 3300005468 | Bacteria | 1683 |
| 121 | Ga0070707_100405395 | 3300005468 | Bacteria | 1324 |
| 122 | Ga0070698_100022115 | 3300005471 | Bacteria | 6657 |
| 123 | Ga0070699_100019712 | 3300005518 | Bacteria | 5812 |
| 124 | Ga0070699_100075190 | 3300005518 | Bacteria | 2940 |
| 125 | Ga0070699_100164444 | 3300005518 | Bacteria | 1965 |
| 126 | Ga0070679_100013061 | 3300005530 | Bacteria | 7952 |
| 127 | Ga0070679_100071250 | 3300005530 | Bacteria | 3467 |
| 128 | Ga0070679_100082398 | 3300005530 | Bacteria | 3207 |
| 129 | Ga0070679_100156099 | 3300005530 | Bacteria | 2257 |
| 130 | Ga0070679_100223255 | 3300005530 | Bacteria | 1845 |
| 131 | Ga0070679_100262536 | 3300005530 | Bacteria | 1682 |
| 132 | Ga0070697_100040276 | 3300005536 | Bacteria | 3779 |
| 133 | Ga0068853_100188929 | 3300005539 | Bacteria | 1871 |
| 134 | Ga0068853_100284509 | 3300005539 | Bacteria | 1525 |
| 135 | Ga0070672_100000897 | 3300005543 | Bacteria | 17894 |
| 136 | Ga0070672_100002207 | 3300005543 | Bacteria | 12280 |
| 137 | Ga0070672_100126770 | 3300005543 | Bacteria | 2094 |
| 138 | Ga0070686_100000581 | 3300005544 | Bacteria | 21695 |
| 139 | Ga0070686_100184571 | 3300005544 | Bacteria | 1484 |
| 140 | Ga0070686_100530707 | 3300005544 | Bacteria | 918 |
| 141 | Ga0070695_100004254 | 3300005545 | Bacteria | 8374 |
| 142 | Ga0070695_100024821 | 3300005545 | Bacteria | 3697 |
| 143 | Ga0070696_100001088 | 3300005546 | Bacteria | 17560 |
| 144 | Ga0070696_100003606 | 3300005546 | Bacteria | 10309 |
| 145 | Ga0070696_100009006 | 3300005546 | Bacteria | 6682 |
| 146 | Ga0070696_100043913 | 3300005546 | Bacteria | 3094 |
| 147 | Ga0070693_100007485 | 3300005547 | Bacteria | 5341 |
| 148 | Ga0070693_100315784 | 3300005547 | Bacteria | 1058 |
| 149 | Ga0070665_100020647 | 3300005548 | Bacteria | 6618 |
| 150 | Ga0070665_100157856 | 3300005548 | Bacteria | 2270 |
| 151 | Ga0070665_100177456 | 3300005548 | Bacteria | 2131 |
| 152 | Ga0070665_100258522 | 3300005548 | Bacteria | 1742 |
| 153 | Ga0070665_100422778 | 3300005548 | Unclassified | 1341 |
| 154 | Ga0070665_100782006 | 3300005548 | Bacteria | 967 |
| 155 | Ga0068855_100005816 | 3300005563 | Bacteria | 15050 |
| 156 | Ga0068855_100039981 | 3300005563 | Bacteria | 5567 |
| 157 | Ga0068855_100049904 | 3300005563 | Bacteria | 4934 |
| 158 | Ga0068855_100054231 | 3300005563 | Bacteria | 4712 |
| 159 | Ga0068855_100066708 | 3300005563 | Bacteria | 4195 |
| 160 | Ga0068855_100103418 | 3300005563 | Bacteria | 3277 |
| 161 | Ga0068855_100127783 | 3300005563 | Bacteria | 2905 |
| 162 | Ga0070664_100013435 | 3300005564 | Bacteria | 6669 |
| 163 | Ga0070664_100239092 | 3300005564 | Bacteria | 1630 |
| 164 | Ga0070664_100248484 | 3300005564 | Bacteria | 1598 |
| 165 | Ga0070664_100282143 | 3300005564 | Bacteria | 1498 |
| 166 | Ga0068857_100454495 | 3300005577 | Bacteria | 1198 |
| 167 | Ga0068854_100052329 | 3300005578 | Bacteria | 2928 |
| 168 | Ga0068856_100006621 | 3300005614 | Bacteria | 11351 |
| 169 | Ga0068856_100555603 | 3300005614 | Bacteria | 1169 |
| 170 | Ga0070702_100000059 | 3300005615 | Bacteria | 31794 |
| 171 | Ga0070702_100012851 | 3300005615 | Bacteria | 4213 |
| 172 | Ga0070702_100231507 | 3300005615 | Bacteria | 1242 |
| 173 | Ga0068859_100023691 | 3300005617 | Bacteria | 6162 |
| 174 | Ga0068859_100026861 | 3300005617 | Bacteria | 5774 |
| 175 | Ga0068859_100129313 | 3300005617 | Bacteria | 2596 |
| 176 | Ga0068864_100005549 | 3300005618 | Bacteria | 10345 |
| 177 | Ga0068864_100020992 | 3300005618 | Bacteria | 5469 |
| 178 | Ga0068864_100021620 | 3300005618 | Bacteria | 5387 |
| 179 | Ga0068864_100044386 | 3300005618 | Bacteria | 3810 |
| 180 | Ga0068866_10000232 | 3300005718 | Bacteria | 26282 |
| 181 | Ga0068866_10078798 | 3300005718 | Bacteria | 1764 |
| 182 | Ga0068861_100002136 | 3300005719 | Bacteria | 12792 |
| 183 | Ga0068861_100004208 | 3300005719 | Bacteria | 9656 |
| 184 | Ga0068861_100029721 | 3300005719 | Bacteria | 3999 |
| 185 | Ga0068861_100087263 | 3300005719 | Bacteria | 2455 |
| 186 | Ga0068861_100150451 | 3300005719 | Bacteria | 1909 |
| 187 | Ga0068851_10306564 | 3300005834 | Bacteria | 914 |
| 188 | Ga0068870_10073995 | 3300005840 | Bacteria | 1865 |
| 189 | Ga0068863_100001022 | 3300005841 | Bacteria | 28022 |
| 190 | Ga0068863_100077428 | 3300005841 | Bacteria | 3147 |
| 191 | Ga0068863_100166970 | 3300005841 | Bacteria | 2110 |
| 192 | Ga0068863_100168920 | 3300005841 | Bacteria | 2097 |
| 193 | Ga0068858_100007122 | 3300005842 | Bacteria | 10860 |
| 194 | Ga0068858_100015159 | 3300005842 | Bacteria | 7250 |
| 195 | Ga0068860_100006231 | 3300005843 | Bacteria | 11984 |
| 196 | Ga0068860_100035098 | 3300005843 | Bacteria | 4811 |
| 197 | Ga0068860_100226783 | 3300005843 | Bacteria | 1815 |
| 198 | Ga0068860_100240206 | 3300005843 | Bacteria | 1762 |
| 199 | Ga0068860_100396307 | 3300005843 | Bacteria | 1365 |
| 200 | Ga0068860_100866183 | 3300005843 | Bacteria | 918 |
| 201 | Ga0068862_100003925 | 3300005844 | Bacteria | 12648 |
| 202 | Ga0068862_100012684 | 3300005844 | Bacteria | 6974 |
| 203 | Ga0068862_100018071 | 3300005844 | Bacteria | 5873 |
| 204 | Ga0068862_100035015 | 3300005844 | Bacteria | 4250 |
| 205 | Ga0068862_100087008 | 3300005844 | Bacteria | 2717 |
| 206 | Ga0068862_100087533 | 3300005844 | Bacteria | 2709 |
| 207 | Ga0068862_100114202 | 3300005844 | Bacteria | 2373 |
| 208 | Ga0068862_100202387 | 3300005844 | Bacteria | 1791 |
| 209 | Ga0068862_100721881 | 3300005844 | Bacteria | 967 |
| 210 | Ga0081539_10001081 | 3300005985 | Bacteria | 49568 |
| 211 | Ga0081539_10014568 | 3300005985 | Bacteria | 5803 |
| 212 | Ga0075365_10000044 | 3300006038 | Bacteria | 40804 |
| 213 | Ga0075365_10001373 | 3300006038 | Bacteria | 10942 |
| 214 | Ga0075365_10009380 | 3300006038 | Bacteria | 5621 |
| 215 | Ga0075365_10053815 | 3300006038 | Bacteria | 2667 |
| 216 | Ga0075363_100000225 | 3300006048 | Bacteria | 15778 |
| 217 | Ga0075363_100008829 | 3300006048 | Bacteria | 4714 |
| 218 | Ga0075364_10000030 | 3300006051 | Bacteria | 50362 |
| 219 | Ga0075364_10001387 | 3300006051 | Bacteria | 13083 |
| 220 | Ga0075364_10027961 | 3300006051 | Bacteria | 3606 |
| 221 | Ga0075364_10043122 | 3300006051 | Bacteria | 2932 |
| 222 | Ga0075432_10000438 | 3300006058 | Bacteria | 12245 |
| 223 | Ga0070716_100027556 | 3300006173 | Bacteria | 3054 |
| 224 | Ga0070716_100083089 | 3300006173 | Bacteria | 1917 |
| 225 | Ga0075362_10003052 | 3300006177 | Bacteria | 5761 |
| 226 | Ga0075362_10023797 | 3300006177 | Bacteria | 2594 |
| 227 | Ga0075367_10101649 | 3300006178 | Bacteria | 1758 |
| 228 | Ga0075369_10003991 | 3300006186 | Bacteria | 5416 |
| 229 | Ga0075366_10001170 | 3300006195 | Bacteria | 12998 |
| 230 | Ga0075366_10001262 | 3300006195 | Bacteria | 12578 |
| 231 | Ga0075366_10043493 | 3300006195 | Bacteria | 2661 |
| 232 | Ga0075366_10062126 | 3300006195 | Bacteria | 2220 |
| 233 | Ga0097621_100003187 | 3300006237 | Bacteria | 11279 |
| 234 | Ga0097621_100005133 | 3300006237 | Bacteria | 9198 |
| 235 | Ga0097621_100011121 | 3300006237 | Bacteria | 6620 |
| 236 | Ga0097621_100632969 | 3300006237 | Bacteria | 980 |
| 237 | Ga0075370_10001855 | 3300006353 | Bacteria | 9466 |
| 238 | Ga0075370_10010463 | 3300006353 | Bacteria | 4852 |
| 239 | Ga0068871_100023423 | 3300006358 | Bacteria | 4776 |
| 240 | Ga0068871_100027151 | 3300006358 | Bacteria | 4474 |
| 241 | Ga0068871_100045394 | 3300006358 | Bacteria | 3537 |
| 242 | Ga0068871_100136632 | 3300006358 | Bacteria | 2082 |
| 243 | Ga0068871_100142924 | 3300006358 | Bacteria | 2036 |
| 244 | Ga0068871_100726686 | 3300006358 | Bacteria | 911 |
| 245 | Ga0075430_100011630 | 3300006846 | Bacteria | 7486 |
| 246 | Ga0075430_100024514 | 3300006846 | Bacteria | 5131 |
| 247 | Ga0075430_100040080 | 3300006846 | Unclassified | 3964 |
| 248 | Ga0075430_100107319 | 3300006846 | Bacteria | 2329 |
| 249 | Ga0075431_100091284 | 3300006847 | Bacteria | 3144 |
| 250 | Ga0075431_100247441 | 3300006847 | Unclassified | 1812 |
| 251 | Ga0075431_100585072 | 3300006847 | Bacteria | 1101 |
| 252 | Ga0075434_100097812 | 3300006871 | Bacteria | 2939 |
| 253 | Ga0075434_100124510 | 3300006871 | Bacteria | 2595 |
| 254 | Ga0075434_100326508 | 3300006871 | Bacteria | 1555 |
| 255 | Ga0075429_100234560 | 3300006880 | Bacteria | 1607 |
| 256 | Ga0068865_100000084 | 3300006881 | Bacteria | 50482 |
| 257 | Ga0068865_100006386 | 3300006881 | Bacteria | 7186 |
| 258 | Ga0068865_100089387 | 3300006881 | Bacteria | 2231 |
| 259 | Ga0068865_100345336 | 3300006881 | Bacteria | 1204 |
| 260 | Ga0075436_100001365 | 3300006914 | Bacteria | 16615 |
| 261 | Ga0075436_100064662 | 3300006914 | Bacteria | 2529 |
| 262 | Ga0075436_100089871 | 3300006914 | Bacteria | 2134 |
| 263 | Ga0075436_100130939 | 3300006914 | Bacteria | 1759 |
| 264 | Ga0097620_100023692 | 3300006931 | Bacteria | 6162 |
| 265 | Ga0097620_100026861 | 3300006931 | Bacteria | 5774 |
| 266 | Ga0097620_100129323 | 3300006931 | Bacteria | 2596 |
| 267 | Ga0075435_100229763 | 3300007076 | Bacteria | 1576 |
| 268 | Ga0099794_10235087 | 3300007265 | Bacteria | 943 |
| 269 | Ga0105240_10000012 | 3300009093 | Bacteria | 496639 |
| 270 | Ga0105240_10082812 | 3300009093 | Bacteria | 3940 |
| 271 | Ga0105240_10162189 | 3300009093 | Bacteria | 2654 |
| 272 | Ga0105240_10169635 | 3300009093 | Bacteria | 2586 |
| 273 | Ga0105240_10358712 | 3300009093 | Bacteria | 1652 |
| 274 | Ga0111539_10037704 | 3300009094 | Bacteria | 5836 |
| 275 | Ga0111539_10081231 | 3300009094 | Bacteria | 3813 |
| 276 | Ga0111539_10385789 | 3300009094 | Unclassified | 1631 |
| 277 | Ga0111539_10645884 | 3300009094 | Bacteria | 1232 |
| 278 | Ga0105245_10000063 | 3300009098 | Bacteria | 113377 |
| 279 | Ga0105245_10102415 | 3300009098 | Bacteria | 2651 |
| 280 | Ga0105245_10402603 | 3300009098 | Bacteria | 1368 |
| 281 | Ga0105245_10566299 | 3300009098 | Bacteria | 1159 |
| 282 | Ga0114129_10303814 | 3300009147 | Bacteria | 2126 |
| 283 | Ga0114129_11123664 | 3300009147 | Bacteria | 983 |
| 284 | Ga0105243_10001481 | 3300009148 | Bacteria | 20602 |
| 285 | Ga0105243_10007236 | 3300009148 | Bacteria | 8529 |
| 286 | Ga0105243_10019086 | 3300009148 | Bacteria | 5199 |
| 287 | Ga0105243_10108380 | 3300009148 | Bacteria | 2318 |
| 288 | Ga0105243_10117886 | 3300009148 | Bacteria | 2233 |
| 289 | Ga0105243_10169110 | 3300009148 | Bacteria | 1891 |
| 290 | Ga0105241_10006214 | 3300009174 | Bacteria | 8811 |
| 291 | Ga0105241_10063033 | 3300009174 | Bacteria | 2859 |
| 292 | Ga0105242_10007900 | 3300009176 | Bacteria | 8187 |
| 293 | Ga0105242_10100322 | 3300009176 | Bacteria | 2452 |
| 294 | Ga0105248_10002136 | 3300009177 | Bacteria | 21878 |
| 295 | Ga0105248_10054710 | 3300009177 | Bacteria | 4476 |
| 296 | Ga0105248_10061417 | 3300009177 | Bacteria | 4219 |
| 297 | Ga0105248_10071115 | 3300009177 | Bacteria | 3908 |
| 298 | Ga0105248_10398915 | 3300009177 | Bacteria | 1549 |
| 299 | Ga0105248_10706631 | 3300009177 | Bacteria | 1137 |
| 300 | Ga0105248_10781819 | 3300009177 | Unclassified | 1077 |
| 301 | Ga0105248_10822203 | 3300009177 | Bacteria | 1049 |
| 302 | Ga0105237_10000054 | 3300009545 | Bacteria | 155063 |
| 303 | Ga0105238_10198068 | 3300009551 | Bacteria | 1984 |
| 304 | Ga0105249_10031989 | 3300009553 | Bacteria | 4758 |
| 305 | Ga0105249_10164718 | 3300009553 | Bacteria | 2145 |
| 306 | Ga0105249_10306717 | 3300009553 | Bacteria | 1594 |
| 307 | Ga0105239_10005299 | 3300010375 | Bacteria | 15149 |
| 308 | Ga0105239_10038319 | 3300010375 | Bacteria | 5253 |
| 309 | Ga0105239_10246699 | 3300010375 | Bacteria | 2005 |
| 310 | Ga0157373_10139221 | 3300013100 | Bacteria | 1706 |
| 311 | Ga0157370_10000078 | 3300013104 | Bacteria | 107381 |
| 312 | Ga0157370_10004743 | 3300013104 | Bacteria | 15487 |
| 313 | Ga0157370_10010762 | 3300013104 | Bacteria | 9622 |
| 314 | Ga0157370_10047660 | 3300013104 | Bacteria | 4107 |
| 315 | Ga0157370_10104286 | 3300013104 | Bacteria | 2654 |
| 316 | Ga0157369_10128403 | 3300013105 | Bacteria | 2687 |
| 317 | Ga0157369_10187068 | 3300013105 | Bacteria | 2177 |
| 318 | Ga0157374_10005976 | 3300013296 | Bacteria | 10296 |
| 319 | Ga0157374_10260236 | 3300013296 | Bacteria | 1709 |
| 320 | Ga0157378_10000193 | 3300013297 | Bacteria | 58970 |
| 321 | Ga0157378_10137833 | 3300013297 | Bacteria | 2263 |
| 322 | Ga0157378_10184148 | 3300013297 | Bacteria | 1966 |
| 323 | Ga0157378_10321925 | 3300013297 | Bacteria | 1502 |
| 324 | Ga0157378_10720283 | 3300013297 | Bacteria | 1018 |
| 325 | Ga0163162_10005118 | 3300013306 | Bacteria | 12639 |
| 326 | Ga0163162_10034161 | 3300013306 | Bacteria | 5059 |
| 327 | Ga0163162_10448769 | 3300013306 | Bacteria | 1422 |
| 328 | Ga0157372_10044028 | 3300013307 | Bacteria | 4944 |
| 329 | Ga0157372_10213637 | 3300013307 | Bacteria | 2235 |
| 330 | Ga0157372_10360804 | 3300013307 | Bacteria | 1693 |
| 331 | Ga0157375_10027399 | 3300013308 | Bacteria | 5326 |
| 332 | Ga0157375_10027429 | 3300013308 | Bacteria | 5322 |
| 333 | Ga0157375_10064697 | 3300013308 | Bacteria | 3642 |
| 334 | Ga0157375_10105744 | 3300013308 | Bacteria | 2906 |
| 335 | Ga0157375_10161039 | 3300013308 | Bacteria | 2386 |
| 336 | Ga0157375_10355521 | 3300013308 | Bacteria | 1631 |
| 337 | Ga0163163_10104989 | 3300014325 | Bacteria | 2851 |
| 338 | Ga0163163_10391719 | 3300014325 | Bacteria | 1447 |
| 339 | Ga0157380_10013593 | 3300014326 | Bacteria | 5940 |
| 340 | Ga0157380_10016886 | 3300014326 | Bacteria | 5390 |
| 341 | Ga0157380_10040170 | 3300014326 | Bacteria | 3642 |
| 342 | Ga0157380_10072327 | 3300014326 | Bacteria | 2793 |
| 343 | Ga0157380_10255379 | 3300014326 | Bacteria | 1589 |
| 344 | Ga0157380_10273970 | 3300014326 | Bacteria | 1540 |
| 345 | Ga0182008_10051731 | 3300014497 | Bacteria | 2037 |
| 346 | Ga0157377_10112187 | 3300014745 | Bacteria | 1640 |
| 347 | Ga0157377_10129354 | 3300014745 | Bacteria | 1540 |
| 348 | Ga0157379_10002399 | 3300014968 | Bacteria | 15647 |
| 349 | Ga0157379_10021865 | 3300014968 | Bacteria | 5667 |
| 350 | Ga0157379_10048948 | 3300014968 | Bacteria | 3773 |
| 351 | Ga0157379_10420799 | 3300014968 | Bacteria | 1230 |
| 352 | Ga0157376_10057962 | 3300014969 | Bacteria | 3242 |
| 353 | Ga0157376_10140221 | 3300014969 | Bacteria | 2168 |
| 354 | Ga0157376_10236448 | 3300014969 | Bacteria | 1700 |
| 355 | Ga0182007_10001905 | 3300015262 | Bacteria | 10852 |
| 356 | Ga0182005_1013863 | 3300015265 | Bacteria | 2264 |
| 357 | Ga0163161_10004280 | 3300017792 | Bacteria | 9954 |
| 358 | Ga0163161_10008347 | 3300017792 | Bacteria | 7169 |
| 359 | Ga0163161_10027453 | 3300017792 | Bacteria | 4038 |
| 360 | Ga0163161_10232613 | 3300017792 | Bacteria | 1431 |
| 361 | Ga0209437_100067 | 3300025233 | Bacteria | 317685 |
| 362 | Ga0209437_106902 | 3300025233 | Bacteria | 1872 |
| 363 | Ga0209677_101204 | 3300025253 | Bacteria | 11775 |
| 364 | Ga0209233_1000088 | 3300025261 | Bacteria | 317980 |
| 365 | Ga0209233_1000201 | 3300025261 | Bacteria | 123566 |
| 366 | Ga0209565_1024389 | 3300025263 | Bacteria | 1231 |
| 367 | Ga0209673_1035979 | 3300025273 | Bacteria | 1476 |
| 368 | Ga0209130_1003030 | 3300025284 | Bacteria | 7589 |
| 369 | Ga0209675_1000270 | 3300025291 | Bacteria | 49663 |
| 370 | Ga0209676_1003129 | 3300025292 | Bacteria | 10596 |
| 371 | Ga0209051_1000527 | 3300025303 | Bacteria | 47465 |
| 372 | Ga0209051_1009227 | 3300025303 | Bacteria | 5105 |
| 373 | Ga0209257_1045534 | 3300025304 | Bacteria | 1273 |
| 374 | Ga0207697_10056146 | 3300025315 | Bacteria | 1633 |
| 375 | Ga0207656_10177181 | 3300025321 | Bacteria | 1022 |
| 376 | Ga0207642_10008787 | 3300025899 | Bacteria | 3487 |
| 377 | Ga0207642_10061255 | 3300025899 | Bacteria | 1749 |
| 378 | Ga0207680_10006771 | 3300025903 | Bacteria | 5562 |
| 379 | Ga0207680_10142744 | 3300025903 | Bacteria | 1589 |
| 380 | Ga0207699_10036370 | 3300025906 | Bacteria | 2806 |
| 381 | Ga0207645_10000419 | 3300025907 | Bacteria | 35124 |
| 382 | Ga0207645_10013325 | 3300025907 | Bacteria | 5546 |
| 383 | Ga0207645_10088312 | 3300025907 | Bacteria | 1993 |
| 384 | Ga0207643_10011586 | 3300025908 | Bacteria | 4762 |
| 385 | Ga0207643_10034932 | 3300025908 | Bacteria | 2818 |
| 386 | Ga0207643_10080513 | 3300025908 | Bacteria | 1886 |
| 387 | Ga0207643_10104341 | 3300025908 | Bacteria | 1665 |
| 388 | Ga0207705_10007282 | 3300025909 | Bacteria | 8137 |
| 389 | Ga0207684_10001941 | 3300025910 | Bacteria | 21443 |
| 390 | Ga0207684_10405373 | 3300025910 | Bacteria | 1172 |
| 391 | Ga0207654_10054383 | 3300025911 | Bacteria | 2313 |
| 392 | Ga0207654_10316949 | 3300025911 | Bacteria | 1065 |
| 393 | Ga0207707_10005043 | 3300025912 | Bacteria | 11589 |
| 394 | Ga0207707_10072282 | 3300025912 | Bacteria | 3007 |
| 395 | Ga0207707_10093831 | 3300025912 | Bacteria | 2622 |
| 396 | Ga0207707_10504699 | 3300025912 | Bacteria | 1031 |
| 397 | Ga0207707_10541166 | 3300025912 | Bacteria | 990 |
| 398 | Ga0207695_10000097 | 3300025913 | Bacteria | 262517 |
| 399 | Ga0207695_10033918 | 3300025913 | Bacteria | 5558 |
| 400 | Ga0207695_10095673 | 3300025913 | Bacteria | 2973 |
| 401 | Ga0207695_10166123 | 3300025913 | Bacteria | 2135 |
| 402 | Ga0207695_10408604 | 3300025913 | Bacteria | 1242 |
| 403 | Ga0207671_10000023 | 3300025914 | Bacteria | 274756 |
| 404 | Ga0207693_10088089 | 3300025915 | Bacteria | 2433 |
| 405 | Ga0207660_10003132 | 3300025917 | Bacteria | 10817 |
| 406 | Ga0207660_10211337 | 3300025917 | Bacteria | 1519 |
| 407 | Ga0207660_10271291 | 3300025917 | Bacteria | 1344 |
| 408 | Ga0207657_10103123 | 3300025919 | Bacteria | 2365 |
| 409 | Ga0207649_10113249 | 3300025920 | Bacteria | 1817 |
| 410 | Ga0207649_10236926 | 3300025920 | Unclassified | 1308 |
| 411 | Ga0207649_10295495 | 3300025920 | Bacteria | 1183 |
| 412 | Ga0207652_10234758 | 3300025921 | Bacteria | 1653 |
| 413 | Ga0207652_10260600 | 3300025921 | Bacteria | 1564 |
| 414 | Ga0207652_10316788 | 3300025921 | Bacteria | 1408 |
| 415 | Ga0207646_10213889 | 3300025922 | Bacteria | 1741 |
| 416 | Ga0207646_10527731 | 3300025922 | Bacteria | 1063 |
| 417 | Ga0207681_10004085 | 3300025923 | Bacteria | 9043 |
| 418 | Ga0207681_10005388 | 3300025923 | Bacteria | 7858 |
| 419 | Ga0207681_10040251 | 3300025923 | Bacteria | 3109 |
| 420 | Ga0207681_10500117 | 3300025923 | Bacteria | 995 |
| 421 | Ga0207681_10558799 | 3300025923 | Bacteria | 942 |
| 422 | Ga0207650_10001061 | 3300025925 | Bacteria | 20432 |
| 423 | Ga0207650_10004208 | 3300025925 | Bacteria | 9833 |
| 424 | Ga0207650_10022657 | 3300025925 | Bacteria | 4448 |
| 425 | Ga0207650_10092574 | 3300025925 | Bacteria | 2312 |
| 426 | Ga0207659_10003137 | 3300025926 | Bacteria | 9880 |
| 427 | Ga0207659_10039987 | 3300025926 | Bacteria | 3275 |
| 428 | Ga0207659_10075971 | 3300025926 | Bacteria | 2467 |
| 429 | Ga0207659_10625778 | 3300025926 | Bacteria | 919 |
| 430 | Ga0207687_10007353 | 3300025927 | Bacteria | 7261 |
| 431 | Ga0207687_10345256 | 3300025927 | Bacteria | 1211 |
| 432 | Ga0207664_10038452 | 3300025929 | Bacteria | 3710 |
| 433 | Ga0207664_10123884 | 3300025929 | Bacteria | 2167 |
| 434 | Ga0207664_10320867 | 3300025929 | Bacteria | 1367 |
| 435 | Ga0207664_10489953 | 3300025929 | Bacteria | 1100 |
| 436 | Ga0207644_10065847 | 3300025931 | Bacteria | 2636 |
| 437 | Ga0207644_10122380 | 3300025931 | Bacteria | 1982 |
| 438 | Ga0207644_10182854 | 3300025931 | Bacteria | 1644 |
| 439 | Ga0207690_10020905 | 3300025932 | Unclassified | 4051 |
| 440 | Ga0207690_10043181 | 3300025932 | Bacteria | 2966 |
| 441 | Ga0207690_10100786 | 3300025932 | Bacteria | 2062 |
| 442 | Ga0207706_10069436 | 3300025933 | Bacteria | 3099 |
| 443 | Ga0207706_10469832 | 3300025933 | Bacteria | 1087 |
| 444 | Ga0207706_10472173 | 3300025933 | Bacteria | 1084 |
| 445 | Ga0207686_10000467 | 3300025934 | Bacteria | 26772 |
| 446 | Ga0207686_10191294 | 3300025934 | Bacteria | 1459 |
| 447 | Ga0207709_10001392 | 3300025935 | Bacteria | 16932 |
| 448 | Ga0207709_10002974 | 3300025935 | Bacteria | 10327 |
| 449 | Ga0207709_10148972 | 3300025935 | Bacteria | 1618 |
| 450 | Ga0207670_10015389 | 3300025936 | Bacteria | 4570 |
| 451 | Ga0207670_10243410 | 3300025936 | Bacteria | 1387 |
| 452 | Ga0207670_10503315 | 3300025936 | Bacteria | 984 |
| 453 | Ga0207669_10040343 | 3300025937 | Bacteria | 2707 |
| 454 | Ga0207669_10061520 | 3300025937 | Bacteria | 2308 |
| 455 | Ga0207704_10006116 | 3300025938 | Bacteria | 5582 |
| 456 | Ga0207704_10071139 | 3300025938 | Bacteria | 2206 |
| 457 | Ga0207704_10113388 | 3300025938 | Bacteria | 1838 |
| 458 | Ga0207665_10161555 | 3300025939 | Bacteria | 1612 |
| 459 | Ga0207691_10000232 | 3300025940 | Bacteria | 54241 |
| 460 | Ga0207691_10001955 | 3300025940 | Bacteria | 20123 |
| 461 | Ga0207691_10180415 | 3300025940 | Bacteria | 1845 |
| 462 | Ga0207691_10259148 | 3300025940 | Bacteria | 1499 |
| 463 | Ga0207691_10440072 | 3300025940 | Unclassified | 1110 |
| 464 | Ga0207691_10629186 | 3300025940 | Bacteria | 907 |
| 465 | Ga0207711_10059056 | 3300025941 | Bacteria | 3302 |
| 466 | Ga0207711_10203130 | 3300025941 | Bacteria | 1809 |
| 467 | Ga0207689_10000152 | 3300025942 | Bacteria | 59757 |
| 468 | Ga0207689_10009430 | 3300025942 | Bacteria | 8429 |
| 469 | Ga0207689_10014808 | 3300025942 | Bacteria | 6621 |
| 470 | Ga0207689_10348608 | 3300025942 | Bacteria | 1231 |
| 471 | Ga0207661_10469560 | 3300025944 | Bacteria | 1148 |
| 472 | Ga0207679_10000864 | 3300025945 | Bacteria | 19388 |
| 473 | Ga0207679_10184221 | 3300025945 | Bacteria | 1730 |
| 474 | Ga0207667_10002896 | 3300025949 | Bacteria | 21308 |
| 475 | Ga0207667_10067668 | 3300025949 | Bacteria | 3720 |
| 476 | Ga0207667_10079594 | 3300025949 | Bacteria | 3396 |
| 477 | Ga0207667_10107074 | 3300025949 | Bacteria | 2884 |
| 478 | Ga0207667_10111695 | 3300025949 | Bacteria | 2819 |
| 479 | Ga0207667_10224381 | 3300025949 | Bacteria | 1925 |
| 480 | Ga0207651_10006677 | 3300025960 | Bacteria | 6072 |
| 481 | Ga0207651_10045487 | 3300025960 | Bacteria | 2945 |
| 482 | Ga0207651_10126966 | 3300025960 | Bacteria | 1945 |
| 483 | Ga0207651_10431951 | 3300025960 | Bacteria | 1126 |
| 484 | Ga0207712_10353086 | 3300025961 | Bacteria | 1223 |
| 485 | Ga0207668_10006939 | 3300025972 | Bacteria | 6720 |
| 486 | Ga0207668_10040588 | 3300025972 | Bacteria | 3141 |
| 487 | Ga0207668_10063542 | 3300025972 | Bacteria | 2605 |
| 488 | Ga0207640_10035725 | 3300025981 | Bacteria | 3112 |
| 489 | Ga0207658_10014076 | 3300025986 | Bacteria | 5477 |
| 490 | Ga0207658_10062154 | 3300025986 | Bacteria | 2794 |
| 491 | Ga0207658_10214709 | 3300025986 | Bacteria | 1615 |
| 492 | Ga0207658_10240415 | 3300025986 | Bacteria | 1533 |
| 493 | Ga0207677_10011683 | 3300026023 | Bacteria | 5014 |
| 494 | Ga0207677_10047853 | 3300026023 | Bacteria | 2874 |
| 495 | Ga0207677_10443458 | 3300026023 | Bacteria | 1111 |
| 496 | Ga0207703_10013897 | 3300026035 | Bacteria | 6276 |
| 497 | Ga0207703_10034171 | 3300026035 | Bacteria | 4034 |
| 498 | Ga0207703_10036717 | 3300026035 | Bacteria | 3901 |
| 499 | Ga0207703_10777389 | 3300026035 | Bacteria | 913 |
| 500 | Ga0207639_10004783 | 3300026041 | Bacteria | 9132 |
| 501 | Ga0207639_10249494 | 3300026041 | Bacteria | 1547 |
| 502 | Ga0207708_10000166 | 3300026075 | Bacteria | 51921 |
| 503 | Ga0207708_10000755 | 3300026075 | Bacteria | 24235 |
| 504 | Ga0207708_10016758 | 3300026075 | Bacteria | 5514 |
| 505 | Ga0207708_10030173 | 3300026075 | Bacteria | 4112 |
| 506 | Ga0207708_10058767 | 3300026075 | Bacteria | 2934 |
| 507 | Ga0207702_10011398 | 3300026078 | Bacteria | 7411 |
| 508 | Ga0207702_10012230 | 3300026078 | Bacteria | 7141 |
| 509 | Ga0207641_10004693 | 3300026088 | Bacteria | 11776 |
| 510 | Ga0207641_10004813 | 3300026088 | Bacteria | 11627 |
| 511 | Ga0207641_10061616 | 3300026088 | Bacteria | 3200 |
| 512 | Ga0207641_10135824 | 3300026088 | Bacteria | 2213 |
| 513 | Ga0207641_10144415 | 3300026088 | Bacteria | 2150 |
| 514 | Ga0207641_10865054 | 3300026088 | Bacteria | 897 |
| 515 | Ga0207648_10000131 | 3300026089 | Bacteria | 73949 |
| 516 | Ga0207648_10000276 | 3300026089 | Bacteria | 55713 |
| 517 | Ga0207648_10013865 | 3300026089 | Bacteria | 7477 |
| 518 | Ga0207648_10015834 | 3300026089 | Bacteria | 6912 |
| 519 | Ga0207648_10115732 | 3300026089 | Bacteria | 2356 |
| 520 | Ga0207648_10690287 | 3300026089 | Bacteria | 946 |
| 521 | Ga0207676_10001858 | 3300026095 | Bacteria | 15468 |
| 522 | Ga0207676_10024861 | 3300026095 | Bacteria | 4438 |
| 523 | Ga0207674_10348387 | 3300026116 | Bacteria | 1432 |
| 524 | Ga0207675_100000084 | 3300026118 | Bacteria | 74312 |
| 525 | Ga0207675_100003258 | 3300026118 | Bacteria | 15896 |
| 526 | Ga0207675_100015099 | 3300026118 | Bacteria | 7205 |
| 527 | Ga0207675_100038831 | 3300026118 | Bacteria | 4443 |
| 528 | Ga0207675_100083888 | 3300026118 | Bacteria | 2989 |
| 529 | Ga0207675_100242671 | 3300026118 | Bacteria | 1741 |
| 530 | Ga0207675_100375045 | 3300026118 | Bacteria | 1398 |
| 531 | Ga0207675_100547012 | 3300026118 | Bacteria | 1156 |
| 532 | Ga0207683_10000063 | 3300026121 | Bacteria | 80638 |
| 533 | Ga0207683_10006739 | 3300026121 | Bacteria | 9830 |
| 534 | Ga0207683_10131027 | 3300026121 | Bacteria | 2256 |
| 535 | Ga0207683_10318484 | 3300026121 | Bacteria | 1424 |
| 536 | Ga0209970_1013019 | 3300027614 | Bacteria | 1376 |
| 537 | Ga0209971_1005150 | 3300027682 | Bacteria | 3104 |
| 538 | Ga0207428_10012294 | 3300027907 | Bacteria | 7525 |
| 539 | Ga0207428_10013964 | 3300027907 | Bacteria | 6994 |
| 540 | Ga0268266_10007407 | 3300028379 | Bacteria | 9908 |
| 541 | Ga0268266_10023985 | 3300028379 | Bacteria | 5191 |
| 542 | Ga0268266_10110138 | 3300028379 | Bacteria | 2439 |
| 543 | Ga0268266_10118963 | 3300028379 | Bacteria | 2349 |
| 544 | Ga0268266_10331348 | 3300028379 | Bacteria | 1427 |
| 545 | Ga0268265_10002208 | 3300028380 | Bacteria | 15006 |
| 546 | Ga0268265_10005049 | 3300028380 | Bacteria | 9060 |
| 547 | Ga0268265_10006155 | 3300028380 | Bacteria | 8138 |
| 548 | Ga0268265_10014989 | 3300028380 | Bacteria | 5293 |
| 549 | Ga0268265_10032764 | 3300028380 | Bacteria | 3770 |
| 550 | Ga0268265_10065226 | 3300028380 | Bacteria | 2809 |
| 551 | Ga0268265_10071644 | 3300028380 | Bacteria | 2700 |
| 552 | Ga0268265_10762499 | 3300028380 | Bacteria | 940 |
| 553 | Ga0268264_10195394 | 3300028381 | Bacteria | 1847 |
| 554 | Ga0268264_10458429 | 3300028381 | Bacteria | 1236 |
| 555 | Ga0268264_10705114 | 3300028381 | Bacteria | 1003 |
| 556 | Ga0307515_10115476 | 3300028794 | Bacteria | 3092 |
| 557 | Ga0265330_10016532 | 3300031235 | Bacteria | 3403 |
| 558 | Ga0265332_10000255 | 3300031238 | Bacteria | 42422 |
| 559 | Ga0265325_10017682 | 3300031241 | Bacteria | 3960 |
| 560 | Ga0265329_10001448 | 3300031242 | Bacteria | 11444 |
| 561 | Ga0265331_10000354 | 3300031250 | Bacteria | 48614 |
| 562 | Ga0265327_10024791 | 3300031251 | Bacteria | 3512 |
| 563 | Ga0265327_10025730 | 3300031251 | Bacteria | 3425 |
| 564 | Ga0265327_10082915 | 3300031251 | Bacteria | 1579 |
| 565 | Ga0265316_10142525 | 3300031344 | Bacteria | 1799 |
| 566 | Ga0307513_10003370 | 3300031456 | Bacteria | 21705 |
| 567 | Ga0307408_100070860 | 3300031548 | Bacteria | 2575 |
| 568 | Ga0307408_100092027 | 3300031548 | Bacteria | 2291 |
| 569 | Ga0265314_10017506 | 3300031711 | Bacteria | 5623 |
| 570 | Ga0265342_10082481 | 3300031712 | Bacteria | 1855 |
| 571 | Ga0307516_10009467 | 3300031730 | Bacteria | 10853 |
| 572 | Ga0307413_10398397 | 3300031824 | Bacteria | 1078 |
| 573 | Ga0307410_10001761 | 3300031852 | Bacteria | 10011 |
| 574 | Ga0307410_10010439 | 3300031852 | Bacteria | 5259 |
| 575 | Ga0307410_10261353 | 3300031852 | Bacteria | 1350 |
| 576 | Ga0307407_10013882 | 3300031903 | Bacteria | 3925 |
| 577 | Ga0307407_10035671 | 3300031903 | Bacteria | 2734 |
| 578 | Ga0307407_10133638 | 3300031903 | Bacteria | 1591 |
| 579 | Ga0307407_10234362 | 3300031903 | Bacteria | 1249 |
| 580 | Ga0307412_10006840 | 3300031911 | Bacteria | 6472 |
| 581 | Ga0307409_100016403 | 3300031995 | Bacteria | 4899 |
| 582 | Ga0307409_100087558 | 3300031995 | Bacteria | 2538 |
| 583 | Ga0307409_100220746 | 3300031995 | Bacteria | 1711 |
| 584 | Ga0307416_100000857 | 3300032002 | Bacteria | 15997 |
| 585 | Ga0307416_100021173 | 3300032002 | Bacteria | 4661 |
| 586 | Ga0307411_10099517 | 3300032005 | Bacteria | 2052 |
| 587 | Ga0307411_10101796 | 3300032005 | Bacteria | 2034 |
| 588 | Ga0307411_10233949 | 3300032005 | Bacteria | 1434 |
| 589 | Ga0307415_100014519 | 3300032126 | Bacteria | 4633 |
| 590 | Ga0307415_100032845 | 3300032126 | Bacteria | 3362 |
| 591 | Ga0307510_10356930 | 3300033180 | Bacteria | 911 |
| 592 | Ga0373932_0048648 | 3300035112 | Bacteria | 1250 |
| 593 | Ga0373939_0013050 | 3300035114 | Bacteria | 2130 |
| 594 | Ga0373953_0045622 | 3300035117 | Bacteria | 1757 |
| 595 | Ga0373956_0056939 | 3300035119 | Bacteria | 1766 |
| 596 | Ga0373957_0004905 | 3300035120 | Bacteria | 4110 |
| 597 | Ga0373960_0018572 | 3300035121 | Bacteria | 1815 |
| 598 | Ga0373943_0349020 | 3300035170 | Unclassified | 848 |
| 599 | Ga0373946_0050819 | 3300035171 | Bacteria | 1733 |
| 600 | Ga0373955_0025140 | 3300035172 | Bacteria | 3055 |
| 601 | Ga0373924_0027605 | 3300035410 | Bacteria | 2258 |
| 602 | Ga0373931_0052195 | 3300035691 | Bacteria | 2179 |
| 603 | Ga0373927_0007037 | 3300035695 | Bacteria | 7632 |
| 604 | Ga0373927_0334125 | 3300035695 | Bacteria | 998 |
| 605 | Ga0373933_0014773 | 3300035724 | Bacteria | 4345 |
| 606 | Ga0373947_0030159 | 3300035725 | Bacteria | 3186 |
| 607 | Ga0373947_0086698 | 3300035725 | Bacteria | 1947 |
| 608 | Ga0373925_0004776 | 3300037068 | Bacteria | 10206 |
| 609 | Ga0373925_0519602 | 3300037068 | Bacteria | 978 |
| 610 | Ga0395900_0066669 | 3300037418 | Bacteria | 3699 |
| 611 | Ga0395898_0026512 | 3300037466 | Bacteria | 5829 |
| 612 | Ga0395905_0026473 | 3300037471 | Bacteria | 5467 |
| 613 | Ga0395905_0060692 | 3300037471 | Bacteria | 3536 |
| 614 | Ga0395905_0416090 | 3300037471 | Bacteria | 1240 |
| 615 | Ga0395901_0000034 | 3300038443 | Bacteria | 230365 |
| 616 | Ga0395901_0010150 | 3300038443 | Bacteria | 9541 |
| 617 | Ga0439436_0005628 | 3300041404 | Bacteria | 3842 |
| 618 | Ga0439465_0040481 | 3300041413 | Bacteria | 1506 |
| 619 | Ga0439441_003123 | 3300042001 | Bacteria | 2407 |
| 620 | Ga0439442_007562 | 3300042002 | Bacteria | 2187 |
| 621 | Ga0439442_009716 | 3300042002 | Bacteria | 1946 |
| 622 | Ga0439448_0000260 | 3300042005 | Bacteria | 11455 |
| 623 | Ga0439449_0071712 | 3300042007 | Bacteria | 1276 |
| 624 | Ga0450923_002704 | 3300042125 | Bacteria | 2581 |
| 625 | Ga0450895_002269 | 3300042132 | Bacteria | 1422 |
| 626 | Ga0450898_003396 | 3300042134 | Bacteria | 2287 |
| 627 | Ga0450906_000773 | 3300042145 | Bacteria | 6963 |
| 628 | Ga0450908_002426 | 3300042184 | Bacteria | 3649 |
| 629 | Ga0439434_0001721 | 3300042435 | Bacteria | 6351 |
| 630 | Ga0439460_0044802 | 3300042461 | Bacteria | 1311 |
| 631 | Ga0450918_001559 | 3300042531 | Bacteria | 4527 |
| 632 | Ga0451577_0351657 | 3300042876 | Bacteria | 1337 |
| 633 | Ga0451577_0403473 | 3300042876 | Bacteria | 1241 |
| 634 | Ga0453684_0071736 | 3300044712 | Bacteria | 4377 |
| 635 | Ga0453684_0199301 | 3300044712 | Bacteria | 2335 |
| 636 | Ga0495617_022696 | 3300046452 | Bacteria | 2122 |
| 637 | Ga0495638_0000560 | 3300046460 | Bacteria | 42333 |
| 638 | Ga0495638_0163449 | 3300046460 | Bacteria | 1283 |
| 639 | Ga0495580_0038531 | 3300046472 | Bacteria | 3423 |
| 640 | Ga0495605_0015309 | 3300046474 | Bacteria | 4175 |
| 641 | Ga0495605_0035536 | 3300046474 | Bacteria | 2518 |
| 642 | Ga0495605_0195709 | 3300046474 | Bacteria | 883 |
| 643 | Ga0495639_0062236 | 3300046475 | Bacteria | 1712 |
| 644 | Ga0495585_0158817 | 3300046492 | Bacteria | 1174 |
| 645 | Ga0495594_0157363 | 3300046499 | Bacteria | 1291 |
| 646 | Ga0495583_0109103 | 3300046506 | Bacteria | 1174 |
| 647 | Ga0495606_0001061 | 3300046507 | Bacteria | 39727 |
| 648 | Ga0495616_0024877 | 3300046513 | Bacteria | 3206 |
| 649 | Ga0495616_0154466 | 3300046513 | Bacteria | 1036 |
| 650 | Ga0495631_0009103 | 3300046518 | Bacteria | 4972 |
| 651 | Ga0495643_0001621 | 3300046522 | Bacteria | 19880 |
| 652 | Ga0495648_0084460 | 3300046524 | Bacteria | 1796 |
| 653 | Ga0495609_0055865 | 3300046538 | Bacteria | 1750 |
| 654 | Ga0495668_0006908 | 3300046616 | Bacteria | 7347 |
| 655 | Ga0495611_0018143 | 3300046648 | Bacteria | 3015 |
| 656 | Ga0495625_0000056 | 3300046660 | Bacteria | 186024 |
| 657 | Ga0495625_0018268 | 3300046660 | Bacteria | 5479 |
| 658 | Ga0495625_0021119 | 3300046660 | Bacteria | 5018 |
| 659 | Ga0495625_0281606 | 3300046660 | Bacteria | 1070 |
| 660 | Ga0495647_0161484 | 3300046681 | Bacteria | 966 |
| 661 | Ga0495670_0271524 | 3300046691 | Bacteria | 906 |
| 662 | Ga0495660_0033746 | 3300046810 | Bacteria | 2867 |
| 663 | Ga0495672_0007888 | 3300047320 | Bacteria | 7943 |
| 664 | Ga0495672_0014508 | 3300047320 | Bacteria | 5393 |
| 665 | Ga0495680_0055787 | 3300047322 | Bacteria | 3063 |
| 666 | Ga0495683_0022469 | 3300047323 | Bacteria | 3243 |
| 667 | Ga0495683_0227670 | 3300047323 | Bacteria | 828 |
| 668 | Ga0495687_005257 | 3300047443 | Bacteria | 8317 |
| 669 | Ga0495687_081262 | 3300047443 | Bacteria | 1268 |
| 670 | Ga0495673_0012730 | 3300047469 | Bacteria | 4444 |
| 671 | Ga0495684_0304563 | 3300047471 | Bacteria | 1144 |
| 672 | Ga0495686_0000296 | 3300047472 | Bacteria | 86346 |
| 673 | Ga0495686_0044116 | 3300047472 | Plasmid | 2823 |
| 674 | Ga0495686_0242280 | 3300047472 | Bacteria | 1016 |
| 675 | Ga0495626_0068226 | 3300048091 | Bacteria | 1604 |
| 676 | Ga0496100_0011067 | 3300048903 | Bacteria | 5120 |
| 677 | Ga0496101_0022621 | 3300048904 | Bacteria | 4330 |
| 678 | Ga0496102_0061043 | 3300048905 | Bacteria | 3449 |
| 679 | Ga0496102_0760942 | 3300048905 | Bacteria | 891 |
| 680 | Ga0496104_0044430 | 3300048907 | Bacteria | 4174 |
| 681 | Ga0496105_0000614 | 3300048908 | Bacteria | 23855 |
| 682 | Ga0496107_0166414 | 3300048910 | Bacteria | 1635 |
| 683 | Ga0496107_0266388 | 3300048910 | Bacteria | 1275 |
| 684 | Ga0496108_0000514 | 3300048911 | Bacteria | 30292 |
| 685 | Ga0496109_0021995 | 3300048912 | Bacteria | 5645 |
| 686 | Ga0496110_0234462 | 3300048913 | Bacteria | 1669 |
| 687 | Ga0496111_0012322 | 3300048914 | Bacteria | 5784 |
| 688 | Ga0496112_0040229 | 3300048915 | Bacteria | 4570 |
| 689 | Ga0496113_0001056 | 3300048916 | Bacteria | 14880 |
| 690 | Ga0496114_0090067 | 3300048917 | Bacteria | 2604 |
| 691 | Ga0496114_0466186 | 3300048917 | Bacteria | 1118 |
| 692 | Ga0496115_0017087 | 3300048918 | Bacteria | 5535 |
| 693 | Ga0496116_0009140 | 3300048919 | Bacteria | 8490 |
| 694 | Ga0496117_0034905 | 3300048920 | Bacteria | 3783 |
| 695 | Ga0496117_0173758 | 3300048920 | Bacteria | 1247 |
| 696 | Ga0496118_0038697 | 3300048921 | Bacteria | 3819 |
| 697 | Ga0496118_0104070 | 3300048921 | Bacteria | 1907 |
| 698 | Ga0496119_0005487 | 3300048922 | Bacteria | 12125 |
| 699 | Ga0496119_0046565 | 3300048922 | Bacteria | 2707 |
| 700 | Ga0496120_0027467 | 3300048923 | Bacteria | 3500 |
| 701 | Ga0496121_0001592 | 3300048924 | Bacteria | 37760 |
| 702 | Ga0496121_0008906 | 3300048924 | Bacteria | 11654 |
| 703 | Ga0496121_0110364 | 3300048924 | Bacteria | 2099 |
| 704 | Ga0496122_0010062 | 3300048925 | Bacteria | 9824 |
| 705 | Ga0496122_0079615 | 3300048925 | Bacteria | 2289 |
| 706 | Ga0496123_0042179 | 3300048926 | Bacteria | 3153 |
| 707 | Ga0496124_0000038 | 3300048927 | Bacteria | 312485 |
| 708 | Ga0496124_0000832 | 3300048927 | Bacteria | 50313 |
| 709 | Ga0496125_0006659 | 3300048928 | Bacteria | 12435 |
| 710 | Ga0496126_0000271 | 3300048929 | Bacteria | 110289 |
| 711 | Ga0495678_024566 | 3300049459 | Bacteria | 2601 |
| 712 | Ga0501034_0002148 | 3300049571 | Bacteria | 24489 |
| 713 | Ga0501034_0045066 | 3300049571 | Bacteria | 4458 |
| 714 | Ga0501034_0514280 | 3300049571 | Bacteria | 1110 |
| 715 | Ga0501034_0659027 | 3300049571 | Bacteria | 948 |
| 716 | Ga0501036_0018757 | 3300049572 | Bacteria | 5803 |
| 717 | Ga0501037_0324760 | 3300049573 | Bacteria | 1065 |
| 718 | Ga0501038_0005280 | 3300049574 | Bacteria | 12014 |
| 719 | Ga0501039_0001702 | 3300049575 | Bacteria | 16202 |
| 720 | Ga0501039_0086530 | 3300049575 | Bacteria | 2441 |
| 721 | Ga0501039_0205890 | 3300049575 | Bacteria | 1547 |
| 722 | Ga0501039_0499411 | 3300049575 | Unclassified | 955 |
| 723 | Ga0501040_0022891 | 3300049576 | Bacteria | 4186 |
| 724 | Ga0501041_0067650 | 3300049577 | Bacteria | 2189 |
| 725 | Ga0501042_0036769 | 3300049578 | Bacteria | 3474 |
| 726 | Ga0501043_0162816 | 3300049579 | Bacteria | 1743 |
| 727 | Ga0501043_0186423 | 3300049579 | Bacteria | 1615 |
| 728 | Ga0501046_0089115 | 3300049580 | Bacteria | 2375 |
| 729 | Ga0501048_0059377 | 3300049582 | Bacteria | 2710 |
| 730 | Ga0501068_0000570 | 3300049584 | Bacteria | 18765 |
| 731 | Ga0501069_0196979 | 3300049585 | Bacteria | 1167 |
| 732 | Ga0501070_0025223 | 3300049586 | Bacteria | 4985 |
| 733 | Ga0501071_0007699 | 3300049587 | Bacteria | 7098 |
| 734 | Ga0501072_0002218 | 3300049588 | Bacteria | 14512 |
| 735 | Ga0501072_0016870 | 3300049588 | Bacteria | 5610 |
| 736 | Ga0501073_0001398 | 3300049589 | Bacteria | 17802 |
| 737 | Ga0501073_0271224 | 3300049589 | Bacteria | 1171 |
| 738 | Ga0501074_0027087 | 3300049590 | Bacteria | 4154 |
| 739 | Ga0501075_0020157 | 3300049591 | Bacteria | 4845 |
| 740 | Ga0501075_0095975 | 3300049591 | Bacteria | 2250 |
| 741 | Ga0501076_0004326 | 3300049592 | Bacteria | 10074 |
| 742 | Ga0501076_0371778 | 3300049592 | Bacteria | 1175 |
| 743 | Ga0501077_0064148 | 3300049593 | Bacteria | 2330 |
| 744 | Ga0501077_0072087 | 3300049593 | Bacteria | 2189 |
| 745 | Ga0501079_0032202 | 3300049741 | Bacteria | 4030 |
| 746 | Ga0501080_0005302 | 3300049742 | Bacteria | 11487 |
| 747 | Ga0501080_0045443 | 3300049742 | Bacteria | 4088 |
| 748 | Ga0501081_0029064 | 3300049743 | Bacteria | 3733 |
| 749 | Ga0501083_0014156 | 3300049744 | Bacteria | 5579 |
| 750 | Ga0501035_0097496 | 3300049822 | Bacteria | 2582 |
| 751 | Ga0501044_0107500 | 3300049823 | Bacteria | 2801 |
| 752 | Ga0501044_0166023 | 3300049823 | Bacteria | 2182 |
| 753 | Ga0501045_0002479 | 3300049824 | Bacteria | 12554 |
| 754 | nmdc:mga03683_131735_c1 | 3300050489 | Bacteria | 1119 |
| 755 | nmdc:mga03683_4178_c1 | 3300050489 | Bacteria | 4756 |
| 756 | nmdc:mga03683_73_c1 | 3300050489 | Bacteria | 37601 |
| 757 | nmdc:mga03n38_14931_c1 | 3300050490 | Bacteria | 2990 |
| 758 | nmdc:mga03n38_30_c1 | 3300050490 | Bacteria | 31879 |
| 759 | nmdc:mga03n38_31794_c1 | 3300050490 | Bacteria | 2230 |
| 760 | nmdc:mga00v17_11142_c1 | 3300050491 | Bacteria | 4934 |
| 761 | nmdc:mga00v17_131_c1 | 3300050491 | Bacteria | 43797 |
| 762 | nmdc:mga00v17_262749_c1 | 3300050491 | Bacteria | 1120 |
| 763 | nmdc:mga00v17_2860_c1 | 3300050491 | Bacteria | 8842 |
| 764 | nmdc:mga0yw44_1201_c1 | 3300050492 | Bacteria | 10130 |
| 765 | nmdc:mga0yw44_198389_c1 | 3300050492 | Bacteria | 1325 |
| 766 | nmdc:mga0yw44_2547_c1 | 3300050492 | Bacteria | 7820 |
| 767 | nmdc:mga0yw44_35_c1 | 3300050492 | Bacteria | 47558 |
| 768 | nmdc:mga0k408_325_c1 | 3300050493 | Bacteria | 25971 |
| 769 | nmdc:mga0k408_42182_c1 | 3300050493 | Bacteria | 2627 |
| 770 | nmdc:mga0k408_7937_c1 | 3300050493 | Bacteria | 5685 |
| 771 | nmdc:mga04h51_99153_c1 | 3300050495 | Bacteria | 1059 |
| 772 | nmdc:mga07m45_347_c2 | 3300050496 | Bacteria | 18471 |
| 773 | nmdc:mga07m45_7798_c1 | 3300050496 | Bacteria | 5479 |
| 774 | nmdc:mga05p37_353560_c1 | 3300050507 | Bacteria | 1729 |
| 775 | nmdc:mga09592_11588_c1 | 3300050508 | Bacteria | 7170 |
| 776 | nmdc:mga09592_423693_c1 | 3300050508 | Bacteria | 1149 |
| 777 | nmdc:mga09592_544001_c1 | 3300050508 | Bacteria | 998 |
| 778 | nmdc:mga0qj67_2908_c1 | 3300050509 | Bacteria | 12286 |
| 779 | nmdc:mga0qj67_31916_c1 | 3300050509 | Bacteria | 4106 |
| 780 | nmdc:mga0qj67_36005_c1 | 3300050509 | Unclassified | 3871 |
| 781 | nmdc:mga0qj67_402463_c1 | 3300050509 | Bacteria | 1105 |
| 782 | nmdc:mga08y16_117117_c1 | 3300050511 | Bacteria | 2773 |
| 783 | nmdc:mga08y16_157962_c1 | 3300050511 | Bacteria | 2356 |
| 784 | nmdc:mga08y16_26617_c1 | 3300050511 | Bacteria | 6096 |
| 785 | nmdc:mga08y16_51699_c1 | 3300050511 | Bacteria | 4300 |
| 786 | nmdc:mga0n895_280334_c1 | 3300050512 | Bacteria | 1690 |
| 787 | nmdc:mga0n895_55132_c1 | 3300050512 | Bacteria | 3912 |
| 788 | nmdc:mga08x19_10398_c1 | 3300050514 | Bacteria | 5586 |
| 789 | nmdc:mga08x19_154673_c1 | 3300050514 | Bacteria | 1555 |
| 790 | nmdc:mga08x19_56714_c1 | 3300050514 | Bacteria | 2529 |
| 791 | nmdc:mga08x19_80855_c2 | 3300050514 | Bacteria | 1837 |
| 792 | nmdc:mga0a205_210043_c1 | 3300050515 | Bacteria | 1835 |
| 793 | nmdc:mga0sz30_2289_c2 | 3300050516 | Bacteria | 6012 |
| 794 | Ga0495612_0033732 | 3300053078 | Bacteria | 2072 |
| 795 | Ga0495619_0109309 | 3300053085 | Bacteria | 1888 |
| 796 | Ga0495619_0162018 | 3300053085 | Bacteria | 1545 |
| 797 | Ga0500578_0023006 | 3300053086 | Bacteria | 4003 |
| 798 | Ga0500643_029683 | 3300053087 | Bacteria | 1680 |
| 799 | Ga0500646_0008307 | 3300053090 | Bacteria | 2655 |
| 800 | Ga0500646_0053111 | 3300053090 | Bacteria | 1174 |
| 801 | Ga0500557_001477 | 3300053105 | Bacteria | 3855 |
| 802 | Ga0500594_0032741 | 3300053118 | Bacteria | 1378 |
| 803 | Ga0500618_002182 | 3300053125 | Bacteria | 7669 |
| 804 | Ga0500658_0103965 | 3300053134 | Bacteria | 1243 |
| 805 | Ga0500568_0001168 | 3300053139 | Bacteria | 17548 |
| 806 | Ga0500568_0050160 | 3300053139 | Bacteria | 1646 |
| 807 | Ga0500577_0035447 | 3300053142 | Bacteria | 1780 |
| 808 | Ga0500577_0045624 | 3300053142 | Bacteria | 1621 |
| 809 | Ga0500586_011930 | 3300053145 | Bacteria | 2509 |
| 810 | Ga0500588_0016291 | 3300053146 | Bacteria | 1921 |
| 811 | Ga0500616_0001225 | 3300053153 | Bacteria | 25824 |
| 812 | Ga0500616_0075231 | 3300053153 | Bacteria | 1710 |
| 813 | Ga0500627_0009818 | 3300053158 | Bacteria | 3465 |
| 814 | Ga0500645_050348 | 3300053730 | Bacteria | 1216 |
| 815 | Ga0501084_0027700 | 3300054114 | Bacteria | 4735 |
| 816 | Ga0501084_0120938 | 3300054114 | Bacteria | 2202 |
| 817 | Ga0501082_0018354 | 3300060353 | Bacteria | 6024 |
| 818 | Ga0530510_0011074 | 3300061734 | Bacteria | 6326 |
| 819 | 2511186229 | 2510917028 | Bacteria | 6185411 |
| 820 | 2513714824 | 2513237104 | Bacteria | 10034502 |
| 821 | 2514416724 | 2513237305 | Bacteria | 7293571 |
| 822 | 2585278184 | 2582581308 | Bacteria | 7413247 |
| 823 | 2585332823 | 2582581316 | Bacteria | 7774528 |
| 824 | 2585532156 | 2585427527 | Bacteria | 7273426 |
| 825 | 2585552516 | 2585427530 | Bacteria | 7383882 |
| 826 | 2585824802 | 2585427590 | Bacteria | 6824633 |
| 827 | 2586001525 | 2585427634 | Bacteria | 6455027 |
| 828 | 2616307702 | 2615840626 | Bacteria | 7921970 |
| 829 | 2616552130 | 2615840698 | Bacteria | 7319877 |
| 830 | 2617382764 | 2617270742 | Bacteria | 6808054 |
| 831 | 2643774890 | 2643221551 | Bacteria | 3750538 |
| 832 | 2643793334 | 2643221555 | Bacteria | 3749717 |
| 833 | 2644158897 | 2643221628 | Bacteria | 5745828 |
| 834 | 2644398227 | 2643221672 | Bacteria | 6322190 |
| 835 | 2671114145 | 2667528174 | Bacteria | 6435400 |
| 836 | 2723577587 | 2721755686 | Bacteria | 7343952 |
| 837 | 2738881197 | 2738541307 | Bacteria | 8606193 |
| 838 | 2739250374 | 2738543013 | Bacteria | 5618633 |
| 839 | 2739612038 | 2739367655 | Bacteria | 4051151 |
| 840 | 2778178407 | 2775507266 | Bacteria | 7392367 |
| 841 | 2792833842 | 2791355137 | Bacteria | 9654227 |
| 842 | 2793336138 | 2791355262 | Bacteria | 6774204 |
| 843 | 2819640401 | 2818991453 | Bacteria | 7181617 |
| 844 | 2821445013 | 2821443989 | Bacteria | 7658172 |
| 845 | 2838032679 | 2838029111 | Bacteria | 6603031 |
| 846 | 2838665293 | 2838661181 | Bacteria | 7385261 |
| 847 | 2842193718 | 2842192696 | Bacteria | 6147454 |
| 848 | 2842479411 | 2842475841 | Bacteria | 6603183 |
| 849 | 2842487042 | 2842482326 | Bacteria | 7212537 |
| 850 | 2842506430 | 2842502639 | Bacteria | 6604161 |
| 851 | 2844535288 | 2844533157 | Bacteria | 7517899 |
| 852 | 2847675414 | 2847670302 | Bacteria | 6165597 |
| 853 | 2856320335 | 2856314179 | Bacteria | 6477897 |
| 854 | 2856350526 | 2856349417 | Bacteria | 6230045 |
| 855 | 2857544787 | 2857542790 | Bacteria | 5326616 |
| 856 | 2874169212 | 2874168670 | Bacteria | 8062617 |
| 857 | 2878042645 | 2878035449 | Bacteria | 6555736 |
| 858 | 2881161485 | 2881155292 | Bacteria | 6461656 |
| 859 | 2881164151 | 2881161766 | Bacteria | 7127907 |
| 860 | 2885344496 | 2885342637 | Bacteria | 7011821 |
| 861 | 2885351166 | 2885350715 | Bacteria | 6787678 |
| 862 | 2906420885 | 2906414383 | Bacteria | 6580790 |
| 863 | 2919412531 | 2919408235 | Bacteria | 6149349 |
| 864 | 2928115253 | 2928108538 | Bacteria | 7360024 |
| 865 | 2928120550 | 2928115317 | Bacteria | 6477646 |
| 866 | 2945984983 | 2945984333 | Bacteria | 7358892 |
| 867 | 2961135989 | 2961127735 | Bacteria | 7196641 |
| 868 | 2968130750 | 2968128360 | Bacteria | 6270294 |
| 869 | 2990711057 | 2990710928 | Bacteria | 5002431 |
| 870 | 3004335576 | 3004334049 | Bacteria | 8449246 |
| 871 | 3005417273 | 3005416602 | Bacteria | 7064308 |
| 872 | 8005320479 | 8005314921 | Bacteria | 7072929 |
| 873 | 8005487450 | 8005484373 | Bacteria | 6297373 |
| 874 | 8005647854 | 8005645114 | Bacteria | 6950293 |
| 875 | 8005684307 | 8005682033 | Bacteria | 6726518 |
| 876 | 8024489427 | 8024486573 | Bacteria | 6540512 |
| 877 | 8055226854 | 8055225921 | Bacteria | 3341787 |
| 878 | Ga0111539_10020809 | |||
| 879 | JGI24740J21852_10005269 | |||
| 880 | JGI24740J21852_10005831 | |||
| 881 | JGI25406J46586_10013352 | |||
| 882 | JGI25165J46597_1000068 | |||
| 883 | JGI25165J46597_1011288 | |||
| 884 | rootL2_10015947 | |||
| 885 | rootL2_10039598 | |||
| 886 | rootH1_10050301 | |||
| 887 | Ga0055534_1000177 | |||
| 888 | Ga0065165_1030548 | |||
| 889 | Ga0065715_10224002 | |||
| 890 | Ga0070658_10003204 | |||
| 891 | Ga0070676_10002219 | |||
| 892 | Ga0070676_10010326 | |||
| 893 | Ga0070676_10081565 | |||
| 894 | Ga0070676_10158689 | |||
| 895 | Ga0070676_10402453 | |||
| 896 | Ga0070690_100089753 | |||
| 897 | Ga0070690_100345048 | |||
| 898 | Ga0070670_100005632 | |||
| 899 | Ga0070670_100018764 | |||
| 900 | Ga0070670_100082894 | |||
| 901 | Ga0070670_100092231 | |||
| 902 | Ga0070670_100121827 | |||
| 903 | Ga0070670_100307995 | |||
| 904 | Ga0068869_100000049 | |||
| 905 | Ga0068869_100066950 | |||
| 906 | Ga0068869_100094043 | |||
| 907 | Ga0068869_100270917 | |||
| 908 | Ga0070666_10001467 | |||
| 909 | Ga0070666_10053367 | |||
| 910 | Ga0070680_100082820 | |||
| 911 | Ga0070680_100203286 | |||
| 912 | Ga0070680_100240963 | |||
| 913 | Ga0070680_100353786 | |||
| 914 | Ga0070682_100151200 | |||
| 915 | Ga0068868_100011885 | |||
| 916 | Ga0068868_100394359 | |||
| 917 | Ga0070689_100000283 | |||
| 918 | Ga0070689_100358808 | |||
| 919 | Ga0070691_10004163 | |||
| 920 | Ga0070661_100001480 | |||
| 921 | Ga0070661_100109787 | |||
| 922 | Ga0070661_100143642 | |||
| 923 | Ga0070692_10014210 | |||
| 924 | Ga0070692_10126836 | |||
| 925 | Ga0070692_10146202 | |||
| 926 | Ga0070668_100000226 | |||
| 927 | Ga0070668_100001385 | |||
| 928 | Ga0070668_100011277 | |||
| 929 | Ga0070668_100014493 | |||
| 930 | Ga0070668_100023107 | |||
| 931 | Ga0070669_100000543 | |||
| 932 | Ga0070669_100002751 | |||
| 933 | Ga0070669_100032928 | |||
| 934 | Ga0070669_100035642 | |||
| 935 | Ga0070669_100041271 | |||
| 936 | Ga0070669_100266065 | |||
| 937 | Ga0070675_100031607 | |||
| 938 | Ga0070675_100057127 | |||
| 939 | Ga0070675_100643024 | |||
| 940 | Ga0070671_100163421 | |||
| 941 | Ga0070671_100216508 | |||
| 942 | Ga0070674_100030681 | |||
| 943 | Ga0070674_100211396 | |||
| 944 | Ga0070673_100002455 | |||
| 945 | Ga0070673_100057674 | |||
| 946 | Ga0070673_100091109 | |||
| 947 | Ga0070673_100141753 | |||
| 948 | Ga0070673_100193792 | |||
| 949 | Ga0070673_100387060 | |||
| 950 | Ga0070688_100064275 | |||
| 951 | Ga0070688_100372035 | |||
| 952 | Ga0070659_100000895 | |||
| 953 | Ga0070659_100090431 | |||
| 954 | Ga0070659_100440690 | |||
| 955 | Ga0070667_100002122 | |||
| 956 | Ga0070667_100026787 | |||
| 957 | Ga0070667_100067245 | |||
| 958 | Ga0070667_100387842 | |||
| 959 | Ga0070703_10086260 | |||
| 960 | Ga0070714_100026265 | |||
| 961 | Ga0070714_100162985 | |||
| 962 | Ga0070710_10038552 | |||
| 963 | Ga0070701_10000223 | |||
| 964 | Ga0070701_10008350 | |||
| 965 | Ga0070711_100266496 | |||
| 966 | Ga0070705_100006703 | |||
| 967 | Ga0070705_100009255 | |||
| 968 | Ga0070705_100011771 | |||
| 969 | Ga0070700_100000271 | |||
| 970 | Ga0070700_100001230 | |||
| 971 | Ga0070700_100005910 | |||
| 972 | Ga0070700_100038712 | |||
| 973 | Ga0070700_100198310 | |||
| 974 | Ga0070694_100043047 | |||
| 975 | Ga0070694_100078796 | |||
| 976 | Ga0070708_100218937 | |||
| 977 | Ga0070708_100458333 | |||
| 978 | Ga0070663_100399210 | |||
| 979 | Ga0070678_100001554 | |||
| 980 | Ga0070678_100119340 | |||
| 981 | Ga0070678_100231583 | |||
| 982 | Ga0070678_100584107 | |||
| 983 | Ga0070662_100095584 | |||
| 984 | Ga0070662_100170916 | |||
| 985 | Ga0070662_100400306 | |||
| 986 | Ga0070681_10004036 | |||
| 987 | Ga0070681_10008003 | |||
| 988 | Ga0070681_10048165 | |||
| 989 | Ga0070681_10059949 | |||
| 990 | Ga0070681_10527605 | |||
| 991 | Ga0068867_100000383 | |||
| 992 | Ga0068867_100000440 | |||
| 993 | Ga0068867_100000940 | |||
| 994 | Ga0068867_100039903 | |||
| 995 | Ga0070706_100000388 | |||
| 996 | Ga0070706_100038959 | |||
| 997 | Ga0070707_100261619 | |||
| 998 | Ga0070707_100405395 | |||
| 999 | Ga0070698_100022115 | |||
| 1000 | Ga0070699_100019712 | |||
| 1001 | Ga0070699_100075190 | |||
| 1002 | Ga0070699_100164444 | |||
| 1003 | Ga0070679_100013061 | |||
| 1004 | Ga0070679_100071250 | |||
| 1005 | Ga0070679_100082398 | |||
| 1006 | Ga0070679_100156099 | |||
| 1007 | Ga0070679_100223255 | |||
| 1008 | Ga0070679_100262536 | |||
| 1009 | Ga0070697_100040276 | |||
| 1010 | Ga0068853_100188929 | |||
| 1011 | Ga0068853_100284509 | |||
| 1012 | Ga0070672_100000897 | |||
| 1013 | Ga0070672_100002207 | |||
| 1014 | Ga0070672_100126770 | |||
| 1015 | Ga0070686_100000581 | |||
| 1016 | Ga0070686_100184571 | |||
| 1017 | Ga0070686_100530707 | |||
| 1018 | Ga0070695_100004254 | |||
| 1019 | Ga0070695_100024821 | |||
| 1020 | Ga0070696_100001088 | |||
| 1021 | Ga0070696_100003606 | |||
| 1022 | Ga0070696_100009006 | |||
| 1023 | Ga0070696_100043913 | |||
| 1024 | Ga0070693_100007485 | |||
| 1025 | Ga0070693_100315784 | |||
| 1026 | Ga0070665_100020647 | |||
| 1027 | Ga0070665_100157856 | |||
| 1028 | Ga0070665_100177456 | |||
| 1029 | Ga0070665_100258522 | |||
| 1030 | Ga0070665_100422778 | |||
| 1031 | Ga0070665_100782006 | |||
| 1032 | Ga0068855_100005816 | |||
| 1033 | Ga0068855_100039981 | |||
| 1034 | Ga0068855_100049904 | |||
| 1035 | Ga0068855_100054231 | |||
| 1036 | Ga0068855_100066708 | |||
| 1037 | Ga0068855_100103418 | |||
| 1038 | Ga0068855_100127783 | |||
| 1039 | Ga0070664_100013435 | |||
| 1040 | Ga0070664_100239092 | |||
| 1041 | Ga0070664_100248484 | |||
| 1042 | Ga0070664_100282143 | |||
| 1043 | Ga0068857_100454495 | |||
| 1044 | Ga0068854_100052329 | |||
| 1045 | Ga0068856_100006621 | |||
| 1046 | Ga0068856_100555603 | |||
| 1047 | Ga0070702_100000059 | |||
| 1048 | Ga0070702_100012851 | |||
| 1049 | Ga0070702_100231507 | |||
| 1050 | Ga0068859_100023691 | |||
| 1051 | Ga0068859_100026861 | |||
| 1052 | Ga0068859_100129313 | |||
| 1053 | Ga0068864_100005549 | |||
| 1054 | Ga0068864_100020992 | |||
| 1055 | Ga0068864_100021620 | |||
| 1056 | Ga0068864_100044386 | |||
| 1057 | Ga0068866_10000232 | |||
| 1058 | Ga0068866_10078798 | |||
| 1059 | Ga0068861_100002136 | |||
| 1060 | Ga0068861_100004208 | |||
| 1061 | Ga0068861_100029721 | |||
| 1062 | Ga0068861_100087263 | |||
| 1063 | Ga0068861_100150451 | |||
| 1064 | Ga0068851_10306564 | |||
| 1065 | Ga0068870_10073995 | |||
| 1066 | Ga0068863_100001022 | |||
| 1067 | Ga0068863_100077428 | |||
| 1068 | Ga0068863_100166970 | |||
| 1069 | Ga0068863_100168920 | |||
| 1070 | Ga0068858_100007122 | |||
| 1071 | Ga0068858_100015159 | |||
| 1072 | Ga0068860_100006231 | |||
| 1073 | Ga0068860_100035098 | |||
| 1074 | Ga0068860_100226783 | |||
| 1075 | Ga0068860_100240206 | |||
| 1076 | Ga0068860_100396307 | |||
| 1077 | Ga0068860_100866183 | |||
| 1078 | Ga0068862_100003925 | |||
| 1079 | Ga0068862_100012684 | |||
| 1080 | Ga0068862_100018071 | |||
| 1081 | Ga0068862_100035015 | |||
| 1082 | Ga0068862_100087008 | |||
| 1083 | Ga0068862_100087533 | |||
| 1084 | Ga0068862_100114202 | |||
| 1085 | Ga0068862_100202387 | |||
| 1086 | Ga0068862_100721881 | |||
| 1087 | Ga0081539_10001081 | |||
| 1088 | Ga0081539_10014568 | |||
| 1089 | Ga0075365_10000044 | |||
| 1090 | Ga0075365_10001373 | |||
| 1091 | Ga0075365_10009380 | |||
| 1092 | Ga0075365_10053815 | |||
| 1093 | Ga0075363_100000225 | |||
| 1094 | Ga0075363_100008829 | |||
| 1095 | Ga0075364_10000030 | |||
| 1096 | Ga0075364_10001387 | |||
| 1097 | Ga0075364_10027961 | |||
| 1098 | Ga0075364_10043122 | |||
| 1099 | Ga0075432_10000438 | |||
| 1100 | Ga0070716_100027556 | |||
| 1101 | Ga0070716_100083089 | |||
| 1102 | Ga0075362_10003052 | |||
| 1103 | Ga0075362_10023797 | |||
| 1104 | Ga0075367_10101649 | |||
| 1105 | Ga0075369_10003991 | |||
| 1106 | Ga0075366_10001170 | |||
| 1107 | Ga0075366_10001262 | |||
| 1108 | Ga0075366_10043493 | |||
| 1109 | Ga0075366_10062126 | |||
| 1110 | Ga0097621_100003187 | |||
| 1111 | Ga0097621_100005133 | |||
| 1112 | Ga0097621_100011121 | |||
| 1113 | Ga0097621_100632969 | |||
| 1114 | Ga0075370_10001855 | |||
| 1115 | Ga0075370_10010463 | |||
| 1116 | Ga0068871_100023423 | |||
| 1117 | Ga0068871_100027151 | |||
| 1118 | Ga0068871_100045394 | |||
| 1119 | Ga0068871_100136632 | |||
| 1120 | Ga0068871_100142924 | |||
| 1121 | Ga0068871_100726686 | |||
| 1122 | Ga0075430_100011630 | |||
| 1123 | Ga0075430_100024514 | |||
| 1124 | Ga0075430_100040080 | |||
| 1125 | Ga0075430_100107319 | |||
| 1126 | Ga0075431_100091284 | |||
| 1127 | Ga0075431_100247441 | |||
| 1128 | Ga0075431_100585072 | |||
| 1129 | Ga0075434_100097812 | |||
| 1130 | Ga0075434_100124510 | |||
| 1131 | Ga0075434_100326508 | |||
| 1132 | Ga0075429_100234560 | |||
| 1133 | Ga0068865_100000084 | |||
| 1134 | Ga0068865_100006386 | |||
| 1135 | Ga0068865_100089387 | |||
| 1136 | Ga0068865_100345336 | |||
| 1137 | Ga0075436_100001365 | |||
| 1138 | Ga0075436_100064662 | |||
| 1139 | Ga0075436_100089871 | |||
| 1140 | Ga0075436_100130939 | |||
| 1141 | Ga0097620_100023692 | |||
| 1142 | Ga0097620_100026861 | |||
| 1143 | Ga0097620_100129323 | |||
| 1144 | Ga0075435_100229763 | |||
| 1145 | Ga0099794_10235087 | |||
| 1146 | Ga0105240_10000012 | |||
| 1147 | Ga0105240_10082812 | |||
| 1148 | Ga0105240_10162189 | |||
| 1149 | Ga0105240_10169635 | |||
| 1150 | Ga0105240_10358712 | |||
| 1151 | Ga0111539_10037704 | |||
| 1152 | Ga0111539_10081231 | |||
| 1153 | Ga0111539_10385789 | |||
| 1154 | Ga0111539_10645884 | |||
| 1155 | Ga0105245_10000063 | |||
| 1156 | Ga0105245_10102415 | |||
| 1157 | Ga0105245_10402603 | |||
| 1158 | Ga0105245_10566299 | |||
| 1159 | Ga0114129_10303814 | |||
| 1160 | Ga0114129_11123664 | |||
| 1161 | Ga0105243_10001481 | |||
| 1162 | Ga0105243_10007236 | |||
| 1163 | Ga0105243_10019086 | |||
| 1164 | Ga0105243_10108380 | |||
| 1165 | Ga0105243_10117886 | |||
| 1166 | Ga0105243_10169110 | |||
| 1167 | Ga0105241_10006214 | |||
| 1168 | Ga0105241_10063033 | |||
| 1169 | Ga0105242_10007900 | |||
| 1170 | Ga0105242_10100322 | |||
| 1171 | Ga0105248_10002136 | |||
| 1172 | Ga0105248_10054710 | |||
| 1173 | Ga0105248_10061417 | |||
| 1174 | Ga0105248_10071115 | |||
| 1175 | Ga0105248_10398915 | |||
| 1176 | Ga0105248_10706631 | |||
| 1177 | Ga0105248_10781819 | |||
| 1178 | Ga0105248_10822203 | |||
| 1179 | Ga0105237_10000054 | |||
| 1180 | Ga0105238_10198068 | |||
| 1181 | Ga0105249_10031989 | |||
| 1182 | Ga0105249_10164718 | |||
| 1183 | Ga0105249_10306717 | |||
| 1184 | Ga0105239_10005299 | |||
| 1185 | Ga0105239_10038319 | |||
| 1186 | Ga0105239_10246699 | |||
| 1187 | Ga0157373_10139221 | |||
| 1188 | Ga0157370_10000078 | |||
| 1189 | Ga0157370_10004743 | |||
| 1190 | Ga0157370_10010762 | |||
| 1191 | Ga0157370_10047660 | |||
| 1192 | Ga0157370_10104286 | |||
| 1193 | Ga0157369_10128403 | |||
| 1194 | Ga0157369_10187068 | |||
| 1195 | Ga0157374_10005976 | |||
| 1196 | Ga0157374_10260236 | |||
| 1197 | Ga0157378_10000193 | |||
| 1198 | Ga0157378_10137833 | |||
| 1199 | Ga0157378_10184148 | |||
| 1200 | Ga0157378_10321925 | |||
| 1201 | Ga0157378_10720283 | |||
| 1202 | Ga0163162_10005118 | |||
| 1203 | Ga0163162_10034161 | |||
| 1204 | Ga0163162_10448769 | |||
| 1205 | Ga0157372_10044028 | |||
| 1206 | Ga0157372_10213637 | |||
| 1207 | Ga0157372_10360804 | |||
| 1208 | Ga0157375_10027399 | |||
| 1209 | Ga0157375_10027429 | |||
| 1210 | Ga0157375_10064697 | |||
| 1211 | Ga0157375_10105744 | |||
| 1212 | Ga0157375_10161039 | |||
| 1213 | Ga0157375_10355521 | |||
| 1214 | Ga0163163_10104989 | |||
| 1215 | Ga0163163_10391719 | |||
| 1216 | Ga0157380_10013593 | |||
| 1217 | Ga0157380_10016886 | |||
| 1218 | Ga0157380_10040170 | |||
| 1219 | Ga0157380_10072327 | |||
| 1220 | Ga0157380_10255379 | |||
| 1221 | Ga0157380_10273970 | |||
| 1222 | Ga0182008_10051731 | |||
| 1223 | Ga0157377_10112187 | |||
| 1224 | Ga0157377_10129354 | |||
| 1225 | Ga0157379_10002399 | |||
| 1226 | Ga0157379_10021865 | |||
| 1227 | Ga0157379_10048948 | |||
| 1228 | Ga0157379_10420799 | |||
| 1229 | Ga0157376_10057962 | |||
| 1230 | Ga0157376_10140221 | |||
| 1231 | Ga0157376_10236448 | |||
| 1232 | Ga0182007_10001905 | |||
| 1233 | Ga0182005_1013863 | |||
| 1234 | Ga0163161_10004280 | |||
| 1235 | Ga0163161_10008347 | |||
| 1236 | Ga0163161_10027453 | |||
| 1237 | Ga0163161_10232613 | |||
| 1238 | Ga0209437_100067 | |||
| 1239 | Ga0209437_106902 | |||
| 1240 | Ga0209677_101204 | |||
| 1241 | Ga0209233_1000088 | |||
| 1242 | Ga0209233_1000201 | |||
| 1243 | Ga0209565_1024389 | |||
| 1244 | Ga0209673_1035979 | |||
| 1245 | Ga0209130_1003030 | |||
| 1246 | Ga0209675_1000270 | |||
| 1247 | Ga0209676_1003129 | |||
| 1248 | Ga0209051_1000527 | |||
| 1249 | Ga0209051_1009227 | |||
| 1250 | Ga0209257_1045534 | |||
| 1251 | Ga0207697_10056146 | |||
| 1252 | Ga0207656_10177181 | |||
| 1253 | Ga0207642_10008787 | |||
| 1254 | Ga0207642_10061255 | |||
| 1255 | Ga0207680_10006771 | |||
| 1256 | Ga0207680_10142744 | |||
| 1257 | Ga0207699_10036370 | |||
| 1258 | Ga0207645_10000419 | |||
| 1259 | Ga0207645_10013325 | |||
| 1260 | Ga0207645_10088312 | |||
| 1261 | Ga0207643_10011586 | |||
| 1262 | Ga0207643_10034932 | |||
| 1263 | Ga0207643_10080513 | |||
| 1264 | Ga0207643_10104341 | |||
| 1265 | Ga0207705_10007282 | |||
| 1266 | Ga0207684_10001941 | |||
| 1267 | Ga0207684_10405373 | |||
| 1268 | Ga0207654_10054383 | |||
| 1269 | Ga0207654_10316949 | |||
| 1270 | Ga0207707_10005043 | |||
| 1271 | Ga0207707_10072282 | |||
| 1272 | Ga0207707_10093831 | |||
| 1273 | Ga0207707_10504699 | |||
| 1274 | Ga0207707_10541166 | |||
| 1275 | Ga0207695_10000097 | |||
| 1276 | Ga0207695_10033918 | |||
| 1277 | Ga0207695_10095673 | |||
| 1278 | Ga0207695_10166123 | |||
| 1279 | Ga0207695_10408604 | |||
| 1280 | Ga0207671_10000023 | |||
| 1281 | Ga0207693_10088089 | |||
| 1282 | Ga0207660_10003132 | |||
| 1283 | Ga0207660_10211337 | |||
| 1284 | Ga0207660_10271291 | |||
| 1285 | Ga0207657_10103123 | |||
| 1286 | Ga0207649_10113249 | |||
| 1287 | Ga0207649_10236926 | |||
| 1288 | Ga0207649_10295495 | |||
| 1289 | Ga0207652_10234758 | |||
| 1290 | Ga0207652_10260600 | |||
| 1291 | Ga0207652_10316788 | |||
| 1292 | Ga0207646_10213889 | |||
| 1293 | Ga0207646_10527731 | |||
| 1294 | Ga0207681_10004085 | |||
| 1295 | Ga0207681_10005388 | |||
| 1296 | Ga0207681_10040251 | |||
| 1297 | Ga0207681_10500117 | |||
| 1298 | Ga0207681_10558799 | |||
| 1299 | Ga0207650_10001061 | |||
| 1300 | Ga0207650_10004208 | |||
| 1301 | Ga0207650_10022657 | |||
| 1302 | Ga0207650_10092574 | |||
| 1303 | Ga0207659_10003137 | |||
| 1304 | Ga0207659_10039987 | |||
| 1305 | Ga0207659_10075971 | |||
| 1306 | Ga0207659_10625778 | |||
| 1307 | Ga0207687_10007353 | |||
| 1308 | Ga0207687_10345256 | |||
| 1309 | Ga0207664_10038452 | |||
| 1310 | Ga0207664_10123884 | |||
| 1311 | Ga0207664_10320867 | |||
| 1312 | Ga0207664_10489953 | |||
| 1313 | Ga0207644_10065847 | |||
| 1314 | Ga0207644_10122380 | |||
| 1315 | Ga0207644_10182854 | |||
| 1316 | Ga0207690_10020905 | |||
| 1317 | Ga0207690_10043181 | |||
| 1318 | Ga0207690_10100786 | |||
| 1319 | Ga0207706_10069436 | |||
| 1320 | Ga0207706_10469832 | |||
| 1321 | Ga0207706_10472173 | |||
| 1322 | Ga0207686_10000467 | |||
| 1323 | Ga0207686_10191294 | |||
| 1324 | Ga0207709_10001392 | |||
| 1325 | Ga0207709_10002974 | |||
| 1326 | Ga0207709_10148972 | |||
| 1327 | Ga0207670_10015389 | |||
| 1328 | Ga0207670_10243410 | |||
| 1329 | Ga0207670_10503315 | |||
| 1330 | Ga0207669_10040343 | |||
| 1331 | Ga0207669_10061520 | |||
| 1332 | Ga0207704_10006116 | |||
| 1333 | Ga0207704_10071139 | |||
| 1334 | Ga0207704_10113388 | |||
| 1335 | Ga0207665_10161555 | |||
| 1336 | Ga0207691_10000232 | |||
| 1337 | Ga0207691_10001955 | |||
| 1338 | Ga0207691_10180415 | |||
| 1339 | Ga0207691_10259148 | |||
| 1340 | Ga0207691_10440072 | |||
| 1341 | Ga0207691_10629186 | |||
| 1342 | Ga0207711_10059056 | |||
| 1343 | Ga0207711_10203130 | |||
| 1344 | Ga0207689_10000152 | |||
| 1345 | Ga0207689_10009430 | |||
| 1346 | Ga0207689_10014808 | |||
| 1347 | Ga0207689_10348608 | |||
| 1348 | Ga0207661_10469560 | |||
| 1349 | Ga0207679_10000864 | |||
| 1350 | Ga0207679_10184221 | |||
| 1351 | Ga0207667_10002896 | |||
| 1352 | Ga0207667_10067668 | |||
| 1353 | Ga0207667_10079594 | |||
| 1354 | Ga0207667_10107074 | |||
| 1355 | Ga0207667_10111695 | |||
| 1356 | Ga0207667_10224381 | |||
| 1357 | Ga0207651_10006677 | |||
| 1358 | Ga0207651_10045487 | |||
| 1359 | Ga0207651_10126966 | |||
| 1360 | Ga0207651_10431951 | |||
| 1361 | Ga0207712_10353086 | |||
| 1362 | Ga0207668_10006939 | |||
| 1363 | Ga0207668_10040588 | |||
| 1364 | Ga0207668_10063542 | |||
| 1365 | Ga0207640_10035725 | |||
| 1366 | Ga0207658_10014076 | |||
| 1367 | Ga0207658_10062154 | |||
| 1368 | Ga0207658_10214709 | |||
| 1369 | Ga0207658_10240415 | |||
| 1370 | Ga0207677_10011683 | |||
| 1371 | Ga0207677_10047853 | |||
| 1372 | Ga0207677_10443458 | |||
| 1373 | Ga0207703_10013897 | |||
| 1374 | Ga0207703_10034171 | |||
| 1375 | Ga0207703_10036717 | |||
| 1376 | Ga0207703_10777389 | |||
| 1377 | Ga0207639_10004783 | |||
| 1378 | Ga0207639_10249494 | |||
| 1379 | Ga0207708_10000166 | |||
| 1380 | Ga0207708_10000755 | |||
| 1381 | Ga0207708_10016758 | |||
| 1382 | Ga0207708_10030173 | |||
| 1383 | Ga0207708_10058767 | |||
| 1384 | Ga0207702_10011398 | |||
| 1385 | Ga0207702_10012230 | |||
| 1386 | Ga0207641_10004693 | |||
| 1387 | Ga0207641_10004813 | |||
| 1388 | Ga0207641_10061616 | |||
| 1389 | Ga0207641_10135824 | |||
| 1390 | Ga0207641_10144415 | |||
| 1391 | Ga0207641_10865054 | |||
| 1392 | Ga0207648_10000131 | |||
| 1393 | Ga0207648_10000276 | |||
| 1394 | Ga0207648_10013865 | |||
| 1395 | Ga0207648_10015834 | |||
| 1396 | Ga0207648_10115732 | |||
| 1397 | Ga0207648_10690287 | |||
| 1398 | Ga0207676_10001858 | |||
| 1399 | Ga0207676_10024861 | |||
| 1400 | Ga0207674_10348387 | |||
| 1401 | Ga0207675_100000084 | |||
| 1402 | Ga0207675_100003258 | |||
| 1403 | Ga0207675_100015099 | |||
| 1404 | Ga0207675_100038831 | |||
| 1405 | Ga0207675_100083888 | |||
| 1406 | Ga0207675_100242671 | |||
| 1407 | Ga0207675_100375045 | |||
| 1408 | Ga0207675_100547012 | |||
| 1409 | Ga0207683_10000063 | |||
| 1410 | Ga0207683_10006739 | |||
| 1411 | Ga0207683_10131027 | |||
| 1412 | Ga0207683_10318484 | |||
| 1413 | Ga0209970_1013019 | |||
| 1414 | Ga0209971_1005150 | |||
| 1415 | Ga0207428_10012294 | |||
| 1416 | Ga0207428_10013964 | |||
| 1417 | Ga0268266_10007407 | |||
| 1418 | Ga0268266_10023985 | |||
| 1419 | Ga0268266_10110138 | |||
| 1420 | Ga0268266_10118963 | |||
| 1421 | Ga0268266_10331348 | |||
| 1422 | Ga0268265_10002208 | |||
| 1423 | Ga0268265_10005049 | |||
| 1424 | Ga0268265_10006155 | |||
| 1425 | Ga0268265_10014989 | |||
| 1426 | Ga0268265_10032764 | |||
| 1427 | Ga0268265_10065226 | |||
| 1428 | Ga0268265_10071644 | |||
| 1429 | Ga0268265_10762499 | |||
| 1430 | Ga0268264_10195394 | |||
| 1431 | Ga0268264_10458429 | |||
| 1432 | Ga0268264_10705114 | |||
| 1433 | Ga0307515_10115476 | |||
| 1434 | Ga0265330_10016532 | |||
| 1435 | Ga0265332_10000255 | |||
| 1436 | Ga0265325_10017682 | |||
| 1437 | Ga0265329_10001448 | |||
| 1438 | Ga0265331_10000354 | |||
| 1439 | Ga0265327_10024791 | |||
| 1440 | Ga0265327_10025730 | |||
| 1441 | Ga0265327_10082915 | |||
| 1442 | Ga0265316_10142525 | |||
| 1443 | Ga0307513_10003370 | |||
| 1444 | Ga0307408_100070860 | |||
| 1445 | Ga0307408_100092027 | |||
| 1446 | Ga0265314_10017506 | |||
| 1447 | Ga0265342_10082481 | |||
| 1448 | Ga0307516_10009467 | |||
| 1449 | Ga0307413_10398397 | |||
| 1450 | Ga0307410_10001761 | |||
| 1451 | Ga0307410_10010439 | |||
| 1452 | Ga0307410_10261353 | |||
| 1453 | Ga0307407_10013882 | |||
| 1454 | Ga0307407_10035671 | |||
| 1455 | Ga0307407_10133638 | |||
| 1456 | Ga0307407_10234362 | |||
| 1457 | Ga0307412_10006840 | |||
| 1458 | Ga0307409_100016403 | |||
| 1459 | Ga0307409_100087558 | |||
| 1460 | Ga0307409_100220746 | |||
| 1461 | Ga0307416_100000857 | |||
| 1462 | Ga0307416_100021173 | |||
| 1463 | Ga0307411_10099517 | |||
| 1464 | Ga0307411_10101796 | |||
| 1465 | Ga0307411_10233949 | |||
| 1466 | Ga0307415_100014519 | |||
| 1467 | Ga0307415_100032845 | |||
| 1468 | Ga0307510_10356930 | |||
| 1469 | Ga0373932_0048648 | |||
| 1470 | Ga0373939_0013050 | |||
| 1471 | Ga0373953_0045622 | |||
| 1472 | Ga0373956_0056939 | |||
| 1473 | Ga0373957_0004905 | |||
| 1474 | Ga0373960_0018572 | |||
| 1475 | Ga0373943_0349020 | |||
| 1476 | Ga0373946_0050819 | |||
| 1477 | Ga0373955_0025140 | |||
| 1478 | Ga0373924_0027605 | |||
| 1479 | Ga0373931_0052195 | |||
| 1480 | Ga0373927_0007037 | |||
| 1481 | Ga0373927_0334125 | |||
| 1482 | Ga0373933_0014773 | |||
| 1483 | Ga0373947_0030159 | |||
| 1484 | Ga0373947_0086698 | |||
| 1485 | Ga0373925_0004776 | |||
| 1486 | Ga0373925_0519602 | |||
| 1487 | Ga0395900_0066669 | |||
| 1488 | Ga0395898_0026512 | |||
| 1489 | Ga0395905_0026473 | |||
| 1490 | Ga0395905_0060692 | |||
| 1491 | Ga0395905_0416090 | |||
| 1492 | Ga0395901_0000034 | |||
| 1493 | Ga0395901_0010150 | |||
| 1494 | Ga0439436_0005628 | |||
| 1495 | Ga0439465_0040481 | |||
| 1496 | Ga0439441_003123 | |||
| 1497 | Ga0439442_007562 | |||
| 1498 | Ga0439442_009716 | |||
| 1499 | Ga0439448_0000260 | |||
| 1500 | Ga0439449_0071712 | |||
| 1501 | Ga0450923_002704 | |||
| 1502 | Ga0450895_002269 | |||
| 1503 | Ga0450898_003396 | |||
| 1504 | Ga0450906_000773 | |||
| 1505 | Ga0450908_002426 | |||
| 1506 | Ga0439434_0001721 | |||
| 1507 | Ga0439460_0044802 | |||
| 1508 | Ga0450918_001559 | |||
| 1509 | Ga0451577_0351657 | |||
| 1510 | Ga0451577_0403473 | |||
| 1511 | Ga0453684_0071736 | |||
| 1512 | Ga0453684_0199301 | |||
| 1513 | Ga0495617_022696 | |||
| 1514 | Ga0495638_0000560 | |||
| 1515 | Ga0495638_0163449 | |||
| 1516 | Ga0495580_0038531 | |||
| 1517 | Ga0495605_0015309 | |||
| 1518 | Ga0495605_0035536 | |||
| 1519 | Ga0495605_0195709 | |||
| 1520 | Ga0495639_0062236 | |||
| 1521 | Ga0495585_0158817 | |||
| 1522 | Ga0495594_0157363 | |||
| 1523 | Ga0495583_0109103 | |||
| 1524 | Ga0495606_0001061 | |||
| 1525 | Ga0495616_0024877 | |||
| 1526 | Ga0495616_0154466 | |||
| 1527 | Ga0495631_0009103 | |||
| 1528 | Ga0495643_0001621 | |||
| 1529 | Ga0495648_0084460 | |||
| 1530 | Ga0495609_0055865 | |||
| 1531 | Ga0495668_0006908 | |||
| 1532 | Ga0495611_0018143 | |||
| 1533 | Ga0495625_0000056 | |||
| 1534 | Ga0495625_0018268 | |||
| 1535 | Ga0495625_0021119 | |||
| 1536 | Ga0495625_0281606 | |||
| 1537 | Ga0495647_0161484 | |||
| 1538 | Ga0495670_0271524 | |||
| 1539 | Ga0495660_0033746 | |||
| 1540 | Ga0495672_0007888 | |||
| 1541 | Ga0495672_0014508 | |||
| 1542 | Ga0495680_0055787 | |||
| 1543 | Ga0495683_0022469 | |||
| 1544 | Ga0495683_0227670 | |||
| 1545 | Ga0495687_005257 | |||
| 1546 | Ga0495687_081262 | |||
| 1547 | Ga0495673_0012730 | |||
| 1548 | Ga0495684_0304563 | |||
| 1549 | Ga0495686_0000296 | |||
| 1550 | Ga0495686_0044116 | |||
| 1551 | Ga0495686_0242280 | |||
| 1552 | Ga0495626_0068226 | |||
| 1553 | Ga0496100_0011067 | |||
| 1554 | Ga0496101_0022621 | |||
| 1555 | Ga0496102_0061043 | |||
| 1556 | Ga0496102_0760942 | |||
| 1557 | Ga0496104_0044430 | |||
| 1558 | Ga0496105_0000614 | |||
| 1559 | Ga0496107_0166414 | |||
| 1560 | Ga0496107_0266388 | |||
| 1561 | Ga0496108_0000514 | |||
| 1562 | Ga0496109_0021995 | |||
| 1563 | Ga0496110_0234462 | |||
| 1564 | Ga0496111_0012322 | |||
| 1565 | Ga0496112_0040229 | |||
| 1566 | Ga0496113_0001056 | |||
| 1567 | Ga0496114_0090067 | |||
| 1568 | Ga0496114_0466186 | |||
| 1569 | Ga0496115_0017087 | |||
| 1570 | Ga0496116_0009140 | |||
| 1571 | Ga0496117_0034905 | |||
| 1572 | Ga0496117_0173758 | |||
| 1573 | Ga0496118_0038697 | |||
| 1574 | Ga0496118_0104070 | |||
| 1575 | Ga0496119_0005487 | |||
| 1576 | Ga0496119_0046565 | |||
| 1577 | Ga0496120_0027467 | |||
| 1578 | Ga0496121_0001592 | |||
| 1579 | Ga0496121_0008906 | |||
| 1580 | Ga0496121_0110364 | |||
| 1581 | Ga0496122_0010062 | |||
| 1582 | Ga0496122_0079615 | |||
| 1583 | Ga0496123_0042179 | |||
| 1584 | Ga0496124_0000038 | |||
| 1585 | Ga0496124_0000832 | |||
| 1586 | Ga0496125_0006659 | |||
| 1587 | Ga0496126_0000271 | |||
| 1588 | Ga0495678_024566 | |||
| 1589 | Ga0501034_0002148 | |||
| 1590 | Ga0501034_0045066 | |||
| 1591 | Ga0501034_0514280 | |||
| 1592 | Ga0501034_0659027 | |||
| 1593 | Ga0501036_0018757 | |||
| 1594 | Ga0501037_0324760 | |||
| 1595 | Ga0501038_0005280 | |||
| 1596 | Ga0501039_0001702 | |||
| 1597 | Ga0501039_0086530 | |||
| 1598 | Ga0501039_0205890 | |||
| 1599 | Ga0501039_0499411 | |||
| 1600 | Ga0501040_0022891 | |||
| 1601 | Ga0501041_0067650 | |||
| 1602 | Ga0501042_0036769 | |||
| 1603 | Ga0501043_0162816 | |||
| 1604 | Ga0501043_0186423 | |||
| 1605 | Ga0501046_0089115 | |||
| 1606 | Ga0501048_0059377 | |||
| 1607 | Ga0501068_0000570 | |||
| 1608 | Ga0501069_0196979 | |||
| 1609 | Ga0501070_0025223 | |||
| 1610 | Ga0501071_0007699 | |||
| 1611 | Ga0501072_0002218 | |||
| 1612 | Ga0501072_0016870 | |||
| 1613 | Ga0501073_0001398 | |||
| 1614 | Ga0501073_0271224 | |||
| 1615 | Ga0501074_0027087 | |||
| 1616 | Ga0501075_0020157 | |||
| 1617 | Ga0501075_0095975 | |||
| 1618 | Ga0501076_0004326 | |||
| 1619 | Ga0501076_0371778 | |||
| 1620 | Ga0501077_0064148 | |||
| 1621 | Ga0501077_0072087 | |||
| 1622 | Ga0501079_0032202 | |||
| 1623 | Ga0501080_0005302 | |||
| 1624 | Ga0501080_0045443 | |||
| 1625 | Ga0501081_0029064 | |||
| 1626 | Ga0501083_0014156 | |||
| 1627 | Ga0501035_0097496 | |||
| 1628 | Ga0501044_0107500 | |||
| 1629 | Ga0501044_0166023 | |||
| 1630 | Ga0501045_0002479 | |||
| 1631 | nmdc:mga03683_131735_c1 | |||
| 1632 | nmdc:mga03683_4178_c1 | |||
| 1633 | nmdc:mga03683_73_c1 | |||
| 1634 | nmdc:mga03n38_14931_c1 | |||
| 1635 | nmdc:mga03n38_30_c1 | |||
| 1636 | nmdc:mga03n38_31794_c1 | |||
| 1637 | nmdc:mga00v17_11142_c1 | |||
| 1638 | nmdc:mga00v17_131_c1 | |||
| 1639 | nmdc:mga00v17_262749_c1 | |||
| 1640 | nmdc:mga00v17_2860_c1 | |||
| 1641 | nmdc:mga0yw44_1201_c1 | |||
| 1642 | nmdc:mga0yw44_198389_c1 | |||
| 1643 | nmdc:mga0yw44_2547_c1 | |||
| 1644 | nmdc:mga0yw44_35_c1 | |||
| 1645 | nmdc:mga0k408_325_c1 | |||
| 1646 | nmdc:mga0k408_42182_c1 | |||
| 1647 | nmdc:mga0k408_7937_c1 | |||
| 1648 | nmdc:mga04h51_99153_c1 | |||
| 1649 | nmdc:mga07m45_347_c2 | |||
| 1650 | nmdc:mga07m45_7798_c1 | |||
| 1651 | nmdc:mga05p37_353560_c1 | |||
| 1652 | nmdc:mga09592_11588_c1 | |||
| 1653 | nmdc:mga09592_423693_c1 | |||
| 1654 | nmdc:mga09592_544001_c1 | |||
| 1655 | nmdc:mga0qj67_2908_c1 | |||
| 1656 | nmdc:mga0qj67_31916_c1 | |||
| 1657 | nmdc:mga0qj67_36005_c1 | |||
| 1658 | nmdc:mga0qj67_402463_c1 | |||
| 1659 | nmdc:mga08y16_117117_c1 | |||
| 1660 | nmdc:mga08y16_157962_c1 | |||
| 1661 | nmdc:mga08y16_26617_c1 | |||
| 1662 | nmdc:mga08y16_51699_c1 | |||
| 1663 | nmdc:mga0n895_280334_c1 | |||
| 1664 | nmdc:mga0n895_55132_c1 | |||
| 1665 | nmdc:mga08x19_10398_c1 | |||
| 1666 | nmdc:mga08x19_154673_c1 | |||
| 1667 | nmdc:mga08x19_56714_c1 | |||
| 1668 | nmdc:mga08x19_80855_c2 | |||
| 1669 | nmdc:mga0a205_210043_c1 | |||
| 1670 | nmdc:mga0sz30_2289_c2 | |||
| 1671 | Ga0495612_0033732 | |||
| 1672 | Ga0495619_0109309 | |||
| 1673 | Ga0495619_0162018 | |||
| 1674 | Ga0500578_0023006 | |||
| 1675 | Ga0500643_029683 | |||
| 1676 | Ga0500646_0008307 | |||
| 1677 | Ga0500646_0053111 | |||
| 1678 | Ga0500557_001477 | |||
| 1679 | Ga0500594_0032741 | |||
| 1680 | Ga0500618_002182 | |||
| 1681 | Ga0500658_0103965 | |||
| 1682 | Ga0500568_0001168 | |||
| 1683 | Ga0500568_0050160 | |||
| 1684 | Ga0500577_0035447 | |||
| 1685 | Ga0500577_0045624 | |||
| 1686 | Ga0500586_011930 | |||
| 1687 | Ga0500588_0016291 | |||
| 1688 | Ga0500616_0001225 | |||
| 1689 | Ga0500616_0075231 | |||
| 1690 | Ga0500627_0009818 | |||
| 1691 | Ga0500645_050348 | |||
| 1692 | Ga0501084_0027700 | |||
| 1693 | Ga0501084_0120938 | |||
| 1694 | Ga0501082_0018354 | |||
| 1695 | Ga0530510_0011074 | |||
| 1696 | 2511186229 | |||
| 1697 | 2513714824 | |||
| 1698 | 2514416724 | |||
| 1699 | 2585278184 | |||
| 1700 | 2585332823 | |||
| 1701 | 2585532156 | |||
| 1702 | 2585552516 | |||
| 1703 | 2585824802 | |||
| 1704 | 2586001525 | |||
| 1705 | 2616307702 | |||
| 1706 | 2616552130 | |||
| 1707 | 2617382764 | |||
| 1708 | 2643774890 | |||
| 1709 | 2643793334 | |||
| 1710 | 2644158897 | |||
| 1711 | 2644398227 | |||
| 1712 | 2671114145 | |||
| 1713 | 2723577587 | |||
| 1714 | 2738881197 | |||
| 1715 | 2739250374 | |||
| 1716 | 2739612038 | |||
| 1717 | 2778178407 | |||
| 1718 | 2792833842 | |||
| 1719 | 2793336138 | |||
| 1720 | 2819640401 | |||
| 1721 | 2821445013 | |||
| 1722 | 2838032679 | |||
| 1723 | 2838665293 | |||
| 1724 | 2842193718 | |||
| 1725 | 2842479411 | |||
| 1726 | 2842487042 | |||
| 1727 | 2842506430 | |||
| 1728 | 2844535288 | |||
| 1729 | 2847675414 | |||
| 1730 | 2856320335 | |||
| 1731 | 2856350526 | |||
| 1732 | 2857544787 | |||
| 1733 | 2874169212 | |||
| 1734 | 2878042645 | |||
| 1735 | 2881161485 | |||
| 1736 | 2881164151 | |||
| 1737 | 2885344496 | |||
| 1738 | 2885351166 | |||
| 1739 | 2906420885 | |||
| 1740 | 2919412531 | |||
| 1741 | 2928115253 | |||
| 1742 | 2928120550 | |||
| 1743 | 2945984983 | |||
| 1744 | 2961135989 | |||
| 1745 | 2968130750 | |||
| 1746 | 2990711057 | |||
| 1747 | 3004335576 | |||
| 1748 | 3005417273 | |||
| 1749 | 8005320479 | |||
| 1750 | 8005487450 | |||
| 1751 | 8005647854 | |||
| 1752 | 8005684307 | |||
| 1753 | 8024489427 | |||
| 1754 | 8055226854 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dc1-assembly1.cif.gz_B | crystal structure of y202f actinorhodin polyketide ketoreductase with nadph | 0.9649 | 7 | 256 |
| 4nbu-assembly1.cif.gz_D | crystal structure of fabg from bacillus sp | 0.9638 | 5 | 251 |
| 3qrw-assembly1.cif.gz_B | actinorhodin polyketide ketoreductase mutant p94l bound to nadph | 0.9623 | 7 | 253 |
| 4dc0-assembly1.cif.gz_B | crystal structure of f189w actinorhodin polyketide ketoreductase with nadph | 0.9618 | 7 | 253 |
| 4dbz-assembly1.cif.gz_B | crystal structure of v151l actinorhodin polyketide ketoreductase with nadph | 0.9607 | 7 | 256 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2rhcB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9588 | 7 | 253 | 3.40.50.720 |
| 5itvA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9542 | 1 | 253 | 3.40.50.720 |
| af_C6T421_12_106_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9534 | 3 | 78 | 3.40.50.720 |
| af_Q0JEC9_1_74_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.952 | 6 | 57 | 3.40.50.720 |
| af_Q0ISZ5_12_118_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.952 | 6 | 87 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1N6A8-F1-model_v4 | Short-chain dehydrogenase | 0.9746 | 104 | 253 |
|
| AF-A0A2E7TDC2-F1-model_v4 | 3-oxoacyl-ACP reductase | 0.9695 | 6 | 254 |
|
| AF-A0A7V1QTB5-F1-model_v4 | SDR family oxidoreductase | 0.969 | 1 | 257 |
|
| AF-A0A661UD25-F1-model_v4 | 3-oxoacyl-ACP reductase | 0.9681 | 1 | 258 |
|
| AF-A0A6I5VG95-F1-model_v4 | SDR family oxidoreductase | 0.9675 | 6 | 254 |
GO:0016616
|