F484387

General Info

Members Datasets Scaffolds Average Seq Length
877 427 1754 259

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10020809|Ga0111539_100208094
Length 302
Sequence VQGWKAGRLEGGNVHFSLPAFHFRLSAFQPSRLATRRPPHGHALMNLELDGRRVLVTGGSKGIGLACARAFLAEGARVAIASRSQANLALARAELGEVTTFAADFTDAAAARSVVDRVEAELGPLDVLVTSAGAARRTPPDELDPAAWRAAMDAKFFTYVNVIDPVVKLMAARGRGAIVNIIGSGGKVASPIHLPGGAANAALMLATVGLANAYAAKGVRVVGINPGLTRTTRVAEGMQAEAARLGISEADALKRSVDRIPLGRLAEAEEIAAAVVFAASPRASYLTGTIITMDGASAPVVV

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
123 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
126 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
128 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
197 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
198 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
199 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
200 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
201 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
202 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
203 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
204 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
207 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
208 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
216 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
217 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
218 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
219 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
220 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
221 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
222 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
223 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
224 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
225 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
226 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
227 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
230 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
231 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
234 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
235 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
238 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
239 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
240 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
241 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
242 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
243 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
244 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
245 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
246 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
247 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
248 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
249 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
250 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
251 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
252 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
253 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
254 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
257 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
258 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
259 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
260 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
261 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
262 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
263 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
264 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
265 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
266 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
267 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
268 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
269 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
270 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
271 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
272 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
273 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
274 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
275 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
276 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
277 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
278 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
279 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
280 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
281 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
282 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
283 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
296 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
297 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
298 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
299 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
300 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
301 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
302 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
303 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
304 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
305 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
306 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
307 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
319 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
320 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
321 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
322 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
323 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
324 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
325 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
326 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
327 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
328 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
329 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
330 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
331 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
332 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
335 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
336 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
337 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
338 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
339 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
340 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
341 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
342 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
343 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
346 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
347 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
348 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
349 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
350 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
351 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
352 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
353 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
354 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
355 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
356 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
357 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
358 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
359 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
360 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
361 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
362 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
363 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
364 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
365 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
366 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
367 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
368 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
369 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
370 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
371 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
372 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
373 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
374 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
375 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
376 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
377 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
378 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
379 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
380 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
381 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
382 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
383 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
384 2643221672 Variovorax sp. Root434 Isolate Unclassified
385 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
386 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
387 2738541307 Variovorax sp. GV008 Isolate Unclassified
388 2738543013 Variovorax sp. BT01 Isolate Unclassified
389 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
390 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
391 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
392 2791355262 Rhizobium sp. M1 Isolate Nodule
393 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
394 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
395 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
396 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
397 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
398 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
399 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
400 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
401 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
402 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
403 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
404 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
405 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
406 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
407 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
408 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
409 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
410 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
411 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
412 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
413 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
414 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
415 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
416 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
417 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
418 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
419 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
420 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
421 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
422 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
423 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
424 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
425 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
426 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
427 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.27
Metatranscriptomes 0
Isolates 6.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.67
Nodule 3.19
Rhizoplane 2.05
Rhizosphere 81.41
Stem 0
Stem Tuber 0
Unclassified 1.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10020809 3300009094 Bacteria 8077
2 JGI24740J21852_10005269 3300001979 Bacteria 5490
3 JGI24740J21852_10005831 3300001979 Bacteria 5169
4 JGI25406J46586_10013352 3300003203 Bacteria 3530
5 JGI25165J46597_1000068 3300003214 Bacteria 196201
6 JGI25165J46597_1011288 3300003214 Bacteria 1279
7 rootL2_10015947 3300003322 Bacteria 13949
8 rootL2_10039598 3300003322 Bacteria 1109
9 rootH1_10050301 3300003323 Bacteria 5866
10 Ga0055534_1000177 3300003784 Bacteria 47626
11 Ga0065165_1030548 3300005262 Bacteria 1712
12 Ga0065715_10224002 3300005293 Bacteria 1260
13 Ga0070658_10003204 3300005327 Bacteria 13509
14 Ga0070676_10002219 3300005328 Bacteria 9906
15 Ga0070676_10010326 3300005328 Bacteria 5065
16 Ga0070676_10081565 3300005328 Bacteria 1963
17 Ga0070676_10158689 3300005328 Bacteria 1454
18 Ga0070676_10402453 3300005328 Bacteria 953
19 Ga0070690_100089753 3300005330 Bacteria 2022
20 Ga0070690_100345048 3300005330 Bacteria 1079
21 Ga0070670_100005632 3300005331 Bacteria 10572
22 Ga0070670_100018764 3300005331 Bacteria 5931
23 Ga0070670_100082894 3300005331 Bacteria 2755
24 Ga0070670_100092231 3300005331 Bacteria 2604
25 Ga0070670_100121827 3300005331 Bacteria 2250
26 Ga0070670_100307995 3300005331 Bacteria 1386
27 Ga0068869_100000049 3300005334 Bacteria 50658
28 Ga0068869_100066950 3300005334 Bacteria 2648
29 Ga0068869_100094043 3300005334 Bacteria 2259
30 Ga0068869_100270917 3300005334 Bacteria 1362
31 Ga0070666_10001467 3300005335 Bacteria 14317
32 Ga0070666_10053367 3300005335 Bacteria 2726
33 Ga0070680_100082820 3300005336 Bacteria 2649
34 Ga0070680_100203286 3300005336 Bacteria 1671
35 Ga0070680_100240963 3300005336 Bacteria 1528
36 Ga0070680_100353786 3300005336 Bacteria 1249
37 Ga0070682_100151200 3300005337 Bacteria 1593
38 Ga0068868_100011885 3300005338 Bacteria 6349
39 Ga0068868_100394359 3300005338 Bacteria 1193
40 Ga0070689_100000283 3300005340 Bacteria 29408
41 Ga0070689_100358808 3300005340 Bacteria 1224
42 Ga0070691_10004163 3300005341 Bacteria 6569
43 Ga0070661_100001480 3300005344 Bacteria 16303
44 Ga0070661_100109787 3300005344 Bacteria 2059
45 Ga0070661_100143642 3300005344 Bacteria 1800
46 Ga0070692_10014210 3300005345 Bacteria 3732
47 Ga0070692_10126836 3300005345 Bacteria 1430
48 Ga0070692_10146202 3300005345 Bacteria 1342
49 Ga0070668_100000226 3300005347 Bacteria 36448
50 Ga0070668_100001385 3300005347 Bacteria 17406
51 Ga0070668_100011277 3300005347 Bacteria 6656
52 Ga0070668_100014493 3300005347 Bacteria 5891
53 Ga0070668_100023107 3300005347 Bacteria 4700
54 Ga0070669_100000543 3300005353 Bacteria 28149
55 Ga0070669_100002751 3300005353 Bacteria 12688
56 Ga0070669_100032928 3300005353 Bacteria 3746
57 Ga0070669_100035642 3300005353 Bacteria 3605
58 Ga0070669_100041271 3300005353 Bacteria 3356
59 Ga0070669_100266065 3300005353 Unclassified 1369
60 Ga0070675_100031607 3300005354 Bacteria 4281
61 Ga0070675_100057127 3300005354 Bacteria 3217
62 Ga0070675_100643024 3300005354 Bacteria 964
63 Ga0070671_100163421 3300005355 Bacteria 1882
64 Ga0070671_100216508 3300005355 Bacteria 1625
65 Ga0070674_100030681 3300005356 Bacteria 3555
66 Ga0070674_100211396 3300005356 Bacteria 1504
67 Ga0070673_100002455 3300005364 Bacteria 11297
68 Ga0070673_100057674 3300005364 Bacteria 3068
69 Ga0070673_100091109 3300005364 Bacteria 2492
70 Ga0070673_100141753 3300005364 Bacteria 2028
71 Ga0070673_100193792 3300005364 Bacteria 1747
72 Ga0070673_100387060 3300005364 Bacteria 1248
73 Ga0070688_100064275 3300005365 Bacteria 2328
74 Ga0070688_100372035 3300005365 Bacteria 1051
75 Ga0070659_100000895 3300005366 Bacteria 21810
76 Ga0070659_100090431 3300005366 Bacteria 2453
77 Ga0070659_100440690 3300005366 Bacteria 1104
78 Ga0070667_100002122 3300005367 Bacteria 17483
79 Ga0070667_100026787 3300005367 Bacteria 4797
80 Ga0070667_100067245 3300005367 Bacteria 3046
81 Ga0070667_100387842 3300005367 Bacteria 1270
82 Ga0070703_10086260 3300005406 Bacteria 1080
83 Ga0070714_100026265 3300005435 Bacteria 4811
84 Ga0070714_100162985 3300005435 Bacteria 2018
85 Ga0070710_10038552 3300005437 Bacteria 2625
86 Ga0070701_10000223 3300005438 Bacteria 17845
87 Ga0070701_10008350 3300005438 Bacteria 4475
88 Ga0070711_100266496 3300005439 Bacteria 1350
89 Ga0070705_100006703 3300005440 Bacteria 5661
90 Ga0070705_100009255 3300005440 Bacteria 4893
91 Ga0070705_100011771 3300005440 Bacteria 4426
92 Ga0070700_100000271 3300005441 Bacteria 27566
93 Ga0070700_100001230 3300005441 Bacteria 12698
94 Ga0070700_100005910 3300005441 Bacteria 6506
95 Ga0070700_100038712 3300005441 Bacteria 2908
96 Ga0070700_100198310 3300005441 Bacteria 1408
97 Ga0070694_100043047 3300005444 Bacteria 3018
98 Ga0070694_100078796 3300005444 Bacteria 2286
99 Ga0070708_100218937 3300005445 Bacteria 1785
100 Ga0070708_100458333 3300005445 Bacteria 1203
101 Ga0070663_100399210 3300005455 Bacteria 1124
102 Ga0070678_100001554 3300005456 Bacteria 12280
103 Ga0070678_100119340 3300005456 Bacteria 2077
104 Ga0070678_100231583 3300005456 Bacteria 1540
105 Ga0070678_100584107 3300005456 Bacteria 996
106 Ga0070662_100095584 3300005457 Bacteria 2240
107 Ga0070662_100170916 3300005457 Unclassified 1707
108 Ga0070662_100400306 3300005457 Bacteria 1133
109 Ga0070681_10004036 3300005458 Bacteria 13848
110 Ga0070681_10008003 3300005458 Bacteria 10348
111 Ga0070681_10048165 3300005458 Bacteria 4260
112 Ga0070681_10059949 3300005458 Bacteria 3784
113 Ga0070681_10527605 3300005458 Bacteria 1094
114 Ga0068867_100000383 3300005459 Bacteria 29506
115 Ga0068867_100000440 3300005459 Bacteria 27583
116 Ga0068867_100000940 3300005459 Bacteria 19803
117 Ga0068867_100039903 3300005459 Bacteria 3423
118 Ga0070706_100000388 3300005467 Bacteria 52771
119 Ga0070706_100038959 3300005467 Bacteria 4387
120 Ga0070707_100261619 3300005468 Bacteria 1683
121 Ga0070707_100405395 3300005468 Bacteria 1324
122 Ga0070698_100022115 3300005471 Bacteria 6657
123 Ga0070699_100019712 3300005518 Bacteria 5812
124 Ga0070699_100075190 3300005518 Bacteria 2940
125 Ga0070699_100164444 3300005518 Bacteria 1965
126 Ga0070679_100013061 3300005530 Bacteria 7952
127 Ga0070679_100071250 3300005530 Bacteria 3467
128 Ga0070679_100082398 3300005530 Bacteria 3207
129 Ga0070679_100156099 3300005530 Bacteria 2257
130 Ga0070679_100223255 3300005530 Bacteria 1845
131 Ga0070679_100262536 3300005530 Bacteria 1682
132 Ga0070697_100040276 3300005536 Bacteria 3779
133 Ga0068853_100188929 3300005539 Bacteria 1871
134 Ga0068853_100284509 3300005539 Bacteria 1525
135 Ga0070672_100000897 3300005543 Bacteria 17894
136 Ga0070672_100002207 3300005543 Bacteria 12280
137 Ga0070672_100126770 3300005543 Bacteria 2094
138 Ga0070686_100000581 3300005544 Bacteria 21695
139 Ga0070686_100184571 3300005544 Bacteria 1484
140 Ga0070686_100530707 3300005544 Bacteria 918
141 Ga0070695_100004254 3300005545 Bacteria 8374
142 Ga0070695_100024821 3300005545 Bacteria 3697
143 Ga0070696_100001088 3300005546 Bacteria 17560
144 Ga0070696_100003606 3300005546 Bacteria 10309
145 Ga0070696_100009006 3300005546 Bacteria 6682
146 Ga0070696_100043913 3300005546 Bacteria 3094
147 Ga0070693_100007485 3300005547 Bacteria 5341
148 Ga0070693_100315784 3300005547 Bacteria 1058
149 Ga0070665_100020647 3300005548 Bacteria 6618
150 Ga0070665_100157856 3300005548 Bacteria 2270
151 Ga0070665_100177456 3300005548 Bacteria 2131
152 Ga0070665_100258522 3300005548 Bacteria 1742
153 Ga0070665_100422778 3300005548 Unclassified 1341
154 Ga0070665_100782006 3300005548 Bacteria 967
155 Ga0068855_100005816 3300005563 Bacteria 15050
156 Ga0068855_100039981 3300005563 Bacteria 5567
157 Ga0068855_100049904 3300005563 Bacteria 4934
158 Ga0068855_100054231 3300005563 Bacteria 4712
159 Ga0068855_100066708 3300005563 Bacteria 4195
160 Ga0068855_100103418 3300005563 Bacteria 3277
161 Ga0068855_100127783 3300005563 Bacteria 2905
162 Ga0070664_100013435 3300005564 Bacteria 6669
163 Ga0070664_100239092 3300005564 Bacteria 1630
164 Ga0070664_100248484 3300005564 Bacteria 1598
165 Ga0070664_100282143 3300005564 Bacteria 1498
166 Ga0068857_100454495 3300005577 Bacteria 1198
167 Ga0068854_100052329 3300005578 Bacteria 2928
168 Ga0068856_100006621 3300005614 Bacteria 11351
169 Ga0068856_100555603 3300005614 Bacteria 1169
170 Ga0070702_100000059 3300005615 Bacteria 31794
171 Ga0070702_100012851 3300005615 Bacteria 4213
172 Ga0070702_100231507 3300005615 Bacteria 1242
173 Ga0068859_100023691 3300005617 Bacteria 6162
174 Ga0068859_100026861 3300005617 Bacteria 5774
175 Ga0068859_100129313 3300005617 Bacteria 2596
176 Ga0068864_100005549 3300005618 Bacteria 10345
177 Ga0068864_100020992 3300005618 Bacteria 5469
178 Ga0068864_100021620 3300005618 Bacteria 5387
179 Ga0068864_100044386 3300005618 Bacteria 3810
180 Ga0068866_10000232 3300005718 Bacteria 26282
181 Ga0068866_10078798 3300005718 Bacteria 1764
182 Ga0068861_100002136 3300005719 Bacteria 12792
183 Ga0068861_100004208 3300005719 Bacteria 9656
184 Ga0068861_100029721 3300005719 Bacteria 3999
185 Ga0068861_100087263 3300005719 Bacteria 2455
186 Ga0068861_100150451 3300005719 Bacteria 1909
187 Ga0068851_10306564 3300005834 Bacteria 914
188 Ga0068870_10073995 3300005840 Bacteria 1865
189 Ga0068863_100001022 3300005841 Bacteria 28022
190 Ga0068863_100077428 3300005841 Bacteria 3147
191 Ga0068863_100166970 3300005841 Bacteria 2110
192 Ga0068863_100168920 3300005841 Bacteria 2097
193 Ga0068858_100007122 3300005842 Bacteria 10860
194 Ga0068858_100015159 3300005842 Bacteria 7250
195 Ga0068860_100006231 3300005843 Bacteria 11984
196 Ga0068860_100035098 3300005843 Bacteria 4811
197 Ga0068860_100226783 3300005843 Bacteria 1815
198 Ga0068860_100240206 3300005843 Bacteria 1762
199 Ga0068860_100396307 3300005843 Bacteria 1365
200 Ga0068860_100866183 3300005843 Bacteria 918
201 Ga0068862_100003925 3300005844 Bacteria 12648
202 Ga0068862_100012684 3300005844 Bacteria 6974
203 Ga0068862_100018071 3300005844 Bacteria 5873
204 Ga0068862_100035015 3300005844 Bacteria 4250
205 Ga0068862_100087008 3300005844 Bacteria 2717
206 Ga0068862_100087533 3300005844 Bacteria 2709
207 Ga0068862_100114202 3300005844 Bacteria 2373
208 Ga0068862_100202387 3300005844 Bacteria 1791
209 Ga0068862_100721881 3300005844 Bacteria 967
210 Ga0081539_10001081 3300005985 Bacteria 49568
211 Ga0081539_10014568 3300005985 Bacteria 5803
212 Ga0075365_10000044 3300006038 Bacteria 40804
213 Ga0075365_10001373 3300006038 Bacteria 10942
214 Ga0075365_10009380 3300006038 Bacteria 5621
215 Ga0075365_10053815 3300006038 Bacteria 2667
216 Ga0075363_100000225 3300006048 Bacteria 15778
217 Ga0075363_100008829 3300006048 Bacteria 4714
218 Ga0075364_10000030 3300006051 Bacteria 50362
219 Ga0075364_10001387 3300006051 Bacteria 13083
220 Ga0075364_10027961 3300006051 Bacteria 3606
221 Ga0075364_10043122 3300006051 Bacteria 2932
222 Ga0075432_10000438 3300006058 Bacteria 12245
223 Ga0070716_100027556 3300006173 Bacteria 3054
224 Ga0070716_100083089 3300006173 Bacteria 1917
225 Ga0075362_10003052 3300006177 Bacteria 5761
226 Ga0075362_10023797 3300006177 Bacteria 2594
227 Ga0075367_10101649 3300006178 Bacteria 1758
228 Ga0075369_10003991 3300006186 Bacteria 5416
229 Ga0075366_10001170 3300006195 Bacteria 12998
230 Ga0075366_10001262 3300006195 Bacteria 12578
231 Ga0075366_10043493 3300006195 Bacteria 2661
232 Ga0075366_10062126 3300006195 Bacteria 2220
233 Ga0097621_100003187 3300006237 Bacteria 11279
234 Ga0097621_100005133 3300006237 Bacteria 9198
235 Ga0097621_100011121 3300006237 Bacteria 6620
236 Ga0097621_100632969 3300006237 Bacteria 980
237 Ga0075370_10001855 3300006353 Bacteria 9466
238 Ga0075370_10010463 3300006353 Bacteria 4852
239 Ga0068871_100023423 3300006358 Bacteria 4776
240 Ga0068871_100027151 3300006358 Bacteria 4474
241 Ga0068871_100045394 3300006358 Bacteria 3537
242 Ga0068871_100136632 3300006358 Bacteria 2082
243 Ga0068871_100142924 3300006358 Bacteria 2036
244 Ga0068871_100726686 3300006358 Bacteria 911
245 Ga0075430_100011630 3300006846 Bacteria 7486
246 Ga0075430_100024514 3300006846 Bacteria 5131
247 Ga0075430_100040080 3300006846 Unclassified 3964
248 Ga0075430_100107319 3300006846 Bacteria 2329
249 Ga0075431_100091284 3300006847 Bacteria 3144
250 Ga0075431_100247441 3300006847 Unclassified 1812
251 Ga0075431_100585072 3300006847 Bacteria 1101
252 Ga0075434_100097812 3300006871 Bacteria 2939
253 Ga0075434_100124510 3300006871 Bacteria 2595
254 Ga0075434_100326508 3300006871 Bacteria 1555
255 Ga0075429_100234560 3300006880 Bacteria 1607
256 Ga0068865_100000084 3300006881 Bacteria 50482
257 Ga0068865_100006386 3300006881 Bacteria 7186
258 Ga0068865_100089387 3300006881 Bacteria 2231
259 Ga0068865_100345336 3300006881 Bacteria 1204
260 Ga0075436_100001365 3300006914 Bacteria 16615
261 Ga0075436_100064662 3300006914 Bacteria 2529
262 Ga0075436_100089871 3300006914 Bacteria 2134
263 Ga0075436_100130939 3300006914 Bacteria 1759
264 Ga0097620_100023692 3300006931 Bacteria 6162
265 Ga0097620_100026861 3300006931 Bacteria 5774
266 Ga0097620_100129323 3300006931 Bacteria 2596
267 Ga0075435_100229763 3300007076 Bacteria 1576
268 Ga0099794_10235087 3300007265 Bacteria 943
269 Ga0105240_10000012 3300009093 Bacteria 496639
270 Ga0105240_10082812 3300009093 Bacteria 3940
271 Ga0105240_10162189 3300009093 Bacteria 2654
272 Ga0105240_10169635 3300009093 Bacteria 2586
273 Ga0105240_10358712 3300009093 Bacteria 1652
274 Ga0111539_10037704 3300009094 Bacteria 5836
275 Ga0111539_10081231 3300009094 Bacteria 3813
276 Ga0111539_10385789 3300009094 Unclassified 1631
277 Ga0111539_10645884 3300009094 Bacteria 1232
278 Ga0105245_10000063 3300009098 Bacteria 113377
279 Ga0105245_10102415 3300009098 Bacteria 2651
280 Ga0105245_10402603 3300009098 Bacteria 1368
281 Ga0105245_10566299 3300009098 Bacteria 1159
282 Ga0114129_10303814 3300009147 Bacteria 2126
283 Ga0114129_11123664 3300009147 Bacteria 983
284 Ga0105243_10001481 3300009148 Bacteria 20602
285 Ga0105243_10007236 3300009148 Bacteria 8529
286 Ga0105243_10019086 3300009148 Bacteria 5199
287 Ga0105243_10108380 3300009148 Bacteria 2318
288 Ga0105243_10117886 3300009148 Bacteria 2233
289 Ga0105243_10169110 3300009148 Bacteria 1891
290 Ga0105241_10006214 3300009174 Bacteria 8811
291 Ga0105241_10063033 3300009174 Bacteria 2859
292 Ga0105242_10007900 3300009176 Bacteria 8187
293 Ga0105242_10100322 3300009176 Bacteria 2452
294 Ga0105248_10002136 3300009177 Bacteria 21878
295 Ga0105248_10054710 3300009177 Bacteria 4476
296 Ga0105248_10061417 3300009177 Bacteria 4219
297 Ga0105248_10071115 3300009177 Bacteria 3908
298 Ga0105248_10398915 3300009177 Bacteria 1549
299 Ga0105248_10706631 3300009177 Bacteria 1137
300 Ga0105248_10781819 3300009177 Unclassified 1077
301 Ga0105248_10822203 3300009177 Bacteria 1049
302 Ga0105237_10000054 3300009545 Bacteria 155063
303 Ga0105238_10198068 3300009551 Bacteria 1984
304 Ga0105249_10031989 3300009553 Bacteria 4758
305 Ga0105249_10164718 3300009553 Bacteria 2145
306 Ga0105249_10306717 3300009553 Bacteria 1594
307 Ga0105239_10005299 3300010375 Bacteria 15149
308 Ga0105239_10038319 3300010375 Bacteria 5253
309 Ga0105239_10246699 3300010375 Bacteria 2005
310 Ga0157373_10139221 3300013100 Bacteria 1706
311 Ga0157370_10000078 3300013104 Bacteria 107381
312 Ga0157370_10004743 3300013104 Bacteria 15487
313 Ga0157370_10010762 3300013104 Bacteria 9622
314 Ga0157370_10047660 3300013104 Bacteria 4107
315 Ga0157370_10104286 3300013104 Bacteria 2654
316 Ga0157369_10128403 3300013105 Bacteria 2687
317 Ga0157369_10187068 3300013105 Bacteria 2177
318 Ga0157374_10005976 3300013296 Bacteria 10296
319 Ga0157374_10260236 3300013296 Bacteria 1709
320 Ga0157378_10000193 3300013297 Bacteria 58970
321 Ga0157378_10137833 3300013297 Bacteria 2263
322 Ga0157378_10184148 3300013297 Bacteria 1966
323 Ga0157378_10321925 3300013297 Bacteria 1502
324 Ga0157378_10720283 3300013297 Bacteria 1018
325 Ga0163162_10005118 3300013306 Bacteria 12639
326 Ga0163162_10034161 3300013306 Bacteria 5059
327 Ga0163162_10448769 3300013306 Bacteria 1422
328 Ga0157372_10044028 3300013307 Bacteria 4944
329 Ga0157372_10213637 3300013307 Bacteria 2235
330 Ga0157372_10360804 3300013307 Bacteria 1693
331 Ga0157375_10027399 3300013308 Bacteria 5326
332 Ga0157375_10027429 3300013308 Bacteria 5322
333 Ga0157375_10064697 3300013308 Bacteria 3642
334 Ga0157375_10105744 3300013308 Bacteria 2906
335 Ga0157375_10161039 3300013308 Bacteria 2386
336 Ga0157375_10355521 3300013308 Bacteria 1631
337 Ga0163163_10104989 3300014325 Bacteria 2851
338 Ga0163163_10391719 3300014325 Bacteria 1447
339 Ga0157380_10013593 3300014326 Bacteria 5940
340 Ga0157380_10016886 3300014326 Bacteria 5390
341 Ga0157380_10040170 3300014326 Bacteria 3642
342 Ga0157380_10072327 3300014326 Bacteria 2793
343 Ga0157380_10255379 3300014326 Bacteria 1589
344 Ga0157380_10273970 3300014326 Bacteria 1540
345 Ga0182008_10051731 3300014497 Bacteria 2037
346 Ga0157377_10112187 3300014745 Bacteria 1640
347 Ga0157377_10129354 3300014745 Bacteria 1540
348 Ga0157379_10002399 3300014968 Bacteria 15647
349 Ga0157379_10021865 3300014968 Bacteria 5667
350 Ga0157379_10048948 3300014968 Bacteria 3773
351 Ga0157379_10420799 3300014968 Bacteria 1230
352 Ga0157376_10057962 3300014969 Bacteria 3242
353 Ga0157376_10140221 3300014969 Bacteria 2168
354 Ga0157376_10236448 3300014969 Bacteria 1700
355 Ga0182007_10001905 3300015262 Bacteria 10852
356 Ga0182005_1013863 3300015265 Bacteria 2264
357 Ga0163161_10004280 3300017792 Bacteria 9954
358 Ga0163161_10008347 3300017792 Bacteria 7169
359 Ga0163161_10027453 3300017792 Bacteria 4038
360 Ga0163161_10232613 3300017792 Bacteria 1431
361 Ga0209437_100067 3300025233 Bacteria 317685
362 Ga0209437_106902 3300025233 Bacteria 1872
363 Ga0209677_101204 3300025253 Bacteria 11775
364 Ga0209233_1000088 3300025261 Bacteria 317980
365 Ga0209233_1000201 3300025261 Bacteria 123566
366 Ga0209565_1024389 3300025263 Bacteria 1231
367 Ga0209673_1035979 3300025273 Bacteria 1476
368 Ga0209130_1003030 3300025284 Bacteria 7589
369 Ga0209675_1000270 3300025291 Bacteria 49663
370 Ga0209676_1003129 3300025292 Bacteria 10596
371 Ga0209051_1000527 3300025303 Bacteria 47465
372 Ga0209051_1009227 3300025303 Bacteria 5105
373 Ga0209257_1045534 3300025304 Bacteria 1273
374 Ga0207697_10056146 3300025315 Bacteria 1633
375 Ga0207656_10177181 3300025321 Bacteria 1022
376 Ga0207642_10008787 3300025899 Bacteria 3487
377 Ga0207642_10061255 3300025899 Bacteria 1749
378 Ga0207680_10006771 3300025903 Bacteria 5562
379 Ga0207680_10142744 3300025903 Bacteria 1589
380 Ga0207699_10036370 3300025906 Bacteria 2806
381 Ga0207645_10000419 3300025907 Bacteria 35124
382 Ga0207645_10013325 3300025907 Bacteria 5546
383 Ga0207645_10088312 3300025907 Bacteria 1993
384 Ga0207643_10011586 3300025908 Bacteria 4762
385 Ga0207643_10034932 3300025908 Bacteria 2818
386 Ga0207643_10080513 3300025908 Bacteria 1886
387 Ga0207643_10104341 3300025908 Bacteria 1665
388 Ga0207705_10007282 3300025909 Bacteria 8137
389 Ga0207684_10001941 3300025910 Bacteria 21443
390 Ga0207684_10405373 3300025910 Bacteria 1172
391 Ga0207654_10054383 3300025911 Bacteria 2313
392 Ga0207654_10316949 3300025911 Bacteria 1065
393 Ga0207707_10005043 3300025912 Bacteria 11589
394 Ga0207707_10072282 3300025912 Bacteria 3007
395 Ga0207707_10093831 3300025912 Bacteria 2622
396 Ga0207707_10504699 3300025912 Bacteria 1031
397 Ga0207707_10541166 3300025912 Bacteria 990
398 Ga0207695_10000097 3300025913 Bacteria 262517
399 Ga0207695_10033918 3300025913 Bacteria 5558
400 Ga0207695_10095673 3300025913 Bacteria 2973
401 Ga0207695_10166123 3300025913 Bacteria 2135
402 Ga0207695_10408604 3300025913 Bacteria 1242
403 Ga0207671_10000023 3300025914 Bacteria 274756
404 Ga0207693_10088089 3300025915 Bacteria 2433
405 Ga0207660_10003132 3300025917 Bacteria 10817
406 Ga0207660_10211337 3300025917 Bacteria 1519
407 Ga0207660_10271291 3300025917 Bacteria 1344
408 Ga0207657_10103123 3300025919 Bacteria 2365
409 Ga0207649_10113249 3300025920 Bacteria 1817
410 Ga0207649_10236926 3300025920 Unclassified 1308
411 Ga0207649_10295495 3300025920 Bacteria 1183
412 Ga0207652_10234758 3300025921 Bacteria 1653
413 Ga0207652_10260600 3300025921 Bacteria 1564
414 Ga0207652_10316788 3300025921 Bacteria 1408
415 Ga0207646_10213889 3300025922 Bacteria 1741
416 Ga0207646_10527731 3300025922 Bacteria 1063
417 Ga0207681_10004085 3300025923 Bacteria 9043
418 Ga0207681_10005388 3300025923 Bacteria 7858
419 Ga0207681_10040251 3300025923 Bacteria 3109
420 Ga0207681_10500117 3300025923 Bacteria 995
421 Ga0207681_10558799 3300025923 Bacteria 942
422 Ga0207650_10001061 3300025925 Bacteria 20432
423 Ga0207650_10004208 3300025925 Bacteria 9833
424 Ga0207650_10022657 3300025925 Bacteria 4448
425 Ga0207650_10092574 3300025925 Bacteria 2312
426 Ga0207659_10003137 3300025926 Bacteria 9880
427 Ga0207659_10039987 3300025926 Bacteria 3275
428 Ga0207659_10075971 3300025926 Bacteria 2467
429 Ga0207659_10625778 3300025926 Bacteria 919
430 Ga0207687_10007353 3300025927 Bacteria 7261
431 Ga0207687_10345256 3300025927 Bacteria 1211
432 Ga0207664_10038452 3300025929 Bacteria 3710
433 Ga0207664_10123884 3300025929 Bacteria 2167
434 Ga0207664_10320867 3300025929 Bacteria 1367
435 Ga0207664_10489953 3300025929 Bacteria 1100
436 Ga0207644_10065847 3300025931 Bacteria 2636
437 Ga0207644_10122380 3300025931 Bacteria 1982
438 Ga0207644_10182854 3300025931 Bacteria 1644
439 Ga0207690_10020905 3300025932 Unclassified 4051
440 Ga0207690_10043181 3300025932 Bacteria 2966
441 Ga0207690_10100786 3300025932 Bacteria 2062
442 Ga0207706_10069436 3300025933 Bacteria 3099
443 Ga0207706_10469832 3300025933 Bacteria 1087
444 Ga0207706_10472173 3300025933 Bacteria 1084
445 Ga0207686_10000467 3300025934 Bacteria 26772
446 Ga0207686_10191294 3300025934 Bacteria 1459
447 Ga0207709_10001392 3300025935 Bacteria 16932
448 Ga0207709_10002974 3300025935 Bacteria 10327
449 Ga0207709_10148972 3300025935 Bacteria 1618
450 Ga0207670_10015389 3300025936 Bacteria 4570
451 Ga0207670_10243410 3300025936 Bacteria 1387
452 Ga0207670_10503315 3300025936 Bacteria 984
453 Ga0207669_10040343 3300025937 Bacteria 2707
454 Ga0207669_10061520 3300025937 Bacteria 2308
455 Ga0207704_10006116 3300025938 Bacteria 5582
456 Ga0207704_10071139 3300025938 Bacteria 2206
457 Ga0207704_10113388 3300025938 Bacteria 1838
458 Ga0207665_10161555 3300025939 Bacteria 1612
459 Ga0207691_10000232 3300025940 Bacteria 54241
460 Ga0207691_10001955 3300025940 Bacteria 20123
461 Ga0207691_10180415 3300025940 Bacteria 1845
462 Ga0207691_10259148 3300025940 Bacteria 1499
463 Ga0207691_10440072 3300025940 Unclassified 1110
464 Ga0207691_10629186 3300025940 Bacteria 907
465 Ga0207711_10059056 3300025941 Bacteria 3302
466 Ga0207711_10203130 3300025941 Bacteria 1809
467 Ga0207689_10000152 3300025942 Bacteria 59757
468 Ga0207689_10009430 3300025942 Bacteria 8429
469 Ga0207689_10014808 3300025942 Bacteria 6621
470 Ga0207689_10348608 3300025942 Bacteria 1231
471 Ga0207661_10469560 3300025944 Bacteria 1148
472 Ga0207679_10000864 3300025945 Bacteria 19388
473 Ga0207679_10184221 3300025945 Bacteria 1730
474 Ga0207667_10002896 3300025949 Bacteria 21308
475 Ga0207667_10067668 3300025949 Bacteria 3720
476 Ga0207667_10079594 3300025949 Bacteria 3396
477 Ga0207667_10107074 3300025949 Bacteria 2884
478 Ga0207667_10111695 3300025949 Bacteria 2819
479 Ga0207667_10224381 3300025949 Bacteria 1925
480 Ga0207651_10006677 3300025960 Bacteria 6072
481 Ga0207651_10045487 3300025960 Bacteria 2945
482 Ga0207651_10126966 3300025960 Bacteria 1945
483 Ga0207651_10431951 3300025960 Bacteria 1126
484 Ga0207712_10353086 3300025961 Bacteria 1223
485 Ga0207668_10006939 3300025972 Bacteria 6720
486 Ga0207668_10040588 3300025972 Bacteria 3141
487 Ga0207668_10063542 3300025972 Bacteria 2605
488 Ga0207640_10035725 3300025981 Bacteria 3112
489 Ga0207658_10014076 3300025986 Bacteria 5477
490 Ga0207658_10062154 3300025986 Bacteria 2794
491 Ga0207658_10214709 3300025986 Bacteria 1615
492 Ga0207658_10240415 3300025986 Bacteria 1533
493 Ga0207677_10011683 3300026023 Bacteria 5014
494 Ga0207677_10047853 3300026023 Bacteria 2874
495 Ga0207677_10443458 3300026023 Bacteria 1111
496 Ga0207703_10013897 3300026035 Bacteria 6276
497 Ga0207703_10034171 3300026035 Bacteria 4034
498 Ga0207703_10036717 3300026035 Bacteria 3901
499 Ga0207703_10777389 3300026035 Bacteria 913
500 Ga0207639_10004783 3300026041 Bacteria 9132
501 Ga0207639_10249494 3300026041 Bacteria 1547
502 Ga0207708_10000166 3300026075 Bacteria 51921
503 Ga0207708_10000755 3300026075 Bacteria 24235
504 Ga0207708_10016758 3300026075 Bacteria 5514
505 Ga0207708_10030173 3300026075 Bacteria 4112
506 Ga0207708_10058767 3300026075 Bacteria 2934
507 Ga0207702_10011398 3300026078 Bacteria 7411
508 Ga0207702_10012230 3300026078 Bacteria 7141
509 Ga0207641_10004693 3300026088 Bacteria 11776
510 Ga0207641_10004813 3300026088 Bacteria 11627
511 Ga0207641_10061616 3300026088 Bacteria 3200
512 Ga0207641_10135824 3300026088 Bacteria 2213
513 Ga0207641_10144415 3300026088 Bacteria 2150
514 Ga0207641_10865054 3300026088 Bacteria 897
515 Ga0207648_10000131 3300026089 Bacteria 73949
516 Ga0207648_10000276 3300026089 Bacteria 55713
517 Ga0207648_10013865 3300026089 Bacteria 7477
518 Ga0207648_10015834 3300026089 Bacteria 6912
519 Ga0207648_10115732 3300026089 Bacteria 2356
520 Ga0207648_10690287 3300026089 Bacteria 946
521 Ga0207676_10001858 3300026095 Bacteria 15468
522 Ga0207676_10024861 3300026095 Bacteria 4438
523 Ga0207674_10348387 3300026116 Bacteria 1432
524 Ga0207675_100000084 3300026118 Bacteria 74312
525 Ga0207675_100003258 3300026118 Bacteria 15896
526 Ga0207675_100015099 3300026118 Bacteria 7205
527 Ga0207675_100038831 3300026118 Bacteria 4443
528 Ga0207675_100083888 3300026118 Bacteria 2989
529 Ga0207675_100242671 3300026118 Bacteria 1741
530 Ga0207675_100375045 3300026118 Bacteria 1398
531 Ga0207675_100547012 3300026118 Bacteria 1156
532 Ga0207683_10000063 3300026121 Bacteria 80638
533 Ga0207683_10006739 3300026121 Bacteria 9830
534 Ga0207683_10131027 3300026121 Bacteria 2256
535 Ga0207683_10318484 3300026121 Bacteria 1424
536 Ga0209970_1013019 3300027614 Bacteria 1376
537 Ga0209971_1005150 3300027682 Bacteria 3104
538 Ga0207428_10012294 3300027907 Bacteria 7525
539 Ga0207428_10013964 3300027907 Bacteria 6994
540 Ga0268266_10007407 3300028379 Bacteria 9908
541 Ga0268266_10023985 3300028379 Bacteria 5191
542 Ga0268266_10110138 3300028379 Bacteria 2439
543 Ga0268266_10118963 3300028379 Bacteria 2349
544 Ga0268266_10331348 3300028379 Bacteria 1427
545 Ga0268265_10002208 3300028380 Bacteria 15006
546 Ga0268265_10005049 3300028380 Bacteria 9060
547 Ga0268265_10006155 3300028380 Bacteria 8138
548 Ga0268265_10014989 3300028380 Bacteria 5293
549 Ga0268265_10032764 3300028380 Bacteria 3770
550 Ga0268265_10065226 3300028380 Bacteria 2809
551 Ga0268265_10071644 3300028380 Bacteria 2700
552 Ga0268265_10762499 3300028380 Bacteria 940
553 Ga0268264_10195394 3300028381 Bacteria 1847
554 Ga0268264_10458429 3300028381 Bacteria 1236
555 Ga0268264_10705114 3300028381 Bacteria 1003
556 Ga0307515_10115476 3300028794 Bacteria 3092
557 Ga0265330_10016532 3300031235 Bacteria 3403
558 Ga0265332_10000255 3300031238 Bacteria 42422
559 Ga0265325_10017682 3300031241 Bacteria 3960
560 Ga0265329_10001448 3300031242 Bacteria 11444
561 Ga0265331_10000354 3300031250 Bacteria 48614
562 Ga0265327_10024791 3300031251 Bacteria 3512
563 Ga0265327_10025730 3300031251 Bacteria 3425
564 Ga0265327_10082915 3300031251 Bacteria 1579
565 Ga0265316_10142525 3300031344 Bacteria 1799
566 Ga0307513_10003370 3300031456 Bacteria 21705
567 Ga0307408_100070860 3300031548 Bacteria 2575
568 Ga0307408_100092027 3300031548 Bacteria 2291
569 Ga0265314_10017506 3300031711 Bacteria 5623
570 Ga0265342_10082481 3300031712 Bacteria 1855
571 Ga0307516_10009467 3300031730 Bacteria 10853
572 Ga0307413_10398397 3300031824 Bacteria 1078
573 Ga0307410_10001761 3300031852 Bacteria 10011
574 Ga0307410_10010439 3300031852 Bacteria 5259
575 Ga0307410_10261353 3300031852 Bacteria 1350
576 Ga0307407_10013882 3300031903 Bacteria 3925
577 Ga0307407_10035671 3300031903 Bacteria 2734
578 Ga0307407_10133638 3300031903 Bacteria 1591
579 Ga0307407_10234362 3300031903 Bacteria 1249
580 Ga0307412_10006840 3300031911 Bacteria 6472
581 Ga0307409_100016403 3300031995 Bacteria 4899
582 Ga0307409_100087558 3300031995 Bacteria 2538
583 Ga0307409_100220746 3300031995 Bacteria 1711
584 Ga0307416_100000857 3300032002 Bacteria 15997
585 Ga0307416_100021173 3300032002 Bacteria 4661
586 Ga0307411_10099517 3300032005 Bacteria 2052
587 Ga0307411_10101796 3300032005 Bacteria 2034
588 Ga0307411_10233949 3300032005 Bacteria 1434
589 Ga0307415_100014519 3300032126 Bacteria 4633
590 Ga0307415_100032845 3300032126 Bacteria 3362
591 Ga0307510_10356930 3300033180 Bacteria 911
592 Ga0373932_0048648 3300035112 Bacteria 1250
593 Ga0373939_0013050 3300035114 Bacteria 2130
594 Ga0373953_0045622 3300035117 Bacteria 1757
595 Ga0373956_0056939 3300035119 Bacteria 1766
596 Ga0373957_0004905 3300035120 Bacteria 4110
597 Ga0373960_0018572 3300035121 Bacteria 1815
598 Ga0373943_0349020 3300035170 Unclassified 848
599 Ga0373946_0050819 3300035171 Bacteria 1733
600 Ga0373955_0025140 3300035172 Bacteria 3055
601 Ga0373924_0027605 3300035410 Bacteria 2258
602 Ga0373931_0052195 3300035691 Bacteria 2179
603 Ga0373927_0007037 3300035695 Bacteria 7632
604 Ga0373927_0334125 3300035695 Bacteria 998
605 Ga0373933_0014773 3300035724 Bacteria 4345
606 Ga0373947_0030159 3300035725 Bacteria 3186
607 Ga0373947_0086698 3300035725 Bacteria 1947
608 Ga0373925_0004776 3300037068 Bacteria 10206
609 Ga0373925_0519602 3300037068 Bacteria 978
610 Ga0395900_0066669 3300037418 Bacteria 3699
611 Ga0395898_0026512 3300037466 Bacteria 5829
612 Ga0395905_0026473 3300037471 Bacteria 5467
613 Ga0395905_0060692 3300037471 Bacteria 3536
614 Ga0395905_0416090 3300037471 Bacteria 1240
615 Ga0395901_0000034 3300038443 Bacteria 230365
616 Ga0395901_0010150 3300038443 Bacteria 9541
617 Ga0439436_0005628 3300041404 Bacteria 3842
618 Ga0439465_0040481 3300041413 Bacteria 1506
619 Ga0439441_003123 3300042001 Bacteria 2407
620 Ga0439442_007562 3300042002 Bacteria 2187
621 Ga0439442_009716 3300042002 Bacteria 1946
622 Ga0439448_0000260 3300042005 Bacteria 11455
623 Ga0439449_0071712 3300042007 Bacteria 1276
624 Ga0450923_002704 3300042125 Bacteria 2581
625 Ga0450895_002269 3300042132 Bacteria 1422
626 Ga0450898_003396 3300042134 Bacteria 2287
627 Ga0450906_000773 3300042145 Bacteria 6963
628 Ga0450908_002426 3300042184 Bacteria 3649
629 Ga0439434_0001721 3300042435 Bacteria 6351
630 Ga0439460_0044802 3300042461 Bacteria 1311
631 Ga0450918_001559 3300042531 Bacteria 4527
632 Ga0451577_0351657 3300042876 Bacteria 1337
633 Ga0451577_0403473 3300042876 Bacteria 1241
634 Ga0453684_0071736 3300044712 Bacteria 4377
635 Ga0453684_0199301 3300044712 Bacteria 2335
636 Ga0495617_022696 3300046452 Bacteria 2122
637 Ga0495638_0000560 3300046460 Bacteria 42333
638 Ga0495638_0163449 3300046460 Bacteria 1283
639 Ga0495580_0038531 3300046472 Bacteria 3423
640 Ga0495605_0015309 3300046474 Bacteria 4175
641 Ga0495605_0035536 3300046474 Bacteria 2518
642 Ga0495605_0195709 3300046474 Bacteria 883
643 Ga0495639_0062236 3300046475 Bacteria 1712
644 Ga0495585_0158817 3300046492 Bacteria 1174
645 Ga0495594_0157363 3300046499 Bacteria 1291
646 Ga0495583_0109103 3300046506 Bacteria 1174
647 Ga0495606_0001061 3300046507 Bacteria 39727
648 Ga0495616_0024877 3300046513 Bacteria 3206
649 Ga0495616_0154466 3300046513 Bacteria 1036
650 Ga0495631_0009103 3300046518 Bacteria 4972
651 Ga0495643_0001621 3300046522 Bacteria 19880
652 Ga0495648_0084460 3300046524 Bacteria 1796
653 Ga0495609_0055865 3300046538 Bacteria 1750
654 Ga0495668_0006908 3300046616 Bacteria 7347
655 Ga0495611_0018143 3300046648 Bacteria 3015
656 Ga0495625_0000056 3300046660 Bacteria 186024
657 Ga0495625_0018268 3300046660 Bacteria 5479
658 Ga0495625_0021119 3300046660 Bacteria 5018
659 Ga0495625_0281606 3300046660 Bacteria 1070
660 Ga0495647_0161484 3300046681 Bacteria 966
661 Ga0495670_0271524 3300046691 Bacteria 906
662 Ga0495660_0033746 3300046810 Bacteria 2867
663 Ga0495672_0007888 3300047320 Bacteria 7943
664 Ga0495672_0014508 3300047320 Bacteria 5393
665 Ga0495680_0055787 3300047322 Bacteria 3063
666 Ga0495683_0022469 3300047323 Bacteria 3243
667 Ga0495683_0227670 3300047323 Bacteria 828
668 Ga0495687_005257 3300047443 Bacteria 8317
669 Ga0495687_081262 3300047443 Bacteria 1268
670 Ga0495673_0012730 3300047469 Bacteria 4444
671 Ga0495684_0304563 3300047471 Bacteria 1144
672 Ga0495686_0000296 3300047472 Bacteria 86346
673 Ga0495686_0044116 3300047472 Plasmid 2823
674 Ga0495686_0242280 3300047472 Bacteria 1016
675 Ga0495626_0068226 3300048091 Bacteria 1604
676 Ga0496100_0011067 3300048903 Bacteria 5120
677 Ga0496101_0022621 3300048904 Bacteria 4330
678 Ga0496102_0061043 3300048905 Bacteria 3449
679 Ga0496102_0760942 3300048905 Bacteria 891
680 Ga0496104_0044430 3300048907 Bacteria 4174
681 Ga0496105_0000614 3300048908 Bacteria 23855
682 Ga0496107_0166414 3300048910 Bacteria 1635
683 Ga0496107_0266388 3300048910 Bacteria 1275
684 Ga0496108_0000514 3300048911 Bacteria 30292
685 Ga0496109_0021995 3300048912 Bacteria 5645
686 Ga0496110_0234462 3300048913 Bacteria 1669
687 Ga0496111_0012322 3300048914 Bacteria 5784
688 Ga0496112_0040229 3300048915 Bacteria 4570
689 Ga0496113_0001056 3300048916 Bacteria 14880
690 Ga0496114_0090067 3300048917 Bacteria 2604
691 Ga0496114_0466186 3300048917 Bacteria 1118
692 Ga0496115_0017087 3300048918 Bacteria 5535
693 Ga0496116_0009140 3300048919 Bacteria 8490
694 Ga0496117_0034905 3300048920 Bacteria 3783
695 Ga0496117_0173758 3300048920 Bacteria 1247
696 Ga0496118_0038697 3300048921 Bacteria 3819
697 Ga0496118_0104070 3300048921 Bacteria 1907
698 Ga0496119_0005487 3300048922 Bacteria 12125
699 Ga0496119_0046565 3300048922 Bacteria 2707
700 Ga0496120_0027467 3300048923 Bacteria 3500
701 Ga0496121_0001592 3300048924 Bacteria 37760
702 Ga0496121_0008906 3300048924 Bacteria 11654
703 Ga0496121_0110364 3300048924 Bacteria 2099
704 Ga0496122_0010062 3300048925 Bacteria 9824
705 Ga0496122_0079615 3300048925 Bacteria 2289
706 Ga0496123_0042179 3300048926 Bacteria 3153
707 Ga0496124_0000038 3300048927 Bacteria 312485
708 Ga0496124_0000832 3300048927 Bacteria 50313
709 Ga0496125_0006659 3300048928 Bacteria 12435
710 Ga0496126_0000271 3300048929 Bacteria 110289
711 Ga0495678_024566 3300049459 Bacteria 2601
712 Ga0501034_0002148 3300049571 Bacteria 24489
713 Ga0501034_0045066 3300049571 Bacteria 4458
714 Ga0501034_0514280 3300049571 Bacteria 1110
715 Ga0501034_0659027 3300049571 Bacteria 948
716 Ga0501036_0018757 3300049572 Bacteria 5803
717 Ga0501037_0324760 3300049573 Bacteria 1065
718 Ga0501038_0005280 3300049574 Bacteria 12014
719 Ga0501039_0001702 3300049575 Bacteria 16202
720 Ga0501039_0086530 3300049575 Bacteria 2441
721 Ga0501039_0205890 3300049575 Bacteria 1547
722 Ga0501039_0499411 3300049575 Unclassified 955
723 Ga0501040_0022891 3300049576 Bacteria 4186
724 Ga0501041_0067650 3300049577 Bacteria 2189
725 Ga0501042_0036769 3300049578 Bacteria 3474
726 Ga0501043_0162816 3300049579 Bacteria 1743
727 Ga0501043_0186423 3300049579 Bacteria 1615
728 Ga0501046_0089115 3300049580 Bacteria 2375
729 Ga0501048_0059377 3300049582 Bacteria 2710
730 Ga0501068_0000570 3300049584 Bacteria 18765
731 Ga0501069_0196979 3300049585 Bacteria 1167
732 Ga0501070_0025223 3300049586 Bacteria 4985
733 Ga0501071_0007699 3300049587 Bacteria 7098
734 Ga0501072_0002218 3300049588 Bacteria 14512
735 Ga0501072_0016870 3300049588 Bacteria 5610
736 Ga0501073_0001398 3300049589 Bacteria 17802
737 Ga0501073_0271224 3300049589 Bacteria 1171
738 Ga0501074_0027087 3300049590 Bacteria 4154
739 Ga0501075_0020157 3300049591 Bacteria 4845
740 Ga0501075_0095975 3300049591 Bacteria 2250
741 Ga0501076_0004326 3300049592 Bacteria 10074
742 Ga0501076_0371778 3300049592 Bacteria 1175
743 Ga0501077_0064148 3300049593 Bacteria 2330
744 Ga0501077_0072087 3300049593 Bacteria 2189
745 Ga0501079_0032202 3300049741 Bacteria 4030
746 Ga0501080_0005302 3300049742 Bacteria 11487
747 Ga0501080_0045443 3300049742 Bacteria 4088
748 Ga0501081_0029064 3300049743 Bacteria 3733
749 Ga0501083_0014156 3300049744 Bacteria 5579
750 Ga0501035_0097496 3300049822 Bacteria 2582
751 Ga0501044_0107500 3300049823 Bacteria 2801
752 Ga0501044_0166023 3300049823 Bacteria 2182
753 Ga0501045_0002479 3300049824 Bacteria 12554
754 nmdc:mga03683_131735_c1 3300050489 Bacteria 1119
755 nmdc:mga03683_4178_c1 3300050489 Bacteria 4756
756 nmdc:mga03683_73_c1 3300050489 Bacteria 37601
757 nmdc:mga03n38_14931_c1 3300050490 Bacteria 2990
758 nmdc:mga03n38_30_c1 3300050490 Bacteria 31879
759 nmdc:mga03n38_31794_c1 3300050490 Bacteria 2230
760 nmdc:mga00v17_11142_c1 3300050491 Bacteria 4934
761 nmdc:mga00v17_131_c1 3300050491 Bacteria 43797
762 nmdc:mga00v17_262749_c1 3300050491 Bacteria 1120
763 nmdc:mga00v17_2860_c1 3300050491 Bacteria 8842
764 nmdc:mga0yw44_1201_c1 3300050492 Bacteria 10130
765 nmdc:mga0yw44_198389_c1 3300050492 Bacteria 1325
766 nmdc:mga0yw44_2547_c1 3300050492 Bacteria 7820
767 nmdc:mga0yw44_35_c1 3300050492 Bacteria 47558
768 nmdc:mga0k408_325_c1 3300050493 Bacteria 25971
769 nmdc:mga0k408_42182_c1 3300050493 Bacteria 2627
770 nmdc:mga0k408_7937_c1 3300050493 Bacteria 5685
771 nmdc:mga04h51_99153_c1 3300050495 Bacteria 1059
772 nmdc:mga07m45_347_c2 3300050496 Bacteria 18471
773 nmdc:mga07m45_7798_c1 3300050496 Bacteria 5479
774 nmdc:mga05p37_353560_c1 3300050507 Bacteria 1729
775 nmdc:mga09592_11588_c1 3300050508 Bacteria 7170
776 nmdc:mga09592_423693_c1 3300050508 Bacteria 1149
777 nmdc:mga09592_544001_c1 3300050508 Bacteria 998
778 nmdc:mga0qj67_2908_c1 3300050509 Bacteria 12286
779 nmdc:mga0qj67_31916_c1 3300050509 Bacteria 4106
780 nmdc:mga0qj67_36005_c1 3300050509 Unclassified 3871
781 nmdc:mga0qj67_402463_c1 3300050509 Bacteria 1105
782 nmdc:mga08y16_117117_c1 3300050511 Bacteria 2773
783 nmdc:mga08y16_157962_c1 3300050511 Bacteria 2356
784 nmdc:mga08y16_26617_c1 3300050511 Bacteria 6096
785 nmdc:mga08y16_51699_c1 3300050511 Bacteria 4300
786 nmdc:mga0n895_280334_c1 3300050512 Bacteria 1690
787 nmdc:mga0n895_55132_c1 3300050512 Bacteria 3912
788 nmdc:mga08x19_10398_c1 3300050514 Bacteria 5586
789 nmdc:mga08x19_154673_c1 3300050514 Bacteria 1555
790 nmdc:mga08x19_56714_c1 3300050514 Bacteria 2529
791 nmdc:mga08x19_80855_c2 3300050514 Bacteria 1837
792 nmdc:mga0a205_210043_c1 3300050515 Bacteria 1835
793 nmdc:mga0sz30_2289_c2 3300050516 Bacteria 6012
794 Ga0495612_0033732 3300053078 Bacteria 2072
795 Ga0495619_0109309 3300053085 Bacteria 1888
796 Ga0495619_0162018 3300053085 Bacteria 1545
797 Ga0500578_0023006 3300053086 Bacteria 4003
798 Ga0500643_029683 3300053087 Bacteria 1680
799 Ga0500646_0008307 3300053090 Bacteria 2655
800 Ga0500646_0053111 3300053090 Bacteria 1174
801 Ga0500557_001477 3300053105 Bacteria 3855
802 Ga0500594_0032741 3300053118 Bacteria 1378
803 Ga0500618_002182 3300053125 Bacteria 7669
804 Ga0500658_0103965 3300053134 Bacteria 1243
805 Ga0500568_0001168 3300053139 Bacteria 17548
806 Ga0500568_0050160 3300053139 Bacteria 1646
807 Ga0500577_0035447 3300053142 Bacteria 1780
808 Ga0500577_0045624 3300053142 Bacteria 1621
809 Ga0500586_011930 3300053145 Bacteria 2509
810 Ga0500588_0016291 3300053146 Bacteria 1921
811 Ga0500616_0001225 3300053153 Bacteria 25824
812 Ga0500616_0075231 3300053153 Bacteria 1710
813 Ga0500627_0009818 3300053158 Bacteria 3465
814 Ga0500645_050348 3300053730 Bacteria 1216
815 Ga0501084_0027700 3300054114 Bacteria 4735
816 Ga0501084_0120938 3300054114 Bacteria 2202
817 Ga0501082_0018354 3300060353 Bacteria 6024
818 Ga0530510_0011074 3300061734 Bacteria 6326
819 2511186229 2510917028 Bacteria 6185411
820 2513714824 2513237104 Bacteria 10034502
821 2514416724 2513237305 Bacteria 7293571
822 2585278184 2582581308 Bacteria 7413247
823 2585332823 2582581316 Bacteria 7774528
824 2585532156 2585427527 Bacteria 7273426
825 2585552516 2585427530 Bacteria 7383882
826 2585824802 2585427590 Bacteria 6824633
827 2586001525 2585427634 Bacteria 6455027
828 2616307702 2615840626 Bacteria 7921970
829 2616552130 2615840698 Bacteria 7319877
830 2617382764 2617270742 Bacteria 6808054
831 2643774890 2643221551 Bacteria 3750538
832 2643793334 2643221555 Bacteria 3749717
833 2644158897 2643221628 Bacteria 5745828
834 2644398227 2643221672 Bacteria 6322190
835 2671114145 2667528174 Bacteria 6435400
836 2723577587 2721755686 Bacteria 7343952
837 2738881197 2738541307 Bacteria 8606193
838 2739250374 2738543013 Bacteria 5618633
839 2739612038 2739367655 Bacteria 4051151
840 2778178407 2775507266 Bacteria 7392367
841 2792833842 2791355137 Bacteria 9654227
842 2793336138 2791355262 Bacteria 6774204
843 2819640401 2818991453 Bacteria 7181617
844 2821445013 2821443989 Bacteria 7658172
845 2838032679 2838029111 Bacteria 6603031
846 2838665293 2838661181 Bacteria 7385261
847 2842193718 2842192696 Bacteria 6147454
848 2842479411 2842475841 Bacteria 6603183
849 2842487042 2842482326 Bacteria 7212537
850 2842506430 2842502639 Bacteria 6604161
851 2844535288 2844533157 Bacteria 7517899
852 2847675414 2847670302 Bacteria 6165597
853 2856320335 2856314179 Bacteria 6477897
854 2856350526 2856349417 Bacteria 6230045
855 2857544787 2857542790 Bacteria 5326616
856 2874169212 2874168670 Bacteria 8062617
857 2878042645 2878035449 Bacteria 6555736
858 2881161485 2881155292 Bacteria 6461656
859 2881164151 2881161766 Bacteria 7127907
860 2885344496 2885342637 Bacteria 7011821
861 2885351166 2885350715 Bacteria 6787678
862 2906420885 2906414383 Bacteria 6580790
863 2919412531 2919408235 Bacteria 6149349
864 2928115253 2928108538 Bacteria 7360024
865 2928120550 2928115317 Bacteria 6477646
866 2945984983 2945984333 Bacteria 7358892
867 2961135989 2961127735 Bacteria 7196641
868 2968130750 2968128360 Bacteria 6270294
869 2990711057 2990710928 Bacteria 5002431
870 3004335576 3004334049 Bacteria 8449246
871 3005417273 3005416602 Bacteria 7064308
872 8005320479 8005314921 Bacteria 7072929
873 8005487450 8005484373 Bacteria 6297373
874 8005647854 8005645114 Bacteria 6950293
875 8005684307 8005682033 Bacteria 6726518
876 8024489427 8024486573 Bacteria 6540512
877 8055226854 8055225921 Bacteria 3341787
878 Ga0111539_10020809
879 JGI24740J21852_10005269
880 JGI24740J21852_10005831
881 JGI25406J46586_10013352
882 JGI25165J46597_1000068
883 JGI25165J46597_1011288
884 rootL2_10015947
885 rootL2_10039598
886 rootH1_10050301
887 Ga0055534_1000177
888 Ga0065165_1030548
889 Ga0065715_10224002
890 Ga0070658_10003204
891 Ga0070676_10002219
892 Ga0070676_10010326
893 Ga0070676_10081565
894 Ga0070676_10158689
895 Ga0070676_10402453
896 Ga0070690_100089753
897 Ga0070690_100345048
898 Ga0070670_100005632
899 Ga0070670_100018764
900 Ga0070670_100082894
901 Ga0070670_100092231
902 Ga0070670_100121827
903 Ga0070670_100307995
904 Ga0068869_100000049
905 Ga0068869_100066950
906 Ga0068869_100094043
907 Ga0068869_100270917
908 Ga0070666_10001467
909 Ga0070666_10053367
910 Ga0070680_100082820
911 Ga0070680_100203286
912 Ga0070680_100240963
913 Ga0070680_100353786
914 Ga0070682_100151200
915 Ga0068868_100011885
916 Ga0068868_100394359
917 Ga0070689_100000283
918 Ga0070689_100358808
919 Ga0070691_10004163
920 Ga0070661_100001480
921 Ga0070661_100109787
922 Ga0070661_100143642
923 Ga0070692_10014210
924 Ga0070692_10126836
925 Ga0070692_10146202
926 Ga0070668_100000226
927 Ga0070668_100001385
928 Ga0070668_100011277
929 Ga0070668_100014493
930 Ga0070668_100023107
931 Ga0070669_100000543
932 Ga0070669_100002751
933 Ga0070669_100032928
934 Ga0070669_100035642
935 Ga0070669_100041271
936 Ga0070669_100266065
937 Ga0070675_100031607
938 Ga0070675_100057127
939 Ga0070675_100643024
940 Ga0070671_100163421
941 Ga0070671_100216508
942 Ga0070674_100030681
943 Ga0070674_100211396
944 Ga0070673_100002455
945 Ga0070673_100057674
946 Ga0070673_100091109
947 Ga0070673_100141753
948 Ga0070673_100193792
949 Ga0070673_100387060
950 Ga0070688_100064275
951 Ga0070688_100372035
952 Ga0070659_100000895
953 Ga0070659_100090431
954 Ga0070659_100440690
955 Ga0070667_100002122
956 Ga0070667_100026787
957 Ga0070667_100067245
958 Ga0070667_100387842
959 Ga0070703_10086260
960 Ga0070714_100026265
961 Ga0070714_100162985
962 Ga0070710_10038552
963 Ga0070701_10000223
964 Ga0070701_10008350
965 Ga0070711_100266496
966 Ga0070705_100006703
967 Ga0070705_100009255
968 Ga0070705_100011771
969 Ga0070700_100000271
970 Ga0070700_100001230
971 Ga0070700_100005910
972 Ga0070700_100038712
973 Ga0070700_100198310
974 Ga0070694_100043047
975 Ga0070694_100078796
976 Ga0070708_100218937
977 Ga0070708_100458333
978 Ga0070663_100399210
979 Ga0070678_100001554
980 Ga0070678_100119340
981 Ga0070678_100231583
982 Ga0070678_100584107
983 Ga0070662_100095584
984 Ga0070662_100170916
985 Ga0070662_100400306
986 Ga0070681_10004036
987 Ga0070681_10008003
988 Ga0070681_10048165
989 Ga0070681_10059949
990 Ga0070681_10527605
991 Ga0068867_100000383
992 Ga0068867_100000440
993 Ga0068867_100000940
994 Ga0068867_100039903
995 Ga0070706_100000388
996 Ga0070706_100038959
997 Ga0070707_100261619
998 Ga0070707_100405395
999 Ga0070698_100022115
1000 Ga0070699_100019712
1001 Ga0070699_100075190
1002 Ga0070699_100164444
1003 Ga0070679_100013061
1004 Ga0070679_100071250
1005 Ga0070679_100082398
1006 Ga0070679_100156099
1007 Ga0070679_100223255
1008 Ga0070679_100262536
1009 Ga0070697_100040276
1010 Ga0068853_100188929
1011 Ga0068853_100284509
1012 Ga0070672_100000897
1013 Ga0070672_100002207
1014 Ga0070672_100126770
1015 Ga0070686_100000581
1016 Ga0070686_100184571
1017 Ga0070686_100530707
1018 Ga0070695_100004254
1019 Ga0070695_100024821
1020 Ga0070696_100001088
1021 Ga0070696_100003606
1022 Ga0070696_100009006
1023 Ga0070696_100043913
1024 Ga0070693_100007485
1025 Ga0070693_100315784
1026 Ga0070665_100020647
1027 Ga0070665_100157856
1028 Ga0070665_100177456
1029 Ga0070665_100258522
1030 Ga0070665_100422778
1031 Ga0070665_100782006
1032 Ga0068855_100005816
1033 Ga0068855_100039981
1034 Ga0068855_100049904
1035 Ga0068855_100054231
1036 Ga0068855_100066708
1037 Ga0068855_100103418
1038 Ga0068855_100127783
1039 Ga0070664_100013435
1040 Ga0070664_100239092
1041 Ga0070664_100248484
1042 Ga0070664_100282143
1043 Ga0068857_100454495
1044 Ga0068854_100052329
1045 Ga0068856_100006621
1046 Ga0068856_100555603
1047 Ga0070702_100000059
1048 Ga0070702_100012851
1049 Ga0070702_100231507
1050 Ga0068859_100023691
1051 Ga0068859_100026861
1052 Ga0068859_100129313
1053 Ga0068864_100005549
1054 Ga0068864_100020992
1055 Ga0068864_100021620
1056 Ga0068864_100044386
1057 Ga0068866_10000232
1058 Ga0068866_10078798
1059 Ga0068861_100002136
1060 Ga0068861_100004208
1061 Ga0068861_100029721
1062 Ga0068861_100087263
1063 Ga0068861_100150451
1064 Ga0068851_10306564
1065 Ga0068870_10073995
1066 Ga0068863_100001022
1067 Ga0068863_100077428
1068 Ga0068863_100166970
1069 Ga0068863_100168920
1070 Ga0068858_100007122
1071 Ga0068858_100015159
1072 Ga0068860_100006231
1073 Ga0068860_100035098
1074 Ga0068860_100226783
1075 Ga0068860_100240206
1076 Ga0068860_100396307
1077 Ga0068860_100866183
1078 Ga0068862_100003925
1079 Ga0068862_100012684
1080 Ga0068862_100018071
1081 Ga0068862_100035015
1082 Ga0068862_100087008
1083 Ga0068862_100087533
1084 Ga0068862_100114202
1085 Ga0068862_100202387
1086 Ga0068862_100721881
1087 Ga0081539_10001081
1088 Ga0081539_10014568
1089 Ga0075365_10000044
1090 Ga0075365_10001373
1091 Ga0075365_10009380
1092 Ga0075365_10053815
1093 Ga0075363_100000225
1094 Ga0075363_100008829
1095 Ga0075364_10000030
1096 Ga0075364_10001387
1097 Ga0075364_10027961
1098 Ga0075364_10043122
1099 Ga0075432_10000438
1100 Ga0070716_100027556
1101 Ga0070716_100083089
1102 Ga0075362_10003052
1103 Ga0075362_10023797
1104 Ga0075367_10101649
1105 Ga0075369_10003991
1106 Ga0075366_10001170
1107 Ga0075366_10001262
1108 Ga0075366_10043493
1109 Ga0075366_10062126
1110 Ga0097621_100003187
1111 Ga0097621_100005133
1112 Ga0097621_100011121
1113 Ga0097621_100632969
1114 Ga0075370_10001855
1115 Ga0075370_10010463
1116 Ga0068871_100023423
1117 Ga0068871_100027151
1118 Ga0068871_100045394
1119 Ga0068871_100136632
1120 Ga0068871_100142924
1121 Ga0068871_100726686
1122 Ga0075430_100011630
1123 Ga0075430_100024514
1124 Ga0075430_100040080
1125 Ga0075430_100107319
1126 Ga0075431_100091284
1127 Ga0075431_100247441
1128 Ga0075431_100585072
1129 Ga0075434_100097812
1130 Ga0075434_100124510
1131 Ga0075434_100326508
1132 Ga0075429_100234560
1133 Ga0068865_100000084
1134 Ga0068865_100006386
1135 Ga0068865_100089387
1136 Ga0068865_100345336
1137 Ga0075436_100001365
1138 Ga0075436_100064662
1139 Ga0075436_100089871
1140 Ga0075436_100130939
1141 Ga0097620_100023692
1142 Ga0097620_100026861
1143 Ga0097620_100129323
1144 Ga0075435_100229763
1145 Ga0099794_10235087
1146 Ga0105240_10000012
1147 Ga0105240_10082812
1148 Ga0105240_10162189
1149 Ga0105240_10169635
1150 Ga0105240_10358712
1151 Ga0111539_10037704
1152 Ga0111539_10081231
1153 Ga0111539_10385789
1154 Ga0111539_10645884
1155 Ga0105245_10000063
1156 Ga0105245_10102415
1157 Ga0105245_10402603
1158 Ga0105245_10566299
1159 Ga0114129_10303814
1160 Ga0114129_11123664
1161 Ga0105243_10001481
1162 Ga0105243_10007236
1163 Ga0105243_10019086
1164 Ga0105243_10108380
1165 Ga0105243_10117886
1166 Ga0105243_10169110
1167 Ga0105241_10006214
1168 Ga0105241_10063033
1169 Ga0105242_10007900
1170 Ga0105242_10100322
1171 Ga0105248_10002136
1172 Ga0105248_10054710
1173 Ga0105248_10061417
1174 Ga0105248_10071115
1175 Ga0105248_10398915
1176 Ga0105248_10706631
1177 Ga0105248_10781819
1178 Ga0105248_10822203
1179 Ga0105237_10000054
1180 Ga0105238_10198068
1181 Ga0105249_10031989
1182 Ga0105249_10164718
1183 Ga0105249_10306717
1184 Ga0105239_10005299
1185 Ga0105239_10038319
1186 Ga0105239_10246699
1187 Ga0157373_10139221
1188 Ga0157370_10000078
1189 Ga0157370_10004743
1190 Ga0157370_10010762
1191 Ga0157370_10047660
1192 Ga0157370_10104286
1193 Ga0157369_10128403
1194 Ga0157369_10187068
1195 Ga0157374_10005976
1196 Ga0157374_10260236
1197 Ga0157378_10000193
1198 Ga0157378_10137833
1199 Ga0157378_10184148
1200 Ga0157378_10321925
1201 Ga0157378_10720283
1202 Ga0163162_10005118
1203 Ga0163162_10034161
1204 Ga0163162_10448769
1205 Ga0157372_10044028
1206 Ga0157372_10213637
1207 Ga0157372_10360804
1208 Ga0157375_10027399
1209 Ga0157375_10027429
1210 Ga0157375_10064697
1211 Ga0157375_10105744
1212 Ga0157375_10161039
1213 Ga0157375_10355521
1214 Ga0163163_10104989
1215 Ga0163163_10391719
1216 Ga0157380_10013593
1217 Ga0157380_10016886
1218 Ga0157380_10040170
1219 Ga0157380_10072327
1220 Ga0157380_10255379
1221 Ga0157380_10273970
1222 Ga0182008_10051731
1223 Ga0157377_10112187
1224 Ga0157377_10129354
1225 Ga0157379_10002399
1226 Ga0157379_10021865
1227 Ga0157379_10048948
1228 Ga0157379_10420799
1229 Ga0157376_10057962
1230 Ga0157376_10140221
1231 Ga0157376_10236448
1232 Ga0182007_10001905
1233 Ga0182005_1013863
1234 Ga0163161_10004280
1235 Ga0163161_10008347
1236 Ga0163161_10027453
1237 Ga0163161_10232613
1238 Ga0209437_100067
1239 Ga0209437_106902
1240 Ga0209677_101204
1241 Ga0209233_1000088
1242 Ga0209233_1000201
1243 Ga0209565_1024389
1244 Ga0209673_1035979
1245 Ga0209130_1003030
1246 Ga0209675_1000270
1247 Ga0209676_1003129
1248 Ga0209051_1000527
1249 Ga0209051_1009227
1250 Ga0209257_1045534
1251 Ga0207697_10056146
1252 Ga0207656_10177181
1253 Ga0207642_10008787
1254 Ga0207642_10061255
1255 Ga0207680_10006771
1256 Ga0207680_10142744
1257 Ga0207699_10036370
1258 Ga0207645_10000419
1259 Ga0207645_10013325
1260 Ga0207645_10088312
1261 Ga0207643_10011586
1262 Ga0207643_10034932
1263 Ga0207643_10080513
1264 Ga0207643_10104341
1265 Ga0207705_10007282
1266 Ga0207684_10001941
1267 Ga0207684_10405373
1268 Ga0207654_10054383
1269 Ga0207654_10316949
1270 Ga0207707_10005043
1271 Ga0207707_10072282
1272 Ga0207707_10093831
1273 Ga0207707_10504699
1274 Ga0207707_10541166
1275 Ga0207695_10000097
1276 Ga0207695_10033918
1277 Ga0207695_10095673
1278 Ga0207695_10166123
1279 Ga0207695_10408604
1280 Ga0207671_10000023
1281 Ga0207693_10088089
1282 Ga0207660_10003132
1283 Ga0207660_10211337
1284 Ga0207660_10271291
1285 Ga0207657_10103123
1286 Ga0207649_10113249
1287 Ga0207649_10236926
1288 Ga0207649_10295495
1289 Ga0207652_10234758
1290 Ga0207652_10260600
1291 Ga0207652_10316788
1292 Ga0207646_10213889
1293 Ga0207646_10527731
1294 Ga0207681_10004085
1295 Ga0207681_10005388
1296 Ga0207681_10040251
1297 Ga0207681_10500117
1298 Ga0207681_10558799
1299 Ga0207650_10001061
1300 Ga0207650_10004208
1301 Ga0207650_10022657
1302 Ga0207650_10092574
1303 Ga0207659_10003137
1304 Ga0207659_10039987
1305 Ga0207659_10075971
1306 Ga0207659_10625778
1307 Ga0207687_10007353
1308 Ga0207687_10345256
1309 Ga0207664_10038452
1310 Ga0207664_10123884
1311 Ga0207664_10320867
1312 Ga0207664_10489953
1313 Ga0207644_10065847
1314 Ga0207644_10122380
1315 Ga0207644_10182854
1316 Ga0207690_10020905
1317 Ga0207690_10043181
1318 Ga0207690_10100786
1319 Ga0207706_10069436
1320 Ga0207706_10469832
1321 Ga0207706_10472173
1322 Ga0207686_10000467
1323 Ga0207686_10191294
1324 Ga0207709_10001392
1325 Ga0207709_10002974
1326 Ga0207709_10148972
1327 Ga0207670_10015389
1328 Ga0207670_10243410
1329 Ga0207670_10503315
1330 Ga0207669_10040343
1331 Ga0207669_10061520
1332 Ga0207704_10006116
1333 Ga0207704_10071139
1334 Ga0207704_10113388
1335 Ga0207665_10161555
1336 Ga0207691_10000232
1337 Ga0207691_10001955
1338 Ga0207691_10180415
1339 Ga0207691_10259148
1340 Ga0207691_10440072
1341 Ga0207691_10629186
1342 Ga0207711_10059056
1343 Ga0207711_10203130
1344 Ga0207689_10000152
1345 Ga0207689_10009430
1346 Ga0207689_10014808
1347 Ga0207689_10348608
1348 Ga0207661_10469560
1349 Ga0207679_10000864
1350 Ga0207679_10184221
1351 Ga0207667_10002896
1352 Ga0207667_10067668
1353 Ga0207667_10079594
1354 Ga0207667_10107074
1355 Ga0207667_10111695
1356 Ga0207667_10224381
1357 Ga0207651_10006677
1358 Ga0207651_10045487
1359 Ga0207651_10126966
1360 Ga0207651_10431951
1361 Ga0207712_10353086
1362 Ga0207668_10006939
1363 Ga0207668_10040588
1364 Ga0207668_10063542
1365 Ga0207640_10035725
1366 Ga0207658_10014076
1367 Ga0207658_10062154
1368 Ga0207658_10214709
1369 Ga0207658_10240415
1370 Ga0207677_10011683
1371 Ga0207677_10047853
1372 Ga0207677_10443458
1373 Ga0207703_10013897
1374 Ga0207703_10034171
1375 Ga0207703_10036717
1376 Ga0207703_10777389
1377 Ga0207639_10004783
1378 Ga0207639_10249494
1379 Ga0207708_10000166
1380 Ga0207708_10000755
1381 Ga0207708_10016758
1382 Ga0207708_10030173
1383 Ga0207708_10058767
1384 Ga0207702_10011398
1385 Ga0207702_10012230
1386 Ga0207641_10004693
1387 Ga0207641_10004813
1388 Ga0207641_10061616
1389 Ga0207641_10135824
1390 Ga0207641_10144415
1391 Ga0207641_10865054
1392 Ga0207648_10000131
1393 Ga0207648_10000276
1394 Ga0207648_10013865
1395 Ga0207648_10015834
1396 Ga0207648_10115732
1397 Ga0207648_10690287
1398 Ga0207676_10001858
1399 Ga0207676_10024861
1400 Ga0207674_10348387
1401 Ga0207675_100000084
1402 Ga0207675_100003258
1403 Ga0207675_100015099
1404 Ga0207675_100038831
1405 Ga0207675_100083888
1406 Ga0207675_100242671
1407 Ga0207675_100375045
1408 Ga0207675_100547012
1409 Ga0207683_10000063
1410 Ga0207683_10006739
1411 Ga0207683_10131027
1412 Ga0207683_10318484
1413 Ga0209970_1013019
1414 Ga0209971_1005150
1415 Ga0207428_10012294
1416 Ga0207428_10013964
1417 Ga0268266_10007407
1418 Ga0268266_10023985
1419 Ga0268266_10110138
1420 Ga0268266_10118963
1421 Ga0268266_10331348
1422 Ga0268265_10002208
1423 Ga0268265_10005049
1424 Ga0268265_10006155
1425 Ga0268265_10014989
1426 Ga0268265_10032764
1427 Ga0268265_10065226
1428 Ga0268265_10071644
1429 Ga0268265_10762499
1430 Ga0268264_10195394
1431 Ga0268264_10458429
1432 Ga0268264_10705114
1433 Ga0307515_10115476
1434 Ga0265330_10016532
1435 Ga0265332_10000255
1436 Ga0265325_10017682
1437 Ga0265329_10001448
1438 Ga0265331_10000354
1439 Ga0265327_10024791
1440 Ga0265327_10025730
1441 Ga0265327_10082915
1442 Ga0265316_10142525
1443 Ga0307513_10003370
1444 Ga0307408_100070860
1445 Ga0307408_100092027
1446 Ga0265314_10017506
1447 Ga0265342_10082481
1448 Ga0307516_10009467
1449 Ga0307413_10398397
1450 Ga0307410_10001761
1451 Ga0307410_10010439
1452 Ga0307410_10261353
1453 Ga0307407_10013882
1454 Ga0307407_10035671
1455 Ga0307407_10133638
1456 Ga0307407_10234362
1457 Ga0307412_10006840
1458 Ga0307409_100016403
1459 Ga0307409_100087558
1460 Ga0307409_100220746
1461 Ga0307416_100000857
1462 Ga0307416_100021173
1463 Ga0307411_10099517
1464 Ga0307411_10101796
1465 Ga0307411_10233949
1466 Ga0307415_100014519
1467 Ga0307415_100032845
1468 Ga0307510_10356930
1469 Ga0373932_0048648
1470 Ga0373939_0013050
1471 Ga0373953_0045622
1472 Ga0373956_0056939
1473 Ga0373957_0004905
1474 Ga0373960_0018572
1475 Ga0373943_0349020
1476 Ga0373946_0050819
1477 Ga0373955_0025140
1478 Ga0373924_0027605
1479 Ga0373931_0052195
1480 Ga0373927_0007037
1481 Ga0373927_0334125
1482 Ga0373933_0014773
1483 Ga0373947_0030159
1484 Ga0373947_0086698
1485 Ga0373925_0004776
1486 Ga0373925_0519602
1487 Ga0395900_0066669
1488 Ga0395898_0026512
1489 Ga0395905_0026473
1490 Ga0395905_0060692
1491 Ga0395905_0416090
1492 Ga0395901_0000034
1493 Ga0395901_0010150
1494 Ga0439436_0005628
1495 Ga0439465_0040481
1496 Ga0439441_003123
1497 Ga0439442_007562
1498 Ga0439442_009716
1499 Ga0439448_0000260
1500 Ga0439449_0071712
1501 Ga0450923_002704
1502 Ga0450895_002269
1503 Ga0450898_003396
1504 Ga0450906_000773
1505 Ga0450908_002426
1506 Ga0439434_0001721
1507 Ga0439460_0044802
1508 Ga0450918_001559
1509 Ga0451577_0351657
1510 Ga0451577_0403473
1511 Ga0453684_0071736
1512 Ga0453684_0199301
1513 Ga0495617_022696
1514 Ga0495638_0000560
1515 Ga0495638_0163449
1516 Ga0495580_0038531
1517 Ga0495605_0015309
1518 Ga0495605_0035536
1519 Ga0495605_0195709
1520 Ga0495639_0062236
1521 Ga0495585_0158817
1522 Ga0495594_0157363
1523 Ga0495583_0109103
1524 Ga0495606_0001061
1525 Ga0495616_0024877
1526 Ga0495616_0154466
1527 Ga0495631_0009103
1528 Ga0495643_0001621
1529 Ga0495648_0084460
1530 Ga0495609_0055865
1531 Ga0495668_0006908
1532 Ga0495611_0018143
1533 Ga0495625_0000056
1534 Ga0495625_0018268
1535 Ga0495625_0021119
1536 Ga0495625_0281606
1537 Ga0495647_0161484
1538 Ga0495670_0271524
1539 Ga0495660_0033746
1540 Ga0495672_0007888
1541 Ga0495672_0014508
1542 Ga0495680_0055787
1543 Ga0495683_0022469
1544 Ga0495683_0227670
1545 Ga0495687_005257
1546 Ga0495687_081262
1547 Ga0495673_0012730
1548 Ga0495684_0304563
1549 Ga0495686_0000296
1550 Ga0495686_0044116
1551 Ga0495686_0242280
1552 Ga0495626_0068226
1553 Ga0496100_0011067
1554 Ga0496101_0022621
1555 Ga0496102_0061043
1556 Ga0496102_0760942
1557 Ga0496104_0044430
1558 Ga0496105_0000614
1559 Ga0496107_0166414
1560 Ga0496107_0266388
1561 Ga0496108_0000514
1562 Ga0496109_0021995
1563 Ga0496110_0234462
1564 Ga0496111_0012322
1565 Ga0496112_0040229
1566 Ga0496113_0001056
1567 Ga0496114_0090067
1568 Ga0496114_0466186
1569 Ga0496115_0017087
1570 Ga0496116_0009140
1571 Ga0496117_0034905
1572 Ga0496117_0173758
1573 Ga0496118_0038697
1574 Ga0496118_0104070
1575 Ga0496119_0005487
1576 Ga0496119_0046565
1577 Ga0496120_0027467
1578 Ga0496121_0001592
1579 Ga0496121_0008906
1580 Ga0496121_0110364
1581 Ga0496122_0010062
1582 Ga0496122_0079615
1583 Ga0496123_0042179
1584 Ga0496124_0000038
1585 Ga0496124_0000832
1586 Ga0496125_0006659
1587 Ga0496126_0000271
1588 Ga0495678_024566
1589 Ga0501034_0002148
1590 Ga0501034_0045066
1591 Ga0501034_0514280
1592 Ga0501034_0659027
1593 Ga0501036_0018757
1594 Ga0501037_0324760
1595 Ga0501038_0005280
1596 Ga0501039_0001702
1597 Ga0501039_0086530
1598 Ga0501039_0205890
1599 Ga0501039_0499411
1600 Ga0501040_0022891
1601 Ga0501041_0067650
1602 Ga0501042_0036769
1603 Ga0501043_0162816
1604 Ga0501043_0186423
1605 Ga0501046_0089115
1606 Ga0501048_0059377
1607 Ga0501068_0000570
1608 Ga0501069_0196979
1609 Ga0501070_0025223
1610 Ga0501071_0007699
1611 Ga0501072_0002218
1612 Ga0501072_0016870
1613 Ga0501073_0001398
1614 Ga0501073_0271224
1615 Ga0501074_0027087
1616 Ga0501075_0020157
1617 Ga0501075_0095975
1618 Ga0501076_0004326
1619 Ga0501076_0371778
1620 Ga0501077_0064148
1621 Ga0501077_0072087
1622 Ga0501079_0032202
1623 Ga0501080_0005302
1624 Ga0501080_0045443
1625 Ga0501081_0029064
1626 Ga0501083_0014156
1627 Ga0501035_0097496
1628 Ga0501044_0107500
1629 Ga0501044_0166023
1630 Ga0501045_0002479
1631 nmdc:mga03683_131735_c1
1632 nmdc:mga03683_4178_c1
1633 nmdc:mga03683_73_c1
1634 nmdc:mga03n38_14931_c1
1635 nmdc:mga03n38_30_c1
1636 nmdc:mga03n38_31794_c1
1637 nmdc:mga00v17_11142_c1
1638 nmdc:mga00v17_131_c1
1639 nmdc:mga00v17_262749_c1
1640 nmdc:mga00v17_2860_c1
1641 nmdc:mga0yw44_1201_c1
1642 nmdc:mga0yw44_198389_c1
1643 nmdc:mga0yw44_2547_c1
1644 nmdc:mga0yw44_35_c1
1645 nmdc:mga0k408_325_c1
1646 nmdc:mga0k408_42182_c1
1647 nmdc:mga0k408_7937_c1
1648 nmdc:mga04h51_99153_c1
1649 nmdc:mga07m45_347_c2
1650 nmdc:mga07m45_7798_c1
1651 nmdc:mga05p37_353560_c1
1652 nmdc:mga09592_11588_c1
1653 nmdc:mga09592_423693_c1
1654 nmdc:mga09592_544001_c1
1655 nmdc:mga0qj67_2908_c1
1656 nmdc:mga0qj67_31916_c1
1657 nmdc:mga0qj67_36005_c1
1658 nmdc:mga0qj67_402463_c1
1659 nmdc:mga08y16_117117_c1
1660 nmdc:mga08y16_157962_c1
1661 nmdc:mga08y16_26617_c1
1662 nmdc:mga08y16_51699_c1
1663 nmdc:mga0n895_280334_c1
1664 nmdc:mga0n895_55132_c1
1665 nmdc:mga08x19_10398_c1
1666 nmdc:mga08x19_154673_c1
1667 nmdc:mga08x19_56714_c1
1668 nmdc:mga08x19_80855_c2
1669 nmdc:mga0a205_210043_c1
1670 nmdc:mga0sz30_2289_c2
1671 Ga0495612_0033732
1672 Ga0495619_0109309
1673 Ga0495619_0162018
1674 Ga0500578_0023006
1675 Ga0500643_029683
1676 Ga0500646_0008307
1677 Ga0500646_0053111
1678 Ga0500557_001477
1679 Ga0500594_0032741
1680 Ga0500618_002182
1681 Ga0500658_0103965
1682 Ga0500568_0001168
1683 Ga0500568_0050160
1684 Ga0500577_0035447
1685 Ga0500577_0045624
1686 Ga0500586_011930
1687 Ga0500588_0016291
1688 Ga0500616_0001225
1689 Ga0500616_0075231
1690 Ga0500627_0009818
1691 Ga0500645_050348
1692 Ga0501084_0027700
1693 Ga0501084_0120938
1694 Ga0501082_0018354
1695 Ga0530510_0011074
1696 2511186229
1697 2513714824
1698 2514416724
1699 2585278184
1700 2585332823
1701 2585532156
1702 2585552516
1703 2585824802
1704 2586001525
1705 2616307702
1706 2616552130
1707 2617382764
1708 2643774890
1709 2643793334
1710 2644158897
1711 2644398227
1712 2671114145
1713 2723577587
1714 2738881197
1715 2739250374
1716 2739612038
1717 2778178407
1718 2792833842
1719 2793336138
1720 2819640401
1721 2821445013
1722 2838032679
1723 2838665293
1724 2842193718
1725 2842479411
1726 2842487042
1727 2842506430
1728 2844535288
1729 2847675414
1730 2856320335
1731 2856350526
1732 2857544787
1733 2874169212
1734 2878042645
1735 2881161485
1736 2881164151
1737 2885344496
1738 2885351166
1739 2906420885
1740 2919412531
1741 2928115253
1742 2928120550
1743 2945984983
1744 2961135989
1745 2968130750
1746 2990711057
1747 3004335576
1748 3005417273
1749 8005320479
1750 8005487450
1751 8005647854
1752 8005684307
1753 8024489427
1754 8055226854

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

52

242

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

58

296

0.92

PF08659

KR

KR domain

53

231

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dc1-assembly1.cif.gz_B crystal structure of y202f actinorhodin polyketide ketoreductase with nadph 0.9649 7 256
4nbu-assembly1.cif.gz_D crystal structure of fabg from bacillus sp 0.9638 5 251
3qrw-assembly1.cif.gz_B actinorhodin polyketide ketoreductase mutant p94l bound to nadph 0.9623 7 253
4dc0-assembly1.cif.gz_B crystal structure of f189w actinorhodin polyketide ketoreductase with nadph 0.9618 7 253
4dbz-assembly1.cif.gz_B crystal structure of v151l actinorhodin polyketide ketoreductase with nadph 0.9607 7 256
ID Description Score Start End Superfamily
2rhcB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9588 7 253 3.40.50.720
5itvA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9542 1 253 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9534 3 78 3.40.50.720
af_Q0JEC9_1_74_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.952 6 57 3.40.50.720
af_Q0ISZ5_12_118_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.952 6 87 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3C1N6A8-F1-model_v4 Short-chain dehydrogenase 0.9746 104 253
AF-A0A2E7TDC2-F1-model_v4 3-oxoacyl-ACP reductase 0.9695 6 254
AF-A0A7V1QTB5-F1-model_v4 SDR family oxidoreductase 0.969 1 257
AF-A0A661UD25-F1-model_v4 3-oxoacyl-ACP reductase 0.9681 1 258
AF-A0A6I5VG95-F1-model_v4 SDR family oxidoreductase 0.9675 6 254 GO:0016616

Map