F484394

General Info

Members Datasets Scaffolds Average Seq Length
877 414 1755 130

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_11146266|Ga0307410_111462662
Length 150
Sequence VTRVKGRGAFACARVSPRPMVQAMSTTTTEGIRVTVKPAYWPERSSPEGGQFAFMYTVEIANEGPEPAQLRRRHWLITDANGRVEEVKGEGVVGKQPRLAPGERFEYTSWAMLRTPFGTMRGTYSMVRPAGAQFEARIGEFALTQPHALH

Samples

Sample ID Description Type Environment
1 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
15 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
16 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
17 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
18 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
19 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
20 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
21 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
22 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
23 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
24 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
27 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
29 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
30 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
31 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
32 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
33 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
42 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
49 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
52 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
61 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
62 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
63 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
64 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
65 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
66 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
67 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
68 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
69 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
70 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
71 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
72 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
79 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
80 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
81 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
82 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
83 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
84 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
85 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
86 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
87 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
88 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
89 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
90 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
91 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
92 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
101 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
102 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
103 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
104 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
105 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
106 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
107 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
108 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
109 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
110 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
111 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
112 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
113 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
115 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
116 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
117 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
118 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
119 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
131 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
137 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
138 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
139 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
140 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
141 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
142 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
143 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
144 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
145 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
146 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
152 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
153 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
154 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
155 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
156 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
157 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
163 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
164 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
166 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
167 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
168 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
171 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
172 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
173 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
175 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
176 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
245 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
246 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
247 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
248 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
249 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
250 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
251 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
252 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
253 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
254 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
255 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
256 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
257 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
258 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
259 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
260 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
261 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
262 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
263 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
264 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
265 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
266 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
267 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
270 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
271 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
272 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
273 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
274 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
275 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
276 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
277 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
278 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
279 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
280 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
281 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
282 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
283 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
284 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
285 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
286 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
287 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
288 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
289 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
290 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
291 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
292 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
293 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
294 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
295 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
296 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
297 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
298 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
299 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
300 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
301 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
302 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
303 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
304 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
305 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
306 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
307 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
308 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
309 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
310 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
311 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
312 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
313 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
314 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
315 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
316 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
317 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
318 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
319 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
320 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
321 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
322 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
323 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
324 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
325 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
326 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
327 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
328 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
329 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
330 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
331 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
332 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
333 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
334 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
335 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
336 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
337 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
338 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
339 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
340 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
341 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
342 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
343 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
346 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
347 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
348 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
349 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
350 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
351 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
352 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
353 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
354 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
355 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
356 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
357 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
358 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
359 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
360 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
361 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
362 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
363 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
364 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
365 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
366 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
382 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
383 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
384 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
385 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
386 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
387 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
388 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
389 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
390 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
391 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
392 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
393 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
394 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
395 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
396 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
399 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
400 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
401 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
402 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
403 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
404 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
405 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
406 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
407 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
408 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
409 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
410 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
411 2643221593 Lysobacter sp. Root690 Isolate Unclassified
412 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
413 2739367700 Dyella sp. YR388 Isolate Unclassified
414 2884411467 Dyella sp. AD56 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 0.68
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.01
Nodule 0
Rhizoplane 3.53
Rhizosphere 79.82
Stem 0
Stem Tuber 0
Unclassified 1.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307410_11146266 3300031852 Bacteria 676
2 JGI24736J21556_1027090 3300001904 Bacteria 889
3 JGI24752J21851_1002551 3300001976 Bacteria 2427
4 JGI24747J21853_1010270 3300001978 Bacteria 935
5 JGI24740J21852_10005074 3300001979 Bacteria 5589
6 JGI24739J22299_10007103 3300001989 Bacteria 4214
7 JGI24739J22299_10082502 3300001989 Bacteria 986
8 JGI24737J22298_10001599 3300001990 Bacteria 8055
9 JGI24743J22301_10012732 3300001991 Bacteria 1534
10 JGI24735J21928_10001292 3300002067 Bacteria 8885
11 JGI24735J21928_10008461 3300002067 Bacteria 3325
12 JGI24735J21928_10081073 3300002067 Bacteria 929
13 JGI24749J21850_1000989 3300002076 Bacteria 4051
14 JGI24744J21845_10024618 3300002077 Bacteria 1177
15 JGI24034J26672_10000713 3300002239 Bacteria 4273
16 JGI24751J29686_10013501 3300002459 Bacteria 1686
17 JGI25156J39149_1001615 3300002705 Bacteria 9210
18 JGI25156J39149_1014311 3300002705 Bacteria 1642
19 JGI25162J39368_1000174 3300002737 Bacteria 69350
20 JGI25162J39368_1000799 3300002737 Bacteria 21011
21 JGI25162J39368_1002458 3300002737 Bacteria 7164
22 JGI25162J39368_1003791 3300002737 Bacteria 4018
23 JGI25154J39366_1004596 3300002738 Bacteria 2427
24 JGI25157J39369_1000121 3300002741 Bacteria 66489
25 JGI25157J39369_1001208 3300002741 Bacteria 10764
26 JGI25157J39369_1001410 3300002741 Bacteria 9198
27 JGI25163J39215_1000140 3300002771 Bacteria 28932
28 JGI25163J39215_1001585 3300002771 Bacteria 3448
29 JGI25164J39214_1000135 3300002772 Bacteria 71187
30 JGI25164J39214_1000141 3300002772 Bacteria 69350
31 JGI25152J39213_1028608 3300002773 Bacteria 885
32 JGI25165J46597_1000057 3300003214 Bacteria 217135
33 JGI25165J46597_1000262 3300003214 Bacteria 69350
34 JGI25153J46596_10021046 3300003215 Bacteria 2444
35 rootH1_10020131 3300003316 Bacteria 2359
36 rootH1_10020131 3300003323 Bacteria 6510
37 rootH1_10098222 3300003316 Bacteria 2448
38 rootH2_10001302 3300003320 Bacteria 24438
39 rootH1_10372931 3300003323 Bacteria 1026
40 Ga0006562J51391_1002853 3300003578 Bacteria 9440
41 Ga0006562J51391_1002854 3300003578 Bacteria 13271
42 JGI25404J52841_10001677 3300003659 Bacteria 3982
43 JGI25404J52841_10026272 3300003659 Bacteria 1253
44 Ga0055538_1002363 3300003751 Bacteria 2826
45 Ga0055533_1000961 3300003756 Bacteria 8482
46 Ga0055533_1001263 3300003756 Bacteria 6922
47 Ga0055527_1000531 3300003760 Bacteria 12858
48 Ga0055527_1002205 3300003760 Bacteria 3432
49 Ga0055535_1000173 3300003761 Bacteria 69346
50 Ga0055535_1001159 3300003761 Bacteria 15513
51 Ga0055535_1001344 3300003761 Bacteria 12967
52 Ga0055535_1001359 3300003761 Bacteria 12858
53 Ga0055542_1000221 3300003762 Bacteria 69350
54 Ga0055542_1000590 3300003762 Bacteria 31377
55 Ga0055542_1000857 3300003762 Bacteria 21323
56 Ga0055542_1001323 3300003762 Bacteria 12976
57 Ga0055542_1001336 3300003762 Bacteria 12858
58 Ga0055529_1000137 3300003763 Bacteria 103695
59 Ga0055529_1000236 3300003763 Bacteria 69350
60 Ga0055529_1001051 3300003763 Bacteria 12858
61 Ga0055531_10005644 3300003794 Bacteria 7275
62 Ga0065165_1001387 3300005262 Bacteria 26573
63 Ga0065714_10010934 3300005288 Bacteria 3923
64 Ga0065715_10093649 3300005293 Bacteria 4608
65 Ga0065715_10099085 3300005293 Bacteria 3460
66 Ga0065715_10796669 3300005293 Bacteria 611
67 Ga0065707_10267915 3300005295 Bacteria 1079
68 Ga0065707_10348916 3300005295 Bacteria 921
69 Ga0070658_10001169 3300005327 Bacteria 22419
70 Ga0070658_10622007 3300005327 Bacteria 936
71 Ga0070676_10003463 3300005328 Bacteria 8227
72 Ga0070683_100036105 3300005329 Bacteria 4521
73 Ga0070690_100000192 3300005330 Bacteria 31563
74 Ga0070690_100902558 3300005330 Bacteria 691
75 Ga0070670_100008353 3300005331 Bacteria 8826
76 Ga0070670_101482683 3300005331 Bacteria 623
77 Ga0070677_10000944 3300005333 Bacteria 9430
78 Ga0068869_100004010 3300005334 Bacteria 9106
79 Ga0068869_100179069 3300005334 Bacteria 1661
80 Ga0070666_10000655 3300005335 Bacteria 20873
81 Ga0070680_100005369 3300005336 Bacteria 9698
82 Ga0070680_100038107 3300005336 Bacteria 3887
83 Ga0070680_100047042 3300005336 Bacteria 3512
84 Ga0070680_100597949 3300005336 Bacteria 947
85 Ga0070682_100005794 3300005337 Bacteria 6898
86 Ga0070682_100010470 3300005337 Bacteria 5264
87 Ga0070682_100043714 3300005337 Bacteria 2771
88 Ga0070682_100150784 3300005337 Bacteria 1595
89 Ga0068868_100006069 3300005338 Bacteria 8532
90 Ga0070660_100000582 3300005339 Bacteria 24527
91 Ga0070689_100001359 3300005340 Bacteria 15534
92 Ga0070689_100018373 3300005340 Bacteria 5149
93 Ga0070687_100000421 3300005343 Bacteria 14326
94 Ga0070661_100013375 3300005344 Bacteria 5760
95 Ga0070661_100027836 3300005344 Bacteria 4074
96 Ga0070661_100057486 3300005344 Bacteria 2850
97 Ga0070661_100081678 3300005344 Bacteria 2386
98 Ga0070692_10003210 3300005345 Bacteria 6578
99 Ga0070692_10010485 3300005345 Bacteria 4219
100 Ga0070692_10019968 3300005345 Bacteria 3241
101 Ga0070668_100001586 3300005347 Bacteria 16454
102 Ga0070668_100025273 3300005347 Bacteria 4502
103 Ga0070668_100499222 3300005347 Bacteria 1053
104 Ga0070669_100006368 3300005353 Bacteria 8504
105 Ga0070669_100029845 3300005353 Bacteria 3934
106 Ga0070675_100007016 3300005354 Bacteria 8660
107 Ga0070671_100004375 3300005355 Bacteria 11168
108 Ga0070674_100000396 3300005356 Bacteria 21883
109 Ga0070673_100004706 3300005364 Bacteria 8660
110 Ga0070673_100349428 3300005364 Bacteria 1312
111 Ga0070688_100000714 3300005365 Bacteria 16375
112 Ga0070688_100081968 3300005365 Bacteria 2090
113 Ga0070659_100001614 3300005366 Bacteria 16241
114 Ga0070659_100006925 3300005366 Bacteria 8209
115 Ga0070659_100010207 3300005366 Bacteria 6908
116 Ga0070667_100002833 3300005367 Bacteria 14969
117 Ga0070703_10093625 3300005406 Bacteria 1046
118 Ga0070709_10397496 3300005434 Bacteria 1028
119 Ga0070714_100000800 3300005435 Bacteria 22264
120 Ga0070714_100001224 3300005435 Bacteria 18505
121 Ga0070701_10019128 3300005438 Bacteria 3232
122 Ga0070711_100546154 3300005439 Bacteria 961
123 Ga0070705_100028302 3300005440 Bacteria 3068
124 Ga0070700_100005676 3300005441 Bacteria 6621
125 Ga0070694_100115115 3300005444 Bacteria 1921
126 Ga0070694_100565122 3300005444 Bacteria 912
127 Ga0070708_100000215 3300005445 Bacteria 42925
128 Ga0070663_100002836 3300005455 Bacteria 9848
129 Ga0070663_100042899 3300005455 Bacteria 3181
130 Ga0070663_100101785 3300005455 Bacteria 2145
131 Ga0070663_101118717 3300005455 Bacteria 689
132 Ga0070678_100039348 3300005456 Bacteria 3335
133 Ga0070662_100000832 3300005457 Bacteria 18969
134 Ga0070662_100028898 3300005457 Bacteria 3864
135 Ga0070681_10004526 3300005458 Bacteria 13267
136 Ga0070681_10007658 3300005458 Bacteria 10561
137 Ga0070681_10084477 3300005458 Bacteria 3127
138 Ga0070681_10093457 3300005458 Bacteria 2956
139 Ga0068867_100000327 3300005459 Bacteria 31347
140 Ga0068867_100353933 3300005459 Bacteria 1226
141 Ga0068867_100947905 3300005459 Bacteria 777
142 Ga0070685_10000059 3300005466 Bacteria 64287
143 Ga0070685_10034425 3300005466 Bacteria 2853
144 Ga0070706_100000062 3300005467 Bacteria 129915
145 Ga0070707_100005437 3300005468 Bacteria 11912
146 Ga0070698_100250417 3300005471 Bacteria 1704
147 Ga0070699_100009284 3300005518 Bacteria 8521
148 Ga0070699_100278067 3300005518 Bacteria 1499
149 Ga0070679_100029431 3300005530 Bacteria 5419
150 Ga0070679_100176610 3300005530 Bacteria 2108
151 Ga0070679_100443051 3300005530 Bacteria 1244
152 Ga0070679_100712732 3300005530 Bacteria 946
153 Ga0070684_100180774 3300005535 Bacteria 1918
154 Ga0070684_100808920 3300005535 Bacteria 876
155 Ga0070684_101501450 3300005535 Bacteria 635
156 Ga0070697_100012945 3300005536 Bacteria 6537
157 Ga0070697_100273179 3300005536 Unclassified 1449
158 Ga0068853_100000641 3300005539 Bacteria 23961
159 Ga0068853_100010261 3300005539 Bacteria 7576
160 Ga0068853_100084743 3300005539 Bacteria 2777
161 Ga0068853_100485990 3300005539 Bacteria 1164
162 Ga0068853_100942117 3300005539 Bacteria 830
163 Ga0070672_100000383 3300005543 Bacteria 25666
164 Ga0070686_100000062 3300005544 Bacteria 82388
165 Ga0070695_100108329 3300005545 Bacteria 1881
166 Ga0070696_100001234 3300005546 Bacteria 16603
167 Ga0070696_100003989 3300005546 Bacteria 9837
168 Ga0070696_100024501 3300005546 Bacteria 4102
169 Ga0070696_100214055 3300005546 Bacteria 1443
170 Ga0070696_100364050 3300005546 Bacteria 1123
171 Ga0070693_100013868 3300005547 Bacteria 4115
172 Ga0070693_100223684 3300005547 Bacteria 1235
173 Ga0070665_100038372 3300005548 Bacteria 4815
174 Ga0070665_100339049 3300005548 Bacteria 1508
175 Ga0070665_100410725 3300005548 Bacteria 1362
176 Ga0070665_100781382 3300005548 Bacteria 968
177 Ga0068855_100016460 3300005563 Bacteria 8891
178 Ga0068855_100045967 3300005563 Bacteria 5161
179 Ga0068855_100048124 3300005563 Bacteria 5034
180 Ga0068855_100064449 3300005563 Bacteria 4274
181 Ga0070664_100001494 3300005564 Bacteria 18618
182 Ga0070664_100007300 3300005564 Bacteria 8909
183 Ga0068857_100002699 3300005577 Bacteria 14564
184 Ga0068857_100008936 3300005577 Bacteria 8679
185 Ga0068857_100038299 3300005577 Bacteria 4246
186 Ga0068857_100070688 3300005577 Bacteria 3109
187 Ga0068857_100422579 3300005577 Bacteria 1243
188 Ga0068857_100523969 3300005577 Bacteria 1114
189 Ga0068854_100004456 3300005578 Bacteria 8832
190 Ga0068854_100012583 3300005578 Bacteria 5543
191 Ga0068854_100074596 3300005578 Bacteria 2489
192 Ga0068856_100011571 3300005614 Bacteria 8558
193 Ga0068856_100030389 3300005614 Bacteria 5281
194 Ga0068856_100035257 3300005614 Bacteria 4902
195 Ga0070702_100042638 3300005615 Bacteria 2553
196 Ga0068852_100001398 3300005616 Bacteria 16240
197 Ga0068852_100045413 3300005616 Bacteria 3736
198 Ga0068859_100012397 3300005617 Bacteria 8575
199 Ga0068859_100216631 3300005617 Bacteria 2002
200 Ga0068864_100006910 3300005618 Bacteria 9307
201 Ga0068866_10000168 3300005718 Bacteria 30242
202 Ga0068861_100000261 3300005719 Bacteria 29377
203 Ga0068851_10000556 3300005834 Bacteria 16239
204 Ga0068870_10000118 3300005840 Bacteria 27021
205 Ga0068870_11325138 3300005840 Bacteria 525
206 Ga0068863_100001331 3300005841 Bacteria 24609
207 Ga0068863_100164937 3300005841 Bacteria 2124
208 Ga0068858_100010373 3300005842 Bacteria 8826
209 Ga0068860_100001978 3300005843 Bacteria 21670
210 Ga0068860_100013797 3300005843 Bacteria 7922
211 Ga0068860_100330674 3300005843 Bacteria 1497
212 Ga0068860_100542694 3300005843 Bacteria 1164
213 Ga0068862_100002379 3300005844 Bacteria 16736
214 Ga0068862_100141944 3300005844 Bacteria 2132
215 Ga0068862_100283626 3300005844 Bacteria 1519
216 Ga0068862_100910284 3300005844 Bacteria 865
217 Ga0081540_1000052 3300005983 Bacteria 124880
218 Ga0081540_1002995 3300005983 Bacteria 13538
219 Ga0081540_1003052 3300005983 Bacteria 13414
220 Ga0070717_10366126 3300006028 Bacteria 1291
221 Ga0070712_100389922 3300006175 Bacteria 1148
222 Ga0097621_100005637 3300006237 Bacteria 8830
223 Ga0068871_100004801 3300006358 Bacteria 9451
224 Ga0068871_100038609 3300006358 Bacteria 3814
225 Ga0075428_100051182 3300006844 Bacteria 4529
226 Ga0075430_100117515 3300006846 Bacteria 2217
227 Ga0075431_100212641 3300006847 Bacteria 1975
228 Ga0075434_101138781 3300006871 Bacteria 793
229 Ga0075429_100874908 3300006880 Bacteria 786
230 Ga0068865_100000171 3300006881 Bacteria 35966
231 Ga0068865_100766664 3300006881 Bacteria 830
232 Ga0097620_100012396 3300006931 Bacteria 8575
233 Ga0097620_100216633 3300006931 Bacteria 2002
234 Ga0099794_10000002 3300007265 Bacteria 155314
235 Ga0105240_10006019 3300009093 Bacteria 17933
236 Ga0105240_10016826 3300009093 Bacteria 9885
237 Ga0105240_10019280 3300009093 Bacteria 9118
238 Ga0105240_10101550 3300009093 Bacteria 3498
239 Ga0105240_10151053 3300009093 Bacteria 2766
240 Ga0105240_12675978 3300009093 Bacteria 515
241 Ga0111539_10215925 3300009094 Bacteria 2234
242 Ga0105245_10000986 3300009098 Bacteria 25916
243 Ga0105247_10004633 3300009101 Bacteria 8764
244 Ga0105247_11166581 3300009101 Bacteria 611
245 Ga0105243_10072502 3300009148 Bacteria 2788
246 Ga0105243_11469550 3300009148 Bacteria 704
247 Ga0105241_10004755 3300009174 Bacteria 10006
248 Ga0105241_10090258 3300009174 Bacteria 2416
249 Ga0105241_10137732 3300009174 Bacteria 1984
250 Ga0105241_10590896 3300009174 Bacteria 1002
251 Ga0105242_10007126 3300009176 Bacteria 8629
252 Ga0105242_12906443 3300009176 Bacteria 529
253 Ga0105248_10009383 3300009177 Bacteria 10772
254 Ga0105248_11451331 3300009177 Bacteria 776
255 Ga0105237_10000011 3300009545 Bacteria 307361
256 Ga0105237_10013041 3300009545 Bacteria 8726
257 Ga0105237_10122645 3300009545 Bacteria 2593
258 Ga0105238_10002809 3300009551 Bacteria 17372
259 Ga0105238_10023038 3300009551 Bacteria 6350
260 Ga0105238_10177993 3300009551 Bacteria 2103
261 Ga0105238_10608270 3300009551 Bacteria 1101
262 Ga0105238_10732244 3300009551 Bacteria 1002
263 Ga0105238_11568987 3300009551 Bacteria 688
264 Ga0105249_10009045 3300009553 Bacteria 8706
265 Ga0105239_10000304 3300010375 Bacteria 72715
266 Ga0105239_10007657 3300010375 Bacteria 12374
267 Ga0105239_10063304 3300010375 Bacteria 4061
268 Ga0105239_10328870 3300010375 Bacteria 1724
269 Ga0105239_12000931 3300010375 Bacteria 673
270 Ga0105246_10000353 3300011119 Bacteria 24710
271 Ga0157322_1045309 3300012490 Bacteria 518
272 Ga0157314_1000094 3300012500 Bacteria 9307
273 Ga0157373_10005244 3300013100 Bacteria 9731
274 Ga0157373_10023134 3300013100 Bacteria 4506
275 Ga0157371_10006820 3300013102 Bacteria 9332
276 Ga0157370_10049982 3300013104 Bacteria 3998
277 Ga0157370_10238385 3300013104 Bacteria 1683
278 Ga0157370_10604488 3300013104 Bacteria 1004
279 Ga0157369_10000925 3300013105 Bacteria 37347
280 Ga0157369_10016633 3300013105 Bacteria 8270
281 Ga0157369_10034772 3300013105 Bacteria 5528
282 Ga0157369_10164420 3300013105 Bacteria 2341
283 Ga0157374_10048493 3300013296 Bacteria 3940
284 Ga0157378_10000826 3300013297 Bacteria 28832
285 Ga0163162_10020828 3300013306 Bacteria 6447
286 Ga0163162_10083593 3300013306 Bacteria 3266
287 Ga0163162_10430932 3300013306 Unclassified 1451
288 Ga0157372_10014312 3300013307 Bacteria 8481
289 Ga0157372_10017225 3300013307 Bacteria 7755
290 Ga0157372_10053699 3300013307 Bacteria 4492
291 Ga0157372_10985556 3300013307 Bacteria 976
292 Ga0157375_10009145 3300013308 Bacteria 8683
293 Ga0157375_12086454 3300013308 Bacteria 674
294 Ga0157380_10048773 3300014326 Bacteria 3337
295 Ga0157380_10077604 3300014326 Bacteria 2707
296 Ga0157377_10001977 3300014745 Bacteria 8972
297 Ga0157379_10005888 3300014968 Bacteria 10550
298 Ga0157376_10061276 3300014969 Bacteria 3162
299 Ga0157376_10126764 3300014969 Bacteria 2272
300 Ga0157376_10345488 3300014969 Bacteria 1422
301 Ga0182006_1001805 3300015261 Bacteria 12330
302 Ga0182006_1040395 3300015261 Bacteria 1837
303 Ga0182007_10070984 3300015262 Bacteria 1141
304 Ga0182005_1001291 3300015265 Bacteria 10294
305 Ga0183368_1003 3300015687 Bacteria 1276390
306 Ga0213872_10028934 3300021361 Bacteria 2541
307 Ga0213872_10151572 3300021361 Bacteria 1013
308 Ga0209435_110217 3300025206 Bacteria 1017
309 Ga0209760_100306 3300025207 Bacteria 16339
310 Ga0209784_100137 3300025224 Bacteria 69520
311 Ga0209566_105730 3300025225 Bacteria 1529
312 Ga0209674_100079 3300025226 Bacteria 205836
313 Ga0209674_100485 3300025226 Bacteria 16899
314 Ga0209672_100055 3300025228 Bacteria 221655
315 Ga0209672_100189 3300025228 Bacteria 50005
316 Ga0209672_101206 3300025228 Bacteria 10484
317 Ga0209672_101415 3300025228 Bacteria 8714
318 Ga0209672_106886 3300025228 Bacteria 1804
319 Ga0207427_100053 3300025231 Bacteria 217191
320 Ga0207427_100134 3300025231 Bacteria 91077
321 Ga0207427_100176 3300025231 Bacteria 69443
322 Ga0207427_101195 3300025231 Bacteria 10082
323 Ga0209437_100005 3300025233 Bacteria 1071596
324 Ga0209437_100059 3300025233 Bacteria 355048
325 Ga0209437_100108 3300025233 Bacteria 217191
326 Ga0209437_100200 3300025233 Bacteria 119306
327 Ga0209437_100214 3300025233 Bacteria 107034
328 Ga0209437_102717 3300025233 Bacteria 3349
329 Ga0209258_100027 3300025242 Bacteria 518449
330 Ga0209258_100055 3300025242 Bacteria 337291
331 Ga0209258_100135 3300025242 Bacteria 170832
332 Ga0209258_100152 3300025242 Bacteria 160154
333 Ga0209258_100383 3300025242 Bacteria 56544
334 Ga0209258_103518 3300025242 Bacteria 3337
335 Ga0209258_111660 3300025242 Bacteria 1100
336 Ga0207425_1044919 3300025245 Bacteria 828
337 Ga0209646_1001049 3300025246 Bacteria 8335
338 Ga0209646_1002876 3300025246 Bacteria 3596
339 Ga0209026_1000017 3300025250 Bacteria 385214
340 Ga0209026_1000245 3300025250 Bacteria 69469
341 Ga0209026_1000510 3300025250 Bacteria 27418
342 Ga0209026_1002866 3300025250 Bacteria 6088
343 Ga0209026_1019426 3300025250 Bacteria 1064
344 Ga0209677_101983 3300025253 Bacteria 8133
345 Ga0209148_1000001 3300025254 Bacteria 2545271
346 Ga0209148_1000002 3300025254 Bacteria 2399500
347 Ga0209148_1000014 3300025254 Bacteria 925277
348 Ga0209148_1000058 3300025254 Bacteria 357482
349 Ga0209148_1000102 3300025254 Bacteria 216658
350 Ga0209759_1000159 3300025256 Bacteria 116456
351 Ga0209759_1000290 3300025256 Bacteria 69409
352 Ga0209759_1000386 3300025256 Bacteria 55050
353 Ga0209759_1002995 3300025256 Bacteria 6998
354 Ga0209759_1010654 3300025256 Bacteria 2679
355 Ga0209129_1001206 3300025258 Bacteria 14869
356 Ga0209233_1000002 3300025261 Bacteria 2501366
357 Ga0209233_1000011 3300025261 Bacteria 1071611
358 Ga0209233_1000125 3300025261 Bacteria 217190
359 Ga0209233_1000193 3300025261 Bacteria 126812
360 Ga0209455_1000014 3300025272 Bacteria 806601
361 Ga0209455_1000018 3300025272 Bacteria 718034
362 Ga0209455_1000019 3300025272 Bacteria 705658
363 Ga0209455_1007632 3300025272 Bacteria 3029
364 Ga0209758_1001184 3300025297 Bacteria 32994
365 Ga0207426_1081283 3300025302 Bacteria 878
366 Ga0209257_1001357 3300025304 Bacteria 29616
367 Ga0207697_10000259 3300025315 Bacteria 29159
368 Ga0207656_10007415 3300025321 Bacteria 3993
369 Ga0207682_10000086 3300025893 Bacteria 41922
370 Ga0207642_10002030 3300025899 Bacteria 6245
371 Ga0207710_10007230 3300025900 Bacteria 4704
372 Ga0207688_10001840 3300025901 Bacteria 11329
373 Ga0207680_10018816 3300025903 Bacteria 3681
374 Ga0207647_10001342 3300025904 Bacteria 18911
375 Ga0207647_10001533 3300025904 Bacteria 17798
376 Ga0207647_10002912 3300025904 Bacteria 12885
377 Ga0207647_10132322 3300025904 Bacteria 1465
378 Ga0207699_11236951 3300025906 Bacteria 553
379 Ga0207645_10000060 3300025907 Bacteria 77635
380 Ga0207643_10000063 3300025908 Bacteria 70685
381 Ga0207705_10009402 3300025909 Bacteria 7106
382 Ga0207705_10026464 3300025909 Bacteria 4137
383 Ga0207705_10831391 3300025909 Bacteria 716
384 Ga0207684_10000055 3300025910 Bacteria 216970
385 Ga0207654_10134295 3300025911 Bacteria 1570
386 Ga0207707_10003865 3300025912 Bacteria 13285
387 Ga0207707_10019046 3300025912 Bacteria 5989
388 Ga0207707_10029942 3300025912 Bacteria 4759
389 Ga0207707_10060467 3300025912 Bacteria 3296
390 Ga0207695_10000901 3300025913 Bacteria 53440
391 Ga0207695_10017281 3300025913 Bacteria 8399
392 Ga0207695_10042448 3300025913 Bacteria 4857
393 Ga0207695_10079331 3300025913 Bacteria 3327
394 Ga0207671_10000011 3300025914 Bacteria 530349
395 Ga0207671_10009660 3300025914 Bacteria 8039
396 Ga0207693_10624786 3300025915 Bacteria 838
397 Ga0207660_10051911 3300025917 Bacteria 2917
398 Ga0207660_10296306 3300025917 Bacteria 1287
399 Ga0207662_10000019 3300025918 Bacteria 74468
400 Ga0207662_11208255 3300025918 Bacteria 537
401 Ga0207657_10000107 3300025919 Bacteria 80870
402 Ga0207657_10361004 3300025919 Bacteria 1145
403 Ga0207649_10002559 3300025920 Bacteria 10115
404 Ga0207649_10003756 3300025920 Bacteria 8285
405 Ga0207649_10221957 3300025920 Bacteria 1347
406 Ga0207652_10093744 3300025921 Bacteria 2643
407 Ga0207652_10156936 3300025921 Bacteria 2039
408 Ga0207652_10608206 3300025921 Bacteria 980
409 Ga0207646_10014416 3300025922 Bacteria 7506
410 Ga0207681_10002278 3300025923 Bacteria 12192
411 Ga0207681_10232955 3300025923 Bacteria 1430
412 Ga0207681_10846354 3300025923 Bacteria 765
413 Ga0207694_10011028 3300025924 Bacteria 6826
414 Ga0207694_10015057 3300025924 Bacteria 5832
415 Ga0207694_10090967 3300025924 Bacteria 2408
416 Ga0207694_10155499 3300025924 Bacteria 1844
417 Ga0207694_10833908 3300025924 Bacteria 779
418 Ga0207694_10864934 3300025924 Bacteria 764
419 Ga0207650_10000217 3300025925 Bacteria 65387
420 Ga0207650_11805351 3300025925 Bacteria 517
421 Ga0207659_10003946 3300025926 Bacteria 8955
422 Ga0207687_10005234 3300025927 Bacteria 8601
423 Ga0207700_10000529 3300025928 Bacteria 22476
424 Ga0207664_10000184 3300025929 Bacteria 47854
425 Ga0207664_10008340 3300025929 Bacteria 7222
426 Ga0207664_10042947 3300025929 Bacteria 3533
427 Ga0207644_10003802 3300025931 Bacteria 9779
428 Ga0207690_10004659 3300025932 Bacteria 8111
429 Ga0207690_10007499 3300025932 Bacteria 6476
430 Ga0207690_10021254 3300025932 Bacteria 4022
431 Ga0207690_10025582 3300025932 Bacteria 3708
432 Ga0207690_10232485 3300025932 Bacteria 1416
433 Ga0207706_10000082 3300025933 Bacteria 98165
434 Ga0207706_10867819 3300025933 Bacteria 764
435 Ga0207686_10010797 3300025934 Bacteria 4979
436 Ga0207709_10096918 3300025935 Bacteria 1941
437 Ga0207670_10001214 3300025936 Bacteria 13604
438 Ga0207670_10001255 3300025936 Bacteria 13396
439 Ga0207669_10000175 3300025937 Bacteria 30022
440 Ga0207704_10002688 3300025938 Bacteria 8020
441 Ga0207691_10011213 3300025940 Bacteria 8602
442 Ga0207711_10003670 3300025941 Bacteria 13265
443 Ga0207689_10000015 3300025942 Bacteria 118820
444 Ga0207689_10298243 3300025942 Bacteria 1336
445 Ga0207661_10003856 3300025944 Bacteria 10453
446 Ga0207679_10000344 3300025945 Bacteria 33854
447 Ga0207679_10004959 3300025945 Bacteria 8303
448 Ga0207679_10198890 3300025945 Bacteria 1673
449 Ga0207667_10000249 3300025949 Bacteria 75885
450 Ga0207667_10016458 3300025949 Bacteria 8356
451 Ga0207667_10082221 3300025949 Bacteria 3336
452 Ga0207667_11014402 3300025949 Bacteria 817
453 Ga0207651_10002506 3300025960 Bacteria 8762
454 Ga0207651_10318904 3300025960 Bacteria 1299
455 Ga0207712_10003509 3300025961 Bacteria 9898
456 Ga0207668_10004928 3300025972 Bacteria 7850
457 Ga0207668_10015892 3300025972 Bacteria 4686
458 Ga0207640_10000364 3300025981 Bacteria 29455
459 Ga0207640_10001892 3300025981 Bacteria 11232
460 Ga0207640_10009710 3300025981 Bacteria 5394
461 Ga0207640_10452234 3300025981 Bacteria 1059
462 Ga0207640_11016935 3300025981 Bacteria 730
463 Ga0207658_10002649 3300025986 Bacteria 12969
464 Ga0207677_10002100 3300026023 Bacteria 10481
465 Ga0207703_10000645 3300026035 Bacteria 34976
466 Ga0207639_10003460 3300026041 Bacteria 10623
467 Ga0207639_10053036 3300026041 Bacteria 3092
468 Ga0207639_11017433 3300026041 Bacteria 776
469 Ga0207639_11705965 3300026041 Bacteria 590
470 Ga0207678_10000679 3300026067 Bacteria 31132
471 Ga0207678_10038207 3300026067 Bacteria 4172
472 Ga0207678_10046566 3300026067 Bacteria 3750
473 Ga0207678_10158062 3300026067 Bacteria 1936
474 Ga0207708_10013605 3300026075 Bacteria 6080
475 Ga0207702_10005156 3300026078 Bacteria 11496
476 Ga0207702_10342609 3300026078 Bacteria 1428
477 Ga0207641_10007878 3300026088 Bacteria 8837
478 Ga0207641_10076873 3300026088 Bacteria 2888
479 Ga0207648_10011519 3300026089 Bacteria 8326
480 Ga0207676_10000901 3300026095 Bacteria 23045
481 Ga0207674_10000146 3300026116 Bacteria 82851
482 Ga0207674_10001829 3300026116 Bacteria 27153
483 Ga0207674_10044214 3300026116 Bacteria 4588
484 Ga0207674_10125646 3300026116 Bacteria 2531
485 Ga0207674_10550675 3300026116 Bacteria 1114
486 Ga0207674_11215565 3300026116 Bacteria 723
487 Ga0207675_100001513 3300026118 Bacteria 23288
488 Ga0207675_100089712 3300026118 Bacteria 2889
489 Ga0207683_10007433 3300026121 Bacteria 9394
490 Ga0207698_10004222 3300026142 Bacteria 8737
491 Ga0207698_10030374 3300026142 Bacteria 3884
492 Ga0209588_1000002 3300027671 Bacteria 311181
493 Ga0268266_10009240 3300028379 Bacteria 8696
494 Ga0268266_10757387 3300028379 Bacteria 937
495 Ga0268266_11280892 3300028379 Bacteria 708
496 Ga0268265_10000898 3300028380 Bacteria 27688
497 Ga0268265_10132315 3300028380 Bacteria 2075
498 Ga0268265_10420157 3300028380 Bacteria 1241
499 Ga0268265_10440017 3300028380 Bacteria 1215
500 Ga0268264_10001012 3300028381 Bacteria 28511
501 Ga0268264_10009703 3300028381 Bacteria 7971
502 Ga0268264_10544092 3300028381 Bacteria 1138
503 Ga0265337_1002365 3300028556 Bacteria 8711
504 Ga0265318_10030498 3300028577 Unclassified 2098
505 Ga0265336_10116721 3300028666 Bacteria 795
506 Ga0307515_10157860 3300028794 Bacteria 2331
507 Ga0265324_10000895 3300029957 Bacteria 18950
508 Ga0265324_10172621 3300029957 Bacteria 734
509 Ga0265328_10004451 3300031239 Bacteria 6087
510 Ga0265331_10000019 3300031250 Bacteria 258837
511 Ga0265327_10002529 3300031251 Bacteria 19058
512 Ga0265327_10093721 3300031251 Bacteria 1460
513 Ga0265327_10217940 3300031251 Bacteria 859
514 Ga0265316_10648754 3300031344 Bacteria 746
515 Ga0316575_10069954 3300031665 Bacteria 1409
516 Ga0316579_10001767 3300031691 Bacteria 7956
517 Ga0316579_10009503 3300031691 Bacteria 4091
518 Ga0316579_10028523 3300031691 Bacteria 2541
519 Ga0316579_10216814 3300031691 Bacteria 925
520 Ga0316579_10359543 3300031691 Bacteria 704
521 Ga0316576_10061268 3300031727 Bacteria 2757
522 Ga0316576_10692130 3300031727 Bacteria 739
523 Ga0316578_10007346 3300031728 Bacteria 5517
524 Ga0316578_10015531 3300031728 Bacteria 4097
525 Ga0316578_10026435 3300031728 Bacteria 3274
526 Ga0316578_10032872 3300031728 Bacteria 2967
527 Ga0316578_10120660 3300031728 Bacteria 1576
528 Ga0307405_10943373 3300031731 Bacteria 733
529 Ga0316577_10018570 3300031733 Bacteria 3847
530 Ga0316577_10140311 3300031733 Bacteria 1361
531 Ga0316577_10298701 3300031733 Bacteria 912
532 Ga0307413_10087012 3300031824 Bacteria 2022
533 Ga0307413_10969090 3300031824 Bacteria 727
534 Ga0307412_10001623 3300031911 Bacteria 12397
535 Ga0307412_10428235 3300031911 Bacteria 1084
536 Ga0307412_11090368 3300031911 Bacteria 710
537 Ga0307416_100498182 3300032002 Bacteria 1282
538 Ga0307416_100541586 3300032002 Bacteria 1236
539 Ga0307416_100870345 3300032002 Bacteria 1000
540 Ga0307416_102291728 3300032002 Bacteria 640
541 Ga0307414_10274513 3300032004 Bacteria 1413
542 Ga0307415_100063311 3300032126 Bacteria 2570
543 Ga0307415_102154812 3300032126 Bacteria 545
544 Ga0316583_10018715 3300032133 Bacteria 2487
545 Ga0316585_10005626 3300032137 Bacteria 3544
546 Ga0316580_10006578 3300032139 Bacteria 3435
547 Ga0316580_10013605 3300032139 Bacteria 2480
548 Ga0316580_10082946 3300032139 Bacteria 980
549 Ga0316593_10009903 3300032168 Unclassified 2713
550 Ga0316593_10049729 3300032168 Bacteria 1413
551 Ga0316593_10146177 3300032168 Bacteria 858
552 Ga0316587_1050698 3300033529 Unclassified 760
553 Ga0373950_0034588 3300034818 Bacteria 948
554 Ga0373958_0170028 3300034819 Bacteria 556
555 Ga0373943_0063635 3300035170 Unclassified 1850
556 Ga0373943_0642784 3300035170 Bacteria 627
557 Ga0373961_0170227 3300035241 Bacteria 753
558 Ga0373961_0315410 3300035241 Bacteria 582
559 Ga0316574_0017240 3300035398 Bacteria 4224
560 Ga0316574_0017647 3300035398 Unclassified 4181
561 Ga0316574_0304960 3300035398 Bacteria 1012
562 Ga0373931_0436816 3300035691 Bacteria 835
563 Ga0373933_0740021 3300035724 Bacteria 647
564 Ga0316582_0003645 3300036647 Bacteria 7603
565 Ga0316582_0038833 3300036647 Bacteria 2961
566 Ga0316582_0041932 3300036647 Bacteria 2864
567 Ga0316582_0062704 3300036647 Bacteria 2387
568 Ga0316582_0077738 3300036647 Bacteria 2160
569 Ga0316582_0557975 3300036647 Bacteria 789
570 Ga0316584_0017144 3300036712 Bacteria 5202
571 Ga0316584_0047640 3300036712 Bacteria 3202
572 Ga0316584_0094058 3300036712 Bacteria 2244
573 Ga0316584_0142091 3300036712 Bacteria 1789
574 Ga0316584_0390303 3300036712 Bacteria 993
575 Ga0316584_0454491 3300036712 Bacteria 905
576 Ga0373925_0102077 3300037068 Unclassified 2206
577 Ga0395899_0000076 3300037312 Bacteria 177673
578 Ga0395899_0027518 3300037312 Bacteria 4285
579 Ga0395899_0086213 3300037312 Bacteria 2281
580 Ga0395899_0338012 3300037312 Bacteria 1010
581 Ga0395900_0000024 3300037418 Bacteria 323480
582 Ga0395900_0114784 3300037418 Bacteria 2764
583 Ga0395898_0000044 3300037466 Bacteria 298164
584 Ga0395898_0000132 3300037466 Bacteria 192211
585 Ga0395898_0014285 3300037466 Bacteria 8160
586 Ga0316581_0004753 3300037588 Bacteria 3492
587 Ga0316581_0053324 3300037588 Bacteria 1239
588 Ga0316581_0281752 3300037588 Unclassified 510
589 Ga0395901_0000951 3300038443 Bacteria 31516
590 Ga0395901_0106818 3300038443 Bacteria 2938
591 Ga0395901_0108624 3300038443 Bacteria 2912
592 Ga0395901_0131640 3300038443 Bacteria 2628
593 Ga0395901_0157079 3300038443 Bacteria 2389
594 Ga0395901_0159818 3300038443 Bacteria 2366
595 Ga0395901_0198401 3300038443 Bacteria 2104
596 Ga0400485_18116 3300038735 Bacteria 1767
597 Ga0400488_59519 3300038741 Bacteria 1771
598 Ga0400488_60711 3300038741 Unclassified 3616
599 Ga0400486_00835 3300038742 Bacteria 2841
600 Ga0400483_116796 3300039062 Bacteria 1338
601 Ga0400483_149709 3300039062 Bacteria 1519
602 Ga0400483_225876 3300039062 Bacteria 3371
603 Ga0400489_48498 3300039093 Bacteria 28665
604 Ga0400487_19854 3300039110 Bacteria 3443
605 Ga0400487_24814 3300039110 Bacteria 29015
606 Ga0436361_0243182 3300039447 Bacteria 26202
607 Ga0436361_0972619 3300039447 Bacteria 1945
608 Ga0436363_0765819 3300039450 Bacteria 532
609 Ga0439436_0003593 3300041404 Bacteria 4715
610 Ga0451793_0040926 3300041452 Bacteria 942
611 Ga0451797_0144330 3300041453 Bacteria 1906
612 Ga0451800_0021606 3300041459 Bacteria 905
613 Ga0451802_0760283 3300041460 Bacteria 958
614 Ga0451843_0434061 3300041509 Bacteria 1049
615 Ga0451843_0680532 3300041509 Bacteria 1701
616 Ga0439437_000270 3300042000 Bacteria 4781
617 Ga0439448_0031845 3300042005 Bacteria 1676
618 Ga0439448_0087133 3300042005 Bacteria 1053
619 Ga0439449_0054897 3300042007 Bacteria 1472
620 Ga0439455_0019486 3300042012 Bacteria 1600
621 Ga0439455_0053933 3300042012 Bacteria 1055
622 Ga0450914_018313 3300042118 Bacteria 759
623 Ga0450906_080001 3300042145 Unclassified 589
624 Ga0439459_0138087 3300042438 Bacteria 628
625 Ga0451577_0002920 3300042876 Bacteria 19599
626 Ga0451577_0015493 3300042876 Bacteria 7092
627 Ga0451577_0275651 3300042876 Bacteria 1523
628 Ga0451577_0504532 3300042876 Bacteria 1098
629 Ga0466988_0148510 3300044536 Bacteria 1367
630 Ga0466969_0001879 3300044656 Bacteria 11228
631 Ga0466969_0040260 3300044656 Bacteria 2341
632 Ga0466969_0070873 3300044656 Bacteria 1676
633 Ga0466969_0081100 3300044656 Bacteria 1548
634 Ga0466989_0055559 3300044663 Bacteria 2426
635 Ga0466982_0000012 3300044672 Bacteria 166823
636 Ga0466965_0018781 3300044683 Bacteria 3317
637 Ga0466965_0061289 3300044683 Bacteria 1880
638 Ga0466965_0277825 3300044683 Bacteria 904
639 Ga0466966_0008238 3300044684 Bacteria 6911
640 Ga0466966_0010292 3300044684 Bacteria 6206
641 Ga0466966_0030985 3300044684 Bacteria 3469
642 Ga0466966_0269050 3300044684 Bacteria 1025
643 Ga0466961_0004498 3300044693 Bacteria 8740
644 Ga0466961_0008198 3300044693 Bacteria 6655
645 Ga0466961_0009092 3300044693 Bacteria 6332
646 Ga0466961_0021791 3300044693 Bacteria 4122
647 Ga0466961_0059458 3300044693 Bacteria 2430
648 Ga0466961_0264850 3300044693 Bacteria 1053
649 Ga0466961_0689460 3300044693 Bacteria 612
650 Ga0466963_0177565 3300044694 Bacteria 1486
651 Ga0466963_1081055 3300044694 Bacteria 564
652 Ga0466964_0001346 3300044706 Bacteria 8385
653 Ga0466964_0025492 3300044706 Bacteria 2309
654 Ga0453684_0000159 3300044712 Bacteria 300297
655 Ga0453684_0000778 3300044712 Bacteria 109956
656 Ga0453684_0005910 3300044712 Bacteria 23730
657 Ga0453684_0079553 3300044712 Bacteria 4097
658 Ga0453684_0190945 3300044712 Bacteria 2396
659 Ga0453684_0305383 3300044712 Bacteria 1807
660 Ga0466971_0006891 3300044719 Bacteria 4938
661 Ga0466971_0012661 3300044719 Bacteria 3699
662 Ga0466971_0040729 3300044719 Bacteria 2086
663 Ga0466971_0043693 3300044719 Bacteria 2013
664 Ga0466968_0016234 3300044735 Bacteria 2962
665 Ga0466970_0033990 3300044765 Bacteria 2697
666 Ga0466970_0084188 3300044765 Bacteria 1721
667 Ga0466970_0176551 3300044765 Bacteria 1184
668 Ga0466957_0002601 3300044842 Bacteria 9727
669 Ga0466957_0054836 3300044842 Bacteria 2434
670 Ga0466957_0432142 3300044842 Bacteria 905
671 Ga0466959_0000254 3300045049 Bacteria 32770
672 Ga0466959_0007720 3300045049 Bacteria 7558
673 Ga0466959_0021068 3300045049 Bacteria 4806
674 Ga0466959_0033192 3300045049 Bacteria 3818
675 Ga0466959_0252377 3300045049 Bacteria 1216
676 Ga0466959_1185298 3300045049 Bacteria 508
677 Ga0451576_0000200 3300045051 Bacteria 150230
678 Ga0451576_0000401 3300045051 Bacteria 101008
679 Ga0451576_0032812 3300045051 Bacteria 5522
680 Ga0451576_0070898 3300045051 Bacteria 3627
681 Ga0466958_0031064 3300045836 Bacteria 3174
682 Ga0466958_0050594 3300045836 Bacteria 2515
683 Ga0466958_0062287 3300045836 Bacteria 2274
684 Ga0466958_0081308 3300045836 Bacteria 1994
685 Ga0466958_0125499 3300045836 Bacteria 1609
686 Ga0466967_0035183 3300045976 Bacteria 4260
687 Ga0466967_0464600 3300045976 Bacteria 1238
688 Ga0466967_0571174 3300045976 Bacteria 1114
689 Ga0495638_0000106 3300046460 Bacteria 133921
690 Ga0495638_0000111 3300046460 Bacteria 130877
691 Ga0495638_0000164 3300046460 Bacteria 103139
692 Ga0495651_0640760 3300046462 Bacteria 667
693 Ga0495650_0002962 3300046471 Bacteria 12852
694 Ga0495580_0222678 3300046472 Unclassified 1296
695 Ga0495606_0001648 3300046507 Bacteria 29061
696 Ga0495610_0012503 3300046512 Bacteria 5104
697 Ga0495640_0436442 3300046533 Bacteria 801
698 Ga0495598_0196206 3300046537 Bacteria 727
699 Ga0495621_0008629 3300046539 Bacteria 3065
700 Ga0495622_0005348 3300046557 Bacteria 5960
701 Ga0495656_0024178 3300046615 Bacteria 2396
702 Ga0495625_0048117 3300046660 Bacteria 3072
703 Ga0495658_0120569 3300046683 Bacteria 1586
704 Ga0495658_0485852 3300046683 Bacteria 790
705 Ga0495670_0001418 3300046691 Bacteria 11769
706 Ga0495670_0122058 3300046691 Bacteria 1354
707 Ga0495649_0000842 3300046694 Bacteria 24640
708 Ga0495649_0059634 3300046694 Bacteria 2054
709 Ga0495636_0006817 3300047318 Bacteria 4490
710 Ga0495636_0016747 3300047318 Bacteria 2930
711 Ga0495636_0190918 3300047318 Bacteria 932
712 Ga0495681_0293878 3300047470 Bacteria 630
713 Ga0495615_0003253 3300048090 Bacteria 2700
714 Ga0495615_0032682 3300048090 Bacteria 1256
715 Ga0495615_0138605 3300048090 Bacteria 716
716 Ga0496100_0074654 3300048903 Bacteria 2272
717 Ga0496100_0214414 3300048903 Bacteria 1410
718 Ga0496100_0245575 3300048903 Bacteria 1322
719 Ga0496101_0143622 3300048904 Bacteria 1821
720 Ga0496101_0702320 3300048904 Bacteria 798
721 Ga0496102_0001570 3300048905 Bacteria 20165
722 Ga0496102_1037683 3300048905 Bacteria 740
723 Ga0496103_0024793 3300048906 Bacteria 3620
724 Ga0496105_0004390 3300048908 Bacteria 10619
725 Ga0496105_0191585 3300048908 Bacteria 1672
726 Ga0496105_0352116 3300048908 Bacteria 1176
727 Ga0496106_0076433 3300048909 Bacteria 2566
728 Ga0496106_0303814 3300048909 Bacteria 1280
729 Ga0496107_0037393 3300048910 Bacteria 3483
730 Ga0496107_0152010 3300048910 Bacteria 1712
731 Ga0496109_0012792 3300048912 Bacteria 7255
732 Ga0496109_0583981 3300048912 Bacteria 1053
733 Ga0496109_1936718 3300048912 Bacteria 522
734 Ga0496110_0183441 3300048913 Bacteria 1900
735 Ga0496112_0000442 3300048915 Bacteria 27561
736 Ga0496113_0009724 3300048916 Bacteria 6319
737 Ga0496113_0025949 3300048916 Bacteria 4185
738 Ga0496114_0122277 3300048917 Bacteria 2240
739 Ga0496115_0000238 3300048918 Bacteria 50050
740 Ga0496115_0000625 3300048918 Bacteria 26688
741 Ga0496115_0037358 3300048918 Bacteria 3848
742 Ga0496115_0161700 3300048918 Bacteria 1850
743 Ga0496116_0060214 3300048919 Bacteria 2464
744 Ga0496117_0039682 3300048920 Bacteria 3471
745 Ga0496118_0005123 3300048921 Bacteria 15055
746 Ga0496118_0010198 3300048921 Bacteria 9330
747 Ga0496118_0292534 3300048921 Bacteria 899
748 Ga0496119_0002921 3300048922 Bacteria 18223
749 Ga0496119_0019587 3300048922 Bacteria 4974
750 Ga0496119_0030233 3300048922 Bacteria 3656
751 Ga0496120_0000143 3300048923 Bacteria 120051
752 Ga0496120_0000665 3300048923 Bacteria 50530
753 Ga0496121_0000321 3300048924 Bacteria 100530
754 Ga0496121_0011882 3300048924 Bacteria 9588
755 Ga0496121_0168447 3300048924 Bacteria 1594
756 Ga0496122_0249052 3300048925 Bacteria 995
757 Ga0496125_0000469 3300048928 Bacteria 72128
758 Ga0496125_0336028 3300048928 Bacteria 909
759 Ga0496126_0001473 3300048929 Bacteria 36602
760 Ga0496126_0012372 3300048929 Bacteria 8749
761 Ga0496126_0216342 3300048929 Bacteria 1611
762 Ga0496126_0227637 3300048929 Bacteria 1563
763 Ga0466983_0610608 3300048986 Bacteria 715
764 Ga0495678_024704 3300049459 Bacteria 2591
765 Ga0501031_0026939 3300049568 Bacteria 3747
766 Ga0501031_0525551 3300049568 Bacteria 763
767 Ga0501032_0013750 3300049569 Bacteria 5743
768 Ga0501032_0479348 3300049569 Bacteria 796
769 Ga0501033_0026700 3300049570 Bacteria 4344
770 Ga0501033_0037897 3300049570 Bacteria 3607
771 Ga0501033_0047963 3300049570 Bacteria 3174
772 Ga0501033_0172228 3300049570 Bacteria 1554
773 Ga0501033_0695874 3300049570 Bacteria 692
774 Ga0501034_0009450 3300049571 Bacteria 10204
775 Ga0501034_0108343 3300049571 Bacteria 2769
776 Ga0501034_0210116 3300049571 Bacteria 1902
777 Ga0501034_0229183 3300049571 Bacteria 1807
778 Ga0501034_0883701 3300049571 Bacteria 782
779 Ga0501034_1600313 3300049571 Bacteria 524
780 Ga0501036_0016165 3300049572 Bacteria 6234
781 Ga0501036_0021558 3300049572 Bacteria 5417
782 Ga0501036_0031212 3300049572 Bacteria 4502
783 Ga0501036_0037434 3300049572 Bacteria 4104
784 Ga0501037_0082122 3300049573 Bacteria 2335
785 Ga0501037_0088922 3300049573 Bacteria 2236
786 Ga0501037_0109568 3300049573 Bacteria 1990
787 Ga0501037_0409222 3300049573 Bacteria 929
788 Ga0501038_0097369 3300049574 Bacteria 2454
789 Ga0501038_0101466 3300049574 Bacteria 2395
790 Ga0501038_0183928 3300049574 Bacteria 1685
791 Ga0501038_0540474 3300049574 Bacteria 887
792 Ga0501039_0539395 3300049575 Bacteria 915
793 Ga0501040_0003179 3300049576 Bacteria 10635
794 Ga0501040_0116822 3300049576 Bacteria 1869
795 Ga0501040_0379575 3300049576 Bacteria 1014
796 Ga0501041_0012728 3300049577 Bacteria 4984
797 Ga0501042_0023626 3300049578 Bacteria 4304
798 Ga0501042_0358778 3300049578 Bacteria 1055
799 Ga0501042_0595758 3300049578 Bacteria 804
800 Ga0501043_0017737 3300049579 Bacteria 5581
801 Ga0501043_0019636 3300049579 Bacteria 5305
802 Ga0501043_0022748 3300049579 Bacteria 4916
803 Ga0501043_1222983 3300049579 Bacteria 527
804 Ga0501046_0010571 3300049580 Bacteria 7920
805 Ga0501046_0034444 3300049580 Bacteria 4086
806 Ga0501046_0047362 3300049580 Bacteria 3408
807 Ga0501046_0078467 3300049580 Bacteria 2554
808 Ga0501046_0147063 3300049580 Bacteria 1779
809 Ga0501047_0003342 3300049581 Bacteria 15195
810 Ga0501047_0032774 3300049581 Bacteria 5015
811 Ga0501047_0087516 3300049581 Bacteria 2992
812 Ga0501047_0161668 3300049581 Bacteria 2111
813 Ga0501047_0336891 3300049581 Bacteria 1346
814 Ga0501047_0665768 3300049581 Bacteria 860
815 Ga0501048_0028574 3300049582 Bacteria 4048
816 Ga0501048_0416701 3300049582 Bacteria 961
817 Ga0501067_0597634 3300049583 Bacteria 619
818 Ga0501070_0019064 3300049586 Bacteria 5755
819 Ga0501070_0057697 3300049586 Bacteria 3219
820 Ga0501071_0028000 3300049587 Bacteria 3968
821 Ga0501071_0303090 3300049587 Bacteria 1211
822 Ga0501071_0983849 3300049587 Bacteria 651
823 Ga0501072_0056422 3300049588 Bacteria 3095
824 Ga0501072_1353101 3300049588 Bacteria 551
825 Ga0501072_1497215 3300049588 Bacteria 521
826 Ga0501073_0283064 3300049589 Bacteria 1144
827 Ga0501074_0007395 3300049590 Bacteria 7945
828 Ga0501074_0573174 3300049590 Bacteria 799
829 Ga0501075_0000666 3300049591 Bacteria 21152
830 Ga0501075_1258518 3300049591 Bacteria 561
831 Ga0501076_0000541 3300049592 Bacteria 24125
832 Ga0501077_0005412 3300049593 Bacteria 7763
833 Ga0501077_0123650 3300049593 Bacteria 1640
834 Ga0501261_039298 3300049690 Bacteria 741
835 Ga0501221_174897 3300049704 Unclassified 583
836 Ga0501079_0001441 3300049741 Bacteria 16808
837 Ga0501079_0613292 3300049741 Bacteria 856
838 Ga0501080_0109384 3300049742 Bacteria 2562
839 Ga0501081_0009639 3300049743 Bacteria 6295
840 Ga0501081_0607582 3300049743 Bacteria 819
841 Ga0501081_0671997 3300049743 Bacteria 777
842 Ga0501083_0115654 3300049744 Bacteria 1761
843 Ga0501035_0000286 3300049822 Bacteria 60023
844 Ga0501035_0014305 3300049822 Bacteria 7325
845 Ga0501035_0023365 3300049822 Bacteria 5671
846 Ga0501035_0093854 3300049822 Bacteria 2639
847 Ga0501035_0177031 3300049822 Bacteria 1839
848 Ga0501035_0567869 3300049822 Bacteria 927
849 Ga0501044_0144392 3300049823 Bacteria 2366
850 Ga0501044_0511834 3300049823 Bacteria 1101
851 Ga0501044_1201506 3300049823 Bacteria 626
852 Ga0501045_0001897 3300049824 Bacteria 14159
853 Ga0501045_0052684 3300049824 Bacteria 2972
854 Ga0501045_0155115 3300049824 Bacteria 1704
855 Ga0501045_0574092 3300049824 Bacteria 836
856 nmdc:mga09592_740242_c1 3300050508 Bacteria 835
857 nmdc:mga0qj67_290561_c1 3300050509 Bacteria 1325
858 nmdc:mga06r32_356770_c1 3300050510 Bacteria 1446
859 nmdc:mga08y16_720231_c1 3300050511 Bacteria 996
860 nmdc:mga08y16_98873_c1 3300050511 Bacteria 3038
861 nmdc:mga0n895_255693_c1 3300050512 Bacteria 1777
862 Ga0500583_0010979 3300053092 Bacteria 3391
863 Ga0500637_0016479 3300053178 Bacteria 3939
864 Ga0501084_0026643 3300054114 Bacteria 4825
865 Ga0501084_0108442 3300054114 Bacteria 2333
866 Ga0501082_0018715 3300060353 Bacteria 5967
867 Ga0501082_0664347 3300060353 Bacteria 912
868 Ga0466962_0001738 3300061719 Bacteria 10245
869 Ga0466962_0032770 3300061719 Bacteria 2486
870 Ga0466962_0067107 3300061719 Bacteria 1713
871 Ga0466962_0069997 3300061719 Bacteria 1675
872 Ga0530510_0003722 3300061734 Bacteria 10496
873 Ga0530510_0524641 3300061734 Bacteria 898
874 2643895703 2643221577 Bacteria 3710843
875 2643976288 2643221593 Bacteria 6296053
876 2644477896 2643221685 Bacteria 3673288
877 2739732516 2739367700 Bacteria 4747630
878 2884412598 2884411467 Bacteria 5246714
879 Ga0307410_11146266
880 JGI24736J21556_1027090
881 JGI24752J21851_1002551
882 JGI24747J21853_1010270
883 JGI24740J21852_10005074
884 JGI24739J22299_10007103
885 JGI24739J22299_10082502
886 JGI24737J22298_10001599
887 JGI24743J22301_10012732
888 JGI24735J21928_10001292
889 JGI24735J21928_10008461
890 JGI24735J21928_10081073
891 JGI24749J21850_1000989
892 JGI24744J21845_10024618
893 JGI24034J26672_10000713
894 JGI24751J29686_10013501
895 JGI25156J39149_1001615
896 JGI25156J39149_1014311
897 JGI25162J39368_1000174
898 JGI25162J39368_1000799
899 JGI25162J39368_1002458
900 JGI25162J39368_1003791
901 JGI25154J39366_1004596
902 JGI25157J39369_1000121
903 JGI25157J39369_1001208
904 JGI25157J39369_1001410
905 JGI25163J39215_1000140
906 JGI25163J39215_1001585
907 JGI25164J39214_1000135
908 JGI25164J39214_1000141
909 JGI25152J39213_1028608
910 JGI25165J46597_1000057
911 JGI25165J46597_1000262
912 JGI25153J46596_10021046
913 rootH1_10020131
914 rootH1_10098222
915 rootH2_10001302
916 rootH1_10372931
917 Ga0006562J51391_1002853
918 Ga0006562J51391_1002854
919 JGI25404J52841_10001677
920 JGI25404J52841_10026272
921 Ga0055538_1002363
922 Ga0055533_1000961
923 Ga0055533_1001263
924 Ga0055527_1000531
925 Ga0055527_1002205
926 Ga0055535_1000173
927 Ga0055535_1001159
928 Ga0055535_1001344
929 Ga0055535_1001359
930 Ga0055542_1000221
931 Ga0055542_1000590
932 Ga0055542_1000857
933 Ga0055542_1001323
934 Ga0055542_1001336
935 Ga0055529_1000137
936 Ga0055529_1000236
937 Ga0055529_1001051
938 Ga0055531_10005644
939 Ga0065165_1001387
940 Ga0065714_10010934
941 Ga0065715_10093649
942 Ga0065715_10099085
943 Ga0065715_10796669
944 Ga0065707_10267915
945 Ga0065707_10348916
946 Ga0070658_10001169
947 Ga0070658_10622007
948 Ga0070676_10003463
949 Ga0070683_100036105
950 Ga0070690_100000192
951 Ga0070690_100902558
952 Ga0070670_100008353
953 Ga0070670_101482683
954 Ga0070677_10000944
955 Ga0068869_100004010
956 Ga0068869_100179069
957 Ga0070666_10000655
958 Ga0070680_100005369
959 Ga0070680_100038107
960 Ga0070680_100047042
961 Ga0070680_100597949
962 Ga0070682_100005794
963 Ga0070682_100010470
964 Ga0070682_100043714
965 Ga0070682_100150784
966 Ga0068868_100006069
967 Ga0070660_100000582
968 Ga0070689_100001359
969 Ga0070689_100018373
970 Ga0070687_100000421
971 Ga0070661_100013375
972 Ga0070661_100027836
973 Ga0070661_100057486
974 Ga0070661_100081678
975 Ga0070692_10003210
976 Ga0070692_10010485
977 Ga0070692_10019968
978 Ga0070668_100001586
979 Ga0070668_100025273
980 Ga0070668_100499222
981 Ga0070669_100006368
982 Ga0070669_100029845
983 Ga0070675_100007016
984 Ga0070671_100004375
985 Ga0070674_100000396
986 Ga0070673_100004706
987 Ga0070673_100349428
988 Ga0070688_100000714
989 Ga0070688_100081968
990 Ga0070659_100001614
991 Ga0070659_100006925
992 Ga0070659_100010207
993 Ga0070667_100002833
994 Ga0070703_10093625
995 Ga0070709_10397496
996 Ga0070714_100000800
997 Ga0070714_100001224
998 Ga0070701_10019128
999 Ga0070711_100546154
1000 Ga0070705_100028302
1001 Ga0070700_100005676
1002 Ga0070694_100115115
1003 Ga0070694_100565122
1004 Ga0070708_100000215
1005 Ga0070663_100002836
1006 Ga0070663_100042899
1007 Ga0070663_100101785
1008 Ga0070663_101118717
1009 Ga0070678_100039348
1010 Ga0070662_100000832
1011 Ga0070662_100028898
1012 Ga0070681_10004526
1013 Ga0070681_10007658
1014 Ga0070681_10084477
1015 Ga0070681_10093457
1016 Ga0068867_100000327
1017 Ga0068867_100353933
1018 Ga0068867_100947905
1019 Ga0070685_10000059
1020 Ga0070685_10034425
1021 Ga0070706_100000062
1022 Ga0070707_100005437
1023 Ga0070698_100250417
1024 Ga0070699_100009284
1025 Ga0070699_100278067
1026 Ga0070679_100029431
1027 Ga0070679_100176610
1028 Ga0070679_100443051
1029 Ga0070679_100712732
1030 Ga0070684_100180774
1031 Ga0070684_100808920
1032 Ga0070684_101501450
1033 Ga0070697_100012945
1034 Ga0070697_100273179
1035 Ga0068853_100000641
1036 Ga0068853_100010261
1037 Ga0068853_100084743
1038 Ga0068853_100485990
1039 Ga0068853_100942117
1040 Ga0070672_100000383
1041 Ga0070686_100000062
1042 Ga0070695_100108329
1043 Ga0070696_100001234
1044 Ga0070696_100003989
1045 Ga0070696_100024501
1046 Ga0070696_100214055
1047 Ga0070696_100364050
1048 Ga0070693_100013868
1049 Ga0070693_100223684
1050 Ga0070665_100038372
1051 Ga0070665_100339049
1052 Ga0070665_100410725
1053 Ga0070665_100781382
1054 Ga0068855_100016460
1055 Ga0068855_100045967
1056 Ga0068855_100048124
1057 Ga0068855_100064449
1058 Ga0070664_100001494
1059 Ga0070664_100007300
1060 Ga0068857_100002699
1061 Ga0068857_100008936
1062 Ga0068857_100038299
1063 Ga0068857_100070688
1064 Ga0068857_100422579
1065 Ga0068857_100523969
1066 Ga0068854_100004456
1067 Ga0068854_100012583
1068 Ga0068854_100074596
1069 Ga0068856_100011571
1070 Ga0068856_100030389
1071 Ga0068856_100035257
1072 Ga0070702_100042638
1073 Ga0068852_100001398
1074 Ga0068852_100045413
1075 Ga0068859_100012397
1076 Ga0068859_100216631
1077 Ga0068864_100006910
1078 Ga0068866_10000168
1079 Ga0068861_100000261
1080 Ga0068851_10000556
1081 Ga0068870_10000118
1082 Ga0068870_11325138
1083 Ga0068863_100001331
1084 Ga0068863_100164937
1085 Ga0068858_100010373
1086 Ga0068860_100001978
1087 Ga0068860_100013797
1088 Ga0068860_100330674
1089 Ga0068860_100542694
1090 Ga0068862_100002379
1091 Ga0068862_100141944
1092 Ga0068862_100283626
1093 Ga0068862_100910284
1094 Ga0081540_1000052
1095 Ga0081540_1002995
1096 Ga0081540_1003052
1097 Ga0070717_10366126
1098 Ga0070712_100389922
1099 Ga0097621_100005637
1100 Ga0068871_100004801
1101 Ga0068871_100038609
1102 Ga0075428_100051182
1103 Ga0075430_100117515
1104 Ga0075431_100212641
1105 Ga0075434_101138781
1106 Ga0075429_100874908
1107 Ga0068865_100000171
1108 Ga0068865_100766664
1109 Ga0097620_100012396
1110 Ga0097620_100216633
1111 Ga0099794_10000002
1112 Ga0105240_10006019
1113 Ga0105240_10016826
1114 Ga0105240_10019280
1115 Ga0105240_10101550
1116 Ga0105240_10151053
1117 Ga0105240_12675978
1118 Ga0111539_10215925
1119 Ga0105245_10000986
1120 Ga0105247_10004633
1121 Ga0105247_11166581
1122 Ga0105243_10072502
1123 Ga0105243_11469550
1124 Ga0105241_10004755
1125 Ga0105241_10090258
1126 Ga0105241_10137732
1127 Ga0105241_10590896
1128 Ga0105242_10007126
1129 Ga0105242_12906443
1130 Ga0105248_10009383
1131 Ga0105248_11451331
1132 Ga0105237_10000011
1133 Ga0105237_10013041
1134 Ga0105237_10122645
1135 Ga0105238_10002809
1136 Ga0105238_10023038
1137 Ga0105238_10177993
1138 Ga0105238_10608270
1139 Ga0105238_10732244
1140 Ga0105238_11568987
1141 Ga0105249_10009045
1142 Ga0105239_10000304
1143 Ga0105239_10007657
1144 Ga0105239_10063304
1145 Ga0105239_10328870
1146 Ga0105239_12000931
1147 Ga0105246_10000353
1148 Ga0157322_1045309
1149 Ga0157314_1000094
1150 Ga0157373_10005244
1151 Ga0157373_10023134
1152 Ga0157371_10006820
1153 Ga0157370_10049982
1154 Ga0157370_10238385
1155 Ga0157370_10604488
1156 Ga0157369_10000925
1157 Ga0157369_10016633
1158 Ga0157369_10034772
1159 Ga0157369_10164420
1160 Ga0157374_10048493
1161 Ga0157378_10000826
1162 Ga0163162_10020828
1163 Ga0163162_10083593
1164 Ga0163162_10430932
1165 Ga0157372_10014312
1166 Ga0157372_10017225
1167 Ga0157372_10053699
1168 Ga0157372_10985556
1169 Ga0157375_10009145
1170 Ga0157375_12086454
1171 Ga0157380_10048773
1172 Ga0157380_10077604
1173 Ga0157377_10001977
1174 Ga0157379_10005888
1175 Ga0157376_10061276
1176 Ga0157376_10126764
1177 Ga0157376_10345488
1178 Ga0182006_1001805
1179 Ga0182006_1040395
1180 Ga0182007_10070984
1181 Ga0182005_1001291
1182 Ga0183368_1003
1183 Ga0213872_10028934
1184 Ga0213872_10151572
1185 Ga0209435_110217
1186 Ga0209760_100306
1187 Ga0209784_100137
1188 Ga0209566_105730
1189 Ga0209674_100079
1190 Ga0209674_100485
1191 Ga0209672_100055
1192 Ga0209672_100189
1193 Ga0209672_101206
1194 Ga0209672_101415
1195 Ga0209672_106886
1196 Ga0207427_100053
1197 Ga0207427_100134
1198 Ga0207427_100176
1199 Ga0207427_101195
1200 Ga0209437_100005
1201 Ga0209437_100059
1202 Ga0209437_100108
1203 Ga0209437_100200
1204 Ga0209437_100214
1205 Ga0209437_102717
1206 Ga0209258_100027
1207 Ga0209258_100055
1208 Ga0209258_100135
1209 Ga0209258_100152
1210 Ga0209258_100383
1211 Ga0209258_103518
1212 Ga0209258_111660
1213 Ga0207425_1044919
1214 Ga0209646_1001049
1215 Ga0209646_1002876
1216 Ga0209026_1000017
1217 Ga0209026_1000245
1218 Ga0209026_1000510
1219 Ga0209026_1002866
1220 Ga0209026_1019426
1221 Ga0209677_101983
1222 Ga0209148_1000001
1223 Ga0209148_1000002
1224 Ga0209148_1000014
1225 Ga0209148_1000058
1226 Ga0209148_1000102
1227 Ga0209759_1000159
1228 Ga0209759_1000290
1229 Ga0209759_1000386
1230 Ga0209759_1002995
1231 Ga0209759_1010654
1232 Ga0209129_1001206
1233 Ga0209233_1000002
1234 Ga0209233_1000011
1235 Ga0209233_1000125
1236 Ga0209233_1000193
1237 Ga0209455_1000014
1238 Ga0209455_1000018
1239 Ga0209455_1000019
1240 Ga0209455_1007632
1241 Ga0209758_1001184
1242 Ga0207426_1081283
1243 Ga0209257_1001357
1244 Ga0207697_10000259
1245 Ga0207656_10007415
1246 Ga0207682_10000086
1247 Ga0207642_10002030
1248 Ga0207710_10007230
1249 Ga0207688_10001840
1250 Ga0207680_10018816
1251 Ga0207647_10001342
1252 Ga0207647_10001533
1253 Ga0207647_10002912
1254 Ga0207647_10132322
1255 Ga0207699_11236951
1256 Ga0207645_10000060
1257 Ga0207643_10000063
1258 Ga0207705_10009402
1259 Ga0207705_10026464
1260 Ga0207705_10831391
1261 Ga0207684_10000055
1262 Ga0207654_10134295
1263 Ga0207707_10003865
1264 Ga0207707_10019046
1265 Ga0207707_10029942
1266 Ga0207707_10060467
1267 Ga0207695_10000901
1268 Ga0207695_10017281
1269 Ga0207695_10042448
1270 Ga0207695_10079331
1271 Ga0207671_10000011
1272 Ga0207671_10009660
1273 Ga0207693_10624786
1274 Ga0207660_10051911
1275 Ga0207660_10296306
1276 Ga0207662_10000019
1277 Ga0207662_11208255
1278 Ga0207657_10000107
1279 Ga0207657_10361004
1280 Ga0207649_10002559
1281 Ga0207649_10003756
1282 Ga0207649_10221957
1283 Ga0207652_10093744
1284 Ga0207652_10156936
1285 Ga0207652_10608206
1286 Ga0207646_10014416
1287 Ga0207681_10002278
1288 Ga0207681_10232955
1289 Ga0207681_10846354
1290 Ga0207694_10011028
1291 Ga0207694_10015057
1292 Ga0207694_10090967
1293 Ga0207694_10155499
1294 Ga0207694_10833908
1295 Ga0207694_10864934
1296 Ga0207650_10000217
1297 Ga0207650_11805351
1298 Ga0207659_10003946
1299 Ga0207687_10005234
1300 Ga0207700_10000529
1301 Ga0207664_10000184
1302 Ga0207664_10008340
1303 Ga0207664_10042947
1304 Ga0207644_10003802
1305 Ga0207690_10004659
1306 Ga0207690_10007499
1307 Ga0207690_10021254
1308 Ga0207690_10025582
1309 Ga0207690_10232485
1310 Ga0207706_10000082
1311 Ga0207706_10867819
1312 Ga0207686_10010797
1313 Ga0207709_10096918
1314 Ga0207670_10001214
1315 Ga0207670_10001255
1316 Ga0207669_10000175
1317 Ga0207704_10002688
1318 Ga0207691_10011213
1319 Ga0207711_10003670
1320 Ga0207689_10000015
1321 Ga0207689_10298243
1322 Ga0207661_10003856
1323 Ga0207679_10000344
1324 Ga0207679_10004959
1325 Ga0207679_10198890
1326 Ga0207667_10000249
1327 Ga0207667_10016458
1328 Ga0207667_10082221
1329 Ga0207667_11014402
1330 Ga0207651_10002506
1331 Ga0207651_10318904
1332 Ga0207712_10003509
1333 Ga0207668_10004928
1334 Ga0207668_10015892
1335 Ga0207640_10000364
1336 Ga0207640_10001892
1337 Ga0207640_10009710
1338 Ga0207640_10452234
1339 Ga0207640_11016935
1340 Ga0207658_10002649
1341 Ga0207677_10002100
1342 Ga0207703_10000645
1343 Ga0207639_10003460
1344 Ga0207639_10053036
1345 Ga0207639_11017433
1346 Ga0207639_11705965
1347 Ga0207678_10000679
1348 Ga0207678_10038207
1349 Ga0207678_10046566
1350 Ga0207678_10158062
1351 Ga0207708_10013605
1352 Ga0207702_10005156
1353 Ga0207702_10342609
1354 Ga0207641_10007878
1355 Ga0207641_10076873
1356 Ga0207648_10011519
1357 Ga0207676_10000901
1358 Ga0207674_10000146
1359 Ga0207674_10001829
1360 Ga0207674_10044214
1361 Ga0207674_10125646
1362 Ga0207674_10550675
1363 Ga0207674_11215565
1364 Ga0207675_100001513
1365 Ga0207675_100089712
1366 Ga0207683_10007433
1367 Ga0207698_10004222
1368 Ga0207698_10030374
1369 Ga0209588_1000002
1370 Ga0268266_10009240
1371 Ga0268266_10757387
1372 Ga0268266_11280892
1373 Ga0268265_10000898
1374 Ga0268265_10132315
1375 Ga0268265_10420157
1376 Ga0268265_10440017
1377 Ga0268264_10001012
1378 Ga0268264_10009703
1379 Ga0268264_10544092
1380 Ga0265337_1002365
1381 Ga0265318_10030498
1382 Ga0265336_10116721
1383 Ga0307515_10157860
1384 Ga0265324_10000895
1385 Ga0265324_10172621
1386 Ga0265328_10004451
1387 Ga0265331_10000019
1388 Ga0265327_10002529
1389 Ga0265327_10093721
1390 Ga0265327_10217940
1391 Ga0265316_10648754
1392 Ga0316575_10069954
1393 Ga0316579_10001767
1394 Ga0316579_10009503
1395 Ga0316579_10028523
1396 Ga0316579_10216814
1397 Ga0316579_10359543
1398 Ga0316576_10061268
1399 Ga0316576_10692130
1400 Ga0316578_10007346
1401 Ga0316578_10015531
1402 Ga0316578_10026435
1403 Ga0316578_10032872
1404 Ga0316578_10120660
1405 Ga0307405_10943373
1406 Ga0316577_10018570
1407 Ga0316577_10140311
1408 Ga0316577_10298701
1409 Ga0307413_10087012
1410 Ga0307413_10969090
1411 Ga0307412_10001623
1412 Ga0307412_10428235
1413 Ga0307412_11090368
1414 Ga0307416_100498182
1415 Ga0307416_100541586
1416 Ga0307416_100870345
1417 Ga0307416_102291728
1418 Ga0307414_10274513
1419 Ga0307415_100063311
1420 Ga0307415_102154812
1421 Ga0316583_10018715
1422 Ga0316585_10005626
1423 Ga0316580_10006578
1424 Ga0316580_10013605
1425 Ga0316580_10082946
1426 Ga0316593_10009903
1427 Ga0316593_10049729
1428 Ga0316593_10146177
1429 Ga0316587_1050698
1430 Ga0373950_0034588
1431 Ga0373958_0170028
1432 Ga0373943_0063635
1433 Ga0373943_0642784
1434 Ga0373961_0170227
1435 Ga0373961_0315410
1436 Ga0316574_0017240
1437 Ga0316574_0017647
1438 Ga0316574_0304960
1439 Ga0373931_0436816
1440 Ga0373933_0740021
1441 Ga0316582_0003645
1442 Ga0316582_0038833
1443 Ga0316582_0041932
1444 Ga0316582_0062704
1445 Ga0316582_0077738
1446 Ga0316582_0557975
1447 Ga0316584_0017144
1448 Ga0316584_0047640
1449 Ga0316584_0094058
1450 Ga0316584_0142091
1451 Ga0316584_0390303
1452 Ga0316584_0454491
1453 Ga0373925_0102077
1454 Ga0395899_0000076
1455 Ga0395899_0027518
1456 Ga0395899_0086213
1457 Ga0395899_0338012
1458 Ga0395900_0000024
1459 Ga0395900_0114784
1460 Ga0395898_0000044
1461 Ga0395898_0000132
1462 Ga0395898_0014285
1463 Ga0316581_0004753
1464 Ga0316581_0053324
1465 Ga0316581_0281752
1466 Ga0395901_0000951
1467 Ga0395901_0106818
1468 Ga0395901_0108624
1469 Ga0395901_0131640
1470 Ga0395901_0157079
1471 Ga0395901_0159818
1472 Ga0395901_0198401
1473 Ga0400485_18116
1474 Ga0400488_59519
1475 Ga0400488_60711
1476 Ga0400486_00835
1477 Ga0400483_116796
1478 Ga0400483_149709
1479 Ga0400483_225876
1480 Ga0400489_48498
1481 Ga0400487_19854
1482 Ga0400487_24814
1483 Ga0436361_0243182
1484 Ga0436361_0972619
1485 Ga0436363_0765819
1486 Ga0439436_0003593
1487 Ga0451793_0040926
1488 Ga0451797_0144330
1489 Ga0451800_0021606
1490 Ga0451802_0760283
1491 Ga0451843_0434061
1492 Ga0451843_0680532
1493 Ga0439437_000270
1494 Ga0439448_0031845
1495 Ga0439448_0087133
1496 Ga0439449_0054897
1497 Ga0439455_0019486
1498 Ga0439455_0053933
1499 Ga0450914_018313
1500 Ga0450906_080001
1501 Ga0439459_0138087
1502 Ga0451577_0002920
1503 Ga0451577_0015493
1504 Ga0451577_0275651
1505 Ga0451577_0504532
1506 Ga0466988_0148510
1507 Ga0466969_0001879
1508 Ga0466969_0040260
1509 Ga0466969_0070873
1510 Ga0466969_0081100
1511 Ga0466989_0055559
1512 Ga0466982_0000012
1513 Ga0466965_0018781
1514 Ga0466965_0061289
1515 Ga0466965_0277825
1516 Ga0466966_0008238
1517 Ga0466966_0010292
1518 Ga0466966_0030985
1519 Ga0466966_0269050
1520 Ga0466961_0004498
1521 Ga0466961_0008198
1522 Ga0466961_0009092
1523 Ga0466961_0021791
1524 Ga0466961_0059458
1525 Ga0466961_0264850
1526 Ga0466961_0689460
1527 Ga0466963_0177565
1528 Ga0466963_1081055
1529 Ga0466964_0001346
1530 Ga0466964_0025492
1531 Ga0453684_0000159
1532 Ga0453684_0000778
1533 Ga0453684_0005910
1534 Ga0453684_0079553
1535 Ga0453684_0190945
1536 Ga0453684_0305383
1537 Ga0466971_0006891
1538 Ga0466971_0012661
1539 Ga0466971_0040729
1540 Ga0466971_0043693
1541 Ga0466968_0016234
1542 Ga0466970_0033990
1543 Ga0466970_0084188
1544 Ga0466970_0176551
1545 Ga0466957_0002601
1546 Ga0466957_0054836
1547 Ga0466957_0432142
1548 Ga0466959_0000254
1549 Ga0466959_0007720
1550 Ga0466959_0021068
1551 Ga0466959_0033192
1552 Ga0466959_0252377
1553 Ga0466959_1185298
1554 Ga0451576_0000200
1555 Ga0451576_0000401
1556 Ga0451576_0032812
1557 Ga0451576_0070898
1558 Ga0466958_0031064
1559 Ga0466958_0050594
1560 Ga0466958_0062287
1561 Ga0466958_0081308
1562 Ga0466958_0125499
1563 Ga0466967_0035183
1564 Ga0466967_0464600
1565 Ga0466967_0571174
1566 Ga0495638_0000106
1567 Ga0495638_0000111
1568 Ga0495638_0000164
1569 Ga0495651_0640760
1570 Ga0495650_0002962
1571 Ga0495580_0222678
1572 Ga0495606_0001648
1573 Ga0495610_0012503
1574 Ga0495640_0436442
1575 Ga0495598_0196206
1576 Ga0495621_0008629
1577 Ga0495622_0005348
1578 Ga0495656_0024178
1579 Ga0495625_0048117
1580 Ga0495658_0120569
1581 Ga0495658_0485852
1582 Ga0495670_0001418
1583 Ga0495670_0122058
1584 Ga0495649_0000842
1585 Ga0495649_0059634
1586 Ga0495636_0006817
1587 Ga0495636_0016747
1588 Ga0495636_0190918
1589 Ga0495681_0293878
1590 Ga0495615_0003253
1591 Ga0495615_0032682
1592 Ga0495615_0138605
1593 Ga0496100_0074654
1594 Ga0496100_0214414
1595 Ga0496100_0245575
1596 Ga0496101_0143622
1597 Ga0496101_0702320
1598 Ga0496102_0001570
1599 Ga0496102_1037683
1600 Ga0496103_0024793
1601 Ga0496105_0004390
1602 Ga0496105_0191585
1603 Ga0496105_0352116
1604 Ga0496106_0076433
1605 Ga0496106_0303814
1606 Ga0496107_0037393
1607 Ga0496107_0152010
1608 Ga0496109_0012792
1609 Ga0496109_0583981
1610 Ga0496109_1936718
1611 Ga0496110_0183441
1612 Ga0496112_0000442
1613 Ga0496113_0009724
1614 Ga0496113_0025949
1615 Ga0496114_0122277
1616 Ga0496115_0000238
1617 Ga0496115_0000625
1618 Ga0496115_0037358
1619 Ga0496115_0161700
1620 Ga0496116_0060214
1621 Ga0496117_0039682
1622 Ga0496118_0005123
1623 Ga0496118_0010198
1624 Ga0496118_0292534
1625 Ga0496119_0002921
1626 Ga0496119_0019587
1627 Ga0496119_0030233
1628 Ga0496120_0000143
1629 Ga0496120_0000665
1630 Ga0496121_0000321
1631 Ga0496121_0011882
1632 Ga0496121_0168447
1633 Ga0496122_0249052
1634 Ga0496125_0000469
1635 Ga0496125_0336028
1636 Ga0496126_0001473
1637 Ga0496126_0012372
1638 Ga0496126_0216342
1639 Ga0496126_0227637
1640 Ga0466983_0610608
1641 Ga0495678_024704
1642 Ga0501031_0026939
1643 Ga0501031_0525551
1644 Ga0501032_0013750
1645 Ga0501032_0479348
1646 Ga0501033_0026700
1647 Ga0501033_0037897
1648 Ga0501033_0047963
1649 Ga0501033_0172228
1650 Ga0501033_0695874
1651 Ga0501034_0009450
1652 Ga0501034_0108343
1653 Ga0501034_0210116
1654 Ga0501034_0229183
1655 Ga0501034_0883701
1656 Ga0501034_1600313
1657 Ga0501036_0016165
1658 Ga0501036_0021558
1659 Ga0501036_0031212
1660 Ga0501036_0037434
1661 Ga0501037_0082122
1662 Ga0501037_0088922
1663 Ga0501037_0109568
1664 Ga0501037_0409222
1665 Ga0501038_0097369
1666 Ga0501038_0101466
1667 Ga0501038_0183928
1668 Ga0501038_0540474
1669 Ga0501039_0539395
1670 Ga0501040_0003179
1671 Ga0501040_0116822
1672 Ga0501040_0379575
1673 Ga0501041_0012728
1674 Ga0501042_0023626
1675 Ga0501042_0358778
1676 Ga0501042_0595758
1677 Ga0501043_0017737
1678 Ga0501043_0019636
1679 Ga0501043_0022748
1680 Ga0501043_1222983
1681 Ga0501046_0010571
1682 Ga0501046_0034444
1683 Ga0501046_0047362
1684 Ga0501046_0078467
1685 Ga0501046_0147063
1686 Ga0501047_0003342
1687 Ga0501047_0032774
1688 Ga0501047_0087516
1689 Ga0501047_0161668
1690 Ga0501047_0336891
1691 Ga0501047_0665768
1692 Ga0501048_0028574
1693 Ga0501048_0416701
1694 Ga0501067_0597634
1695 Ga0501070_0019064
1696 Ga0501070_0057697
1697 Ga0501071_0028000
1698 Ga0501071_0303090
1699 Ga0501071_0983849
1700 Ga0501072_0056422
1701 Ga0501072_1353101
1702 Ga0501072_1497215
1703 Ga0501073_0283064
1704 Ga0501074_0007395
1705 Ga0501074_0573174
1706 Ga0501075_0000666
1707 Ga0501075_1258518
1708 Ga0501076_0000541
1709 Ga0501077_0005412
1710 Ga0501077_0123650
1711 Ga0501261_039298
1712 Ga0501221_174897
1713 Ga0501079_0001441
1714 Ga0501079_0613292
1715 Ga0501080_0109384
1716 Ga0501081_0009639
1717 Ga0501081_0607582
1718 Ga0501081_0671997
1719 Ga0501083_0115654
1720 Ga0501035_0000286
1721 Ga0501035_0014305
1722 Ga0501035_0023365
1723 Ga0501035_0093854
1724 Ga0501035_0177031
1725 Ga0501035_0567869
1726 Ga0501044_0144392
1727 Ga0501044_0511834
1728 Ga0501044_1201506
1729 Ga0501045_0001897
1730 Ga0501045_0052684
1731 Ga0501045_0155115
1732 Ga0501045_0574092
1733 nmdc:mga09592_740242_c1
1734 nmdc:mga0qj67_290561_c1
1735 nmdc:mga06r32_356770_c1
1736 nmdc:mga08y16_720231_c1
1737 nmdc:mga08y16_98873_c1
1738 nmdc:mga0n895_255693_c1
1739 Ga0500583_0010979
1740 Ga0500637_0016479
1741 Ga0501084_0026643
1742 Ga0501084_0108442
1743 Ga0501082_0018715
1744 Ga0501082_0664347
1745 Ga0466962_0001738
1746 Ga0466962_0032770
1747 Ga0466962_0067107
1748 Ga0466962_0069997
1749 Ga0530510_0003722
1750 Ga0530510_0524641
1751 2643895703
1752 2643976288
1753 2644477896
1754 2739732516
1755 2884412598

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04379

DUF525

ApaG domain

42

128

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xq4-assembly1.cif.gz_A crystal structure of the putative apaa protein from bordetella pertussis, northeast structural genomics target ber40 0.974 7 125
1tza-assembly1.cif.gz_B x-ray structure of northeast structural genomics consortium target sor45 0.9707 8 127
2f1e-assembly1.cif.gz_A solution structure of apag protein 0.9698 7 121
1xvs-assembly1.cif.gz_B crystal structure of apag protein from vibrio cholerae 0.9566 2 125
2f1e-assembly1.cif.gz_A solution structure of apag protein 0.9537 7 121
ID Description Score Start End Superfamily
1xq4B00 Mainly Beta;Sandwich;Immunoglobulin-like;ApaG domain 0.9767 7 121 2.60.40.1470
1xvsB00 Mainly Beta;Sandwich;Immunoglobulin-like;ApaG domain 0.9734 5 125 2.60.40.1470
1tzaB00 Mainly Beta;Sandwich;Immunoglobulin-like;ApaG domain 0.9699 8 127 2.60.40.1470
2f1eA00 Mainly Beta;Sandwich;Immunoglobulin-like;ApaG domain 0.9698 7 121 2.60.40.1470
2f1eA00 Mainly Beta;Sandwich;Immunoglobulin-like;ApaG domain 0.9537 7 121 2.60.40.1470
ID Description Score Start End GO Terms
AF-A0A554XN54-F1-model_v4 Protein ApaG 1.003 7 121 GO:0070987
AF-A0A1A6DUG4-F1-model_v4 Co2+/Mg2+ efflux protein ApaG 1.002 7 121 GO:0070987
AF-A0A498ELH1-F1-model_v4 deleted 0.9999 5 123
AF-A0A2V3CUA1-F1-model_v4 deleted 0.9996 14 127
AF-J8V705-F1-model_v4 deleted 0.9994 14 127

Map