F484397
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 877 | 357 | 877 | 88 |
Family's Representative Sequence
| Representative Sequence | 3300038443|Ga0395901_0143288|Ga0395901_0143288_1780_2103 |
| Length | 107 |
| Sequence | MSVRRLLLPSPGPRCGRFYVMPNIKQQKKRVRIAAEERLENLRYSSAVKTFTRRLRAAVADGDRDRISAEHRELVRQIDKAVAKGSLHRNAAARKKAQAAKLVSGSS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 3 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 184 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 185 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 189 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 190 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 192 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 194 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 195 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 198 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 204 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 205 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 206 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 207 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 208 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 209 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 210 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 211 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 213 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 214 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 215 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 216 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 217 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 218 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 219 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 220 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 221 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 222 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 223 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 224 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 225 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 226 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 227 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 228 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 229 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 230 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 231 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 232 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 299 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 300 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 301 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 302 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 305 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 306 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 307 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 308 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 309 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 341 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 342 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 343 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 344 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 357 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.86 |
| Metatranscriptomes | 1.14 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.03 |
| Nodule | 0 |
| Rhizoplane | 3.76 |
| Rhizosphere | 94.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214844107 | 2209111006 | Unclassified | 626 |
| 2 | ARCol0yngRDRAFT_1001207 | 3300000652 | Unclassified | 2186 |
| 3 | JGI24747J21853_1052053 | 3300001978 | Bacteria | 501 |
| 4 | JGI24737J22298_10086399 | 3300001990 | Unclassified | 932 |
| 5 | JGI24750J21931_1056447 | 3300002070 | Unclassified | 621 |
| 6 | JGI24751J29686_10086328 | 3300002459 | Bacteria | 651 |
| 7 | Ga0070658_10973777 | 3300005327 | Bacteria | 738 |
| 8 | Ga0070658_11031398 | 3300005327 | Unclassified | 715 |
| 9 | Ga0070676_10262441 | 3300005328 | Unclassified | 1157 |
| 10 | Ga0070683_100029646 | 3300005329 | Bacteria | 4958 |
| 11 | Ga0070683_100113027 | 3300005329 | Bacteria | 2563 |
| 12 | Ga0070683_100155888 | 3300005329 | Bacteria | 2165 |
| 13 | Ga0070683_100731772 | 3300005329 | Bacteria | 948 |
| 14 | Ga0070670_100004293 | 3300005331 | Bacteria | 11932 |
| 15 | Ga0070670_101284636 | 3300005331 | Bacteria | 670 |
| 16 | Ga0068869_100765152 | 3300005334 | Unclassified | 828 |
| 17 | Ga0070680_100017076 | 3300005336 | Bacteria | 5716 |
| 18 | Ga0070680_100047883 | 3300005336 | Bacteria | 3482 |
| 19 | Ga0070680_100184404 | 3300005336 | Bacteria | 1758 |
| 20 | Ga0070682_100027482 | 3300005337 | Bacteria | 3414 |
| 21 | Ga0070682_100039472 | 3300005337 | Bacteria | 2901 |
| 22 | Ga0070682_100069359 | 3300005337 | Unclassified | 2251 |
| 23 | Ga0070682_100207939 | 3300005337 | Unclassified | 1385 |
| 24 | Ga0070682_100422299 | 3300005337 | Bacteria | 1014 |
| 25 | Ga0070682_100538241 | 3300005337 | Bacteria | 912 |
| 26 | Ga0068868_100052357 | 3300005338 | Bacteria | 3214 |
| 27 | Ga0068868_100076443 | 3300005338 | Bacteria | 2677 |
| 28 | Ga0068868_100274197 | 3300005338 | Unclassified | 1426 |
| 29 | Ga0070660_100004020 | 3300005339 | Bacteria | 10151 |
| 30 | Ga0070660_100051687 | 3300005339 | Bacteria | 3166 |
| 31 | Ga0070660_100054676 | 3300005339 | Bacteria | 3083 |
| 32 | Ga0070660_100069690 | 3300005339 | Unclassified | 2743 |
| 33 | Ga0070660_100741137 | 3300005339 | Bacteria | 825 |
| 34 | Ga0070689_100003774 | 3300005340 | Bacteria | 10146 |
| 35 | Ga0070691_10007080 | 3300005341 | Bacteria | 5142 |
| 36 | Ga0070691_10034986 | 3300005341 | Bacteria | 2365 |
| 37 | Ga0070691_10067369 | 3300005341 | Bacteria | 1732 |
| 38 | Ga0070691_10100715 | 3300005341 | Bacteria | 1435 |
| 39 | Ga0070691_10201465 | 3300005341 | Bacteria | 1046 |
| 40 | Ga0070691_10277784 | 3300005341 | Unclassified | 907 |
| 41 | Ga0070687_100175273 | 3300005343 | Unclassified | 1280 |
| 42 | Ga0070661_100032624 | 3300005344 | Bacteria | 3769 |
| 43 | Ga0070661_100040181 | 3300005344 | Bacteria | 3411 |
| 44 | Ga0070661_100051438 | 3300005344 | Bacteria | 3015 |
| 45 | Ga0070661_100061220 | 3300005344 | Bacteria | 2762 |
| 46 | Ga0070661_100211329 | 3300005344 | Unclassified | 1485 |
| 47 | Ga0070661_100327878 | 3300005344 | Bacteria | 1197 |
| 48 | Ga0070692_10263196 | 3300005345 | Bacteria | 1038 |
| 49 | Ga0070692_10313588 | 3300005345 | Unclassified | 962 |
| 50 | Ga0070692_10877169 | 3300005345 | Bacteria | 619 |
| 51 | Ga0070668_100012799 | 3300005347 | Bacteria | 6246 |
| 52 | Ga0070668_100106381 | 3300005347 | Unclassified | 2229 |
| 53 | Ga0070669_100220227 | 3300005353 | Bacteria | 1500 |
| 54 | Ga0070669_101617951 | 3300005353 | Unclassified | 564 |
| 55 | Ga0070675_100022753 | 3300005354 | Bacteria | 5008 |
| 56 | Ga0070675_100088535 | 3300005354 | Unclassified | 2591 |
| 57 | Ga0070671_100050170 | 3300005355 | Bacteria | 3471 |
| 58 | Ga0070674_100048016 | 3300005356 | Bacteria | 2928 |
| 59 | Ga0070673_100125318 | 3300005364 | Bacteria | 2148 |
| 60 | Ga0070673_100643777 | 3300005364 | Unclassified | 970 |
| 61 | Ga0070688_100013097 | 3300005365 | Bacteria | 4668 |
| 62 | Ga0070659_100004191 | 3300005366 | Bacteria | 10288 |
| 63 | Ga0070659_100139846 | 3300005366 | Unclassified | 1971 |
| 64 | Ga0070659_100191809 | 3300005366 | Bacteria | 1680 |
| 65 | Ga0070659_100248844 | 3300005366 | Bacteria | 1473 |
| 66 | Ga0070659_100455386 | 3300005366 | Unclassified | 1086 |
| 67 | Ga0070659_100781266 | 3300005366 | Bacteria | 830 |
| 68 | Ga0070709_10065998 | 3300005434 | Unclassified | 2319 |
| 69 | Ga0070709_10602433 | 3300005434 | Bacteria | 846 |
| 70 | Ga0070701_10036135 | 3300005438 | Bacteria | 2487 |
| 71 | Ga0070705_100124794 | 3300005440 | Bacteria | 1669 |
| 72 | Ga0070705_101454682 | 3300005440 | Bacteria | 573 |
| 73 | Ga0070700_100022475 | 3300005441 | Bacteria | 3678 |
| 74 | Ga0070700_100183854 | 3300005441 | Bacteria | 1457 |
| 75 | Ga0070694_100204639 | 3300005444 | Unclassified | 1473 |
| 76 | Ga0070694_100378890 | 3300005444 | Bacteria | 1103 |
| 77 | Ga0070694_100510143 | 3300005444 | Bacteria | 958 |
| 78 | Ga0070708_100026347 | 3300005445 | Bacteria | 4975 |
| 79 | Ga0070708_100543202 | 3300005445 | Bacteria | 1096 |
| 80 | Ga0070663_100018125 | 3300005455 | Bacteria | 4610 |
| 81 | Ga0070663_100377550 | 3300005455 | Unclassified | 1154 |
| 82 | Ga0070663_100745347 | 3300005455 | Unclassified | 836 |
| 83 | Ga0070663_100851697 | 3300005455 | Bacteria | 785 |
| 84 | Ga0070663_101461948 | 3300005455 | Unclassified | 607 |
| 85 | Ga0070678_100093151 | 3300005456 | Bacteria | 2316 |
| 86 | Ga0070678_100113926 | 3300005456 | Bacteria | 2121 |
| 87 | Ga0070678_101752876 | 3300005456 | Unclassified | 585 |
| 88 | Ga0070662_100026481 | 3300005457 | Bacteria | 4017 |
| 89 | Ga0070681_10004205 | 3300005458 | Bacteria | 13637 |
| 90 | Ga0070681_10026421 | 3300005458 | Bacteria | 5833 |
| 91 | Ga0070681_10029317 | 3300005458 | Bacteria | 5526 |
| 92 | Ga0070681_10039157 | 3300005458 | Unclassified | 4752 |
| 93 | Ga0070681_10120245 | 3300005458 | Bacteria | 2562 |
| 94 | Ga0070681_10133318 | 3300005458 | Bacteria | 2415 |
| 95 | Ga0070681_10712138 | 3300005458 | Bacteria | 920 |
| 96 | Ga0068867_100223726 | 3300005459 | Bacteria | 1518 |
| 97 | Ga0068867_100344255 | 3300005459 | Unclassified | 1242 |
| 98 | Ga0068867_100356219 | 3300005459 | Bacteria | 1222 |
| 99 | Ga0068867_101451400 | 3300005459 | Bacteria | 638 |
| 100 | Ga0068867_101923455 | 3300005459 | Bacteria | 558 |
| 101 | Ga0070685_10002617 | 3300005466 | Bacteria | 9220 |
| 102 | Ga0070685_10214238 | 3300005466 | Bacteria | 1259 |
| 103 | Ga0070706_100100250 | 3300005467 | Bacteria | 2691 |
| 104 | Ga0070698_100012820 | 3300005471 | Bacteria | 8876 |
| 105 | Ga0070699_100725371 | 3300005518 | Bacteria | 908 |
| 106 | Ga0070679_100016489 | 3300005530 | Bacteria | 7129 |
| 107 | Ga0070679_100051786 | 3300005530 | Unclassified | 4089 |
| 108 | Ga0070679_100053802 | 3300005530 | Bacteria | 4007 |
| 109 | Ga0070679_100171922 | 3300005530 | Unclassified | 2139 |
| 110 | Ga0070679_100370840 | 3300005530 | Bacteria | 1378 |
| 111 | Ga0070679_100398849 | 3300005530 | Bacteria | 1321 |
| 112 | Ga0070684_100026963 | 3300005535 | Bacteria | 4844 |
| 113 | Ga0070684_100059030 | 3300005535 | Bacteria | 3353 |
| 114 | Ga0070684_100083164 | 3300005535 | Unclassified | 2836 |
| 115 | Ga0070684_101123807 | 3300005535 | Bacteria | 738 |
| 116 | Ga0070697_100588795 | 3300005536 | Unclassified | 977 |
| 117 | Ga0068853_100061202 | 3300005539 | Bacteria | 3255 |
| 118 | Ga0068853_100204397 | 3300005539 | Unclassified | 1798 |
| 119 | Ga0068853_100534876 | 3300005539 | Unclassified | 1109 |
| 120 | Ga0068853_100554622 | 3300005539 | Bacteria | 1089 |
| 121 | Ga0070672_100340813 | 3300005543 | Bacteria | 1276 |
| 122 | Ga0070686_100012297 | 3300005544 | Bacteria | 4870 |
| 123 | Ga0070686_100061669 | 3300005544 | Bacteria | 2424 |
| 124 | Ga0070686_101124669 | 3300005544 | Bacteria | 650 |
| 125 | Ga0070695_100325320 | 3300005545 | Unclassified | 1144 |
| 126 | Ga0070695_101449799 | 3300005545 | Unclassified | 570 |
| 127 | Ga0070696_100046066 | 3300005546 | Bacteria | 3023 |
| 128 | Ga0070696_100090361 | 3300005546 | Unclassified | 2179 |
| 129 | Ga0070696_100486377 | 3300005546 | Bacteria | 979 |
| 130 | Ga0070696_100619929 | 3300005546 | Bacteria | 874 |
| 131 | Ga0070693_100002576 | 3300005547 | Bacteria | 8347 |
| 132 | Ga0070693_100028915 | 3300005547 | Unclassified | 3018 |
| 133 | Ga0070693_100523434 | 3300005547 | Bacteria | 845 |
| 134 | Ga0070665_100003372 | 3300005548 | Bacteria | 17091 |
| 135 | Ga0070665_100004675 | 3300005548 | Bacteria | 14290 |
| 136 | Ga0070704_100161901 | 3300005549 | Unclassified | 1770 |
| 137 | Ga0070704_100268357 | 3300005549 | Unclassified | 1409 |
| 138 | Ga0070704_100462325 | 3300005549 | Bacteria | 1095 |
| 139 | Ga0070704_102123821 | 3300005549 | Bacteria | 522 |
| 140 | Ga0068855_100026901 | 3300005563 | Bacteria | 6883 |
| 141 | Ga0068855_100056594 | 3300005563 | Bacteria | 4600 |
| 142 | Ga0068855_100085283 | 3300005563 | Bacteria | 3655 |
| 143 | Ga0068855_100087106 | 3300005563 | Bacteria | 3610 |
| 144 | Ga0068855_100099792 | 3300005563 | Bacteria | 3343 |
| 145 | Ga0068855_100145330 | 3300005563 | Bacteria | 2700 |
| 146 | Ga0068855_100383957 | 3300005563 | Bacteria | 1542 |
| 147 | Ga0070664_100056774 | 3300005564 | Bacteria | 3326 |
| 148 | Ga0070664_100569298 | 3300005564 | Unclassified | 1049 |
| 149 | Ga0070664_100632732 | 3300005564 | Bacteria | 994 |
| 150 | Ga0068857_100052743 | 3300005577 | Bacteria | 3607 |
| 151 | Ga0068857_100081880 | 3300005577 | Bacteria | 2882 |
| 152 | Ga0068857_100274491 | 3300005577 | Unclassified | 1550 |
| 153 | Ga0068857_101073422 | 3300005577 | Bacteria | 777 |
| 154 | Ga0068854_100057292 | 3300005578 | Bacteria | 2810 |
| 155 | Ga0068854_100069149 | 3300005578 | Unclassified | 2577 |
| 156 | Ga0068854_100182523 | 3300005578 | Unclassified | 1640 |
| 157 | Ga0068854_100616682 | 3300005578 | Bacteria | 928 |
| 158 | Ga0068854_101361307 | 3300005578 | Unclassified | 640 |
| 159 | Ga0068856_100030809 | 3300005614 | Bacteria | 5245 |
| 160 | Ga0068856_100208424 | 3300005614 | Bacteria | 1969 |
| 161 | Ga0068856_100491018 | 3300005614 | Unclassified | 1249 |
| 162 | Ga0068856_101498064 | 3300005614 | Bacteria | 688 |
| 163 | Ga0068856_101982363 | 3300005614 | Unclassified | 593 |
| 164 | Ga0070702_100030952 | 3300005615 | Unclassified | 2923 |
| 165 | Ga0070702_100185144 | 3300005615 | Unclassified | 1366 |
| 166 | Ga0070702_101256906 | 3300005615 | Unclassified | 599 |
| 167 | Ga0068852_100052926 | 3300005616 | Bacteria | 3492 |
| 168 | Ga0068852_100404257 | 3300005616 | Unclassified | 1344 |
| 169 | Ga0068852_100958545 | 3300005616 | Unclassified | 874 |
| 170 | Ga0068852_101491142 | 3300005616 | Bacteria | 699 |
| 171 | Ga0068859_100742505 | 3300005617 | Bacteria | 1071 |
| 172 | Ga0068866_10067979 | 3300005718 | Bacteria | 1872 |
| 173 | Ga0068866_10616268 | 3300005718 | Bacteria | 735 |
| 174 | Ga0068861_100004039 | 3300005719 | Bacteria | 9829 |
| 175 | Ga0068861_100453555 | 3300005719 | Bacteria | 1149 |
| 176 | Ga0068851_10228045 | 3300005834 | Bacteria | 1049 |
| 177 | Ga0068870_10041791 | 3300005840 | Unclassified | 2384 |
| 178 | Ga0068870_10434679 | 3300005840 | Bacteria | 862 |
| 179 | Ga0068870_10470001 | 3300005840 | Bacteria | 832 |
| 180 | Ga0068870_10714179 | 3300005840 | Unclassified | 693 |
| 181 | Ga0068870_10818601 | 3300005840 | Unclassified | 652 |
| 182 | Ga0068870_11222205 | 3300005840 | Bacteria | 545 |
| 183 | Ga0068863_100896296 | 3300005841 | Bacteria | 887 |
| 184 | Ga0068858_100883428 | 3300005842 | Unclassified | 874 |
| 185 | Ga0068860_102257699 | 3300005843 | Unclassified | 565 |
| 186 | Ga0068860_102427781 | 3300005843 | Unclassified | 544 |
| 187 | Ga0068862_100087547 | 3300005844 | Unclassified | 2709 |
| 188 | Ga0081455_10006006 | 3300005937 | Bacteria | 13168 |
| 189 | Ga0081455_10140085 | 3300005937 | Unclassified | 1880 |
| 190 | Ga0081540_1002188 | 3300005983 | Bacteria | 16164 |
| 191 | Ga0081540_1030610 | 3300005983 | Bacteria | 2977 |
| 192 | Ga0075365_10194479 | 3300006038 | Unclassified | 1420 |
| 193 | Ga0075363_100229734 | 3300006048 | Unclassified | 1065 |
| 194 | Ga0075432_10000461 | 3300006058 | Bacteria | 12043 |
| 195 | Ga0075432_10018005 | 3300006058 | Unclassified | 2409 |
| 196 | Ga0070716_101119217 | 3300006173 | Unclassified | 629 |
| 197 | Ga0075367_10027362 | 3300006178 | Bacteria | 3244 |
| 198 | Ga0097621_100038619 | 3300006237 | Bacteria | 3831 |
| 199 | Ga0075428_100002927 | 3300006844 | Bacteria | 18606 |
| 200 | Ga0075428_100056461 | 3300006844 | Unclassified | 4300 |
| 201 | Ga0075428_100116177 | 3300006844 | Bacteria | 2914 |
| 202 | Ga0075428_100216755 | 3300006844 | Bacteria | 2068 |
| 203 | Ga0075431_100108803 | 3300006847 | Unclassified | 2860 |
| 204 | Ga0075431_100295335 | 3300006847 | Unclassified | 1638 |
| 205 | Ga0075433_10035247 | 3300006852 | Bacteria | 4302 |
| 206 | Ga0075433_10224985 | 3300006852 | Bacteria | 1666 |
| 207 | Ga0075433_11465387 | 3300006852 | Unclassified | 590 |
| 208 | Ga0075434_100057148 | 3300006871 | Bacteria | 3878 |
| 209 | Ga0075434_100083197 | 3300006871 | Bacteria | 3198 |
| 210 | Ga0075434_100417130 | 3300006871 | Bacteria | 1363 |
| 211 | Ga0075434_101199660 | 3300006871 | Bacteria | 771 |
| 212 | Ga0075429_100054406 | 3300006880 | Bacteria | 3481 |
| 213 | Ga0075429_100641003 | 3300006880 | Bacteria | 931 |
| 214 | Ga0068865_100039816 | 3300006881 | Bacteria | 3190 |
| 215 | Ga0068865_100083672 | 3300006881 | Unclassified | 2297 |
| 216 | Ga0068865_100159037 | 3300006881 | Unclassified | 1721 |
| 217 | Ga0068865_100818612 | 3300006881 | Bacteria | 804 |
| 218 | Ga0068865_101348879 | 3300006881 | Bacteria | 635 |
| 219 | Ga0075436_100122633 | 3300006914 | Bacteria | 1819 |
| 220 | Ga0075436_100779747 | 3300006914 | Bacteria | 711 |
| 221 | Ga0097620_100742438 | 3300006931 | Bacteria | 1071 |
| 222 | Ga0075435_100011630 | 3300007076 | Bacteria | 6487 |
| 223 | Ga0075435_100083320 | 3300007076 | Unclassified | 2629 |
| 224 | Ga0075435_100246405 | 3300007076 | Bacteria | 1520 |
| 225 | Ga0075435_101050587 | 3300007076 | Bacteria | 712 |
| 226 | Ga0105244_10555514 | 3300009036 | Unclassified | 528 |
| 227 | Ga0105240_10071711 | 3300009093 | Bacteria | 4283 |
| 228 | Ga0105240_10268400 | 3300009093 | Unclassified | 1966 |
| 229 | Ga0105240_10424666 | 3300009093 | Bacteria | 1492 |
| 230 | Ga0105240_11454002 | 3300009093 | Bacteria | 719 |
| 231 | Ga0111539_10000483 | 3300009094 | Bacteria | 50415 |
| 232 | Ga0111539_10004184 | 3300009094 | Bacteria | 18936 |
| 233 | Ga0111539_10164031 | 3300009094 | Bacteria | 2599 |
| 234 | Ga0111539_10273113 | 3300009094 | Unclassified | 1968 |
| 235 | Ga0105245_10001379 | 3300009098 | Bacteria | 21999 |
| 236 | Ga0105245_10020869 | 3300009098 | Bacteria | 5742 |
| 237 | Ga0105245_10059662 | 3300009098 | Bacteria | 3435 |
| 238 | Ga0105245_10108014 | 3300009098 | Bacteria | 2584 |
| 239 | Ga0105245_10275884 | 3300009098 | Bacteria | 1641 |
| 240 | Ga0105245_12025969 | 3300009098 | Unclassified | 629 |
| 241 | Ga0114129_10026232 | 3300009147 | Bacteria | 8253 |
| 242 | Ga0114129_10517947 | 3300009147 | Bacteria | 1555 |
| 243 | Ga0114129_11111957 | 3300009147 | Unclassified | 989 |
| 244 | Ga0114129_12824929 | 3300009147 | Unclassified | 576 |
| 245 | Ga0105243_10034919 | 3300009148 | Bacteria | 3897 |
| 246 | Ga0105243_10075909 | 3300009148 | Bacteria | 2729 |
| 247 | Ga0105241_10043669 | 3300009174 | Bacteria | 3395 |
| 248 | Ga0105241_10279762 | 3300009174 | Bacteria | 1424 |
| 249 | Ga0105241_10872022 | 3300009174 | Bacteria | 834 |
| 250 | Ga0105242_10220483 | 3300009176 | Bacteria | 1695 |
| 251 | Ga0105242_10343508 | 3300009176 | Bacteria | 1376 |
| 252 | Ga0105248_10085552 | 3300009177 | Bacteria | 3548 |
| 253 | Ga0105237_10022728 | 3300009545 | Bacteria | 6434 |
| 254 | Ga0105237_10150488 | 3300009545 | Unclassified | 2324 |
| 255 | Ga0105237_12424549 | 3300009545 | Unclassified | 535 |
| 256 | Ga0105238_10028446 | 3300009551 | Bacteria | 5694 |
| 257 | Ga0105238_10057436 | 3300009551 | Bacteria | 3901 |
| 258 | Ga0105238_10719059 | 3300009551 | Bacteria | 1011 |
| 259 | Ga0105238_10942751 | 3300009551 | Unclassified | 883 |
| 260 | Ga0105249_10022281 | 3300009553 | Bacteria | 5675 |
| 261 | Ga0105249_10136595 | 3300009553 | Unclassified | 2347 |
| 262 | Ga0105249_10665554 | 3300009553 | Unclassified | 1099 |
| 263 | Ga0105249_12325366 | 3300009553 | Bacteria | 609 |
| 264 | Ga0105249_12774164 | 3300009553 | Bacteria | 562 |
| 265 | Ga0105239_10151122 | 3300010375 | Unclassified | 2591 |
| 266 | Ga0105239_10180465 | 3300010375 | Bacteria | 2362 |
| 267 | Ga0105239_10273783 | 3300010375 | Unclassified | 1899 |
| 268 | Ga0105239_10292632 | 3300010375 | Bacteria | 1834 |
| 269 | Ga0105239_10882106 | 3300010375 | Bacteria | 1026 |
| 270 | Ga0105239_13214856 | 3300010375 | Bacteria | 532 |
| 271 | Ga0105246_10015407 | 3300011119 | Bacteria | 4829 |
| 272 | Ga0105246_10102170 | 3300011119 | Unclassified | 2090 |
| 273 | Ga0105246_10731582 | 3300011119 | Bacteria | 870 |
| 274 | Ga0105246_11710392 | 3300011119 | Unclassified | 598 |
| 275 | Ga0157316_1003391 | 3300012510 | Unclassified | 1147 |
| 276 | Ga0157373_10010162 | 3300013100 | Bacteria | 6933 |
| 277 | Ga0157373_10178559 | 3300013100 | Bacteria | 1495 |
| 278 | Ga0157373_10309800 | 3300013100 | Unclassified | 1122 |
| 279 | Ga0157373_10448377 | 3300013100 | Bacteria | 928 |
| 280 | Ga0157373_11293122 | 3300013100 | Unclassified | 552 |
| 281 | Ga0157371_10251315 | 3300013102 | Bacteria | 1273 |
| 282 | Ga0157371_10568442 | 3300013102 | Bacteria | 841 |
| 283 | Ga0157370_10020350 | 3300013104 | Bacteria | 6628 |
| 284 | Ga0157370_10020774 | 3300013104 | Bacteria | 6552 |
| 285 | Ga0157370_10148352 | 3300013104 | Bacteria | 2183 |
| 286 | Ga0157370_10353642 | 3300013104 | Bacteria | 1354 |
| 287 | Ga0157369_10015314 | 3300013105 | Bacteria | 8647 |
| 288 | Ga0157369_10051364 | 3300013105 | Bacteria | 4461 |
| 289 | Ga0157369_10192440 | 3300013105 | Unclassified | 2143 |
| 290 | Ga0157369_10778406 | 3300013105 | Bacteria | 984 |
| 291 | Ga0157369_11614538 | 3300013105 | Bacteria | 659 |
| 292 | Ga0157374_10262783 | 3300013296 | Bacteria | 1700 |
| 293 | Ga0157374_11099496 | 3300013296 | Bacteria | 815 |
| 294 | Ga0157374_11705925 | 3300013296 | Bacteria | 655 |
| 295 | Ga0157378_11120696 | 3300013297 | Bacteria | 824 |
| 296 | Ga0163162_10122856 | 3300013306 | Bacteria | 2701 |
| 297 | Ga0163162_10173123 | 3300013306 | Unclassified | 2283 |
| 298 | Ga0163162_10530942 | 3300013306 | Unclassified | 1306 |
| 299 | Ga0157372_10007863 | 3300013307 | Bacteria | 11332 |
| 300 | Ga0157372_10119843 | 3300013307 | Bacteria | 3021 |
| 301 | Ga0157372_10437467 | 3300013307 | Bacteria | 1524 |
| 302 | Ga0157372_11594983 | 3300013307 | Bacteria | 751 |
| 303 | Ga0157372_12148938 | 3300013307 | Unclassified | 641 |
| 304 | Ga0157372_13043469 | 3300013307 | Bacteria | 536 |
| 305 | Ga0157375_10050701 | 3300013308 | Bacteria | 4072 |
| 306 | Ga0157375_11561608 | 3300013308 | Unclassified | 780 |
| 307 | Ga0157375_12222052 | 3300013308 | Unclassified | 654 |
| 308 | Ga0163163_10061159 | 3300014325 | Bacteria | 3731 |
| 309 | Ga0163163_10190410 | 3300014325 | Bacteria | 2100 |
| 310 | Ga0163163_10240064 | 3300014325 | Bacteria | 1862 |
| 311 | Ga0163163_10664589 | 3300014325 | Bacteria | 1105 |
| 312 | Ga0163163_13284084 | 3300014325 | Bacteria | 504 |
| 313 | Ga0157380_11052040 | 3300014326 | Bacteria | 850 |
| 314 | Ga0157380_12369182 | 3300014326 | Bacteria | 596 |
| 315 | Ga0182008_10378925 | 3300014497 | Unclassified | 756 |
| 316 | Ga0182008_10573538 | 3300014497 | Bacteria | 630 |
| 317 | Ga0157377_10052985 | 3300014745 | Bacteria | 2292 |
| 318 | Ga0157377_10068182 | 3300014745 | Unclassified | 2050 |
| 319 | Ga0157377_10165281 | 3300014745 | Bacteria | 1379 |
| 320 | Ga0157377_11197990 | 3300014745 | Unclassified | 588 |
| 321 | Ga0157376_10051798 | 3300014969 | Bacteria | 3411 |
| 322 | Ga0157376_10703166 | 3300014969 | Bacteria | 1016 |
| 323 | Ga0157376_11033325 | 3300014969 | Bacteria | 845 |
| 324 | Ga0163161_10020642 | 3300017792 | Bacteria | 4626 |
| 325 | Ga0163161_10101804 | 3300017792 | Bacteria | 2139 |
| 326 | Ga0197907_10381642 | 3300020069 | Bacteria | 1311 |
| 327 | Ga0206356_10893813 | 3300020070 | Unclassified | 2868 |
| 328 | Ga0206356_11691718 | 3300020070 | Bacteria | 620 |
| 329 | Ga0206354_10655524 | 3300020081 | Bacteria | 2648 |
| 330 | Ga0206354_11064529 | 3300020081 | Unclassified | 1835 |
| 331 | Ga0206353_10019772 | 3300020082 | Bacteria | 649 |
| 332 | Ga0206353_10184386 | 3300020082 | Unclassified | 1193 |
| 333 | Ga0206353_10588121 | 3300020082 | Bacteria | 1732 |
| 334 | Ga0206353_11289376 | 3300020082 | Bacteria | 747 |
| 335 | Ga0224712_10285904 | 3300022467 | Unclassified | 769 |
| 336 | Ga0207692_10571233 | 3300025898 | Bacteria | 724 |
| 337 | Ga0207692_10798034 | 3300025898 | Unclassified | 617 |
| 338 | Ga0207642_10106239 | 3300025899 | Bacteria | 1420 |
| 339 | Ga0207688_10029329 | 3300025901 | Bacteria | 3028 |
| 340 | Ga0207688_10088948 | 3300025901 | Bacteria | 1771 |
| 341 | Ga0207699_10237408 | 3300025906 | Bacteria | 1251 |
| 342 | Ga0207645_10034937 | 3300025907 | Bacteria | 3228 |
| 343 | Ga0207643_10001826 | 3300025908 | Bacteria | 11805 |
| 344 | Ga0207643_10046142 | 3300025908 | Bacteria | 2463 |
| 345 | Ga0207705_10027534 | 3300025909 | Bacteria | 4053 |
| 346 | Ga0207705_10129551 | 3300025909 | Bacteria | 1877 |
| 347 | Ga0207684_10062371 | 3300025910 | Bacteria | 3165 |
| 348 | Ga0207684_10190423 | 3300025910 | Unclassified | 1769 |
| 349 | Ga0207654_10051699 | 3300025911 | Bacteria | 2366 |
| 350 | Ga0207654_10154676 | 3300025911 | Bacteria | 1476 |
| 351 | Ga0207654_10566411 | 3300025911 | Bacteria | 808 |
| 352 | Ga0207707_10054970 | 3300025912 | Bacteria | 3464 |
| 353 | Ga0207707_10071510 | 3300025912 | Bacteria | 3023 |
| 354 | Ga0207707_10072380 | 3300025912 | Bacteria | 3005 |
| 355 | Ga0207707_10105283 | 3300025912 | Bacteria | 2466 |
| 356 | Ga0207707_10251253 | 3300025912 | Unclassified | 1536 |
| 357 | Ga0207707_11604343 | 3300025912 | Bacteria | 512 |
| 358 | Ga0207695_10192103 | 3300025913 | Unclassified | 1959 |
| 359 | Ga0207695_11129340 | 3300025913 | Bacteria | 664 |
| 360 | Ga0207671_10151354 | 3300025914 | Bacteria | 1792 |
| 361 | Ga0207671_10153650 | 3300025914 | Unclassified | 1779 |
| 362 | Ga0207671_11082927 | 3300025914 | Unclassified | 630 |
| 363 | Ga0207693_10061795 | 3300025915 | Bacteria | 2934 |
| 364 | Ga0207693_10814431 | 3300025915 | Bacteria | 719 |
| 365 | Ga0207663_10019136 | 3300025916 | Bacteria | 3850 |
| 366 | Ga0207660_10032133 | 3300025917 | Bacteria | 3621 |
| 367 | Ga0207660_10035433 | 3300025917 | Bacteria | 3466 |
| 368 | Ga0207660_10184149 | 3300025917 | Bacteria | 1623 |
| 369 | Ga0207660_10195234 | 3300025917 | Unclassified | 1578 |
| 370 | Ga0207662_10036660 | 3300025918 | Bacteria | 2867 |
| 371 | Ga0207657_10000467 | 3300025919 | Bacteria | 42840 |
| 372 | Ga0207657_10000731 | 3300025919 | Bacteria | 34878 |
| 373 | Ga0207657_10033593 | 3300025919 | Unclassified | 4623 |
| 374 | Ga0207657_10072051 | 3300025919 | Bacteria | 2924 |
| 375 | Ga0207657_10170245 | 3300025919 | Unclassified | 1765 |
| 376 | Ga0207657_10184231 | 3300025919 | Bacteria | 1687 |
| 377 | Ga0207657_10500669 | 3300025919 | Unclassified | 952 |
| 378 | Ga0207649_10014002 | 3300025920 | Bacteria | 4489 |
| 379 | Ga0207649_10067545 | 3300025920 | Bacteria | 2270 |
| 380 | Ga0207649_10201225 | 3300025920 | Bacteria | 1407 |
| 381 | Ga0207649_10291502 | 3300025920 | Bacteria | 1190 |
| 382 | Ga0207652_10029820 | 3300025921 | Bacteria | 4565 |
| 383 | Ga0207652_10047514 | 3300025921 | Bacteria | 3666 |
| 384 | Ga0207652_10069746 | 3300025921 | Bacteria | 3052 |
| 385 | Ga0207652_10071978 | 3300025921 | Bacteria | 3005 |
| 386 | Ga0207652_10113398 | 3300025921 | Bacteria | 2406 |
| 387 | Ga0207652_10191399 | 3300025921 | Bacteria | 1840 |
| 388 | Ga0207652_10200392 | 3300025921 | Bacteria | 1796 |
| 389 | Ga0207652_10360937 | 3300025921 | Unclassified | 1311 |
| 390 | Ga0207646_10475425 | 3300025922 | Bacteria | 1127 |
| 391 | Ga0207681_10427786 | 3300025923 | Bacteria | 1074 |
| 392 | Ga0207694_10046466 | 3300025924 | Bacteria | 3356 |
| 393 | Ga0207694_10143163 | 3300025924 | Bacteria | 1923 |
| 394 | Ga0207694_10819375 | 3300025924 | Unclassified | 786 |
| 395 | Ga0207650_10475642 | 3300025925 | Bacteria | 1042 |
| 396 | Ga0207659_10077356 | 3300025926 | Unclassified | 2449 |
| 397 | Ga0207687_10039162 | 3300025927 | Unclassified | 3244 |
| 398 | Ga0207687_10499823 | 3300025927 | Bacteria | 1015 |
| 399 | Ga0207687_11117551 | 3300025927 | Bacteria | 677 |
| 400 | Ga0207664_11462055 | 3300025929 | Bacteria | 605 |
| 401 | Ga0207644_10151842 | 3300025931 | Bacteria | 1793 |
| 402 | Ga0207690_10026602 | 3300025932 | Bacteria | 3644 |
| 403 | Ga0207690_10264722 | 3300025932 | Unclassified | 1333 |
| 404 | Ga0207690_11583860 | 3300025932 | Bacteria | 547 |
| 405 | Ga0207706_10006904 | 3300025933 | Bacteria | 10500 |
| 406 | Ga0207686_10257160 | 3300025934 | Bacteria | 1278 |
| 407 | Ga0207709_10048106 | 3300025935 | Unclassified | 2597 |
| 408 | Ga0207709_10570505 | 3300025935 | Bacteria | 892 |
| 409 | Ga0207669_10005301 | 3300025937 | Bacteria | 5769 |
| 410 | Ga0207669_10099012 | 3300025937 | Unclassified | 1922 |
| 411 | Ga0207704_10007727 | 3300025938 | Bacteria | 5099 |
| 412 | Ga0207704_10335049 | 3300025938 | Bacteria | 1172 |
| 413 | Ga0207704_10468823 | 3300025938 | Bacteria | 1009 |
| 414 | Ga0207665_10001983 | 3300025939 | Bacteria | 13791 |
| 415 | Ga0207665_10395148 | 3300025939 | Unclassified | 1052 |
| 416 | Ga0207665_10600325 | 3300025939 | Bacteria | 859 |
| 417 | Ga0207711_10485872 | 3300025941 | Bacteria | 1151 |
| 418 | Ga0207689_10027077 | 3300025942 | Bacteria | 4799 |
| 419 | Ga0207689_10131692 | 3300025942 | Bacteria | 2058 |
| 420 | Ga0207689_10302189 | 3300025942 | Unclassified | 1326 |
| 421 | Ga0207689_10339157 | 3300025942 | Unclassified | 1248 |
| 422 | Ga0207661_10219589 | 3300025944 | Bacteria | 1679 |
| 423 | Ga0207661_10237678 | 3300025944 | Bacteria | 1615 |
| 424 | Ga0207661_10450548 | 3300025944 | Bacteria | 1172 |
| 425 | Ga0207661_11184357 | 3300025944 | Unclassified | 703 |
| 426 | Ga0207661_11360667 | 3300025944 | Unclassified | 652 |
| 427 | Ga0207661_11381924 | 3300025944 | Unclassified | 646 |
| 428 | Ga0207661_11748784 | 3300025944 | Bacteria | 567 |
| 429 | Ga0207661_11921883 | 3300025944 | Bacteria | 537 |
| 430 | Ga0207679_10181219 | 3300025945 | Unclassified | 1743 |
| 431 | Ga0207679_10228018 | 3300025945 | Bacteria | 1571 |
| 432 | Ga0207679_10702118 | 3300025945 | Bacteria | 918 |
| 433 | Ga0207679_11234490 | 3300025945 | Bacteria | 686 |
| 434 | Ga0207667_10047992 | 3300025949 | Bacteria | 4516 |
| 435 | Ga0207667_10055691 | 3300025949 | Bacteria | 4157 |
| 436 | Ga0207667_10076403 | 3300025949 | Bacteria | 3476 |
| 437 | Ga0207667_10138219 | 3300025949 | Bacteria | 2509 |
| 438 | Ga0207667_10166210 | 3300025949 | Bacteria | 2268 |
| 439 | Ga0207667_10334528 | 3300025949 | Bacteria | 1546 |
| 440 | Ga0207667_12145574 | 3300025949 | Unclassified | 517 |
| 441 | Ga0207651_10100351 | 3300025960 | Bacteria | 2146 |
| 442 | Ga0207651_11981131 | 3300025960 | Unclassified | 523 |
| 443 | Ga0207712_10024008 | 3300025961 | Bacteria | 4032 |
| 444 | Ga0207712_10033899 | 3300025961 | Bacteria | 3455 |
| 445 | Ga0207668_10098019 | 3300025972 | Unclassified | 2171 |
| 446 | Ga0207668_10118821 | 3300025972 | Bacteria | 1998 |
| 447 | Ga0207668_10322373 | 3300025972 | Unclassified | 1282 |
| 448 | Ga0207640_10075865 | 3300025981 | Unclassified | 2280 |
| 449 | Ga0207640_10082353 | 3300025981 | Bacteria | 2203 |
| 450 | Ga0207640_10259968 | 3300025981 | Unclassified | 1352 |
| 451 | Ga0207639_10083877 | 3300026041 | Unclassified | 2530 |
| 452 | Ga0207678_10080492 | 3300026067 | Unclassified | 2789 |
| 453 | Ga0207678_11013350 | 3300026067 | Bacteria | 735 |
| 454 | Ga0207708_10011473 | 3300026075 | Bacteria | 6602 |
| 455 | Ga0207708_10037886 | 3300026075 | Unclassified | 3673 |
| 456 | Ga0207708_10209939 | 3300026075 | Bacteria | 1556 |
| 457 | Ga0207708_10275707 | 3300026075 | Bacteria | 1361 |
| 458 | Ga0207702_10256927 | 3300026078 | Bacteria | 1643 |
| 459 | Ga0207702_10804426 | 3300026078 | Bacteria | 929 |
| 460 | Ga0207641_10803993 | 3300026088 | Bacteria | 930 |
| 461 | Ga0207648_10067794 | 3300026089 | Bacteria | 3110 |
| 462 | Ga0207648_10314967 | 3300026089 | Bacteria | 1405 |
| 463 | Ga0207648_10631573 | 3300026089 | Unclassified | 989 |
| 464 | Ga0207648_10981468 | 3300026089 | Bacteria | 791 |
| 465 | Ga0207676_10477075 | 3300026095 | Bacteria | 1181 |
| 466 | Ga0207674_10017840 | 3300026116 | Bacteria | 7737 |
| 467 | Ga0207674_10224371 | 3300026116 | Unclassified | 1827 |
| 468 | Ga0207674_10669002 | 3300026116 | Bacteria | 1002 |
| 469 | Ga0207675_100000792 | 3300026118 | Bacteria | 31451 |
| 470 | Ga0207675_100142480 | 3300026118 | Unclassified | 2277 |
| 471 | Ga0207683_10017553 | 3300026121 | Bacteria | 6101 |
| 472 | Ga0207683_10026950 | 3300026121 | Bacteria | 4966 |
| 473 | Ga0207698_10031836 | 3300026142 | Bacteria | 3813 |
| 474 | Ga0207698_10054316 | 3300026142 | Unclassified | 3082 |
| 475 | Ga0207698_10221785 | 3300026142 | Bacteria | 1709 |
| 476 | Ga0207698_11262251 | 3300026142 | Bacteria | 753 |
| 477 | Ga0209966_1109360 | 3300027695 | Unclassified | 629 |
| 478 | Ga0207428_10000196 | 3300027907 | Bacteria | 84609 |
| 479 | Ga0207428_10023492 | 3300027907 | Bacteria | 5186 |
| 480 | Ga0207428_10038882 | 3300027907 | Bacteria | 3865 |
| 481 | Ga0207428_10123914 | 3300027907 | Bacteria | 1980 |
| 482 | Ga0207428_10352850 | 3300027907 | Unclassified | 1082 |
| 483 | Ga0207428_10436726 | 3300027907 | Bacteria | 955 |
| 484 | Ga0268266_10134451 | 3300028379 | Bacteria | 2214 |
| 485 | Ga0268266_10693120 | 3300028379 | Bacteria | 981 |
| 486 | Ga0268265_10113510 | 3300028380 | Unclassified | 2217 |
| 487 | Ga0268265_10380175 | 3300028380 | Unclassified | 1299 |
| 488 | Ga0268264_10898715 | 3300028381 | Bacteria | 889 |
| 489 | Ga0268264_11594476 | 3300028381 | Unclassified | 663 |
| 490 | Ga0307405_10043409 | 3300031731 | Unclassified | 2743 |
| 491 | Ga0307413_10779240 | 3300031824 | Bacteria | 802 |
| 492 | Ga0307406_11723478 | 3300031901 | Bacteria | 556 |
| 493 | Ga0307412_10669810 | 3300031911 | Bacteria | 887 |
| 494 | Ga0307409_100861911 | 3300031995 | Bacteria | 917 |
| 495 | Ga0307416_100130815 | 3300032002 | Unclassified | 2259 |
| 496 | Ga0307416_100158582 | 3300032002 | Bacteria | 2087 |
| 497 | Ga0373930_0154200 | 3300034816 | Bacteria | 578 |
| 498 | Ga0373938_0020233 | 3300034957 | Unclassified | 1339 |
| 499 | Ga0373949_0120091 | 3300035090 | Unclassified | 737 |
| 500 | Ga0373949_0233749 | 3300035090 | Bacteria | 563 |
| 501 | Ga0373952_0210989 | 3300035092 | Bacteria | 573 |
| 502 | Ga0373932_0235368 | 3300035112 | Unclassified | 663 |
| 503 | Ga0373936_0069926 | 3300035113 | Bacteria | 1445 |
| 504 | Ga0373939_0013189 | 3300035114 | Bacteria | 2122 |
| 505 | Ga0373945_0009560 | 3300035116 | Bacteria | 3180 |
| 506 | Ga0373945_0177961 | 3300035116 | Bacteria | 874 |
| 507 | Ga0373960_0021450 | 3300035121 | Bacteria | 1718 |
| 508 | Ga0373943_0010858 | 3300035170 | Bacteria | 4089 |
| 509 | Ga0373943_0092909 | 3300035170 | Bacteria | 1565 |
| 510 | Ga0373946_0763483 | 3300035171 | Unclassified | 508 |
| 511 | Ga0373931_0375379 | 3300035691 | Bacteria | 895 |
| 512 | Ga0373935_0054335 | 3300035692 | Bacteria | 2550 |
| 513 | Ga0373935_0075407 | 3300035692 | Bacteria | 2182 |
| 514 | Ga0373947_0000533 | 3300035725 | Bacteria | 22256 |
| 515 | Ga0373947_0007052 | 3300035725 | Bacteria | 6513 |
| 516 | Ga0373925_0004302 | 3300037068 | Bacteria | 10786 |
| 517 | Ga0373925_0005142 | 3300037068 | Bacteria | 9804 |
| 518 | Ga0395899_0019101 | 3300037312 | Bacteria | 5209 |
| 519 | Ga0395899_0103369 | 3300037312 | Bacteria | 2055 |
| 520 | Ga0395899_0342688 | 3300037312 | Bacteria | 1002 |
| 521 | Ga0395899_0664437 | 3300037312 | Bacteria | 657 |
| 522 | Ga0395900_0002857 | 3300037418 | Bacteria | 18833 |
| 523 | Ga0395900_0007033 | 3300037418 | Bacteria | 11651 |
| 524 | Ga0395900_0024664 | 3300037418 | Bacteria | 6154 |
| 525 | Ga0395900_0132501 | 3300037418 | Bacteria | 2554 |
| 526 | Ga0395900_0223612 | 3300037418 | Bacteria | 1896 |
| 527 | Ga0395900_0496441 | 3300037418 | Unclassified | 1171 |
| 528 | Ga0395900_0505405 | 3300037418 | Unclassified | 1158 |
| 529 | Ga0395900_0585983 | 3300037418 | Bacteria | 1057 |
| 530 | Ga0395900_1794388 | 3300037418 | Unclassified | 524 |
| 531 | Ga0395898_0005912 | 3300037466 | Bacteria | 13149 |
| 532 | Ga0395898_0049255 | 3300037466 | Bacteria | 4128 |
| 533 | Ga0395898_0119559 | 3300037466 | Unclassified | 2524 |
| 534 | Ga0395898_0127401 | 3300037466 | Unclassified | 2439 |
| 535 | Ga0395898_0139447 | 3300037466 | Bacteria | 2321 |
| 536 | Ga0395898_0199860 | 3300037466 | Bacteria | 1909 |
| 537 | Ga0395898_0210539 | 3300037466 | Bacteria | 1854 |
| 538 | Ga0395898_0244486 | 3300037466 | Bacteria | 1711 |
| 539 | Ga0395898_0751481 | 3300037466 | Unclassified | 916 |
| 540 | Ga0395898_1018596 | 3300037466 | Unclassified | 763 |
| 541 | Ga0395898_1399223 | 3300037466 | Bacteria | 627 |
| 542 | Ga0395898_1444569 | 3300037466 | Bacteria | 615 |
| 543 | Ga0395905_0000568 | 3300037471 | Bacteria | 50013 |
| 544 | Ga0395905_0074777 | 3300037471 | Bacteria | 3175 |
| 545 | Ga0395905_0155309 | 3300037471 | Bacteria | 2152 |
| 546 | Ga0395905_0196194 | 3300037471 | Unclassified | 1893 |
| 547 | Ga0395905_0272235 | 3300037471 | Unclassified | 1579 |
| 548 | Ga0395905_0799707 | 3300037471 | Bacteria | 846 |
| 549 | Ga0395905_0857099 | 3300037471 | Unclassified | 811 |
| 550 | Ga0436364_0135606 | 3300037853 | Bacteria | 1088 |
| 551 | Ga0395901_0001508 | 3300038443 | Bacteria | 24209 |
| 552 | Ga0395901_0001844 | 3300038443 | Bacteria | 21899 |
| 553 | Ga0395901_0020113 | 3300038443 | Bacteria | 6831 |
| 554 | Ga0395901_0022801 | 3300038443 | Bacteria | 6419 |
| 555 | Ga0395901_0099773 | 3300038443 | Unclassified | 3045 |
| 556 | Ga0395901_0143288 | 3300038443 | Bacteria | 2512 |
| 557 | Ga0395901_0154003 | 3300038443 | Bacteria | 2414 |
| 558 | Ga0395901_0166266 | 3300038443 | Unclassified | 2316 |
| 559 | Ga0395901_0273538 | 3300038443 | Bacteria | 1756 |
| 560 | Ga0395901_0434011 | 3300038443 | Unclassified | 1345 |
| 561 | Ga0395901_1552502 | 3300038443 | Bacteria | 617 |
| 562 | Ga0395901_1718000 | 3300038443 | Bacteria | 578 |
| 563 | Ga0436365_1360505 | 3300039437 | Bacteria | 5265 |
| 564 | Ga0436363_1283513 | 3300039450 | Bacteria | 1365 |
| 565 | Ga0451800_1206920 | 3300041459 | Bacteria | 914 |
| 566 | Ga0451841_0962610 | 3300041498 | Bacteria | 850 |
| 567 | Ga0451853_3046892 | 3300041512 | Unclassified | 974 |
| 568 | Ga0439448_0036216 | 3300042005 | Unclassified | 1582 |
| 569 | Ga0439448_0050431 | 3300042005 | Bacteria | 1362 |
| 570 | Ga0439450_191670 | 3300042008 | Unclassified | 545 |
| 571 | Ga0439450_214576 | 3300042008 | Unclassified | 517 |
| 572 | Ga0439458_0024941 | 3300042157 | Unclassified | 1400 |
| 573 | Ga0439459_0008300 | 3300042438 | Unclassified | 1772 |
| 574 | Ga0439460_0302318 | 3300042461 | Bacteria | 559 |
| 575 | Ga0466965_0213282 | 3300044683 | Bacteria | 1027 |
| 576 | Ga0466965_0556251 | 3300044683 | Bacteria | 648 |
| 577 | Ga0466966_0012700 | 3300044684 | Bacteria | 5582 |
| 578 | Ga0466961_0062856 | 3300044693 | Bacteria | 2359 |
| 579 | Ga0466961_0222985 | 3300044693 | Bacteria | 1162 |
| 580 | Ga0466963_0000743 | 3300044694 | Bacteria | 16069 |
| 581 | Ga0466963_0003907 | 3300044694 | Bacteria | 8612 |
| 582 | Ga0466963_0011801 | 3300044694 | Bacteria | 5330 |
| 583 | Ga0466963_0016083 | 3300044694 | Bacteria | 4647 |
| 584 | Ga0466963_0702603 | 3300044694 | Bacteria | 713 |
| 585 | Ga0466964_0057077 | 3300044706 | Unclassified | 1615 |
| 586 | Ga0466964_0288249 | 3300044706 | Bacteria | 823 |
| 587 | Ga0466964_0371995 | 3300044706 | Bacteria | 739 |
| 588 | Ga0466971_0253830 | 3300044719 | Bacteria | 838 |
| 589 | Ga0466968_0102500 | 3300044735 | Bacteria | 1279 |
| 590 | Ga0466957_0035500 | 3300044842 | Bacteria | 2991 |
| 591 | Ga0466957_0037750 | 3300044842 | Bacteria | 2909 |
| 592 | Ga0466957_1166679 | 3300044842 | Bacteria | 557 |
| 593 | Ga0466957_1365385 | 3300044842 | Bacteria | 515 |
| 594 | Ga0466960_0059143 | 3300044901 | Bacteria | 1874 |
| 595 | Ga0466960_0199030 | 3300044901 | Bacteria | 1094 |
| 596 | Ga0466960_0404126 | 3300044901 | Bacteria | 787 |
| 597 | Ga0466959_0116832 | 3300045049 | Unclassified | 1899 |
| 598 | Ga0466959_0117305 | 3300045049 | Bacteria | 1895 |
| 599 | Ga0466959_0414820 | 3300045049 | Bacteria | 914 |
| 600 | Ga0466959_0470427 | 3300045049 | Bacteria | 851 |
| 601 | Ga0451576_0076759 | 3300045051 | Unclassified | 3477 |
| 602 | Ga0451576_0799670 | 3300045051 | Bacteria | 990 |
| 603 | Ga0451576_1672917 | 3300045051 | Unclassified | 659 |
| 604 | Ga0466958_0188522 | 3300045836 | Unclassified | 1310 |
| 605 | Ga0466958_0215460 | 3300045836 | Bacteria | 1224 |
| 606 | Ga0466958_0735974 | 3300045836 | Bacteria | 643 |
| 607 | Ga0466967_0017646 | 3300045976 | Bacteria | 5676 |
| 608 | Ga0466967_0025753 | 3300045976 | Bacteria | 4854 |
| 609 | Ga0466967_0086552 | 3300045976 | Bacteria | 2839 |
| 610 | Ga0466967_0150849 | 3300045976 | Bacteria | 2172 |
| 611 | Ga0466967_0252259 | 3300045976 | Bacteria | 1686 |
| 612 | Ga0466967_0323005 | 3300045976 | Bacteria | 1489 |
| 613 | Ga0466967_0466491 | 3300045976 | Unclassified | 1236 |
| 614 | Ga0466967_0563334 | 3300045976 | Bacteria | 1122 |
| 615 | Ga0466967_1419134 | 3300045976 | Bacteria | 691 |
| 616 | Ga0466967_1680503 | 3300045976 | Bacteria | 632 |
| 617 | Ga0495617_196152 | 3300046452 | Unclassified | 632 |
| 618 | Ga0495627_209246 | 3300046453 | Unclassified | 537 |
| 619 | Ga0495592_0358570 | 3300046454 | Bacteria | 933 |
| 620 | Ga0495603_0001442 | 3300046455 | Bacteria | 13834 |
| 621 | Ga0495590_0161515 | 3300046457 | Unclassified | 815 |
| 622 | Ga0495591_093021 | 3300046458 | Bacteria | 755 |
| 623 | Ga0495629_0281263 | 3300046459 | Bacteria | 1141 |
| 624 | Ga0495638_0220396 | 3300046460 | Bacteria | 1061 |
| 625 | Ga0495641_0001137 | 3300046461 | Bacteria | 22903 |
| 626 | Ga0495651_0540941 | 3300046462 | Bacteria | 741 |
| 627 | Ga0495653_0319535 | 3300046463 | Bacteria | 1007 |
| 628 | Ga0495580_0024689 | 3300046472 | Bacteria | 4398 |
| 629 | Ga0495582_0508520 | 3300046473 | Bacteria | 696 |
| 630 | Ga0495605_0152583 | 3300046474 | Bacteria | 1030 |
| 631 | Ga0495605_0229594 | 3300046474 | Bacteria | 800 |
| 632 | Ga0495639_0092991 | 3300046475 | Bacteria | 1417 |
| 633 | Ga0495664_0871479 | 3300046477 | Bacteria | 527 |
| 634 | Ga0495584_0031556 | 3300046491 | Bacteria | 2682 |
| 635 | Ga0495584_0102989 | 3300046491 | Bacteria | 1443 |
| 636 | Ga0495584_0113837 | 3300046491 | Bacteria | 1369 |
| 637 | Ga0495584_0147462 | 3300046491 | Bacteria | 1195 |
| 638 | Ga0495585_0073866 | 3300046492 | Bacteria | 1856 |
| 639 | Ga0495596_0148636 | 3300046500 | Bacteria | 910 |
| 640 | Ga0495607_0099665 | 3300046501 | Bacteria | 1558 |
| 641 | Ga0495607_0116113 | 3300046501 | Bacteria | 1412 |
| 642 | Ga0495608_0118464 | 3300046511 | Unclassified | 1699 |
| 643 | Ga0495616_0062508 | 3300046513 | Bacteria | 1823 |
| 644 | Ga0495618_0576325 | 3300046514 | Bacteria | 672 |
| 645 | Ga0495628_0089479 | 3300046516 | Bacteria | 2384 |
| 646 | Ga0495630_0241726 | 3300046517 | Bacteria | 1379 |
| 647 | Ga0495630_0329553 | 3300046517 | Bacteria | 1167 |
| 648 | Ga0495637_0072954 | 3300046520 | Unclassified | 1381 |
| 649 | Ga0495643_0115895 | 3300046522 | Bacteria | 1358 |
| 650 | Ga0495644_0040461 | 3300046523 | Bacteria | 1757 |
| 651 | Ga0495644_0361866 | 3300046523 | Unclassified | 572 |
| 652 | Ga0495663_0039737 | 3300046525 | Bacteria | 1426 |
| 653 | Ga0495666_0030512 | 3300046526 | Bacteria | 2645 |
| 654 | Ga0495652_0060460 | 3300046529 | Bacteria | 3202 |
| 655 | Ga0495654_0054023 | 3300046530 | Bacteria | 1950 |
| 656 | Ga0495640_0365558 | 3300046533 | Bacteria | 889 |
| 657 | Ga0495586_0011957 | 3300046535 | Bacteria | 4611 |
| 658 | Ga0495598_0002624 | 3300046537 | Bacteria | 3722 |
| 659 | Ga0495609_0029943 | 3300046538 | Bacteria | 2477 |
| 660 | Ga0495609_0070700 | 3300046538 | Bacteria | 1534 |
| 661 | Ga0495621_0091796 | 3300046539 | Unclassified | 1145 |
| 662 | Ga0495621_0307785 | 3300046539 | Bacteria | 658 |
| 663 | Ga0495622_0178440 | 3300046557 | Unclassified | 953 |
| 664 | Ga0495633_0367589 | 3300046558 | Bacteria | 651 |
| 665 | Ga0495633_0490530 | 3300046558 | Unclassified | 554 |
| 666 | Ga0495667_0607962 | 3300046559 | Unclassified | 681 |
| 667 | Ga0495656_0020197 | 3300046615 | Bacteria | 2581 |
| 668 | Ga0495656_0468026 | 3300046615 | Bacteria | 665 |
| 669 | Ga0495668_0115958 | 3300046616 | Bacteria | 1465 |
| 670 | Ga0495668_0842471 | 3300046616 | Unclassified | 508 |
| 671 | Ga0495634_0270683 | 3300046642 | Bacteria | 1034 |
| 672 | Ga0495611_0165473 | 3300046648 | Unclassified | 1034 |
| 673 | Ga0495659_0034272 | 3300046664 | Bacteria | 1785 |
| 674 | Ga0495659_0054242 | 3300046664 | Bacteria | 1466 |
| 675 | Ga0495657_0391294 | 3300046675 | Unclassified | 819 |
| 676 | Ga0495599_0418419 | 3300046678 | Bacteria | 796 |
| 677 | Ga0495658_0090430 | 3300046683 | Bacteria | 1812 |
| 678 | Ga0495658_0236207 | 3300046683 | Bacteria | 1147 |
| 679 | Ga0495613_0029948 | 3300046689 | Bacteria | 4044 |
| 680 | Ga0495670_0076392 | 3300046691 | Bacteria | 1702 |
| 681 | Ga0495670_0182764 | 3300046691 | Bacteria | 1107 |
| 682 | Ga0495671_0023230 | 3300046692 | Unclassified | 3241 |
| 683 | Ga0495671_0240615 | 3300046692 | Bacteria | 874 |
| 684 | Ga0495589_0091290 | 3300046794 | Bacteria | 1479 |
| 685 | Ga0495660_0052786 | 3300046810 | Bacteria | 2208 |
| 686 | Ga0495581_0449843 | 3300047315 | Unclassified | 750 |
| 687 | Ga0495636_0309298 | 3300047318 | Bacteria | 740 |
| 688 | Ga0495636_0350394 | 3300047318 | Unclassified | 697 |
| 689 | Ga0495674_0037327 | 3300047319 | Bacteria | 4366 |
| 690 | Ga0495674_0057423 | 3300047319 | Bacteria | 3406 |
| 691 | Ga0495676_0004439 | 3300047321 | Bacteria | 12831 |
| 692 | Ga0495676_0152464 | 3300047321 | Bacteria | 1643 |
| 693 | Ga0495683_0134032 | 3300047323 | Unclassified | 1166 |
| 694 | Ga0495677_0102244 | 3300047445 | Bacteria | 1086 |
| 695 | Ga0495679_077589 | 3300047446 | Bacteria | 948 |
| 696 | Ga0495685_060001 | 3300047447 | Bacteria | 1283 |
| 697 | Ga0495684_0239030 | 3300047471 | Bacteria | 1326 |
| 698 | Ga0495614_0185542 | 3300048089 | Bacteria | 937 |
| 699 | Ga0495615_0040955 | 3300048090 | Bacteria | 1156 |
| 700 | Ga0495615_0158045 | 3300048090 | Unclassified | 679 |
| 701 | Ga0495626_0406239 | 3300048091 | Unclassified | 526 |
| 702 | Ga0496100_0107149 | 3300048903 | Unclassified | 1935 |
| 703 | Ga0496100_0546977 | 3300048903 | Unclassified | 895 |
| 704 | Ga0496102_0069469 | 3300048905 | Bacteria | 3233 |
| 705 | Ga0496102_0332158 | 3300048905 | Unclassified | 1432 |
| 706 | Ga0496102_1118018 | 3300048905 | Bacteria | 708 |
| 707 | Ga0496103_0001272 | 3300048906 | Bacteria | 17185 |
| 708 | Ga0496104_0068050 | 3300048907 | Bacteria | 3383 |
| 709 | Ga0496104_0145904 | 3300048907 | Bacteria | 2272 |
| 710 | Ga0496105_0040024 | 3300048908 | Bacteria | 3864 |
| 711 | Ga0496105_0087274 | 3300048908 | Bacteria | 2577 |
| 712 | Ga0496108_0030725 | 3300048911 | Bacteria | 4451 |
| 713 | Ga0496108_0031161 | 3300048911 | Bacteria | 4422 |
| 714 | Ga0496108_0080685 | 3300048911 | Bacteria | 2756 |
| 715 | Ga0496109_0017493 | 3300048912 | Bacteria | 6285 |
| 716 | Ga0496109_0045948 | 3300048912 | Bacteria | 3965 |
| 717 | Ga0496109_0391846 | 3300048912 | Bacteria | 1312 |
| 718 | Ga0496109_0658730 | 3300048912 | Archaea | 984 |
| 719 | Ga0496109_0697472 | 3300048912 | Bacteria | 952 |
| 720 | Ga0496109_0759751 | 3300048912 | Bacteria | 907 |
| 721 | Ga0496110_0027599 | 3300048913 | Bacteria | 4867 |
| 722 | Ga0496110_0040053 | 3300048913 | Bacteria | 4082 |
| 723 | Ga0496110_0343280 | 3300048913 | Bacteria | 1360 |
| 724 | Ga0496110_0621323 | 3300048913 | Bacteria | 979 |
| 725 | Ga0496111_0028098 | 3300048914 | Bacteria | 3984 |
| 726 | Ga0496111_0974635 | 3300048914 | Bacteria | 608 |
| 727 | Ga0496112_0140642 | 3300048915 | Bacteria | 2383 |
| 728 | Ga0496112_0154778 | 3300048915 | Bacteria | 2260 |
| 729 | Ga0496113_0049910 | 3300048916 | Bacteria | 3117 |
| 730 | Ga0496113_0285579 | 3300048916 | Bacteria | 1320 |
| 731 | Ga0496113_0476688 | 3300048916 | Unclassified | 1002 |
| 732 | Ga0496113_1308342 | 3300048916 | Bacteria | 563 |
| 733 | Ga0496115_0301259 | 3300048918 | Unclassified | 1313 |
| 734 | Ga0501031_0791810 | 3300049568 | Bacteria | 608 |
| 735 | Ga0501032_0086020 | 3300049569 | Bacteria | 2090 |
| 736 | Ga0501032_0207989 | 3300049569 | Bacteria | 1276 |
| 737 | Ga0501033_0152133 | 3300049570 | Unclassified | 1669 |
| 738 | Ga0501036_0008255 | 3300049572 | Bacteria | 8536 |
| 739 | Ga0501036_0054381 | 3300049572 | Bacteria | 3391 |
| 740 | Ga0501036_0182990 | 3300049572 | Bacteria | 1764 |
| 741 | Ga0501036_1503353 | 3300049572 | Bacteria | 545 |
| 742 | Ga0501037_0177334 | 3300049573 | Bacteria | 1513 |
| 743 | Ga0501037_0191611 | 3300049573 | Bacteria | 1447 |
| 744 | Ga0501038_0102375 | 3300049574 | Bacteria | 2383 |
| 745 | Ga0501038_0135942 | 3300049574 | Unclassified | 2014 |
| 746 | Ga0501038_1087868 | 3300049574 | Bacteria | 584 |
| 747 | Ga0501039_0005748 | 3300049575 | Bacteria | 9390 |
| 748 | Ga0501039_0040396 | 3300049575 | Bacteria | 3601 |
| 749 | Ga0501039_0288171 | 3300049575 | Bacteria | 1291 |
| 750 | Ga0501040_0014913 | 3300049576 | Bacteria | 5131 |
| 751 | Ga0501040_0122600 | 3300049576 | Unclassified | 1824 |
| 752 | Ga0501040_0434922 | 3300049576 | Bacteria | 944 |
| 753 | Ga0501040_0543641 | 3300049576 | Bacteria | 838 |
| 754 | Ga0501040_0869225 | 3300049576 | Bacteria | 653 |
| 755 | Ga0501041_0013301 | 3300049577 | Bacteria | 4876 |
| 756 | Ga0501041_0193853 | 3300049577 | Bacteria | 1273 |
| 757 | Ga0501041_0355648 | 3300049577 | Bacteria | 926 |
| 758 | Ga0501041_0724316 | 3300049577 | Bacteria | 637 |
| 759 | Ga0501042_0012634 | 3300049578 | Bacteria | 5728 |
| 760 | Ga0501043_0134523 | 3300049579 | Bacteria | 1937 |
| 761 | Ga0501043_0216468 | 3300049579 | Unclassified | 1483 |
| 762 | Ga0501046_0015766 | 3300049580 | Bacteria | 6344 |
| 763 | Ga0501046_0073305 | 3300049580 | Bacteria | 2657 |
| 764 | Ga0501048_0016652 | 3300049582 | Bacteria | 5420 |
| 765 | Ga0501048_0110789 | 3300049582 | Unclassified | 1938 |
| 766 | Ga0501067_0007929 | 3300049583 | Bacteria | 5898 |
| 767 | Ga0501067_0008781 | 3300049583 | Bacteria | 5598 |
| 768 | Ga0501067_0163793 | 3300049583 | Bacteria | 1238 |
| 769 | Ga0501067_0591902 | 3300049583 | Bacteria | 622 |
| 770 | Ga0501067_0759140 | 3300049583 | Bacteria | 546 |
| 771 | Ga0501068_0028112 | 3300049584 | Bacteria | 3323 |
| 772 | Ga0501068_0317711 | 3300049584 | Bacteria | 998 |
| 773 | Ga0501068_0461380 | 3300049584 | Bacteria | 822 |
| 774 | Ga0501068_0797315 | 3300049584 | Bacteria | 619 |
| 775 | Ga0501068_1027469 | 3300049584 | Bacteria | 544 |
| 776 | Ga0501069_0006739 | 3300049585 | Bacteria | 6012 |
| 777 | Ga0501069_0040999 | 3300049585 | Bacteria | 2558 |
| 778 | Ga0501069_0089266 | 3300049585 | Bacteria | 1742 |
| 779 | Ga0501070_0098290 | 3300049586 | Unclassified | 2421 |
| 780 | Ga0501070_0174680 | 3300049586 | Bacteria | 1769 |
| 781 | Ga0501070_0282188 | 3300049586 | Bacteria | 1355 |
| 782 | Ga0501071_0003446 | 3300049587 | Bacteria | 9881 |
| 783 | Ga0501071_0017284 | 3300049587 | Bacteria | 4972 |
| 784 | Ga0501071_0047094 | 3300049587 | Bacteria | 3097 |
| 785 | Ga0501071_0426790 | 3300049587 | Bacteria | 1013 |
| 786 | Ga0501072_0002483 | 3300049588 | Bacteria | 13814 |
| 787 | Ga0501072_0004929 | 3300049588 | Bacteria | 10151 |
| 788 | Ga0501072_0073843 | 3300049588 | Bacteria | 2696 |
| 789 | Ga0501072_0255406 | 3300049588 | Bacteria | 1395 |
| 790 | Ga0501073_0090545 | 3300049589 | Bacteria | 2126 |
| 791 | Ga0501074_0025245 | 3300049590 | Bacteria | 4317 |
| 792 | Ga0501074_0261882 | 3300049590 | Bacteria | 1229 |
| 793 | Ga0501075_0016749 | 3300049591 | Bacteria | 5286 |
| 794 | Ga0501075_0059032 | 3300049591 | Bacteria | 2889 |
| 795 | Ga0501075_0060058 | 3300049591 | Bacteria | 2865 |
| 796 | Ga0501075_0265228 | 3300049591 | Bacteria | 1309 |
| 797 | Ga0501076_0004215 | 3300049592 | Bacteria | 10176 |
| 798 | Ga0501076_0007588 | 3300049592 | Bacteria | 7897 |
| 799 | Ga0501077_0005911 | 3300049593 | Bacteria | 7464 |
| 800 | Ga0501077_0023566 | 3300049593 | Bacteria | 3903 |
| 801 | Ga0501079_0001382 | 3300049741 | Bacteria | 17096 |
| 802 | Ga0501079_0005016 | 3300049741 | Bacteria | 9819 |
| 803 | Ga0501079_0015422 | 3300049741 | Bacteria | 5831 |
| 804 | Ga0501079_0244225 | 3300049741 | Bacteria | 1403 |
| 805 | Ga0501080_0002032 | 3300049742 | Bacteria | 17493 |
| 806 | Ga0501080_0162035 | 3300049742 | Bacteria | 2065 |
| 807 | Ga0501081_0006195 | 3300049743 | Bacteria | 7748 |
| 808 | Ga0501081_0012524 | 3300049743 | Bacteria | 5577 |
| 809 | Ga0501081_0055419 | 3300049743 | Bacteria | 2740 |
| 810 | Ga0501081_0476230 | 3300049743 | Unclassified | 929 |
| 811 | Ga0501083_0111851 | 3300049744 | Bacteria | 1795 |
| 812 | Ga0501035_0019017 | 3300049822 | Bacteria | 6323 |
| 813 | Ga0501035_1279037 | 3300049822 | Bacteria | 566 |
| 814 | Ga0501044_0237734 | 3300049823 | Bacteria | 1767 |
| 815 | Ga0501045_0026787 | 3300049824 | Bacteria | 4149 |
| 816 | Ga0501045_0044759 | 3300049824 | Bacteria | 3224 |
| 817 | Ga0501045_0078100 | 3300049824 | Bacteria | 2440 |
| 818 | Ga0501045_0341451 | 3300049824 | Bacteria | 1115 |
| 819 | Ga0501045_0661007 | 3300049824 | Bacteria | 772 |
| 820 | nmdc:mga03n38_236587_c1 | 3300050490 | Unclassified | 959 |
| 821 | nmdc:mga00v17_24047_c1 | 3300050491 | Bacteria | 3530 |
| 822 | nmdc:mga0yw44_195849_c1 | 3300050492 | Bacteria | 1333 |
| 823 | nmdc:mga0yw44_243554_c1 | 3300050492 | Unclassified | 1196 |
| 824 | nmdc:mga0yw44_369402_c1 | 3300050492 | Bacteria | 968 |
| 825 | nmdc:mga06z11_7552_c1 | 3300050494 | Bacteria | 4482 |
| 826 | nmdc:mga05p37_159332_c1 | 3300050507 | Bacteria | 2757 |
| 827 | nmdc:mga05p37_4691_c2 | 3300050507 | Bacteria | 8253 |
| 828 | nmdc:mga09592_4692_c1 | 3300050508 | Bacteria | 11062 |
| 829 | nmdc:mga06r32_282208_c1 | 3300050510 | Bacteria | 1648 |
| 830 | nmdc:mga08y16_100664_c1 | 3300050511 | Bacteria | 3009 |
| 831 | nmdc:mga08y16_2176447_c1 | 3300050511 | Bacteria | 501 |
| 832 | nmdc:mga08y16_334025_c1 | 3300050511 | Bacteria | 1559 |
| 833 | nmdc:mga08y16_458110_c1 | 3300050511 | Bacteria | 1300 |
| 834 | nmdc:mga08y16_56074_c1 | 3300050511 | Bacteria | 4119 |
| 835 | nmdc:mga08y16_716998_c1 | 3300050511 | Bacteria | 999 |
| 836 | nmdc:mga08y16_759948_c1 | 3300050511 | Unclassified | 965 |
| 837 | nmdc:mga08y16_8793_c1 | 3300050511 | Bacteria | 10600 |
| 838 | nmdc:mga0n895_1130384_c1 | 3300050512 | Bacteria | 760 |
| 839 | nmdc:mga0n895_1581838_c1 | 3300050512 | Unclassified | 620 |
| 840 | nmdc:mga0n895_46478_c1 | 3300050512 | Bacteria | 4241 |
| 841 | nmdc:mga0n895_565935_c1 | 3300050512 | Bacteria | 1141 |
| 842 | nmdc:mga0n895_608643_c1 | 3300050512 | Unclassified | 1094 |
| 843 | nmdc:mga0n895_72506_c1 | 3300050512 | Bacteria | 3416 |
| 844 | nmdc:mga0n895_929025_c1 | 3300050512 | Unclassified | 854 |
| 845 | nmdc:mga0rr50_13665_c1 | 3300050513 | Bacteria | 5296 |
| 846 | nmdc:mga0rr50_1633915_c1 | 3300050513 | Bacteria | 544 |
| 847 | nmdc:mga0rr50_54017_c1 | 3300050513 | Unclassified | 2991 |
| 848 | nmdc:mga0rr50_640727_c1 | 3300050513 | Bacteria | 907 |
| 849 | nmdc:mga08x19_28639_c1 | 3300050514 | Bacteria | 3490 |
| 850 | nmdc:mga0a205_1165110_c1 | 3300050515 | Bacteria | 618 |
| 851 | nmdc:mga0a205_29555_c1 | 3300050515 | Bacteria | 5245 |
| 852 | nmdc:mga0a205_491719_c1 | 3300050515 | Unclassified | 1084 |
| 853 | nmdc:mga0a205_60942_c1 | 3300050515 | Bacteria | 3644 |
| 854 | nmdc:mga0a205_65347_c1 | 3300050515 | Bacteria | 3515 |
| 855 | Ga0495612_0474198 | 3300053078 | Bacteria | 573 |
| 856 | Ga0495619_0914415 | 3300053085 | Bacteria | 590 |
| 857 | Ga0501084_0001654 | 3300054114 | Bacteria | 17736 |
| 858 | Ga0501084_0003270 | 3300054114 | Bacteria | 13109 |
| 859 | Ga0501084_0083263 | 3300054114 | Bacteria | 2685 |
| 860 | Ga0501084_0263187 | 3300054114 | Unclassified | 1456 |
| 861 | Ga0501082_0047898 | 3300060353 | Bacteria | 3683 |
| 862 | Ga0501082_0378196 | 3300060353 | Bacteria | 1236 |
| 863 | Ga0501082_0462488 | 3300060353 | Bacteria | 1109 |
| 864 | Ga0501082_0897358 | 3300060353 | Bacteria | 775 |
| 865 | Ga0466962_0052428 | 3300061719 | Bacteria | 1950 |
| 866 | Ga0466962_0363666 | 3300061719 | Unclassified | 721 |
| 867 | Ga0466962_0476138 | 3300061719 | Bacteria | 630 |
| 868 | Ga0530510_0004090 | 3300061734 | Bacteria | 10065 |
| 869 | Ga0530510_0024164 | 3300061734 | Bacteria | 4335 |
| 870 | Ga0530510_0049813 | 3300061734 | Unclassified | 3025 |
| 871 | Ga0530510_0058423 | 3300061734 | Bacteria | 2789 |
| 872 | Ga0530510_0166606 | 3300061734 | Bacteria | 1631 |
| 873 | Ga0530510_0201631 | 3300061734 | Bacteria | 1478 |
| 874 | Ga0530510_0362616 | 3300061734 | Bacteria | 1089 |
| 875 | Ga0530510_0482666 | 3300061734 | Bacteria | 939 |
| 876 | Ga0530510_0665806 | 3300061734 | Bacteria | 793 |
| 877 | Ga0530510_0711399 | 3300061734 | Bacteria | 766 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009551 | Ga0105238_10942751 | Ga0105238_109427511 | 85 |
| 2 | 3300005337 | Ga0070682_100039472 | Ga0070682_1000394723 | 86 |
| 3 | 3300005344 | Ga0070661_100211329 | Ga0070661_1002113292 | 86 |
| 4 | 3300005364 | Ga0070673_100643777 | Ga0070673_1006437772 | 86 |
| 5 | 3300005434 | Ga0070709_10065998 | Ga0070709_100659982 | 86 |
| 6 | 3300005455 | Ga0070663_100018125 | Ga0070663_1000181253 | 86 |
| 7 | 3300005456 | Ga0070678_100093151 | Ga0070678_1000931513 | 86 |
| 8 | 3300005458 | Ga0070681_10039157 | Ga0070681_100391574 | 86 |
| 9 | 3300005530 | Ga0070679_100171922 | Ga0070679_1001719222 | 86 |
| 10 | 3300005544 | Ga0070686_100012297 | Ga0070686_1000122973 | 86 |
| 11 | 3300005578 | Ga0068854_100182523 | Ga0068854_1001825232 | 86 |
| 12 | 3300005615 | Ga0070702_101256906 | Ga0070702_1012569061 | 86 |
| 13 | 3300005840 | Ga0068870_10041791 | Ga0068870_100417912 | 86 |
| 14 | 3300005937 | Ga0081455_10140085 | Ga0081455_101400852 | 86 |
| 15 | 3300006237 | Ga0097621_100038619 | Ga0097621_1000386192 | 86 |
| 16 | 3300006871 | Ga0075434_101199660 | Ga0075434_1011996601 | 86 |
| 17 | 3300009094 | Ga0111539_10273113 | Ga0111539_102731132 | 86 |
| 18 | 3300009147 | Ga0114129_12824929 | Ga0114129_128249292 | 86 |
| 19 | 3300009174 | Ga0105241_10043669 | Ga0105241_100436692 | 86 |
| 20 | 3300010375 | Ga0105239_10273783 | Ga0105239_102737832 | 86 |
| 21 | 3300012510 | Ga0157316_1003391 | Ga0157316_10033912 | 86 |
| 22 | 3300014325 | Ga0163163_10664589 | Ga0163163_106645892 | 86 |
| 23 | 3300014497 | Ga0182008_10573538 | Ga0182008_105735382 | 86 |
| 24 | 3300014969 | Ga0157376_10051798 | Ga0157376_100517982 | 86 |
| 25 | 3300020082 | Ga0206353_10019772 | Ga0206353_100197721 | 86 |
| 26 | 3300025898 | Ga0207692_10798034 | Ga0207692_107980341 | 86 |
| 27 | 3300025911 | Ga0207654_10051699 | Ga0207654_100516992 | 86 |
| 28 | 3300025912 | Ga0207707_10071510 | Ga0207707_100715102 | 86 |
| 29 | 3300025915 | Ga0207693_10061795 | Ga0207693_100617951 | 86 |
| 30 | 3300025916 | Ga0207663_10019136 | Ga0207663_100191365 | 86 |
| 31 | 3300025921 | Ga0207652_10069746 | Ga0207652_100697462 | 86 |
| 32 | 3300025939 | Ga0207665_10001983 | Ga0207665_100019832 | 86 |
| 33 | 3300025944 | Ga0207661_11360667 | Ga0207661_113606672 | 86 |
| 34 | 3300025945 | Ga0207679_10181219 | Ga0207679_101812192 | 86 |
| 35 | 3300025960 | Ga0207651_11981131 | Ga0207651_119811312 | 86 |
| 36 | 3300025981 | Ga0207640_10259968 | Ga0207640_102599682 | 86 |
| 37 | 3300026067 | Ga0207678_10080492 | Ga0207678_100804922 | 86 |
| 38 | 3300026095 | Ga0207676_10477075 | Ga0207676_104770752 | 86 |
| 39 | 3300027907 | Ga0207428_10352850 | Ga0207428_103528502 | 86 |
| 40 | 3300027907 | Ga0207428_10436726 | Ga0207428_104367262 | 86 |
| 41 | 3300034816 | Ga0373930_0154200 | Ga0373930_0154200_289_549 | 86 |
| 42 | 3300037466 | Ga0395898_1018596 | Ga0395898_1018596_442_702 | 86 |
| 43 | 3300037466 | Ga0395898_1444569 | Ga0395898_1444569_341_601 | 86 |
| 44 | 3300038443 | Ga0395901_0166266 | Ga0395901_0166266_1289_1549 | 86 |
| 45 | 3300045976 | Ga0466967_0323005 | Ga0466967_0323005_499_759 | 86 |
| 46 | 3300048903 | Ga0496100_0107149 | Ga0496100_0107149_1260_1520 | 86 |
| 47 | 3300048905 | Ga0496102_0332158 | Ga0496102_0332158_1145_1405 | 86 |
| 48 | 3300048906 | Ga0496103_0001272 | Ga0496103_0001272_15261_15521 | 86 |
| 49 | 3300048907 | Ga0496104_0068050 | Ga0496104_0068050_2455_2715 | 86 |
| 50 | 3300048908 | Ga0496105_0087274 | Ga0496105_0087274_157_417 | 86 |
| 51 | 3300048911 | Ga0496108_0031161 | Ga0496108_0031161_2759_3019 | 86 |
| 52 | 3300048912 | Ga0496109_0391846 | Ga0496109_0391846_60_320 | 86 |
| 53 | 3300048913 | Ga0496110_0040053 | Ga0496110_0040053_1692_1952 | 86 |
| 54 | 3300048914 | Ga0496111_0028098 | Ga0496111_0028098_1927_2187 | 86 |
| 55 | 3300048915 | Ga0496112_0140642 | Ga0496112_0140642_627_887 | 86 |
| 56 | 3300048916 | Ga0496113_0476688 | Ga0496113_0476688_327_587 | 86 |
| 57 | 3300048916 | Ga0496113_1308342 | Ga0496113_1308342_21_281 | 86 |
| 58 | 3300048918 | Ga0496115_0301259 | Ga0496115_0301259_350_610 | 86 |
| 59 | 3300049568 | Ga0501031_0791810 | Ga0501031_0791810_144_404 | 86 |
| 60 | 3300049572 | Ga0501036_0182990 | Ga0501036_0182990_1006_1266 | 86 |
| 61 | 3300049575 | Ga0501039_0288171 | Ga0501039_0288171_370_630 | 86 |
| 62 | 3300049576 | Ga0501040_0869225 | Ga0501040_0869225_104_364 | 86 |
| 63 | 3300049577 | Ga0501041_0193853 | Ga0501041_0193853_365_625 | 86 |
| 64 | 3300049583 | Ga0501067_0008781 | Ga0501067_0008781_2981_3241 | 86 |
| 65 | 3300049583 | Ga0501067_0591902 | Ga0501067_0591902_114_374 | 86 |
| 66 | 3300049584 | Ga0501068_1027469 | Ga0501068_1027469_264_524 | 86 |
| 67 | 3300049585 | Ga0501069_0006739 | Ga0501069_0006739_2446_2706 | 86 |
| 68 | 3300049586 | Ga0501070_0098290 | Ga0501070_0098290_1410_1670 | 86 |
| 69 | 3300049587 | Ga0501071_0017284 | Ga0501071_0017284_2512_2772 | 86 |
| 70 | 3300049588 | Ga0501072_0073843 | Ga0501072_0073843_1941_2201 | 86 |
| 71 | 3300049588 | Ga0501072_0255406 | Ga0501072_0255406_233_493 | 86 |
| 72 | 3300049590 | Ga0501074_0261882 | Ga0501074_0261882_77_337 | 86 |
| 73 | 3300049591 | Ga0501075_0060058 | Ga0501075_0060058_875_1135 | 86 |
| 74 | 3300049741 | Ga0501079_0015422 | Ga0501079_0015422_1135_1395 | 86 |
| 75 | 3300049741 | Ga0501079_0244225 | Ga0501079_0244225_389_649 | 86 |
| 76 | 3300049743 | Ga0501081_0055419 | Ga0501081_0055419_2076_2336 | 86 |
| 77 | 3300049822 | Ga0501035_1279037 | Ga0501035_1279037_180_440 | 86 |
| 78 | 3300049824 | Ga0501045_0078100 | Ga0501045_0078100_1856_2116 | 86 |
| 79 | 3300050511 | nmdc:mga08y16_458110_c1 | nmdc:mga08y16_458110_c1_15_275 | 86 |
| 80 | 3300050511 | nmdc:mga08y16_716998_c1 | nmdc:mga08y16_716998_c1_313_573 | 86 |
| 81 | 3300050511 | nmdc:mga08y16_759948_c1 | nmdc:mga08y16_759948_c1_237_497 | 86 |
| 82 | 3300050512 | nmdc:mga0n895_565935_c1 | nmdc:mga0n895_565935_c1_47_307 | 86 |
| 83 | 3300050512 | nmdc:mga0n895_608643_c1 | nmdc:mga0n895_608643_c1_163_423 | 86 |
| 84 | 3300050512 | nmdc:mga0n895_929025_c1 | nmdc:mga0n895_929025_c1_475_735 | 86 |
| 85 | 3300050515 | nmdc:mga0a205_1165110_c1 | nmdc:mga0a205_1165110_c1_346_606 | 86 |
| 86 | 3300050515 | nmdc:mga0a205_60942_c1 | nmdc:mga0a205_60942_c1_141_401 | 86 |
| 87 | 3300054114 | Ga0501084_0083263 | Ga0501084_0083263_973_1233 | 86 |
| 88 | 3300060353 | Ga0501082_0378196 | Ga0501082_0378196_433_693 | 86 |
| 89 | 3300060353 | Ga0501082_0897358 | Ga0501082_0897358_431_691 | 86 |
| 90 | 3300061734 | Ga0530510_0049813 | Ga0530510_0049813_1464_1724 | 86 |
| 91 | 3300061734 | Ga0530510_0058423 | Ga0530510_0058423_941_1201 | 86 |
| 92 | 3300061734 | Ga0530510_0711399 | Ga0530510_0711399_251_511 | 86 |
| 93 | 3300005338 | Ga0068868_100076443 | Ga0068868_1000764433 | 87 |
| 94 | 3300005341 | Ga0070691_10034986 | Ga0070691_100349863 | 87 |
| 95 | 3300005341 | Ga0070691_10277784 | Ga0070691_102777842 | 87 |
| 96 | 3300005345 | Ga0070692_10877169 | Ga0070692_108771691 | 87 |
| 97 | 3300005347 | Ga0070668_100012799 | Ga0070668_1000127993 | 87 |
| 98 | 3300005353 | Ga0070669_100220227 | Ga0070669_1002202272 | 87 |
| 99 | 3300005434 | Ga0070709_10602433 | Ga0070709_106024331 | 87 |
| 100 | 3300005440 | Ga0070705_101454682 | Ga0070705_1014546821 | 87 |
| 101 | 3300005444 | Ga0070694_100204639 | Ga0070694_1002046392 | 87 |
| 102 | 3300005455 | Ga0070663_101461948 | Ga0070663_1014619482 | 87 |
| 103 | 3300005456 | Ga0070678_101752876 | Ga0070678_1017528761 | 87 |
| 104 | 3300005457 | Ga0070662_100026481 | Ga0070662_1000264815 | 87 |
| 105 | 3300005458 | Ga0070681_10712138 | Ga0070681_107121382 | 87 |
| 106 | 3300005459 | Ga0068867_100223726 | Ga0068867_1002237262 | 87 |
| 107 | 3300005459 | Ga0068867_101451400 | Ga0068867_1014514001 | 87 |
| 108 | 3300005536 | Ga0070697_100588795 | Ga0070697_1005887952 | 87 |
| 109 | 3300005545 | Ga0070695_101449799 | Ga0070695_1014497991 | 87 |
| 110 | 3300005546 | Ga0070696_100486377 | Ga0070696_1004863772 | 87 |
| 111 | 3300005549 | Ga0070704_100268357 | Ga0070704_1002683572 | 87 |
| 112 | 3300005549 | Ga0070704_100462325 | Ga0070704_1004623252 | 87 |
| 113 | 3300005549 | Ga0070704_102123821 | Ga0070704_1021238211 | 87 |
| 114 | 3300005563 | Ga0068855_100056594 | Ga0068855_1000565944 | 87 |
| 115 | 3300005563 | Ga0068855_100085283 | Ga0068855_1000852833 | 87 |
| 116 | 3300005578 | Ga0068854_101361307 | Ga0068854_1013613072 | 87 |
| 117 | 3300005718 | Ga0068866_10067979 | Ga0068866_100679792 | 87 |
| 118 | 3300005719 | Ga0068861_100004039 | Ga0068861_1000040398 | 87 |
| 119 | 3300005840 | Ga0068870_11222205 | Ga0068870_112222051 | 87 |
| 120 | 3300005842 | Ga0068858_100883428 | Ga0068858_1008834281 | 87 |
| 121 | 3300005843 | Ga0068860_102427781 | Ga0068860_1024277811 | 87 |
| 122 | 3300006881 | Ga0068865_100159037 | Ga0068865_1001590372 | 87 |
| 123 | 3300006881 | Ga0068865_100818612 | Ga0068865_1008186122 | 87 |
| 124 | 3300009093 | Ga0105240_10268400 | Ga0105240_102684002 | 87 |
| 125 | 3300009098 | Ga0105245_10059662 | Ga0105245_100596622 | 87 |
| 126 | 3300009098 | Ga0105245_12025969 | Ga0105245_120259691 | 87 |
| 127 | 3300009148 | Ga0105243_10034919 | Ga0105243_100349192 | 87 |
| 128 | 3300009176 | Ga0105242_10220483 | Ga0105242_102204832 | 87 |
| 129 | 3300009553 | Ga0105249_10022281 | Ga0105249_100222814 | 87 |
| 130 | 3300009553 | Ga0105249_10665554 | Ga0105249_106655542 | 87 |
| 131 | 3300009553 | Ga0105249_12325366 | Ga0105249_123253662 | 87 |
| 132 | 3300010375 | Ga0105239_10292632 | Ga0105239_102926322 | 87 |
| 133 | 3300013104 | Ga0157370_10020774 | Ga0157370_100207742 | 87 |
| 134 | 3300013105 | Ga0157369_10192440 | Ga0157369_101924403 | 87 |
| 135 | 3300013306 | Ga0163162_10173123 | Ga0163162_101731232 | 87 |
| 136 | 3300013306 | Ga0163162_10530942 | Ga0163162_105309422 | 87 |
| 137 | 3300013307 | Ga0157372_13043469 | Ga0157372_130434692 | 87 |
| 138 | 3300013308 | Ga0157375_11561608 | Ga0157375_115616081 | 87 |
| 139 | 3300014326 | Ga0157380_11052040 | Ga0157380_110520401 | 87 |
| 140 | 3300014326 | Ga0157380_12369182 | Ga0157380_123691822 | 87 |
| 141 | 3300014745 | Ga0157377_11197990 | Ga0157377_111979902 | 87 |
| 142 | 3300017792 | Ga0163161_10020642 | Ga0163161_100206424 | 87 |
| 143 | 3300020070 | Ga0206356_11691718 | Ga0206356_116917182 | 87 |
| 144 | 3300025899 | Ga0207642_10106239 | Ga0207642_101062392 | 87 |
| 145 | 3300025901 | Ga0207688_10088948 | Ga0207688_100889483 | 87 |
| 146 | 3300025912 | Ga0207707_11604343 | Ga0207707_116043431 | 87 |
| 147 | 3300025915 | Ga0207693_10814431 | Ga0207693_108144312 | 87 |
| 148 | 3300025927 | Ga0207687_11117551 | Ga0207687_111175512 | 87 |
| 149 | 3300025929 | Ga0207664_11462055 | Ga0207664_114620552 | 87 |
| 150 | 3300025933 | Ga0207706_10006904 | Ga0207706_100069041 | 87 |
| 151 | 3300025935 | Ga0207709_10048106 | Ga0207709_100481063 | 87 |
| 152 | 3300025938 | Ga0207704_10335049 | Ga0207704_103350492 | 87 |
| 153 | 3300025938 | Ga0207704_10468823 | Ga0207704_104688232 | 87 |
| 154 | 3300025944 | Ga0207661_10450548 | Ga0207661_104505482 | 87 |
| 155 | 3300025949 | Ga0207667_10076403 | Ga0207667_100764033 | 87 |
| 156 | 3300025949 | Ga0207667_10166210 | Ga0207667_101662103 | 87 |
| 157 | 3300025961 | Ga0207712_10024008 | Ga0207712_100240081 | 87 |
| 158 | 3300025972 | Ga0207668_10322373 | Ga0207668_103223731 | 87 |
| 159 | 3300026089 | Ga0207648_10067794 | Ga0207648_100677943 | 87 |
| 160 | 3300026089 | Ga0207648_10981468 | Ga0207648_109814681 | 87 |
| 161 | 3300026118 | Ga0207675_100000792 | Ga0207675_1000007924 | 87 |
| 162 | 3300026142 | Ga0207698_10221785 | Ga0207698_102217853 | 87 |
| 163 | 3300031731 | Ga0307405_10043409 | Ga0307405_100434092 | 87 |
| 164 | 3300031824 | Ga0307413_10779240 | Ga0307413_107792401 | 87 |
| 165 | 3300031901 | Ga0307406_11723478 | Ga0307406_117234782 | 87 |
| 166 | 3300031911 | Ga0307412_10669810 | Ga0307412_106698102 | 87 |
| 167 | 3300032002 | Ga0307416_100130815 | Ga0307416_1001308153 | 87 |
| 168 | 3300032002 | Ga0307416_100158582 | Ga0307416_1001585823 | 87 |
| 169 | 3300037312 | Ga0395899_0664437 | Ga0395899_0664437_181_444 | 87 |
| 170 | 3300037418 | Ga0395900_0132501 | Ga0395900_0132501_274_537 | 87 |
| 171 | 3300037418 | Ga0395900_0505405 | Ga0395900_0505405_550_813 | 87 |
| 172 | 3300037466 | Ga0395898_0127401 | Ga0395898_0127401_1244_1507 | 87 |
| 173 | 3300037466 | Ga0395898_0139447 | Ga0395898_0139447_1982_2245 | 87 |
| 174 | 3300037466 | Ga0395898_0199860 | Ga0395898_0199860_1355_1618 | 87 |
| 175 | 3300037466 | Ga0395898_0751481 | Ga0395898_0751481_79_342 | 87 |
| 176 | 3300037471 | Ga0395905_0196194 | Ga0395905_0196194_1246_1509 | 87 |
| 177 | 3300037471 | Ga0395905_0857099 | Ga0395905_0857099_134_397 | 87 |
| 178 | 3300038443 | Ga0395901_0099773 | Ga0395901_0099773_969_1232 | 87 |
| 179 | 3300038443 | Ga0395901_0143288 | Ga0395901_0143288_1780_2103 | 87 |
| 180 | 3300038443 | Ga0395901_0154003 | Ga0395901_0154003_1956_2219 | 87 |
| 181 | 3300038443 | Ga0395901_0434011 | Ga0395901_0434011_809_1072 | 87 |
| 182 | 3300044694 | Ga0466963_0003907 | Ga0466963_0003907_2780_3043 | 87 |
| 183 | 3300044706 | Ga0466964_0371995 | Ga0466964_0371995_277_540 | 87 |
| 184 | 3300044842 | Ga0466957_0035500 | Ga0466957_0035500_346_609 | 87 |
| 185 | 3300045836 | Ga0466958_0188522 | Ga0466958_0188522_237_500 | 87 |
| 186 | 3300045976 | Ga0466967_0017646 | Ga0466967_0017646_5002_5265 | 87 |
| 187 | 3300046491 | Ga0495584_0113837 | Ga0495584_0113837_933_1196 | 87 |
| 188 | 3300046539 | Ga0495621_0307785 | Ga0495621_0307785_83_346 | 87 |
| 189 | 3300047318 | Ga0495636_0309298 | Ga0495636_0309298_25_288 | 87 |
| 190 | 3300048905 | Ga0496102_1118018 | Ga0496102_1118018_132_395 | 87 |
| 191 | 3300048913 | Ga0496110_0343280 | Ga0496110_0343280_481_744 | 87 |
| 192 | 3300049569 | Ga0501032_0207989 | Ga0501032_0207989_818_1081 | 87 |
| 193 | 3300049572 | Ga0501036_0008255 | Ga0501036_0008255_5574_5837 | 87 |
| 194 | 3300049572 | Ga0501036_1503353 | Ga0501036_1503353_21_284 | 87 |
| 195 | 3300049573 | Ga0501037_0177334 | Ga0501037_0177334_514_777 | 87 |
| 196 | 3300049574 | Ga0501038_0102375 | Ga0501038_0102375_76_339 | 87 |
| 197 | 3300049574 | Ga0501038_1087868 | Ga0501038_1087868_130_393 | 87 |
| 198 | 3300049575 | Ga0501039_0005748 | Ga0501039_0005748_2846_3109 | 87 |
| 199 | 3300049576 | Ga0501040_0014913 | Ga0501040_0014913_2818_3081 | 87 |
| 200 | 3300049576 | Ga0501040_0434922 | Ga0501040_0434922_409_672 | 87 |
| 201 | 3300049576 | Ga0501040_0543641 | Ga0501040_0543641_407_670 | 87 |
| 202 | 3300049577 | Ga0501041_0013301 | Ga0501041_0013301_1970_2233 | 87 |
| 203 | 3300049577 | Ga0501041_0355648 | Ga0501041_0355648_200_463 | 87 |
| 204 | 3300049577 | Ga0501041_0724316 | Ga0501041_0724316_320_583 | 87 |
| 205 | 3300049578 | Ga0501042_0012634 | Ga0501042_0012634_3312_3575 | 87 |
| 206 | 3300049579 | Ga0501043_0134523 | Ga0501043_0134523_130_393 | 87 |
| 207 | 3300049580 | Ga0501046_0073305 | Ga0501046_0073305_979_1242 | 87 |
| 208 | 3300049582 | Ga0501048_0016652 | Ga0501048_0016652_1600_1863 | 87 |
| 209 | 3300049584 | Ga0501068_0797315 | Ga0501068_0797315_170_433 | 87 |
| 210 | 3300049585 | Ga0501069_0040999 | Ga0501069_0040999_1352_1615 | 87 |
| 211 | 3300049586 | Ga0501070_0282188 | Ga0501070_0282188_58_321 | 87 |
| 212 | 3300049587 | Ga0501071_0003446 | Ga0501071_0003446_4808_5071 | 87 |
| 213 | 3300049587 | Ga0501071_0426790 | Ga0501071_0426790_364_627 | 87 |
| 214 | 3300049588 | Ga0501072_0002483 | Ga0501072_0002483_8294_8557 | 87 |
| 215 | 3300049589 | Ga0501073_0090545 | Ga0501073_0090545_1499_1762 | 87 |
| 216 | 3300049591 | Ga0501075_0016749 | Ga0501075_0016749_3076_3339 | 87 |
| 217 | 3300049591 | Ga0501075_0265228 | Ga0501075_0265228_419_682 | 87 |
| 218 | 3300049592 | Ga0501076_0007588 | Ga0501076_0007588_4605_4868 | 87 |
| 219 | 3300049593 | Ga0501077_0023566 | Ga0501077_0023566_2713_2976 | 87 |
| 220 | 3300049741 | Ga0501079_0001382 | Ga0501079_0001382_8512_8775 | 87 |
| 221 | 3300049742 | Ga0501080_0162035 | Ga0501080_0162035_421_684 | 87 |
| 222 | 3300049743 | Ga0501081_0006195 | Ga0501081_0006195_1496_1759 | 87 |
| 223 | 3300049743 | Ga0501081_0476230 | Ga0501081_0476230_264_527 | 87 |
| 224 | 3300049822 | Ga0501035_0019017 | Ga0501035_0019017_6043_6306 | 87 |
| 225 | 3300049823 | Ga0501044_0237734 | Ga0501044_0237734_1494_1757 | 87 |
| 226 | 3300049824 | Ga0501045_0026787 | Ga0501045_0026787_3862_4125 | 87 |
| 227 | 3300049824 | Ga0501045_0341451 | Ga0501045_0341451_699_962 | 87 |
| 228 | 3300049824 | Ga0501045_0661007 | Ga0501045_0661007_339_602 | 87 |
| 229 | 3300053085 | Ga0495619_0914415 | Ga0495619_0914415_124_387 | 87 |
| 230 | 3300054114 | Ga0501084_0003270 | Ga0501084_0003270_4477_4740 | 87 |
| 231 | 3300054114 | Ga0501084_0263187 | Ga0501084_0263187_435_698 | 87 |
| 232 | 3300060353 | Ga0501082_0047898 | Ga0501082_0047898_2589_2852 | 87 |
| 233 | 3300061719 | Ga0466962_0363666 | Ga0466962_0363666_392_655 | 87 |
| 234 | 3300061734 | Ga0530510_0024164 | Ga0530510_0024164_1013_1276 | 87 |
| 235 | 3300061734 | Ga0530510_0201631 | Ga0530510_0201631_121_384 | 87 |
| 236 | 3300061734 | Ga0530510_0362616 | Ga0530510_0362616_793_1056 | 87 |
| 237 | 2209111006 | 2214844107 | 2213886949 | 88 |
| 238 | 3300000652 | ARCol0yngRDRAFT_1001207 | ARCol0yngRDRAFT_10012072 | 88 |
| 239 | 3300001978 | JGI24747J21853_1052053 | JGI24747J21853_10520532 | 88 |
| 240 | 3300001990 | JGI24737J22298_10086399 | JGI24737J22298_100863992 | 88 |
| 241 | 3300002070 | JGI24750J21931_1056447 | JGI24750J21931_10564471 | 88 |
| 242 | 3300002459 | JGI24751J29686_10086328 | JGI24751J29686_100863282 | 88 |
| 243 | 3300005327 | Ga0070658_10973777 | Ga0070658_109737771 | 88 |
| 244 | 3300005327 | Ga0070658_11031398 | Ga0070658_110313982 | 88 |
| 245 | 3300005328 | Ga0070676_10262441 | Ga0070676_102624412 | 88 |
| 246 | 3300005329 | Ga0070683_100029646 | Ga0070683_1000296462 | 88 |
| 247 | 3300005329 | Ga0070683_100113027 | Ga0070683_1001130272 | 88 |
| 248 | 3300005329 | Ga0070683_100155888 | Ga0070683_1001558882 | 88 |
| 249 | 3300005329 | Ga0070683_100731772 | Ga0070683_1007317721 | 88 |
| 250 | 3300005331 | Ga0070670_100004293 | Ga0070670_1000042932 | 88 |
| 251 | 3300005331 | Ga0070670_101284636 | Ga0070670_1012846362 | 88 |
| 252 | 3300005334 | Ga0068869_100765152 | Ga0068869_1007651522 | 88 |
| 253 | 3300005336 | Ga0070680_100017076 | Ga0070680_1000170764 | 88 |
| 254 | 3300005336 | Ga0070680_100047883 | Ga0070680_1000478832 | 88 |
| 255 | 3300005336 | Ga0070680_100184404 | Ga0070680_1001844042 | 88 |
| 256 | 3300005337 | Ga0070682_100027482 | Ga0070682_1000274823 | 88 |
| 257 | 3300005337 | Ga0070682_100069359 | Ga0070682_1000693592 | 88 |
| 258 | 3300005337 | Ga0070682_100207939 | Ga0070682_1002079392 | 88 |
| 259 | 3300005337 | Ga0070682_100422299 | Ga0070682_1004222992 | 88 |
| 260 | 3300005337 | Ga0070682_100538241 | Ga0070682_1005382412 | 88 |
| 261 | 3300005338 | Ga0068868_100052357 | Ga0068868_1000523573 | 88 |
| 262 | 3300005338 | Ga0068868_100274197 | Ga0068868_1002741972 | 88 |
| 263 | 3300005339 | Ga0070660_100004020 | Ga0070660_1000040206 | 88 |
| 264 | 3300005339 | Ga0070660_100051687 | Ga0070660_1000516872 | 88 |
| 265 | 3300005339 | Ga0070660_100054676 | Ga0070660_1000546762 | 88 |
| 266 | 3300005339 | Ga0070660_100069690 | Ga0070660_1000696903 | 88 |
| 267 | 3300005339 | Ga0070660_100741137 | Ga0070660_1007411372 | 88 |
| 268 | 3300005340 | Ga0070689_100003774 | Ga0070689_1000037742 | 88 |
| 269 | 3300005341 | Ga0070691_10007080 | Ga0070691_100070802 | 88 |
| 270 | 3300005341 | Ga0070691_10067369 | Ga0070691_100673692 | 88 |
| 271 | 3300005341 | Ga0070691_10100715 | Ga0070691_101007152 | 88 |
| 272 | 3300005341 | Ga0070691_10201465 | Ga0070691_102014651 | 88 |
| 273 | 3300005343 | Ga0070687_100175273 | Ga0070687_1001752732 | 88 |
| 274 | 3300005344 | Ga0070661_100032624 | Ga0070661_1000326242 | 88 |
| 275 | 3300005344 | Ga0070661_100040181 | Ga0070661_1000401812 | 88 |
| 276 | 3300005344 | Ga0070661_100051438 | Ga0070661_1000514382 | 88 |
| 277 | 3300005344 | Ga0070661_100061220 | Ga0070661_1000612203 | 88 |
| 278 | 3300005344 | Ga0070661_100327878 | Ga0070661_1003278781 | 88 |
| 279 | 3300005345 | Ga0070692_10263196 | Ga0070692_102631962 | 88 |
| 280 | 3300005345 | Ga0070692_10313588 | Ga0070692_103135882 | 88 |
| 281 | 3300005347 | Ga0070668_100106381 | Ga0070668_1001063812 | 88 |
| 282 | 3300005353 | Ga0070669_101617951 | Ga0070669_1016179511 | 88 |
| 283 | 3300005354 | Ga0070675_100022753 | Ga0070675_1000227534 | 88 |
| 284 | 3300005354 | Ga0070675_100088535 | Ga0070675_1000885352 | 88 |
| 285 | 3300005355 | Ga0070671_100050170 | Ga0070671_1000501703 | 88 |
| 286 | 3300005356 | Ga0070674_100048016 | Ga0070674_1000480162 | 88 |
| 287 | 3300005364 | Ga0070673_100125318 | Ga0070673_1001253182 | 88 |
| 288 | 3300005365 | Ga0070688_100013097 | Ga0070688_1000130973 | 88 |
| 289 | 3300005366 | Ga0070659_100004191 | Ga0070659_1000041913 | 88 |
| 290 | 3300005366 | Ga0070659_100139846 | Ga0070659_1001398462 | 88 |
| 291 | 3300005366 | Ga0070659_100191809 | Ga0070659_1001918092 | 88 |
| 292 | 3300005366 | Ga0070659_100248844 | Ga0070659_1002488442 | 88 |
| 293 | 3300005366 | Ga0070659_100455386 | Ga0070659_1004553862 | 88 |
| 294 | 3300005366 | Ga0070659_100781266 | Ga0070659_1007812662 | 88 |
| 295 | 3300005438 | Ga0070701_10036135 | Ga0070701_100361352 | 88 |
| 296 | 3300005440 | Ga0070705_100124794 | Ga0070705_1001247942 | 88 |
| 297 | 3300005441 | Ga0070700_100022475 | Ga0070700_1000224752 | 88 |
| 298 | 3300005441 | Ga0070700_100183854 | Ga0070700_1001838542 | 88 |
| 299 | 3300005444 | Ga0070694_100378890 | Ga0070694_1003788902 | 88 |
| 300 | 3300005444 | Ga0070694_100510143 | Ga0070694_1005101432 | 88 |
| 301 | 3300005445 | Ga0070708_100026347 | Ga0070708_1000263475 | 88 |
| 302 | 3300005445 | Ga0070708_100543202 | Ga0070708_1005432022 | 88 |
| 303 | 3300005455 | Ga0070663_100377550 | Ga0070663_1003775502 | 88 |
| 304 | 3300005455 | Ga0070663_100745347 | Ga0070663_1007453472 | 88 |
| 305 | 3300005455 | Ga0070663_100851697 | Ga0070663_1008516972 | 88 |
| 306 | 3300005456 | Ga0070678_100113926 | Ga0070678_1001139262 | 88 |
| 307 | 3300005458 | Ga0070681_10004205 | Ga0070681_100042054 | 88 |
| 308 | 3300005458 | Ga0070681_10026421 | Ga0070681_100264215 | 88 |
| 309 | 3300005458 | Ga0070681_10029317 | Ga0070681_100293175 | 88 |
| 310 | 3300005458 | Ga0070681_10120245 | Ga0070681_101202452 | 88 |
| 311 | 3300005458 | Ga0070681_10133318 | Ga0070681_101333182 | 88 |
| 312 | 3300005459 | Ga0068867_100344255 | Ga0068867_1003442552 | 88 |
| 313 | 3300005459 | Ga0068867_100356219 | Ga0068867_1003562192 | 88 |
| 314 | 3300005459 | Ga0068867_101923455 | Ga0068867_1019234552 | 88 |
| 315 | 3300005466 | Ga0070685_10002617 | Ga0070685_100026178 | 88 |
| 316 | 3300005466 | Ga0070685_10214238 | Ga0070685_102142382 | 88 |
| 317 | 3300005467 | Ga0070706_100100250 | Ga0070706_1001002503 | 88 |
| 318 | 3300005471 | Ga0070698_100012820 | Ga0070698_1000128205 | 88 |
| 319 | 3300005518 | Ga0070699_100725371 | Ga0070699_1007253712 | 88 |
| 320 | 3300005530 | Ga0070679_100016489 | Ga0070679_1000164892 | 88 |
| 321 | 3300005530 | Ga0070679_100051786 | Ga0070679_1000517865 | 88 |
| 322 | 3300005530 | Ga0070679_100053802 | Ga0070679_1000538022 | 88 |
| 323 | 3300005530 | Ga0070679_100370840 | Ga0070679_1003708402 | 88 |
| 324 | 3300005530 | Ga0070679_100398849 | Ga0070679_1003988492 | 88 |
| 325 | 3300005535 | Ga0070684_100026963 | Ga0070684_1000269633 | 88 |
| 326 | 3300005535 | Ga0070684_100059030 | Ga0070684_1000590304 | 88 |
| 327 | 3300005535 | Ga0070684_100083164 | Ga0070684_1000831643 | 88 |
| 328 | 3300005535 | Ga0070684_101123807 | Ga0070684_1011238072 | 88 |
| 329 | 3300005539 | Ga0068853_100061202 | Ga0068853_1000612022 | 88 |
| 330 | 3300005539 | Ga0068853_100204397 | Ga0068853_1002043972 | 88 |
| 331 | 3300005539 | Ga0068853_100534876 | Ga0068853_1005348762 | 88 |
| 332 | 3300005539 | Ga0068853_100554622 | Ga0068853_1005546222 | 88 |
| 333 | 3300005543 | Ga0070672_100340813 | Ga0070672_1003408132 | 88 |
| 334 | 3300005544 | Ga0070686_100061669 | Ga0070686_1000616691 | 88 |
| 335 | 3300005544 | Ga0070686_101124669 | Ga0070686_1011246691 | 88 |
| 336 | 3300005545 | Ga0070695_100325320 | Ga0070695_1003253202 | 88 |
| 337 | 3300005546 | Ga0070696_100046066 | Ga0070696_1000460662 | 88 |
| 338 | 3300005546 | Ga0070696_100090361 | Ga0070696_1000903612 | 88 |
| 339 | 3300005546 | Ga0070696_100619929 | Ga0070696_1006199292 | 88 |
| 340 | 3300005547 | Ga0070693_100002576 | Ga0070693_1000025762 | 88 |
| 341 | 3300005547 | Ga0070693_100028915 | Ga0070693_1000289152 | 88 |
| 342 | 3300005547 | Ga0070693_100523434 | Ga0070693_1005234342 | 88 |
| 343 | 3300005548 | Ga0070665_100003372 | Ga0070665_1000033722 | 88 |
| 344 | 3300005548 | Ga0070665_100004675 | Ga0070665_1000046752 | 88 |
| 345 | 3300005549 | Ga0070704_100161901 | Ga0070704_1001619012 | 88 |
| 346 | 3300005563 | Ga0068855_100026901 | Ga0068855_1000269016 | 88 |
| 347 | 3300005563 | Ga0068855_100087106 | Ga0068855_1000871062 | 88 |
| 348 | 3300005563 | Ga0068855_100099792 | Ga0068855_1000997922 | 88 |
| 349 | 3300005563 | Ga0068855_100145330 | Ga0068855_1001453303 | 88 |
| 350 | 3300005563 | Ga0068855_100383957 | Ga0068855_1003839572 | 88 |
| 351 | 3300005564 | Ga0070664_100056774 | Ga0070664_1000567742 | 88 |
| 352 | 3300005564 | Ga0070664_100569298 | Ga0070664_1005692982 | 88 |
| 353 | 3300005564 | Ga0070664_100632732 | Ga0070664_1006327322 | 88 |
| 354 | 3300005577 | Ga0068857_100052743 | Ga0068857_1000527431 | 88 |
| 355 | 3300005577 | Ga0068857_100081880 | Ga0068857_1000818802 | 88 |
| 356 | 3300005577 | Ga0068857_100274491 | Ga0068857_1002744912 | 88 |
| 357 | 3300005577 | Ga0068857_101073422 | Ga0068857_1010734222 | 88 |
| 358 | 3300005578 | Ga0068854_100057292 | Ga0068854_1000572923 | 88 |
| 359 | 3300005578 | Ga0068854_100069149 | Ga0068854_1000691492 | 88 |
| 360 | 3300005578 | Ga0068854_100616682 | Ga0068854_1006166822 | 88 |
| 361 | 3300005614 | Ga0068856_100030809 | Ga0068856_1000308092 | 88 |
| 362 | 3300005614 | Ga0068856_100208424 | Ga0068856_1002084242 | 88 |
| 363 | 3300005614 | Ga0068856_100491018 | Ga0068856_1004910182 | 88 |
| 364 | 3300005614 | Ga0068856_101498064 | Ga0068856_1014980642 | 88 |
| 365 | 3300005614 | Ga0068856_101982363 | Ga0068856_1019823632 | 88 |
| 366 | 3300005615 | Ga0070702_100030952 | Ga0070702_1000309524 | 88 |
| 367 | 3300005615 | Ga0070702_100185144 | Ga0070702_1001851442 | 88 |
| 368 | 3300005616 | Ga0068852_100052926 | Ga0068852_1000529262 | 88 |
| 369 | 3300005616 | Ga0068852_100404257 | Ga0068852_1004042572 | 88 |
| 370 | 3300005616 | Ga0068852_100958545 | Ga0068852_1009585452 | 88 |
| 371 | 3300005616 | Ga0068852_101491142 | Ga0068852_1014911422 | 88 |
| 372 | 3300005617 | Ga0068859_100742505 | Ga0068859_1007425052 | 88 |
| 373 | 3300005718 | Ga0068866_10616268 | Ga0068866_106162682 | 88 |
| 374 | 3300005719 | Ga0068861_100453555 | Ga0068861_1004535552 | 88 |
| 375 | 3300005834 | Ga0068851_10228045 | Ga0068851_102280452 | 88 |
| 376 | 3300005840 | Ga0068870_10434679 | Ga0068870_104346792 | 88 |
| 377 | 3300005840 | Ga0068870_10470001 | Ga0068870_104700012 | 88 |
| 378 | 3300005840 | Ga0068870_10714179 | Ga0068870_107141792 | 88 |
| 379 | 3300005840 | Ga0068870_10818601 | Ga0068870_108186012 | 88 |
| 380 | 3300005841 | Ga0068863_100896296 | Ga0068863_1008962961 | 88 |
| 381 | 3300005843 | Ga0068860_102257699 | Ga0068860_1022576991 | 88 |
| 382 | 3300005844 | Ga0068862_100087547 | Ga0068862_1000875472 | 88 |
| 383 | 3300005937 | Ga0081455_10006006 | Ga0081455_1000600610 | 88 |
| 384 | 3300005983 | Ga0081540_1002188 | Ga0081540_100218816 | 88 |
| 385 | 3300005983 | Ga0081540_1030610 | Ga0081540_10306102 | 88 |
| 386 | 3300006038 | Ga0075365_10194479 | Ga0075365_101944792 | 88 |
| 387 | 3300006048 | Ga0075363_100229734 | Ga0075363_1002297342 | 88 |
| 388 | 3300006058 | Ga0075432_10000461 | Ga0075432_100004615 | 88 |
| 389 | 3300006058 | Ga0075432_10018005 | Ga0075432_100180053 | 88 |
| 390 | 3300006173 | Ga0070716_101119217 | Ga0070716_1011192172 | 88 |
| 391 | 3300006178 | Ga0075367_10027362 | Ga0075367_100273622 | 88 |
| 392 | 3300006844 | Ga0075428_100002927 | Ga0075428_1000029274 | 88 |
| 393 | 3300006844 | Ga0075428_100056461 | Ga0075428_1000564612 | 88 |
| 394 | 3300006844 | Ga0075428_100116177 | Ga0075428_1001161773 | 88 |
| 395 | 3300006844 | Ga0075428_100216755 | Ga0075428_1002167552 | 88 |
| 396 | 3300006847 | Ga0075431_100108803 | Ga0075431_1001088033 | 88 |
| 397 | 3300006847 | Ga0075431_100295335 | Ga0075431_1002953352 | 88 |
| 398 | 3300006852 | Ga0075433_10035247 | Ga0075433_100352474 | 88 |
| 399 | 3300006852 | Ga0075433_10224985 | Ga0075433_102249852 | 88 |
| 400 | 3300006852 | Ga0075433_11465387 | Ga0075433_114653872 | 88 |
| 401 | 3300006871 | Ga0075434_100057148 | Ga0075434_1000571482 | 88 |
| 402 | 3300006871 | Ga0075434_100083197 | Ga0075434_1000831972 | 88 |
| 403 | 3300006871 | Ga0075434_100417130 | Ga0075434_1004171302 | 88 |
| 404 | 3300006880 | Ga0075429_100054406 | Ga0075429_1000544062 | 88 |
| 405 | 3300006880 | Ga0075429_100641003 | Ga0075429_1006410032 | 88 |
| 406 | 3300006881 | Ga0068865_100039816 | Ga0068865_1000398163 | 88 |
| 407 | 3300006881 | Ga0068865_100083672 | Ga0068865_1000836722 | 88 |
| 408 | 3300006881 | Ga0068865_101348879 | Ga0068865_1013488792 | 88 |
| 409 | 3300006914 | Ga0075436_100122633 | Ga0075436_1001226332 | 88 |
| 410 | 3300006914 | Ga0075436_100779747 | Ga0075436_1007797471 | 88 |
| 411 | 3300006931 | Ga0097620_100742438 | Ga0097620_1007424382 | 88 |
| 412 | 3300007076 | Ga0075435_100011630 | Ga0075435_1000116302 | 88 |
| 413 | 3300007076 | Ga0075435_100083320 | Ga0075435_1000833202 | 88 |
| 414 | 3300007076 | Ga0075435_100246405 | Ga0075435_1002464052 | 88 |
| 415 | 3300007076 | Ga0075435_101050587 | Ga0075435_1010505872 | 88 |
| 416 | 3300009036 | Ga0105244_10555514 | Ga0105244_105555142 | 88 |
| 417 | 3300009093 | Ga0105240_10071711 | Ga0105240_100717112 | 88 |
| 418 | 3300009093 | Ga0105240_10424666 | Ga0105240_104246662 | 88 |
| 419 | 3300009093 | Ga0105240_11454002 | Ga0105240_114540022 | 88 |
| 420 | 3300009094 | Ga0111539_10000483 | Ga0111539_1000048318 | 88 |
| 421 | 3300009094 | Ga0111539_10004184 | Ga0111539_100041845 | 88 |
| 422 | 3300009094 | Ga0111539_10164031 | Ga0111539_101640312 | 88 |
| 423 | 3300009098 | Ga0105245_10001379 | Ga0105245_1000137918 | 88 |
| 424 | 3300009098 | Ga0105245_10020869 | Ga0105245_100208695 | 88 |
| 425 | 3300009098 | Ga0105245_10108014 | Ga0105245_101080142 | 88 |
| 426 | 3300009098 | Ga0105245_10275884 | Ga0105245_102758842 | 88 |
| 427 | 3300009147 | Ga0114129_10026232 | Ga0114129_100262322 | 88 |
| 428 | 3300009147 | Ga0114129_10517947 | Ga0114129_105179472 | 88 |
| 429 | 3300009147 | Ga0114129_11111957 | Ga0114129_111119572 | 88 |
| 430 | 3300009148 | Ga0105243_10075909 | Ga0105243_100759092 | 88 |
| 431 | 3300009174 | Ga0105241_10279762 | Ga0105241_102797622 | 88 |
| 432 | 3300009174 | Ga0105241_10872022 | Ga0105241_108720222 | 88 |
| 433 | 3300009176 | Ga0105242_10343508 | Ga0105242_103435081 | 88 |
| 434 | 3300009177 | Ga0105248_10085552 | Ga0105248_100855523 | 88 |
| 435 | 3300009545 | Ga0105237_10022728 | Ga0105237_100227282 | 88 |
| 436 | 3300009545 | Ga0105237_10150488 | Ga0105237_101504882 | 88 |
| 437 | 3300009545 | Ga0105237_12424549 | Ga0105237_124245492 | 88 |
| 438 | 3300009551 | Ga0105238_10028446 | Ga0105238_100284463 | 88 |
| 439 | 3300009551 | Ga0105238_10057436 | Ga0105238_100574361 | 88 |
| 440 | 3300009551 | Ga0105238_10719059 | Ga0105238_107190592 | 88 |
| 441 | 3300009553 | Ga0105249_10136595 | Ga0105249_101365952 | 88 |
| 442 | 3300009553 | Ga0105249_12774164 | Ga0105249_127741642 | 88 |
| 443 | 3300010375 | Ga0105239_10151122 | Ga0105239_101511222 | 88 |
| 444 | 3300010375 | Ga0105239_10180465 | Ga0105239_101804653 | 88 |
| 445 | 3300010375 | Ga0105239_10882106 | Ga0105239_108821062 | 88 |
| 446 | 3300010375 | Ga0105239_13214856 | Ga0105239_132148562 | 88 |
| 447 | 3300011119 | Ga0105246_10015407 | Ga0105246_100154072 | 88 |
| 448 | 3300011119 | Ga0105246_10102170 | Ga0105246_101021703 | 88 |
| 449 | 3300011119 | Ga0105246_10731582 | Ga0105246_107315822 | 88 |
| 450 | 3300011119 | Ga0105246_11710392 | Ga0105246_117103921 | 88 |
| 451 | 3300013100 | Ga0157373_10010162 | Ga0157373_100101623 | 88 |
| 452 | 3300013100 | Ga0157373_10178559 | Ga0157373_101785592 | 88 |
| 453 | 3300013100 | Ga0157373_10309800 | Ga0157373_103098002 | 88 |
| 454 | 3300013100 | Ga0157373_10448377 | Ga0157373_104483771 | 88 |
| 455 | 3300013100 | Ga0157373_11293122 | Ga0157373_112931221 | 88 |
| 456 | 3300013102 | Ga0157371_10251315 | Ga0157371_102513152 | 88 |
| 457 | 3300013102 | Ga0157371_10568442 | Ga0157371_105684422 | 88 |
| 458 | 3300013104 | Ga0157370_10020350 | Ga0157370_100203505 | 88 |
| 459 | 3300013104 | Ga0157370_10148352 | Ga0157370_101483523 | 88 |
| 460 | 3300013104 | Ga0157370_10353642 | Ga0157370_103536422 | 88 |
| 461 | 3300013105 | Ga0157369_10015314 | Ga0157369_100153146 | 88 |
| 462 | 3300013105 | Ga0157369_10051364 | Ga0157369_100513643 | 88 |
| 463 | 3300013105 | Ga0157369_10778406 | Ga0157369_107784062 | 88 |
| 464 | 3300013105 | Ga0157369_11614538 | Ga0157369_116145381 | 88 |
| 465 | 3300013296 | Ga0157374_10262783 | Ga0157374_102627832 | 88 |
| 466 | 3300013296 | Ga0157374_11099496 | Ga0157374_110994961 | 88 |
| 467 | 3300013296 | Ga0157374_11705925 | Ga0157374_117059252 | 88 |
| 468 | 3300013297 | Ga0157378_11120696 | Ga0157378_111206962 | 88 |
| 469 | 3300013306 | Ga0163162_10122856 | Ga0163162_101228562 | 88 |
| 470 | 3300013307 | Ga0157372_10007863 | Ga0157372_100078633 | 88 |
| 471 | 3300013307 | Ga0157372_10119843 | Ga0157372_101198431 | 88 |
| 472 | 3300013307 | Ga0157372_10437467 | Ga0157372_104374671 | 88 |
| 473 | 3300013307 | Ga0157372_11594983 | Ga0157372_115949832 | 88 |
| 474 | 3300013307 | Ga0157372_12148938 | Ga0157372_121489382 | 88 |
| 475 | 3300013308 | Ga0157375_10050701 | Ga0157375_100507012 | 88 |
| 476 | 3300013308 | Ga0157375_12222052 | Ga0157375_122220522 | 88 |
| 477 | 3300014325 | Ga0163163_10061159 | Ga0163163_100611592 | 88 |
| 478 | 3300014325 | Ga0163163_10190410 | Ga0163163_101904102 | 88 |
| 479 | 3300014325 | Ga0163163_10240064 | Ga0163163_102400642 | 88 |
| 480 | 3300014325 | Ga0163163_13284084 | Ga0163163_132840842 | 88 |
| 481 | 3300014497 | Ga0182008_10378925 | Ga0182008_103789252 | 88 |
| 482 | 3300014745 | Ga0157377_10052985 | Ga0157377_100529852 | 88 |
| 483 | 3300014745 | Ga0157377_10068182 | Ga0157377_100681822 | 88 |
| 484 | 3300014745 | Ga0157377_10165281 | Ga0157377_101652812 | 88 |
| 485 | 3300014969 | Ga0157376_10703166 | Ga0157376_107031662 | 88 |
| 486 | 3300014969 | Ga0157376_11033325 | Ga0157376_110333252 | 88 |
| 487 | 3300017792 | Ga0163161_10101804 | Ga0163161_101018042 | 88 |
| 488 | 3300020069 | Ga0197907_10381642 | Ga0197907_103816422 | 88 |
| 489 | 3300020070 | Ga0206356_10893813 | Ga0206356_108938131 | 88 |
| 490 | 3300020081 | Ga0206354_10655524 | Ga0206354_106555243 | 88 |
| 491 | 3300020081 | Ga0206354_11064529 | Ga0206354_110645292 | 88 |
| 492 | 3300020082 | Ga0206353_10184386 | Ga0206353_101843862 | 88 |
| 493 | 3300020082 | Ga0206353_10588121 | Ga0206353_105881212 | 88 |
| 494 | 3300020082 | Ga0206353_11289376 | Ga0206353_112893761 | 88 |
| 495 | 3300022467 | Ga0224712_10285904 | Ga0224712_102859042 | 88 |
| 496 | 3300025898 | Ga0207692_10571233 | Ga0207692_105712332 | 88 |
| 497 | 3300025901 | Ga0207688_10029329 | Ga0207688_100293292 | 88 |
| 498 | 3300025906 | Ga0207699_10237408 | Ga0207699_102374082 | 88 |
| 499 | 3300025907 | Ga0207645_10034937 | Ga0207645_100349372 | 88 |
| 500 | 3300025908 | Ga0207643_10001826 | Ga0207643_100018264 | 88 |
| 501 | 3300025908 | Ga0207643_10046142 | Ga0207643_100461422 | 88 |
| 502 | 3300025909 | Ga0207705_10027534 | Ga0207705_100275344 | 88 |
| 503 | 3300025909 | Ga0207705_10129551 | Ga0207705_101295512 | 88 |
| 504 | 3300025910 | Ga0207684_10062371 | Ga0207684_100623712 | 88 |
| 505 | 3300025910 | Ga0207684_10190423 | Ga0207684_101904232 | 88 |
| 506 | 3300025911 | Ga0207654_10154676 | Ga0207654_101546761 | 88 |
| 507 | 3300025911 | Ga0207654_10566411 | Ga0207654_105664112 | 88 |
| 508 | 3300025912 | Ga0207707_10054970 | Ga0207707_100549704 | 88 |
| 509 | 3300025912 | Ga0207707_10072380 | Ga0207707_100723804 | 88 |
| 510 | 3300025912 | Ga0207707_10105283 | Ga0207707_101052832 | 88 |
| 511 | 3300025912 | Ga0207707_10251253 | Ga0207707_102512532 | 88 |
| 512 | 3300025913 | Ga0207695_10192103 | Ga0207695_101921032 | 88 |
| 513 | 3300025913 | Ga0207695_11129340 | Ga0207695_111293401 | 88 |
| 514 | 3300025914 | Ga0207671_10151354 | Ga0207671_101513542 | 88 |
| 515 | 3300025914 | Ga0207671_10153650 | Ga0207671_101536502 | 88 |
| 516 | 3300025914 | Ga0207671_11082927 | Ga0207671_110829271 | 88 |
| 517 | 3300025917 | Ga0207660_10032133 | Ga0207660_100321332 | 88 |
| 518 | 3300025917 | Ga0207660_10035433 | Ga0207660_100354332 | 88 |
| 519 | 3300025917 | Ga0207660_10184149 | Ga0207660_101841492 | 88 |
| 520 | 3300025917 | Ga0207660_10195234 | Ga0207660_101952343 | 88 |
| 521 | 3300025918 | Ga0207662_10036660 | Ga0207662_100366602 | 88 |
| 522 | 3300025919 | Ga0207657_10000467 | Ga0207657_1000046728 | 88 |
| 523 | 3300025919 | Ga0207657_10000731 | Ga0207657_100007316 | 88 |
| 524 | 3300025919 | Ga0207657_10033593 | Ga0207657_100335932 | 88 |
| 525 | 3300025919 | Ga0207657_10072051 | Ga0207657_100720513 | 88 |
| 526 | 3300025919 | Ga0207657_10170245 | Ga0207657_101702452 | 88 |
| 527 | 3300025919 | Ga0207657_10184231 | Ga0207657_101842312 | 88 |
| 528 | 3300025919 | Ga0207657_10500669 | Ga0207657_105006692 | 88 |
| 529 | 3300025920 | Ga0207649_10014002 | Ga0207649_100140024 | 88 |
| 530 | 3300025920 | Ga0207649_10067545 | Ga0207649_100675452 | 88 |
| 531 | 3300025920 | Ga0207649_10201225 | Ga0207649_102012252 | 88 |
| 532 | 3300025920 | Ga0207649_10291502 | Ga0207649_102915022 | 88 |
| 533 | 3300025921 | Ga0207652_10029820 | Ga0207652_100298202 | 88 |
| 534 | 3300025921 | Ga0207652_10047514 | Ga0207652_100475144 | 88 |
| 535 | 3300025921 | Ga0207652_10071978 | Ga0207652_100719782 | 88 |
| 536 | 3300025921 | Ga0207652_10113398 | Ga0207652_101133982 | 88 |
| 537 | 3300025921 | Ga0207652_10191399 | Ga0207652_101913992 | 88 |
| 538 | 3300025921 | Ga0207652_10200392 | Ga0207652_102003922 | 88 |
| 539 | 3300025921 | Ga0207652_10360937 | Ga0207652_103609372 | 88 |
| 540 | 3300025922 | Ga0207646_10475425 | Ga0207646_104754252 | 88 |
| 541 | 3300025923 | Ga0207681_10427786 | Ga0207681_104277861 | 88 |
| 542 | 3300025924 | Ga0207694_10046466 | Ga0207694_100464663 | 88 |
| 543 | 3300025924 | Ga0207694_10143163 | Ga0207694_101431632 | 88 |
| 544 | 3300025924 | Ga0207694_10819375 | Ga0207694_108193752 | 88 |
| 545 | 3300025925 | Ga0207650_10475642 | Ga0207650_104756422 | 88 |
| 546 | 3300025926 | Ga0207659_10077356 | Ga0207659_100773562 | 88 |
| 547 | 3300025927 | Ga0207687_10039162 | Ga0207687_100391622 | 88 |
| 548 | 3300025927 | Ga0207687_10499823 | Ga0207687_104998232 | 88 |
| 549 | 3300025931 | Ga0207644_10151842 | Ga0207644_101518422 | 88 |
| 550 | 3300025932 | Ga0207690_10026602 | Ga0207690_100266023 | 88 |
| 551 | 3300025932 | Ga0207690_10264722 | Ga0207690_102647222 | 88 |
| 552 | 3300025932 | Ga0207690_11583860 | Ga0207690_115838602 | 88 |
| 553 | 3300025934 | Ga0207686_10257160 | Ga0207686_102571602 | 88 |
| 554 | 3300025935 | Ga0207709_10570505 | Ga0207709_105705052 | 88 |
| 555 | 3300025937 | Ga0207669_10005301 | Ga0207669_100053013 | 88 |
| 556 | 3300025937 | Ga0207669_10099012 | Ga0207669_100990122 | 88 |
| 557 | 3300025938 | Ga0207704_10007727 | Ga0207704_100077274 | 88 |
| 558 | 3300025939 | Ga0207665_10395148 | Ga0207665_103951481 | 88 |
| 559 | 3300025939 | Ga0207665_10600325 | Ga0207665_106003252 | 88 |
| 560 | 3300025941 | Ga0207711_10485872 | Ga0207711_104858722 | 88 |
| 561 | 3300025942 | Ga0207689_10027077 | Ga0207689_100270772 | 88 |
| 562 | 3300025942 | Ga0207689_10131692 | Ga0207689_101316922 | 88 |
| 563 | 3300025942 | Ga0207689_10302189 | Ga0207689_103021892 | 88 |
| 564 | 3300025942 | Ga0207689_10339157 | Ga0207689_103391571 | 88 |
| 565 | 3300025944 | Ga0207661_10219589 | Ga0207661_102195892 | 88 |
| 566 | 3300025944 | Ga0207661_10237678 | Ga0207661_102376782 | 88 |
| 567 | 3300025944 | Ga0207661_11184357 | Ga0207661_111843571 | 88 |
| 568 | 3300025944 | Ga0207661_11381924 | Ga0207661_113819242 | 88 |
| 569 | 3300025944 | Ga0207661_11748784 | Ga0207661_117487842 | 88 |
| 570 | 3300025944 | Ga0207661_11921883 | Ga0207661_119218831 | 88 |
| 571 | 3300025945 | Ga0207679_10228018 | Ga0207679_102280183 | 88 |
| 572 | 3300025945 | Ga0207679_10702118 | Ga0207679_107021182 | 88 |
| 573 | 3300025945 | Ga0207679_11234490 | Ga0207679_112344902 | 88 |
| 574 | 3300025949 | Ga0207667_10047992 | Ga0207667_100479922 | 88 |
| 575 | 3300025949 | Ga0207667_10055691 | Ga0207667_100556913 | 88 |
| 576 | 3300025949 | Ga0207667_10138219 | Ga0207667_101382193 | 88 |
| 577 | 3300025949 | Ga0207667_10334528 | Ga0207667_103345282 | 88 |
| 578 | 3300025949 | Ga0207667_12145574 | Ga0207667_121455741 | 88 |
| 579 | 3300025960 | Ga0207651_10100351 | Ga0207651_101003512 | 88 |
| 580 | 3300025961 | Ga0207712_10033899 | Ga0207712_100338993 | 88 |
| 581 | 3300025972 | Ga0207668_10098019 | Ga0207668_100980192 | 88 |
| 582 | 3300025972 | Ga0207668_10118821 | Ga0207668_101188212 | 88 |
| 583 | 3300025981 | Ga0207640_10075865 | Ga0207640_100758652 | 88 |
| 584 | 3300025981 | Ga0207640_10082353 | Ga0207640_100823533 | 88 |
| 585 | 3300026041 | Ga0207639_10083877 | Ga0207639_100838772 | 88 |
| 586 | 3300026067 | Ga0207678_11013350 | Ga0207678_110133501 | 88 |
| 587 | 3300026075 | Ga0207708_10011473 | Ga0207708_100114735 | 88 |
| 588 | 3300026075 | Ga0207708_10037886 | Ga0207708_100378864 | 88 |
| 589 | 3300026075 | Ga0207708_10209939 | Ga0207708_102099392 | 88 |
| 590 | 3300026075 | Ga0207708_10275707 | Ga0207708_102757072 | 88 |
| 591 | 3300026078 | Ga0207702_10256927 | Ga0207702_102569272 | 88 |
| 592 | 3300026078 | Ga0207702_10804426 | Ga0207702_108044262 | 88 |
| 593 | 3300026088 | Ga0207641_10803993 | Ga0207641_108039932 | 88 |
| 594 | 3300026089 | Ga0207648_10314967 | Ga0207648_103149672 | 88 |
| 595 | 3300026089 | Ga0207648_10631573 | Ga0207648_106315732 | 88 |
| 596 | 3300026116 | Ga0207674_10017840 | Ga0207674_100178402 | 88 |
| 597 | 3300026116 | Ga0207674_10224371 | Ga0207674_102243712 | 88 |
| 598 | 3300026116 | Ga0207674_10669002 | Ga0207674_106690022 | 88 |
| 599 | 3300026118 | Ga0207675_100142480 | Ga0207675_1001424802 | 88 |
| 600 | 3300026121 | Ga0207683_10017553 | Ga0207683_100175534 | 88 |
| 601 | 3300026121 | Ga0207683_10026950 | Ga0207683_100269503 | 88 |
| 602 | 3300026142 | Ga0207698_10031836 | Ga0207698_100318362 | 88 |
| 603 | 3300026142 | Ga0207698_10054316 | Ga0207698_100543162 | 88 |
| 604 | 3300026142 | Ga0207698_11262251 | Ga0207698_112622512 | 88 |
| 605 | 3300027695 | Ga0209966_1109360 | Ga0209966_11093601 | 88 |
| 606 | 3300027907 | Ga0207428_10000196 | Ga0207428_1000019673 | 88 |
| 607 | 3300027907 | Ga0207428_10023492 | Ga0207428_100234922 | 88 |
| 608 | 3300027907 | Ga0207428_10038882 | Ga0207428_100388822 | 88 |
| 609 | 3300027907 | Ga0207428_10123914 | Ga0207428_101239142 | 88 |
| 610 | 3300028379 | Ga0268266_10134451 | Ga0268266_101344511 | 88 |
| 611 | 3300028379 | Ga0268266_10693120 | Ga0268266_106931202 | 88 |
| 612 | 3300028380 | Ga0268265_10113510 | Ga0268265_101135102 | 88 |
| 613 | 3300028380 | Ga0268265_10380175 | Ga0268265_103801752 | 88 |
| 614 | 3300028381 | Ga0268264_10898715 | Ga0268264_108987152 | 88 |
| 615 | 3300028381 | Ga0268264_11594476 | Ga0268264_115944761 | 88 |
| 616 | 3300031995 | Ga0307409_100861911 | Ga0307409_1008619112 | 88 |
| 617 | 3300034957 | Ga0373938_0020233 | Ga0373938_0020233_612_878 | 88 |
| 618 | 3300035090 | Ga0373949_0120091 | Ga0373949_0120091_269_535 | 88 |
| 619 | 3300035090 | Ga0373949_0233749 | Ga0373949_0233749_103_375 | 88 |
| 620 | 3300035092 | Ga0373952_0210989 | Ga0373952_0210989_37_309 | 88 |
| 621 | 3300035112 | Ga0373932_0235368 | Ga0373932_0235368_27_293 | 88 |
| 622 | 3300035113 | Ga0373936_0069926 | Ga0373936_0069926_379_645 | 88 |
| 623 | 3300035114 | Ga0373939_0013189 | Ga0373939_0013189_1442_1714 | 88 |
| 624 | 3300035116 | Ga0373945_0009560 | Ga0373945_0009560_1094_1360 | 88 |
| 625 | 3300035116 | Ga0373945_0177961 | Ga0373945_0177961_74_340 | 88 |
| 626 | 3300035121 | Ga0373960_0021450 | Ga0373960_0021450_523_795 | 88 |
| 627 | 3300035170 | Ga0373943_0010858 | Ga0373943_0010858_3453_3719 | 88 |
| 628 | 3300035170 | Ga0373943_0092909 | Ga0373943_0092909_1282_1548 | 88 |
| 629 | 3300035171 | Ga0373946_0763483 | Ga0373946_0763483_130_396 | 88 |
| 630 | 3300035691 | Ga0373931_0375379 | Ga0373931_0375379_437_709 | 88 |
| 631 | 3300035692 | Ga0373935_0054335 | Ga0373935_0054335_567_833 | 88 |
| 632 | 3300035692 | Ga0373935_0075407 | Ga0373935_0075407_1667_1933 | 88 |
| 633 | 3300035725 | Ga0373947_0000533 | Ga0373947_0000533_5984_6250 | 88 |
| 634 | 3300035725 | Ga0373947_0007052 | Ga0373947_0007052_4757_5023 | 88 |
| 635 | 3300037068 | Ga0373925_0004302 | Ga0373925_0004302_5789_6055 | 88 |
| 636 | 3300037068 | Ga0373925_0005142 | Ga0373925_0005142_7862_8128 | 88 |
| 637 | 3300037312 | Ga0395899_0019101 | Ga0395899_0019101_2375_2647 | 88 |
| 638 | 3300037312 | Ga0395899_0103369 | Ga0395899_0103369_1558_1824 | 88 |
| 639 | 3300037312 | Ga0395899_0342688 | Ga0395899_0342688_176_442 | 88 |
| 640 | 3300037418 | Ga0395900_0002857 | Ga0395900_0002857_16283_16549 | 88 |
| 641 | 3300037418 | Ga0395900_0007033 | Ga0395900_0007033_7315_7587 | 88 |
| 642 | 3300037418 | Ga0395900_0024664 | Ga0395900_0024664_4077_4343 | 88 |
| 643 | 3300037418 | Ga0395900_0223612 | Ga0395900_0223612_129_395 | 88 |
| 644 | 3300037418 | Ga0395900_0496441 | Ga0395900_0496441_348_614 | 88 |
| 645 | 3300037418 | Ga0395900_0585983 | Ga0395900_0585983_481_747 | 88 |
| 646 | 3300037418 | Ga0395900_1794388 | Ga0395900_1794388_195_464 | 88 |
| 647 | 3300037466 | Ga0395898_0005912 | Ga0395898_0005912_2304_2570 | 88 |
| 648 | 3300037466 | Ga0395898_0049255 | Ga0395898_0049255_3713_3979 | 88 |
| 649 | 3300037466 | Ga0395898_0119559 | Ga0395898_0119559_1774_2040 | 88 |
| 650 | 3300037466 | Ga0395898_0210539 | Ga0395898_0210539_14_286 | 88 |
| 651 | 3300037466 | Ga0395898_0244486 | Ga0395898_0244486_991_1257 | 88 |
| 652 | 3300037466 | Ga0395898_1399223 | Ga0395898_1399223_306_572 | 88 |
| 653 | 3300037471 | Ga0395905_0000568 | Ga0395905_0000568_30559_30825 | 88 |
| 654 | 3300037471 | Ga0395905_0074777 | Ga0395905_0074777_764_1036 | 88 |
| 655 | 3300037471 | Ga0395905_0155309 | Ga0395905_0155309_997_1263 | 88 |
| 656 | 3300037471 | Ga0395905_0272235 | Ga0395905_0272235_833_1099 | 88 |
| 657 | 3300037471 | Ga0395905_0799707 | Ga0395905_0799707_156_422 | 88 |
| 658 | 3300037853 | Ga0436364_0135606 | Ga0436364_0135606_130_396 | 88 |
| 659 | 3300038443 | Ga0395901_0001508 | Ga0395901_0001508_3379_3645 | 88 |
| 660 | 3300038443 | Ga0395901_0001844 | Ga0395901_0001844_1446_1718 | 88 |
| 661 | 3300038443 | Ga0395901_0020113 | Ga0395901_0020113_3806_4072 | 88 |
| 662 | 3300038443 | Ga0395901_0022801 | Ga0395901_0022801_4705_4971 | 88 |
| 663 | 3300038443 | Ga0395901_0273538 | Ga0395901_0273538_176_442 | 88 |
| 664 | 3300038443 | Ga0395901_1552502 | Ga0395901_1552502_287_553 | 88 |
| 665 | 3300038443 | Ga0395901_1718000 | Ga0395901_1718000_266_532 | 88 |
| 666 | 3300039437 | Ga0436365_1360505 | Ga0436365_1360505_4094_4360 | 88 |
| 667 | 3300039450 | Ga0436363_1283513 | Ga0436363_1283513_851_1117 | 88 |
| 668 | 3300041459 | Ga0451800_1206920 | Ga0451800_1206920_422_697 | 88 |
| 669 | 3300041498 | Ga0451841_0962610 | Ga0451841_0962610_521_787 | 88 |
| 670 | 3300041512 | Ga0451853_3046892 | Ga0451853_3046892_518_787 | 88 |
| 671 | 3300042005 | Ga0439448_0036216 | Ga0439448_0036216_80_346 | 88 |
| 672 | 3300042005 | Ga0439448_0050431 | Ga0439448_0050431_124_390 | 88 |
| 673 | 3300042008 | Ga0439450_191670 | Ga0439450_191670_207_479 | 88 |
| 674 | 3300042008 | Ga0439450_214576 | Ga0439450_214576_48_314 | 88 |
| 675 | 3300042157 | Ga0439458_0024941 | Ga0439458_0024941_779_1051 | 88 |
| 676 | 3300042438 | Ga0439459_0008300 | Ga0439459_0008300_619_891 | 88 |
| 677 | 3300042461 | Ga0439460_0302318 | Ga0439460_0302318_15_287 | 88 |
| 678 | 3300044683 | Ga0466965_0213282 | Ga0466965_0213282_524_793 | 88 |
| 679 | 3300044683 | Ga0466965_0556251 | Ga0466965_0556251_71_337 | 88 |
| 680 | 3300044684 | Ga0466966_0012700 | Ga0466966_0012700_1408_1674 | 88 |
| 681 | 3300044693 | Ga0466961_0062856 | Ga0466961_0062856_56_322 | 88 |
| 682 | 3300044693 | Ga0466961_0222985 | Ga0466961_0222985_366_638 | 88 |
| 683 | 3300044694 | Ga0466963_0000743 | Ga0466963_0000743_7804_8070 | 88 |
| 684 | 3300044694 | Ga0466963_0011801 | Ga0466963_0011801_3817_4095 | 88 |
| 685 | 3300044694 | Ga0466963_0016083 | Ga0466963_0016083_1983_2255 | 88 |
| 686 | 3300044694 | Ga0466963_0702603 | Ga0466963_0702603_361_630 | 88 |
| 687 | 3300044706 | Ga0466964_0057077 | Ga0466964_0057077_665_931 | 88 |
| 688 | 3300044706 | Ga0466964_0288249 | Ga0466964_0288249_219_485 | 88 |
| 689 | 3300044719 | Ga0466971_0253830 | Ga0466971_0253830_438_707 | 88 |
| 690 | 3300044735 | Ga0466968_0102500 | Ga0466968_0102500_978_1250 | 88 |
| 691 | 3300044842 | Ga0466957_0037750 | Ga0466957_0037750_637_903 | 88 |
| 692 | 3300044842 | Ga0466957_1166679 | Ga0466957_1166679_223_492 | 88 |
| 693 | 3300044842 | Ga0466957_1365385 | Ga0466957_1365385_194_460 | 88 |
| 694 | 3300044901 | Ga0466960_0059143 | Ga0466960_0059143_894_1160 | 88 |
| 695 | 3300044901 | Ga0466960_0199030 | Ga0466960_0199030_60_326 | 88 |
| 696 | 3300044901 | Ga0466960_0404126 | Ga0466960_0404126_286_552 | 88 |
| 697 | 3300045049 | Ga0466959_0116832 | Ga0466959_0116832_227_493 | 88 |
| 698 | 3300045049 | Ga0466959_0117305 | Ga0466959_0117305_532_801 | 88 |
| 699 | 3300045049 | Ga0466959_0414820 | Ga0466959_0414820_50_322 | 88 |
| 700 | 3300045049 | Ga0466959_0470427 | Ga0466959_0470427_32_304 | 88 |
| 701 | 3300045051 | Ga0451576_0076759 | Ga0451576_0076759_2668_2934 | 88 |
| 702 | 3300045051 | Ga0451576_0799670 | Ga0451576_0799670_281_553 | 88 |
| 703 | 3300045051 | Ga0451576_1672917 | Ga0451576_1672917_361_627 | 88 |
| 704 | 3300045836 | Ga0466958_0215460 | Ga0466958_0215460_259_528 | 88 |
| 705 | 3300045836 | Ga0466958_0735974 | Ga0466958_0735974_56_322 | 88 |
| 706 | 3300045976 | Ga0466967_0025753 | Ga0466967_0025753_1736_2002 | 88 |
| 707 | 3300045976 | Ga0466967_0086552 | Ga0466967_0086552_1084_1356 | 88 |
| 708 | 3300045976 | Ga0466967_0150849 | Ga0466967_0150849_729_1001 | 88 |
| 709 | 3300045976 | Ga0466967_0252259 | Ga0466967_0252259_463_732 | 88 |
| 710 | 3300045976 | Ga0466967_0466491 | Ga0466967_0466491_793_1071 | 88 |
| 711 | 3300045976 | Ga0466967_0563334 | Ga0466967_0563334_557_829 | 88 |
| 712 | 3300045976 | Ga0466967_1419134 | Ga0466967_1419134_365_637 | 88 |
| 713 | 3300045976 | Ga0466967_1680503 | Ga0466967_1680503_249_521 | 88 |
| 714 | 3300046452 | Ga0495617_196152 | Ga0495617_196152_220_486 | 88 |
| 715 | 3300046453 | Ga0495627_209246 | Ga0495627_209246_213_482 | 88 |
| 716 | 3300046454 | Ga0495592_0358570 | Ga0495592_0358570_206_478 | 88 |
| 717 | 3300046455 | Ga0495603_0001442 | Ga0495603_0001442_2547_2813 | 88 |
| 718 | 3300046457 | Ga0495590_0161515 | Ga0495590_0161515_364_633 | 88 |
| 719 | 3300046458 | Ga0495591_093021 | Ga0495591_093021_439_705 | 88 |
| 720 | 3300046459 | Ga0495629_0281263 | Ga0495629_0281263_613_879 | 88 |
| 721 | 3300046460 | Ga0495638_0220396 | Ga0495638_0220396_279_545 | 88 |
| 722 | 3300046461 | Ga0495641_0001137 | Ga0495641_0001137_5524_5790 | 88 |
| 723 | 3300046462 | Ga0495651_0540941 | Ga0495651_0540941_225_497 | 88 |
| 724 | 3300046463 | Ga0495653_0319535 | Ga0495653_0319535_216_488 | 88 |
| 725 | 3300046472 | Ga0495580_0024689 | Ga0495580_0024689_3780_4046 | 88 |
| 726 | 3300046473 | Ga0495582_0508520 | Ga0495582_0508520_414_680 | 88 |
| 727 | 3300046474 | Ga0495605_0152583 | Ga0495605_0152583_357_626 | 88 |
| 728 | 3300046474 | Ga0495605_0229594 | Ga0495605_0229594_402_668 | 88 |
| 729 | 3300046475 | Ga0495639_0092991 | Ga0495639_0092991_982_1248 | 88 |
| 730 | 3300046477 | Ga0495664_0871479 | Ga0495664_0871479_101_373 | 88 |
| 731 | 3300046491 | Ga0495584_0031556 | Ga0495584_0031556_947_1216 | 88 |
| 732 | 3300046491 | Ga0495584_0102989 | Ga0495584_0102989_1116_1382 | 88 |
| 733 | 3300046491 | Ga0495584_0147462 | Ga0495584_0147462_583_849 | 88 |
| 734 | 3300046492 | Ga0495585_0073866 | Ga0495585_0073866_1567_1836 | 88 |
| 735 | 3300046500 | Ga0495596_0148636 | Ga0495596_0148636_46_312 | 88 |
| 736 | 3300046501 | Ga0495607_0099665 | Ga0495607_0099665_1264_1530 | 88 |
| 737 | 3300046501 | Ga0495607_0116113 | Ga0495607_0116113_770_1039 | 88 |
| 738 | 3300046511 | Ga0495608_0118464 | Ga0495608_0118464_708_980 | 88 |
| 739 | 3300046513 | Ga0495616_0062508 | Ga0495616_0062508_548_814 | 88 |
| 740 | 3300046514 | Ga0495618_0576325 | Ga0495618_0576325_171_443 | 88 |
| 741 | 3300046516 | Ga0495628_0089479 | Ga0495628_0089479_377_649 | 88 |
| 742 | 3300046517 | Ga0495630_0241726 | Ga0495630_0241726_698_964 | 88 |
| 743 | 3300046517 | Ga0495630_0329553 | Ga0495630_0329553_411_677 | 88 |
| 744 | 3300046520 | Ga0495637_0072954 | Ga0495637_0072954_208_474 | 88 |
| 745 | 3300046522 | Ga0495643_0115895 | Ga0495643_0115895_496_762 | 88 |
| 746 | 3300046523 | Ga0495644_0040461 | Ga0495644_0040461_417_683 | 88 |
| 747 | 3300046523 | Ga0495644_0361866 | Ga0495644_0361866_23_292 | 88 |
| 748 | 3300046525 | Ga0495663_0039737 | Ga0495663_0039737_419_688 | 88 |
| 749 | 3300046526 | Ga0495666_0030512 | Ga0495666_0030512_1159_1425 | 88 |
| 750 | 3300046529 | Ga0495652_0060460 | Ga0495652_0060460_1030_1302 | 88 |
| 751 | 3300046530 | Ga0495654_0054023 | Ga0495654_0054023_1100_1369 | 88 |
| 752 | 3300046533 | Ga0495640_0365558 | Ga0495640_0365558_352_624 | 88 |
| 753 | 3300046535 | Ga0495586_0011957 | Ga0495586_0011957_2964_3230 | 88 |
| 754 | 3300046537 | Ga0495598_0002624 | Ga0495598_0002624_1240_1509 | 88 |
| 755 | 3300046538 | Ga0495609_0029943 | Ga0495609_0029943_222_488 | 88 |
| 756 | 3300046538 | Ga0495609_0070700 | Ga0495609_0070700_169_438 | 88 |
| 757 | 3300046539 | Ga0495621_0091796 | Ga0495621_0091796_858_1124 | 88 |
| 758 | 3300046557 | Ga0495622_0178440 | Ga0495622_0178440_538_804 | 88 |
| 759 | 3300046558 | Ga0495633_0367589 | Ga0495633_0367589_92_361 | 88 |
| 760 | 3300046558 | Ga0495633_0490530 | Ga0495633_0490530_38_304 | 88 |
| 761 | 3300046559 | Ga0495667_0607962 | Ga0495667_0607962_364_636 | 88 |
| 762 | 3300046615 | Ga0495656_0020197 | Ga0495656_0020197_957_1226 | 88 |
| 763 | 3300046615 | Ga0495656_0468026 | Ga0495656_0468026_230_496 | 88 |
| 764 | 3300046616 | Ga0495668_0115958 | Ga0495668_0115958_286_555 | 88 |
| 765 | 3300046616 | Ga0495668_0842471 | Ga0495668_0842471_15_281 | 88 |
| 766 | 3300046642 | Ga0495634_0270683 | Ga0495634_0270683_325_591 | 88 |
| 767 | 3300046648 | Ga0495611_0165473 | Ga0495611_0165473_590_859 | 88 |
| 768 | 3300046664 | Ga0495659_0034272 | Ga0495659_0034272_280_549 | 88 |
| 769 | 3300046664 | Ga0495659_0054242 | Ga0495659_0054242_547_813 | 88 |
| 770 | 3300046675 | Ga0495657_0391294 | Ga0495657_0391294_231_503 | 88 |
| 771 | 3300046678 | Ga0495599_0418419 | Ga0495599_0418419_53_325 | 88 |
| 772 | 3300046683 | Ga0495658_0090430 | Ga0495658_0090430_495_761 | 88 |
| 773 | 3300046683 | Ga0495658_0236207 | Ga0495658_0236207_508_774 | 88 |
| 774 | 3300046689 | Ga0495613_0029948 | Ga0495613_0029948_794_1060 | 88 |
| 775 | 3300046691 | Ga0495670_0076392 | Ga0495670_0076392_14_280 | 88 |
| 776 | 3300046691 | Ga0495670_0182764 | Ga0495670_0182764_93_362 | 88 |
| 777 | 3300046692 | Ga0495671_0023230 | Ga0495671_0023230_2058_2324 | 88 |
| 778 | 3300046692 | Ga0495671_0240615 | Ga0495671_0240615_574_843 | 88 |
| 779 | 3300046794 | Ga0495589_0091290 | Ga0495589_0091290_1051_1320 | 88 |
| 780 | 3300046810 | Ga0495660_0052786 | Ga0495660_0052786_298_564 | 88 |
| 781 | 3300047315 | Ga0495581_0449843 | Ga0495581_0449843_448_714 | 88 |
| 782 | 3300047318 | Ga0495636_0350394 | Ga0495636_0350394_223_489 | 88 |
| 783 | 3300047319 | Ga0495674_0037327 | Ga0495674_0037327_1771_2043 | 88 |
| 784 | 3300047319 | Ga0495674_0057423 | Ga0495674_0057423_2772_3038 | 88 |
| 785 | 3300047321 | Ga0495676_0004439 | Ga0495676_0004439_3547_3813 | 88 |
| 786 | 3300047321 | Ga0495676_0152464 | Ga0495676_0152464_860_1126 | 88 |
| 787 | 3300047323 | Ga0495683_0134032 | Ga0495683_0134032_76_342 | 88 |
| 788 | 3300047445 | Ga0495677_0102244 | Ga0495677_0102244_801_1070 | 88 |
| 789 | 3300047446 | Ga0495679_077589 | Ga0495679_077589_565_831 | 88 |
| 790 | 3300047447 | Ga0495685_060001 | Ga0495685_060001_292_561 | 88 |
| 791 | 3300047471 | Ga0495684_0239030 | Ga0495684_0239030_691_963 | 88 |
| 792 | 3300048089 | Ga0495614_0185542 | Ga0495614_0185542_143_409 | 88 |
| 793 | 3300048090 | Ga0495615_0040955 | Ga0495615_0040955_755_1024 | 88 |
| 794 | 3300048090 | Ga0495615_0158045 | Ga0495615_0158045_320_586 | 88 |
| 795 | 3300048091 | Ga0495626_0406239 | Ga0495626_0406239_79_345 | 88 |
| 796 | 3300048903 | Ga0496100_0546977 | Ga0496100_0546977_444_710 | 88 |
| 797 | 3300048905 | Ga0496102_0069469 | Ga0496102_0069469_1897_2163 | 88 |
| 798 | 3300048907 | Ga0496104_0145904 | Ga0496104_0145904_685_951 | 88 |
| 799 | 3300048908 | Ga0496105_0040024 | Ga0496105_0040024_2202_2468 | 88 |
| 800 | 3300048911 | Ga0496108_0030725 | Ga0496108_0030725_1376_1642 | 88 |
| 801 | 3300048911 | Ga0496108_0080685 | Ga0496108_0080685_2203_2475 | 88 |
| 802 | 3300048912 | Ga0496109_0017493 | Ga0496109_0017493_1693_1965 | 88 |
| 803 | 3300048912 | Ga0496109_0045948 | Ga0496109_0045948_3462_3728 | 88 |
| 804 | 3300048912 | Ga0496109_0658730 | Ga0496109_0658730_386_652 | 88 |
| 805 | 3300048912 | Ga0496109_0697472 | Ga0496109_0697472_377_643 | 88 |
| 806 | 3300048912 | Ga0496109_0759751 | Ga0496109_0759751_275_541 | 88 |
| 807 | 3300048913 | Ga0496110_0027599 | Ga0496110_0027599_1997_2263 | 88 |
| 808 | 3300048913 | Ga0496110_0621323 | Ga0496110_0621323_379_645 | 88 |
| 809 | 3300048914 | Ga0496111_0974635 | Ga0496111_0974635_242_514 | 88 |
| 810 | 3300048915 | Ga0496112_0154778 | Ga0496112_0154778_1955_2221 | 88 |
| 811 | 3300048916 | Ga0496113_0049910 | Ga0496113_0049910_1084_1350 | 88 |
| 812 | 3300048916 | Ga0496113_0285579 | Ga0496113_0285579_518_790 | 88 |
| 813 | 3300049569 | Ga0501032_0086020 | Ga0501032_0086020_479_745 | 88 |
| 814 | 3300049570 | Ga0501033_0152133 | Ga0501033_0152133_396_662 | 88 |
| 815 | 3300049572 | Ga0501036_0054381 | Ga0501036_0054381_1745_2011 | 88 |
| 816 | 3300049573 | Ga0501037_0191611 | Ga0501037_0191611_1081_1347 | 88 |
| 817 | 3300049574 | Ga0501038_0135942 | Ga0501038_0135942_119_385 | 88 |
| 818 | 3300049575 | Ga0501039_0040396 | Ga0501039_0040396_2037_2303 | 88 |
| 819 | 3300049576 | Ga0501040_0122600 | Ga0501040_0122600_1492_1758 | 88 |
| 820 | 3300049579 | Ga0501043_0216468 | Ga0501043_0216468_1130_1396 | 88 |
| 821 | 3300049580 | Ga0501046_0015766 | Ga0501046_0015766_1329_1595 | 88 |
| 822 | 3300049582 | Ga0501048_0110789 | Ga0501048_0110789_62_328 | 88 |
| 823 | 3300049583 | Ga0501067_0007929 | Ga0501067_0007929_1386_1652 | 88 |
| 824 | 3300049583 | Ga0501067_0163793 | Ga0501067_0163793_582_848 | 88 |
| 825 | 3300049583 | Ga0501067_0759140 | Ga0501067_0759140_126_392 | 88 |
| 826 | 3300049584 | Ga0501068_0028112 | Ga0501068_0028112_1470_1736 | 88 |
| 827 | 3300049584 | Ga0501068_0317711 | Ga0501068_0317711_433_699 | 88 |
| 828 | 3300049584 | Ga0501068_0461380 | Ga0501068_0461380_488_760 | 88 |
| 829 | 3300049585 | Ga0501069_0089266 | Ga0501069_0089266_1259_1525 | 88 |
| 830 | 3300049586 | Ga0501070_0174680 | Ga0501070_0174680_974_1240 | 88 |
| 831 | 3300049587 | Ga0501071_0047094 | Ga0501071_0047094_1252_1518 | 88 |
| 832 | 3300049588 | Ga0501072_0004929 | Ga0501072_0004929_5158_5424 | 88 |
| 833 | 3300049590 | Ga0501074_0025245 | Ga0501074_0025245_2115_2381 | 88 |
| 834 | 3300049591 | Ga0501075_0059032 | Ga0501075_0059032_1580_1846 | 88 |
| 835 | 3300049592 | Ga0501076_0004215 | Ga0501076_0004215_2868_3134 | 88 |
| 836 | 3300049593 | Ga0501077_0005911 | Ga0501077_0005911_2370_2636 | 88 |
| 837 | 3300049741 | Ga0501079_0005016 | Ga0501079_0005016_7414_7680 | 88 |
| 838 | 3300049742 | Ga0501080_0002032 | Ga0501080_0002032_7237_7503 | 88 |
| 839 | 3300049743 | Ga0501081_0012524 | Ga0501081_0012524_3546_3812 | 88 |
| 840 | 3300049744 | Ga0501083_0111851 | Ga0501083_0111851_87_353 | 88 |
| 841 | 3300049824 | Ga0501045_0044759 | Ga0501045_0044759_1372_1638 | 88 |
| 842 | 3300050490 | nmdc:mga03n38_236587_c1 | nmdc:mga03n38_236587_c1_210_476 | 88 |
| 843 | 3300050491 | nmdc:mga00v17_24047_c1 | nmdc:mga00v17_24047_c1_3187_3453 | 88 |
| 844 | 3300050492 | nmdc:mga0yw44_195849_c1 | nmdc:mga0yw44_195849_c1_82_348 | 88 |
| 845 | 3300050492 | nmdc:mga0yw44_243554_c1 | nmdc:mga0yw44_243554_c1_737_1003 | 88 |
| 846 | 3300050492 | nmdc:mga0yw44_369402_c1 | nmdc:mga0yw44_369402_c1_618_884 | 88 |
| 847 | 3300050494 | nmdc:mga06z11_7552_c1 | nmdc:mga06z11_7552_c1_1330_1596 | 88 |
| 848 | 3300050507 | nmdc:mga05p37_159332_c1 | nmdc:mga05p37_159332_c1_2291_2563 | 88 |
| 849 | 3300050507 | nmdc:mga05p37_4691_c2 | nmdc:mga05p37_4691_c2_7117_7383 | 88 |
| 850 | 3300050508 | nmdc:mga09592_4692_c1 | nmdc:mga09592_4692_c1_1020_1286 | 88 |
| 851 | 3300050510 | nmdc:mga06r32_282208_c1 | nmdc:mga06r32_282208_c1_309_581 | 88 |
| 852 | 3300050511 | nmdc:mga08y16_100664_c1 | nmdc:mga08y16_100664_c1_1817_2089 | 88 |
| 853 | 3300050511 | nmdc:mga08y16_2176447_c1 | nmdc:mga08y16_2176447_c1_150_416 | 88 |
| 854 | 3300050511 | nmdc:mga08y16_334025_c1 | nmdc:mga08y16_334025_c1_907_1179 | 88 |
| 855 | 3300050511 | nmdc:mga08y16_56074_c1 | nmdc:mga08y16_56074_c1_1088_1354 | 88 |
| 856 | 3300050511 | nmdc:mga08y16_8793_c1 | nmdc:mga08y16_8793_c1_9489_9755 | 88 |
| 857 | 3300050512 | nmdc:mga0n895_1130384_c1 | nmdc:mga0n895_1130384_c1_327_599 | 88 |
| 858 | 3300050512 | nmdc:mga0n895_1581838_c1 | nmdc:mga0n895_1581838_c1_253_519 | 88 |
| 859 | 3300050512 | nmdc:mga0n895_46478_c1 | nmdc:mga0n895_46478_c1_942_1208 | 88 |
| 860 | 3300050512 | nmdc:mga0n895_72506_c1 | nmdc:mga0n895_72506_c1_1552_1818 | 88 |
| 861 | 3300050513 | nmdc:mga0rr50_13665_c1 | nmdc:mga0rr50_13665_c1_791_1057 | 88 |
| 862 | 3300050513 | nmdc:mga0rr50_1633915_c1 | nmdc:mga0rr50_1633915_c1_261_533 | 88 |
| 863 | 3300050513 | nmdc:mga0rr50_54017_c1 | nmdc:mga0rr50_54017_c1_1264_1530 | 88 |
| 864 | 3300050513 | nmdc:mga0rr50_640727_c1 | nmdc:mga0rr50_640727_c1_345_617 | 88 |
| 865 | 3300050514 | nmdc:mga08x19_28639_c1 | nmdc:mga08x19_28639_c1_2246_2518 | 88 |
| 866 | 3300050515 | nmdc:mga0a205_29555_c1 | nmdc:mga0a205_29555_c1_3620_3886 | 88 |
| 867 | 3300050515 | nmdc:mga0a205_491719_c1 | nmdc:mga0a205_491719_c1_749_1015 | 88 |
| 868 | 3300050515 | nmdc:mga0a205_65347_c1 | nmdc:mga0a205_65347_c1_1016_1288 | 88 |
| 869 | 3300053078 | Ga0495612_0474198 | Ga0495612_0474198_94_366 | 88 |
| 870 | 3300054114 | Ga0501084_0001654 | Ga0501084_0001654_7488_7754 | 88 |
| 871 | 3300060353 | Ga0501082_0462488 | Ga0501082_0462488_557_823 | 88 |
| 872 | 3300061719 | Ga0466962_0052428 | Ga0466962_0052428_1189_1455 | 88 |
| 873 | 3300061719 | Ga0466962_0476138 | Ga0466962_0476138_258_527 | 88 |
| 874 | 3300061734 | Ga0530510_0004090 | Ga0530510_0004090_7016_7282 | 88 |
| 875 | 3300061734 | Ga0530510_0166606 | Ga0530510_0166606_902_1168 | 88 |
| 876 | 3300061734 | Ga0530510_0482666 | Ga0530510_0482666_360_626 | 88 |
| 877 | 3300061734 | Ga0530510_0665806 | Ga0530510_0665806_70_342 | 88 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7mfk-assembly1.cif.gz_A | structure of the clostridium perfringens gh89 in complex with alpha-hnjnac | 0.9868 | 24 | 59 |
| 4b6x-assembly2.cif.gz_B | crystal structure of in planta processed avrrps4 | 0.9385 | 17 | 65 |
| 7o3e-assembly1.cif.gz_c | murine supercomplex ciii2civ in the intermediate locked conformation | 0.9368 | 19 | 58 |
| 4v47-assembly1.cif.gz_BT | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the ef-g.gtp state of e. coli 70s ribosome | 0.9346 | 8 | 86 |
| 4v4w-assembly1.cif.gz_AT | structure of a secm-stalled e. coli ribosome complex obtained by fitting atomic models for rna and protein components into cryo-em map emd-1143 | 0.9338 | 8 | 86 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9BPX3_363_558_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.9751 | 12 | 64 | 1.25.10.10 |
| af_Q54DW5_515_797_1.20.120.670 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);N-acetyl-b-d-glucoasminidase | 0.9613 | 24 | 59 | 1.20.120.670 |
| af_Q9UI47_502_632_1.20.120.230 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.9596 | 21 | 60 | 1.20.120.230 |
| af_A5A8R3_1_166_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.9533 | 16 | 64 | 1.20.1270.60 |
| af_A0A0R0H600_74_264_1.20.120.80 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.9439 | 17 | 65 | 1.20.120.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1J7I0-F1-model_v4 | 30S ribosomal protein S20 | 0.9671 | 12 | 86 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-X1Q509-F1-model_v4 | 30S ribosomal protein S20 | 0.967 | 16 | 86 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-X1FE40-F1-model_v4 | 30S ribosomal protein S20 | 0.9655 | 10 | 86 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A419FMU6-F1-model_v4 | Small ribosomal subunit protein bS20 (30S ribosomal protein S20) | 0.9561 | 19 | 86 |
GO:0003735
GO:0005829 GO:0006412 GO:0015935 GO:0070181 |
| AF-A0A6L6B8C7-F1-model_v4 | Small ribosomal subunit protein bS20 (30S ribosomal protein S20) | 0.9539 | 19 | 87 |
GO:0003735
GO:0005829 GO:0006412 GO:0015935 GO:0070181 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar