F484397

General Info

Members Datasets Scaffolds Average Seq Length
877 357 877 88

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0143288|Ga0395901_0143288_1780_2103
Length 107
Sequence MSVRRLLLPSPGPRCGRFYVMPNIKQQKKRVRIAAEERLENLRYSSAVKTFTRRLRAAVADGDRDRISAEHRELVRQIDKAVAKGSLHRNAAARKKAQAAKLVSGSS

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
189 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
190 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
191 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
192 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
193 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
195 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
196 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
212 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
213 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
214 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
215 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
216 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
217 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
218 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
219 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
224 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
225 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
233 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
234 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
235 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
236 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
237 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
238 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
239 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
240 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
241 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
242 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
249 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
250 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
251 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
252 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
253 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
254 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
258 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
259 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
260 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
261 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
262 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
263 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
264 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
265 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
266 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
267 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
268 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
269 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
270 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
271 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
272 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
273 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
274 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
275 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
276 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
277 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
278 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
279 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
280 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
281 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
282 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
283 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
284 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
285 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
286 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
287 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
288 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
289 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
290 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
291 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
292 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
293 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
294 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
295 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
296 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
297 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
298 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
299 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
300 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
301 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
302 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
303 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
304 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
305 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
306 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
307 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
308 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
309 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
323 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
324 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
325 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
326 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
327 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
328 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
329 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
330 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
331 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
332 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
333 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
336 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
337 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
340 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
341 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
342 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
343 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
346 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
347 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
348 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
349 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
350 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
351 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
352 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
353 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
354 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
355 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
356 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
357 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.86
Metatranscriptomes 1.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0
Rhizoplane 3.76
Rhizosphere 94.64
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214844107 2209111006 Unclassified 626
2 ARCol0yngRDRAFT_1001207 3300000652 Unclassified 2186
3 JGI24747J21853_1052053 3300001978 Bacteria 501
4 JGI24737J22298_10086399 3300001990 Unclassified 932
5 JGI24750J21931_1056447 3300002070 Unclassified 621
6 JGI24751J29686_10086328 3300002459 Bacteria 651
7 Ga0070658_10973777 3300005327 Bacteria 738
8 Ga0070658_11031398 3300005327 Unclassified 715
9 Ga0070676_10262441 3300005328 Unclassified 1157
10 Ga0070683_100029646 3300005329 Bacteria 4958
11 Ga0070683_100113027 3300005329 Bacteria 2563
12 Ga0070683_100155888 3300005329 Bacteria 2165
13 Ga0070683_100731772 3300005329 Bacteria 948
14 Ga0070670_100004293 3300005331 Bacteria 11932
15 Ga0070670_101284636 3300005331 Bacteria 670
16 Ga0068869_100765152 3300005334 Unclassified 828
17 Ga0070680_100017076 3300005336 Bacteria 5716
18 Ga0070680_100047883 3300005336 Bacteria 3482
19 Ga0070680_100184404 3300005336 Bacteria 1758
20 Ga0070682_100027482 3300005337 Bacteria 3414
21 Ga0070682_100039472 3300005337 Bacteria 2901
22 Ga0070682_100069359 3300005337 Unclassified 2251
23 Ga0070682_100207939 3300005337 Unclassified 1385
24 Ga0070682_100422299 3300005337 Bacteria 1014
25 Ga0070682_100538241 3300005337 Bacteria 912
26 Ga0068868_100052357 3300005338 Bacteria 3214
27 Ga0068868_100076443 3300005338 Bacteria 2677
28 Ga0068868_100274197 3300005338 Unclassified 1426
29 Ga0070660_100004020 3300005339 Bacteria 10151
30 Ga0070660_100051687 3300005339 Bacteria 3166
31 Ga0070660_100054676 3300005339 Bacteria 3083
32 Ga0070660_100069690 3300005339 Unclassified 2743
33 Ga0070660_100741137 3300005339 Bacteria 825
34 Ga0070689_100003774 3300005340 Bacteria 10146
35 Ga0070691_10007080 3300005341 Bacteria 5142
36 Ga0070691_10034986 3300005341 Bacteria 2365
37 Ga0070691_10067369 3300005341 Bacteria 1732
38 Ga0070691_10100715 3300005341 Bacteria 1435
39 Ga0070691_10201465 3300005341 Bacteria 1046
40 Ga0070691_10277784 3300005341 Unclassified 907
41 Ga0070687_100175273 3300005343 Unclassified 1280
42 Ga0070661_100032624 3300005344 Bacteria 3769
43 Ga0070661_100040181 3300005344 Bacteria 3411
44 Ga0070661_100051438 3300005344 Bacteria 3015
45 Ga0070661_100061220 3300005344 Bacteria 2762
46 Ga0070661_100211329 3300005344 Unclassified 1485
47 Ga0070661_100327878 3300005344 Bacteria 1197
48 Ga0070692_10263196 3300005345 Bacteria 1038
49 Ga0070692_10313588 3300005345 Unclassified 962
50 Ga0070692_10877169 3300005345 Bacteria 619
51 Ga0070668_100012799 3300005347 Bacteria 6246
52 Ga0070668_100106381 3300005347 Unclassified 2229
53 Ga0070669_100220227 3300005353 Bacteria 1500
54 Ga0070669_101617951 3300005353 Unclassified 564
55 Ga0070675_100022753 3300005354 Bacteria 5008
56 Ga0070675_100088535 3300005354 Unclassified 2591
57 Ga0070671_100050170 3300005355 Bacteria 3471
58 Ga0070674_100048016 3300005356 Bacteria 2928
59 Ga0070673_100125318 3300005364 Bacteria 2148
60 Ga0070673_100643777 3300005364 Unclassified 970
61 Ga0070688_100013097 3300005365 Bacteria 4668
62 Ga0070659_100004191 3300005366 Bacteria 10288
63 Ga0070659_100139846 3300005366 Unclassified 1971
64 Ga0070659_100191809 3300005366 Bacteria 1680
65 Ga0070659_100248844 3300005366 Bacteria 1473
66 Ga0070659_100455386 3300005366 Unclassified 1086
67 Ga0070659_100781266 3300005366 Bacteria 830
68 Ga0070709_10065998 3300005434 Unclassified 2319
69 Ga0070709_10602433 3300005434 Bacteria 846
70 Ga0070701_10036135 3300005438 Bacteria 2487
71 Ga0070705_100124794 3300005440 Bacteria 1669
72 Ga0070705_101454682 3300005440 Bacteria 573
73 Ga0070700_100022475 3300005441 Bacteria 3678
74 Ga0070700_100183854 3300005441 Bacteria 1457
75 Ga0070694_100204639 3300005444 Unclassified 1473
76 Ga0070694_100378890 3300005444 Bacteria 1103
77 Ga0070694_100510143 3300005444 Bacteria 958
78 Ga0070708_100026347 3300005445 Bacteria 4975
79 Ga0070708_100543202 3300005445 Bacteria 1096
80 Ga0070663_100018125 3300005455 Bacteria 4610
81 Ga0070663_100377550 3300005455 Unclassified 1154
82 Ga0070663_100745347 3300005455 Unclassified 836
83 Ga0070663_100851697 3300005455 Bacteria 785
84 Ga0070663_101461948 3300005455 Unclassified 607
85 Ga0070678_100093151 3300005456 Bacteria 2316
86 Ga0070678_100113926 3300005456 Bacteria 2121
87 Ga0070678_101752876 3300005456 Unclassified 585
88 Ga0070662_100026481 3300005457 Bacteria 4017
89 Ga0070681_10004205 3300005458 Bacteria 13637
90 Ga0070681_10026421 3300005458 Bacteria 5833
91 Ga0070681_10029317 3300005458 Bacteria 5526
92 Ga0070681_10039157 3300005458 Unclassified 4752
93 Ga0070681_10120245 3300005458 Bacteria 2562
94 Ga0070681_10133318 3300005458 Bacteria 2415
95 Ga0070681_10712138 3300005458 Bacteria 920
96 Ga0068867_100223726 3300005459 Bacteria 1518
97 Ga0068867_100344255 3300005459 Unclassified 1242
98 Ga0068867_100356219 3300005459 Bacteria 1222
99 Ga0068867_101451400 3300005459 Bacteria 638
100 Ga0068867_101923455 3300005459 Bacteria 558
101 Ga0070685_10002617 3300005466 Bacteria 9220
102 Ga0070685_10214238 3300005466 Bacteria 1259
103 Ga0070706_100100250 3300005467 Bacteria 2691
104 Ga0070698_100012820 3300005471 Bacteria 8876
105 Ga0070699_100725371 3300005518 Bacteria 908
106 Ga0070679_100016489 3300005530 Bacteria 7129
107 Ga0070679_100051786 3300005530 Unclassified 4089
108 Ga0070679_100053802 3300005530 Bacteria 4007
109 Ga0070679_100171922 3300005530 Unclassified 2139
110 Ga0070679_100370840 3300005530 Bacteria 1378
111 Ga0070679_100398849 3300005530 Bacteria 1321
112 Ga0070684_100026963 3300005535 Bacteria 4844
113 Ga0070684_100059030 3300005535 Bacteria 3353
114 Ga0070684_100083164 3300005535 Unclassified 2836
115 Ga0070684_101123807 3300005535 Bacteria 738
116 Ga0070697_100588795 3300005536 Unclassified 977
117 Ga0068853_100061202 3300005539 Bacteria 3255
118 Ga0068853_100204397 3300005539 Unclassified 1798
119 Ga0068853_100534876 3300005539 Unclassified 1109
120 Ga0068853_100554622 3300005539 Bacteria 1089
121 Ga0070672_100340813 3300005543 Bacteria 1276
122 Ga0070686_100012297 3300005544 Bacteria 4870
123 Ga0070686_100061669 3300005544 Bacteria 2424
124 Ga0070686_101124669 3300005544 Bacteria 650
125 Ga0070695_100325320 3300005545 Unclassified 1144
126 Ga0070695_101449799 3300005545 Unclassified 570
127 Ga0070696_100046066 3300005546 Bacteria 3023
128 Ga0070696_100090361 3300005546 Unclassified 2179
129 Ga0070696_100486377 3300005546 Bacteria 979
130 Ga0070696_100619929 3300005546 Bacteria 874
131 Ga0070693_100002576 3300005547 Bacteria 8347
132 Ga0070693_100028915 3300005547 Unclassified 3018
133 Ga0070693_100523434 3300005547 Bacteria 845
134 Ga0070665_100003372 3300005548 Bacteria 17091
135 Ga0070665_100004675 3300005548 Bacteria 14290
136 Ga0070704_100161901 3300005549 Unclassified 1770
137 Ga0070704_100268357 3300005549 Unclassified 1409
138 Ga0070704_100462325 3300005549 Bacteria 1095
139 Ga0070704_102123821 3300005549 Bacteria 522
140 Ga0068855_100026901 3300005563 Bacteria 6883
141 Ga0068855_100056594 3300005563 Bacteria 4600
142 Ga0068855_100085283 3300005563 Bacteria 3655
143 Ga0068855_100087106 3300005563 Bacteria 3610
144 Ga0068855_100099792 3300005563 Bacteria 3343
145 Ga0068855_100145330 3300005563 Bacteria 2700
146 Ga0068855_100383957 3300005563 Bacteria 1542
147 Ga0070664_100056774 3300005564 Bacteria 3326
148 Ga0070664_100569298 3300005564 Unclassified 1049
149 Ga0070664_100632732 3300005564 Bacteria 994
150 Ga0068857_100052743 3300005577 Bacteria 3607
151 Ga0068857_100081880 3300005577 Bacteria 2882
152 Ga0068857_100274491 3300005577 Unclassified 1550
153 Ga0068857_101073422 3300005577 Bacteria 777
154 Ga0068854_100057292 3300005578 Bacteria 2810
155 Ga0068854_100069149 3300005578 Unclassified 2577
156 Ga0068854_100182523 3300005578 Unclassified 1640
157 Ga0068854_100616682 3300005578 Bacteria 928
158 Ga0068854_101361307 3300005578 Unclassified 640
159 Ga0068856_100030809 3300005614 Bacteria 5245
160 Ga0068856_100208424 3300005614 Bacteria 1969
161 Ga0068856_100491018 3300005614 Unclassified 1249
162 Ga0068856_101498064 3300005614 Bacteria 688
163 Ga0068856_101982363 3300005614 Unclassified 593
164 Ga0070702_100030952 3300005615 Unclassified 2923
165 Ga0070702_100185144 3300005615 Unclassified 1366
166 Ga0070702_101256906 3300005615 Unclassified 599
167 Ga0068852_100052926 3300005616 Bacteria 3492
168 Ga0068852_100404257 3300005616 Unclassified 1344
169 Ga0068852_100958545 3300005616 Unclassified 874
170 Ga0068852_101491142 3300005616 Bacteria 699
171 Ga0068859_100742505 3300005617 Bacteria 1071
172 Ga0068866_10067979 3300005718 Bacteria 1872
173 Ga0068866_10616268 3300005718 Bacteria 735
174 Ga0068861_100004039 3300005719 Bacteria 9829
175 Ga0068861_100453555 3300005719 Bacteria 1149
176 Ga0068851_10228045 3300005834 Bacteria 1049
177 Ga0068870_10041791 3300005840 Unclassified 2384
178 Ga0068870_10434679 3300005840 Bacteria 862
179 Ga0068870_10470001 3300005840 Bacteria 832
180 Ga0068870_10714179 3300005840 Unclassified 693
181 Ga0068870_10818601 3300005840 Unclassified 652
182 Ga0068870_11222205 3300005840 Bacteria 545
183 Ga0068863_100896296 3300005841 Bacteria 887
184 Ga0068858_100883428 3300005842 Unclassified 874
185 Ga0068860_102257699 3300005843 Unclassified 565
186 Ga0068860_102427781 3300005843 Unclassified 544
187 Ga0068862_100087547 3300005844 Unclassified 2709
188 Ga0081455_10006006 3300005937 Bacteria 13168
189 Ga0081455_10140085 3300005937 Unclassified 1880
190 Ga0081540_1002188 3300005983 Bacteria 16164
191 Ga0081540_1030610 3300005983 Bacteria 2977
192 Ga0075365_10194479 3300006038 Unclassified 1420
193 Ga0075363_100229734 3300006048 Unclassified 1065
194 Ga0075432_10000461 3300006058 Bacteria 12043
195 Ga0075432_10018005 3300006058 Unclassified 2409
196 Ga0070716_101119217 3300006173 Unclassified 629
197 Ga0075367_10027362 3300006178 Bacteria 3244
198 Ga0097621_100038619 3300006237 Bacteria 3831
199 Ga0075428_100002927 3300006844 Bacteria 18606
200 Ga0075428_100056461 3300006844 Unclassified 4300
201 Ga0075428_100116177 3300006844 Bacteria 2914
202 Ga0075428_100216755 3300006844 Bacteria 2068
203 Ga0075431_100108803 3300006847 Unclassified 2860
204 Ga0075431_100295335 3300006847 Unclassified 1638
205 Ga0075433_10035247 3300006852 Bacteria 4302
206 Ga0075433_10224985 3300006852 Bacteria 1666
207 Ga0075433_11465387 3300006852 Unclassified 590
208 Ga0075434_100057148 3300006871 Bacteria 3878
209 Ga0075434_100083197 3300006871 Bacteria 3198
210 Ga0075434_100417130 3300006871 Bacteria 1363
211 Ga0075434_101199660 3300006871 Bacteria 771
212 Ga0075429_100054406 3300006880 Bacteria 3481
213 Ga0075429_100641003 3300006880 Bacteria 931
214 Ga0068865_100039816 3300006881 Bacteria 3190
215 Ga0068865_100083672 3300006881 Unclassified 2297
216 Ga0068865_100159037 3300006881 Unclassified 1721
217 Ga0068865_100818612 3300006881 Bacteria 804
218 Ga0068865_101348879 3300006881 Bacteria 635
219 Ga0075436_100122633 3300006914 Bacteria 1819
220 Ga0075436_100779747 3300006914 Bacteria 711
221 Ga0097620_100742438 3300006931 Bacteria 1071
222 Ga0075435_100011630 3300007076 Bacteria 6487
223 Ga0075435_100083320 3300007076 Unclassified 2629
224 Ga0075435_100246405 3300007076 Bacteria 1520
225 Ga0075435_101050587 3300007076 Bacteria 712
226 Ga0105244_10555514 3300009036 Unclassified 528
227 Ga0105240_10071711 3300009093 Bacteria 4283
228 Ga0105240_10268400 3300009093 Unclassified 1966
229 Ga0105240_10424666 3300009093 Bacteria 1492
230 Ga0105240_11454002 3300009093 Bacteria 719
231 Ga0111539_10000483 3300009094 Bacteria 50415
232 Ga0111539_10004184 3300009094 Bacteria 18936
233 Ga0111539_10164031 3300009094 Bacteria 2599
234 Ga0111539_10273113 3300009094 Unclassified 1968
235 Ga0105245_10001379 3300009098 Bacteria 21999
236 Ga0105245_10020869 3300009098 Bacteria 5742
237 Ga0105245_10059662 3300009098 Bacteria 3435
238 Ga0105245_10108014 3300009098 Bacteria 2584
239 Ga0105245_10275884 3300009098 Bacteria 1641
240 Ga0105245_12025969 3300009098 Unclassified 629
241 Ga0114129_10026232 3300009147 Bacteria 8253
242 Ga0114129_10517947 3300009147 Bacteria 1555
243 Ga0114129_11111957 3300009147 Unclassified 989
244 Ga0114129_12824929 3300009147 Unclassified 576
245 Ga0105243_10034919 3300009148 Bacteria 3897
246 Ga0105243_10075909 3300009148 Bacteria 2729
247 Ga0105241_10043669 3300009174 Bacteria 3395
248 Ga0105241_10279762 3300009174 Bacteria 1424
249 Ga0105241_10872022 3300009174 Bacteria 834
250 Ga0105242_10220483 3300009176 Bacteria 1695
251 Ga0105242_10343508 3300009176 Bacteria 1376
252 Ga0105248_10085552 3300009177 Bacteria 3548
253 Ga0105237_10022728 3300009545 Bacteria 6434
254 Ga0105237_10150488 3300009545 Unclassified 2324
255 Ga0105237_12424549 3300009545 Unclassified 535
256 Ga0105238_10028446 3300009551 Bacteria 5694
257 Ga0105238_10057436 3300009551 Bacteria 3901
258 Ga0105238_10719059 3300009551 Bacteria 1011
259 Ga0105238_10942751 3300009551 Unclassified 883
260 Ga0105249_10022281 3300009553 Bacteria 5675
261 Ga0105249_10136595 3300009553 Unclassified 2347
262 Ga0105249_10665554 3300009553 Unclassified 1099
263 Ga0105249_12325366 3300009553 Bacteria 609
264 Ga0105249_12774164 3300009553 Bacteria 562
265 Ga0105239_10151122 3300010375 Unclassified 2591
266 Ga0105239_10180465 3300010375 Bacteria 2362
267 Ga0105239_10273783 3300010375 Unclassified 1899
268 Ga0105239_10292632 3300010375 Bacteria 1834
269 Ga0105239_10882106 3300010375 Bacteria 1026
270 Ga0105239_13214856 3300010375 Bacteria 532
271 Ga0105246_10015407 3300011119 Bacteria 4829
272 Ga0105246_10102170 3300011119 Unclassified 2090
273 Ga0105246_10731582 3300011119 Bacteria 870
274 Ga0105246_11710392 3300011119 Unclassified 598
275 Ga0157316_1003391 3300012510 Unclassified 1147
276 Ga0157373_10010162 3300013100 Bacteria 6933
277 Ga0157373_10178559 3300013100 Bacteria 1495
278 Ga0157373_10309800 3300013100 Unclassified 1122
279 Ga0157373_10448377 3300013100 Bacteria 928
280 Ga0157373_11293122 3300013100 Unclassified 552
281 Ga0157371_10251315 3300013102 Bacteria 1273
282 Ga0157371_10568442 3300013102 Bacteria 841
283 Ga0157370_10020350 3300013104 Bacteria 6628
284 Ga0157370_10020774 3300013104 Bacteria 6552
285 Ga0157370_10148352 3300013104 Bacteria 2183
286 Ga0157370_10353642 3300013104 Bacteria 1354
287 Ga0157369_10015314 3300013105 Bacteria 8647
288 Ga0157369_10051364 3300013105 Bacteria 4461
289 Ga0157369_10192440 3300013105 Unclassified 2143
290 Ga0157369_10778406 3300013105 Bacteria 984
291 Ga0157369_11614538 3300013105 Bacteria 659
292 Ga0157374_10262783 3300013296 Bacteria 1700
293 Ga0157374_11099496 3300013296 Bacteria 815
294 Ga0157374_11705925 3300013296 Bacteria 655
295 Ga0157378_11120696 3300013297 Bacteria 824
296 Ga0163162_10122856 3300013306 Bacteria 2701
297 Ga0163162_10173123 3300013306 Unclassified 2283
298 Ga0163162_10530942 3300013306 Unclassified 1306
299 Ga0157372_10007863 3300013307 Bacteria 11332
300 Ga0157372_10119843 3300013307 Bacteria 3021
301 Ga0157372_10437467 3300013307 Bacteria 1524
302 Ga0157372_11594983 3300013307 Bacteria 751
303 Ga0157372_12148938 3300013307 Unclassified 641
304 Ga0157372_13043469 3300013307 Bacteria 536
305 Ga0157375_10050701 3300013308 Bacteria 4072
306 Ga0157375_11561608 3300013308 Unclassified 780
307 Ga0157375_12222052 3300013308 Unclassified 654
308 Ga0163163_10061159 3300014325 Bacteria 3731
309 Ga0163163_10190410 3300014325 Bacteria 2100
310 Ga0163163_10240064 3300014325 Bacteria 1862
311 Ga0163163_10664589 3300014325 Bacteria 1105
312 Ga0163163_13284084 3300014325 Bacteria 504
313 Ga0157380_11052040 3300014326 Bacteria 850
314 Ga0157380_12369182 3300014326 Bacteria 596
315 Ga0182008_10378925 3300014497 Unclassified 756
316 Ga0182008_10573538 3300014497 Bacteria 630
317 Ga0157377_10052985 3300014745 Bacteria 2292
318 Ga0157377_10068182 3300014745 Unclassified 2050
319 Ga0157377_10165281 3300014745 Bacteria 1379
320 Ga0157377_11197990 3300014745 Unclassified 588
321 Ga0157376_10051798 3300014969 Bacteria 3411
322 Ga0157376_10703166 3300014969 Bacteria 1016
323 Ga0157376_11033325 3300014969 Bacteria 845
324 Ga0163161_10020642 3300017792 Bacteria 4626
325 Ga0163161_10101804 3300017792 Bacteria 2139
326 Ga0197907_10381642 3300020069 Bacteria 1311
327 Ga0206356_10893813 3300020070 Unclassified 2868
328 Ga0206356_11691718 3300020070 Bacteria 620
329 Ga0206354_10655524 3300020081 Bacteria 2648
330 Ga0206354_11064529 3300020081 Unclassified 1835
331 Ga0206353_10019772 3300020082 Bacteria 649
332 Ga0206353_10184386 3300020082 Unclassified 1193
333 Ga0206353_10588121 3300020082 Bacteria 1732
334 Ga0206353_11289376 3300020082 Bacteria 747
335 Ga0224712_10285904 3300022467 Unclassified 769
336 Ga0207692_10571233 3300025898 Bacteria 724
337 Ga0207692_10798034 3300025898 Unclassified 617
338 Ga0207642_10106239 3300025899 Bacteria 1420
339 Ga0207688_10029329 3300025901 Bacteria 3028
340 Ga0207688_10088948 3300025901 Bacteria 1771
341 Ga0207699_10237408 3300025906 Bacteria 1251
342 Ga0207645_10034937 3300025907 Bacteria 3228
343 Ga0207643_10001826 3300025908 Bacteria 11805
344 Ga0207643_10046142 3300025908 Bacteria 2463
345 Ga0207705_10027534 3300025909 Bacteria 4053
346 Ga0207705_10129551 3300025909 Bacteria 1877
347 Ga0207684_10062371 3300025910 Bacteria 3165
348 Ga0207684_10190423 3300025910 Unclassified 1769
349 Ga0207654_10051699 3300025911 Bacteria 2366
350 Ga0207654_10154676 3300025911 Bacteria 1476
351 Ga0207654_10566411 3300025911 Bacteria 808
352 Ga0207707_10054970 3300025912 Bacteria 3464
353 Ga0207707_10071510 3300025912 Bacteria 3023
354 Ga0207707_10072380 3300025912 Bacteria 3005
355 Ga0207707_10105283 3300025912 Bacteria 2466
356 Ga0207707_10251253 3300025912 Unclassified 1536
357 Ga0207707_11604343 3300025912 Bacteria 512
358 Ga0207695_10192103 3300025913 Unclassified 1959
359 Ga0207695_11129340 3300025913 Bacteria 664
360 Ga0207671_10151354 3300025914 Bacteria 1792
361 Ga0207671_10153650 3300025914 Unclassified 1779
362 Ga0207671_11082927 3300025914 Unclassified 630
363 Ga0207693_10061795 3300025915 Bacteria 2934
364 Ga0207693_10814431 3300025915 Bacteria 719
365 Ga0207663_10019136 3300025916 Bacteria 3850
366 Ga0207660_10032133 3300025917 Bacteria 3621
367 Ga0207660_10035433 3300025917 Bacteria 3466
368 Ga0207660_10184149 3300025917 Bacteria 1623
369 Ga0207660_10195234 3300025917 Unclassified 1578
370 Ga0207662_10036660 3300025918 Bacteria 2867
371 Ga0207657_10000467 3300025919 Bacteria 42840
372 Ga0207657_10000731 3300025919 Bacteria 34878
373 Ga0207657_10033593 3300025919 Unclassified 4623
374 Ga0207657_10072051 3300025919 Bacteria 2924
375 Ga0207657_10170245 3300025919 Unclassified 1765
376 Ga0207657_10184231 3300025919 Bacteria 1687
377 Ga0207657_10500669 3300025919 Unclassified 952
378 Ga0207649_10014002 3300025920 Bacteria 4489
379 Ga0207649_10067545 3300025920 Bacteria 2270
380 Ga0207649_10201225 3300025920 Bacteria 1407
381 Ga0207649_10291502 3300025920 Bacteria 1190
382 Ga0207652_10029820 3300025921 Bacteria 4565
383 Ga0207652_10047514 3300025921 Bacteria 3666
384 Ga0207652_10069746 3300025921 Bacteria 3052
385 Ga0207652_10071978 3300025921 Bacteria 3005
386 Ga0207652_10113398 3300025921 Bacteria 2406
387 Ga0207652_10191399 3300025921 Bacteria 1840
388 Ga0207652_10200392 3300025921 Bacteria 1796
389 Ga0207652_10360937 3300025921 Unclassified 1311
390 Ga0207646_10475425 3300025922 Bacteria 1127
391 Ga0207681_10427786 3300025923 Bacteria 1074
392 Ga0207694_10046466 3300025924 Bacteria 3356
393 Ga0207694_10143163 3300025924 Bacteria 1923
394 Ga0207694_10819375 3300025924 Unclassified 786
395 Ga0207650_10475642 3300025925 Bacteria 1042
396 Ga0207659_10077356 3300025926 Unclassified 2449
397 Ga0207687_10039162 3300025927 Unclassified 3244
398 Ga0207687_10499823 3300025927 Bacteria 1015
399 Ga0207687_11117551 3300025927 Bacteria 677
400 Ga0207664_11462055 3300025929 Bacteria 605
401 Ga0207644_10151842 3300025931 Bacteria 1793
402 Ga0207690_10026602 3300025932 Bacteria 3644
403 Ga0207690_10264722 3300025932 Unclassified 1333
404 Ga0207690_11583860 3300025932 Bacteria 547
405 Ga0207706_10006904 3300025933 Bacteria 10500
406 Ga0207686_10257160 3300025934 Bacteria 1278
407 Ga0207709_10048106 3300025935 Unclassified 2597
408 Ga0207709_10570505 3300025935 Bacteria 892
409 Ga0207669_10005301 3300025937 Bacteria 5769
410 Ga0207669_10099012 3300025937 Unclassified 1922
411 Ga0207704_10007727 3300025938 Bacteria 5099
412 Ga0207704_10335049 3300025938 Bacteria 1172
413 Ga0207704_10468823 3300025938 Bacteria 1009
414 Ga0207665_10001983 3300025939 Bacteria 13791
415 Ga0207665_10395148 3300025939 Unclassified 1052
416 Ga0207665_10600325 3300025939 Bacteria 859
417 Ga0207711_10485872 3300025941 Bacteria 1151
418 Ga0207689_10027077 3300025942 Bacteria 4799
419 Ga0207689_10131692 3300025942 Bacteria 2058
420 Ga0207689_10302189 3300025942 Unclassified 1326
421 Ga0207689_10339157 3300025942 Unclassified 1248
422 Ga0207661_10219589 3300025944 Bacteria 1679
423 Ga0207661_10237678 3300025944 Bacteria 1615
424 Ga0207661_10450548 3300025944 Bacteria 1172
425 Ga0207661_11184357 3300025944 Unclassified 703
426 Ga0207661_11360667 3300025944 Unclassified 652
427 Ga0207661_11381924 3300025944 Unclassified 646
428 Ga0207661_11748784 3300025944 Bacteria 567
429 Ga0207661_11921883 3300025944 Bacteria 537
430 Ga0207679_10181219 3300025945 Unclassified 1743
431 Ga0207679_10228018 3300025945 Bacteria 1571
432 Ga0207679_10702118 3300025945 Bacteria 918
433 Ga0207679_11234490 3300025945 Bacteria 686
434 Ga0207667_10047992 3300025949 Bacteria 4516
435 Ga0207667_10055691 3300025949 Bacteria 4157
436 Ga0207667_10076403 3300025949 Bacteria 3476
437 Ga0207667_10138219 3300025949 Bacteria 2509
438 Ga0207667_10166210 3300025949 Bacteria 2268
439 Ga0207667_10334528 3300025949 Bacteria 1546
440 Ga0207667_12145574 3300025949 Unclassified 517
441 Ga0207651_10100351 3300025960 Bacteria 2146
442 Ga0207651_11981131 3300025960 Unclassified 523
443 Ga0207712_10024008 3300025961 Bacteria 4032
444 Ga0207712_10033899 3300025961 Bacteria 3455
445 Ga0207668_10098019 3300025972 Unclassified 2171
446 Ga0207668_10118821 3300025972 Bacteria 1998
447 Ga0207668_10322373 3300025972 Unclassified 1282
448 Ga0207640_10075865 3300025981 Unclassified 2280
449 Ga0207640_10082353 3300025981 Bacteria 2203
450 Ga0207640_10259968 3300025981 Unclassified 1352
451 Ga0207639_10083877 3300026041 Unclassified 2530
452 Ga0207678_10080492 3300026067 Unclassified 2789
453 Ga0207678_11013350 3300026067 Bacteria 735
454 Ga0207708_10011473 3300026075 Bacteria 6602
455 Ga0207708_10037886 3300026075 Unclassified 3673
456 Ga0207708_10209939 3300026075 Bacteria 1556
457 Ga0207708_10275707 3300026075 Bacteria 1361
458 Ga0207702_10256927 3300026078 Bacteria 1643
459 Ga0207702_10804426 3300026078 Bacteria 929
460 Ga0207641_10803993 3300026088 Bacteria 930
461 Ga0207648_10067794 3300026089 Bacteria 3110
462 Ga0207648_10314967 3300026089 Bacteria 1405
463 Ga0207648_10631573 3300026089 Unclassified 989
464 Ga0207648_10981468 3300026089 Bacteria 791
465 Ga0207676_10477075 3300026095 Bacteria 1181
466 Ga0207674_10017840 3300026116 Bacteria 7737
467 Ga0207674_10224371 3300026116 Unclassified 1827
468 Ga0207674_10669002 3300026116 Bacteria 1002
469 Ga0207675_100000792 3300026118 Bacteria 31451
470 Ga0207675_100142480 3300026118 Unclassified 2277
471 Ga0207683_10017553 3300026121 Bacteria 6101
472 Ga0207683_10026950 3300026121 Bacteria 4966
473 Ga0207698_10031836 3300026142 Bacteria 3813
474 Ga0207698_10054316 3300026142 Unclassified 3082
475 Ga0207698_10221785 3300026142 Bacteria 1709
476 Ga0207698_11262251 3300026142 Bacteria 753
477 Ga0209966_1109360 3300027695 Unclassified 629
478 Ga0207428_10000196 3300027907 Bacteria 84609
479 Ga0207428_10023492 3300027907 Bacteria 5186
480 Ga0207428_10038882 3300027907 Bacteria 3865
481 Ga0207428_10123914 3300027907 Bacteria 1980
482 Ga0207428_10352850 3300027907 Unclassified 1082
483 Ga0207428_10436726 3300027907 Bacteria 955
484 Ga0268266_10134451 3300028379 Bacteria 2214
485 Ga0268266_10693120 3300028379 Bacteria 981
486 Ga0268265_10113510 3300028380 Unclassified 2217
487 Ga0268265_10380175 3300028380 Unclassified 1299
488 Ga0268264_10898715 3300028381 Bacteria 889
489 Ga0268264_11594476 3300028381 Unclassified 663
490 Ga0307405_10043409 3300031731 Unclassified 2743
491 Ga0307413_10779240 3300031824 Bacteria 802
492 Ga0307406_11723478 3300031901 Bacteria 556
493 Ga0307412_10669810 3300031911 Bacteria 887
494 Ga0307409_100861911 3300031995 Bacteria 917
495 Ga0307416_100130815 3300032002 Unclassified 2259
496 Ga0307416_100158582 3300032002 Bacteria 2087
497 Ga0373930_0154200 3300034816 Bacteria 578
498 Ga0373938_0020233 3300034957 Unclassified 1339
499 Ga0373949_0120091 3300035090 Unclassified 737
500 Ga0373949_0233749 3300035090 Bacteria 563
501 Ga0373952_0210989 3300035092 Bacteria 573
502 Ga0373932_0235368 3300035112 Unclassified 663
503 Ga0373936_0069926 3300035113 Bacteria 1445
504 Ga0373939_0013189 3300035114 Bacteria 2122
505 Ga0373945_0009560 3300035116 Bacteria 3180
506 Ga0373945_0177961 3300035116 Bacteria 874
507 Ga0373960_0021450 3300035121 Bacteria 1718
508 Ga0373943_0010858 3300035170 Bacteria 4089
509 Ga0373943_0092909 3300035170 Bacteria 1565
510 Ga0373946_0763483 3300035171 Unclassified 508
511 Ga0373931_0375379 3300035691 Bacteria 895
512 Ga0373935_0054335 3300035692 Bacteria 2550
513 Ga0373935_0075407 3300035692 Bacteria 2182
514 Ga0373947_0000533 3300035725 Bacteria 22256
515 Ga0373947_0007052 3300035725 Bacteria 6513
516 Ga0373925_0004302 3300037068 Bacteria 10786
517 Ga0373925_0005142 3300037068 Bacteria 9804
518 Ga0395899_0019101 3300037312 Bacteria 5209
519 Ga0395899_0103369 3300037312 Bacteria 2055
520 Ga0395899_0342688 3300037312 Bacteria 1002
521 Ga0395899_0664437 3300037312 Bacteria 657
522 Ga0395900_0002857 3300037418 Bacteria 18833
523 Ga0395900_0007033 3300037418 Bacteria 11651
524 Ga0395900_0024664 3300037418 Bacteria 6154
525 Ga0395900_0132501 3300037418 Bacteria 2554
526 Ga0395900_0223612 3300037418 Bacteria 1896
527 Ga0395900_0496441 3300037418 Unclassified 1171
528 Ga0395900_0505405 3300037418 Unclassified 1158
529 Ga0395900_0585983 3300037418 Bacteria 1057
530 Ga0395900_1794388 3300037418 Unclassified 524
531 Ga0395898_0005912 3300037466 Bacteria 13149
532 Ga0395898_0049255 3300037466 Bacteria 4128
533 Ga0395898_0119559 3300037466 Unclassified 2524
534 Ga0395898_0127401 3300037466 Unclassified 2439
535 Ga0395898_0139447 3300037466 Bacteria 2321
536 Ga0395898_0199860 3300037466 Bacteria 1909
537 Ga0395898_0210539 3300037466 Bacteria 1854
538 Ga0395898_0244486 3300037466 Bacteria 1711
539 Ga0395898_0751481 3300037466 Unclassified 916
540 Ga0395898_1018596 3300037466 Unclassified 763
541 Ga0395898_1399223 3300037466 Bacteria 627
542 Ga0395898_1444569 3300037466 Bacteria 615
543 Ga0395905_0000568 3300037471 Bacteria 50013
544 Ga0395905_0074777 3300037471 Bacteria 3175
545 Ga0395905_0155309 3300037471 Bacteria 2152
546 Ga0395905_0196194 3300037471 Unclassified 1893
547 Ga0395905_0272235 3300037471 Unclassified 1579
548 Ga0395905_0799707 3300037471 Bacteria 846
549 Ga0395905_0857099 3300037471 Unclassified 811
550 Ga0436364_0135606 3300037853 Bacteria 1088
551 Ga0395901_0001508 3300038443 Bacteria 24209
552 Ga0395901_0001844 3300038443 Bacteria 21899
553 Ga0395901_0020113 3300038443 Bacteria 6831
554 Ga0395901_0022801 3300038443 Bacteria 6419
555 Ga0395901_0099773 3300038443 Unclassified 3045
556 Ga0395901_0143288 3300038443 Bacteria 2512
557 Ga0395901_0154003 3300038443 Bacteria 2414
558 Ga0395901_0166266 3300038443 Unclassified 2316
559 Ga0395901_0273538 3300038443 Bacteria 1756
560 Ga0395901_0434011 3300038443 Unclassified 1345
561 Ga0395901_1552502 3300038443 Bacteria 617
562 Ga0395901_1718000 3300038443 Bacteria 578
563 Ga0436365_1360505 3300039437 Bacteria 5265
564 Ga0436363_1283513 3300039450 Bacteria 1365
565 Ga0451800_1206920 3300041459 Bacteria 914
566 Ga0451841_0962610 3300041498 Bacteria 850
567 Ga0451853_3046892 3300041512 Unclassified 974
568 Ga0439448_0036216 3300042005 Unclassified 1582
569 Ga0439448_0050431 3300042005 Bacteria 1362
570 Ga0439450_191670 3300042008 Unclassified 545
571 Ga0439450_214576 3300042008 Unclassified 517
572 Ga0439458_0024941 3300042157 Unclassified 1400
573 Ga0439459_0008300 3300042438 Unclassified 1772
574 Ga0439460_0302318 3300042461 Bacteria 559
575 Ga0466965_0213282 3300044683 Bacteria 1027
576 Ga0466965_0556251 3300044683 Bacteria 648
577 Ga0466966_0012700 3300044684 Bacteria 5582
578 Ga0466961_0062856 3300044693 Bacteria 2359
579 Ga0466961_0222985 3300044693 Bacteria 1162
580 Ga0466963_0000743 3300044694 Bacteria 16069
581 Ga0466963_0003907 3300044694 Bacteria 8612
582 Ga0466963_0011801 3300044694 Bacteria 5330
583 Ga0466963_0016083 3300044694 Bacteria 4647
584 Ga0466963_0702603 3300044694 Bacteria 713
585 Ga0466964_0057077 3300044706 Unclassified 1615
586 Ga0466964_0288249 3300044706 Bacteria 823
587 Ga0466964_0371995 3300044706 Bacteria 739
588 Ga0466971_0253830 3300044719 Bacteria 838
589 Ga0466968_0102500 3300044735 Bacteria 1279
590 Ga0466957_0035500 3300044842 Bacteria 2991
591 Ga0466957_0037750 3300044842 Bacteria 2909
592 Ga0466957_1166679 3300044842 Bacteria 557
593 Ga0466957_1365385 3300044842 Bacteria 515
594 Ga0466960_0059143 3300044901 Bacteria 1874
595 Ga0466960_0199030 3300044901 Bacteria 1094
596 Ga0466960_0404126 3300044901 Bacteria 787
597 Ga0466959_0116832 3300045049 Unclassified 1899
598 Ga0466959_0117305 3300045049 Bacteria 1895
599 Ga0466959_0414820 3300045049 Bacteria 914
600 Ga0466959_0470427 3300045049 Bacteria 851
601 Ga0451576_0076759 3300045051 Unclassified 3477
602 Ga0451576_0799670 3300045051 Bacteria 990
603 Ga0451576_1672917 3300045051 Unclassified 659
604 Ga0466958_0188522 3300045836 Unclassified 1310
605 Ga0466958_0215460 3300045836 Bacteria 1224
606 Ga0466958_0735974 3300045836 Bacteria 643
607 Ga0466967_0017646 3300045976 Bacteria 5676
608 Ga0466967_0025753 3300045976 Bacteria 4854
609 Ga0466967_0086552 3300045976 Bacteria 2839
610 Ga0466967_0150849 3300045976 Bacteria 2172
611 Ga0466967_0252259 3300045976 Bacteria 1686
612 Ga0466967_0323005 3300045976 Bacteria 1489
613 Ga0466967_0466491 3300045976 Unclassified 1236
614 Ga0466967_0563334 3300045976 Bacteria 1122
615 Ga0466967_1419134 3300045976 Bacteria 691
616 Ga0466967_1680503 3300045976 Bacteria 632
617 Ga0495617_196152 3300046452 Unclassified 632
618 Ga0495627_209246 3300046453 Unclassified 537
619 Ga0495592_0358570 3300046454 Bacteria 933
620 Ga0495603_0001442 3300046455 Bacteria 13834
621 Ga0495590_0161515 3300046457 Unclassified 815
622 Ga0495591_093021 3300046458 Bacteria 755
623 Ga0495629_0281263 3300046459 Bacteria 1141
624 Ga0495638_0220396 3300046460 Bacteria 1061
625 Ga0495641_0001137 3300046461 Bacteria 22903
626 Ga0495651_0540941 3300046462 Bacteria 741
627 Ga0495653_0319535 3300046463 Bacteria 1007
628 Ga0495580_0024689 3300046472 Bacteria 4398
629 Ga0495582_0508520 3300046473 Bacteria 696
630 Ga0495605_0152583 3300046474 Bacteria 1030
631 Ga0495605_0229594 3300046474 Bacteria 800
632 Ga0495639_0092991 3300046475 Bacteria 1417
633 Ga0495664_0871479 3300046477 Bacteria 527
634 Ga0495584_0031556 3300046491 Bacteria 2682
635 Ga0495584_0102989 3300046491 Bacteria 1443
636 Ga0495584_0113837 3300046491 Bacteria 1369
637 Ga0495584_0147462 3300046491 Bacteria 1195
638 Ga0495585_0073866 3300046492 Bacteria 1856
639 Ga0495596_0148636 3300046500 Bacteria 910
640 Ga0495607_0099665 3300046501 Bacteria 1558
641 Ga0495607_0116113 3300046501 Bacteria 1412
642 Ga0495608_0118464 3300046511 Unclassified 1699
643 Ga0495616_0062508 3300046513 Bacteria 1823
644 Ga0495618_0576325 3300046514 Bacteria 672
645 Ga0495628_0089479 3300046516 Bacteria 2384
646 Ga0495630_0241726 3300046517 Bacteria 1379
647 Ga0495630_0329553 3300046517 Bacteria 1167
648 Ga0495637_0072954 3300046520 Unclassified 1381
649 Ga0495643_0115895 3300046522 Bacteria 1358
650 Ga0495644_0040461 3300046523 Bacteria 1757
651 Ga0495644_0361866 3300046523 Unclassified 572
652 Ga0495663_0039737 3300046525 Bacteria 1426
653 Ga0495666_0030512 3300046526 Bacteria 2645
654 Ga0495652_0060460 3300046529 Bacteria 3202
655 Ga0495654_0054023 3300046530 Bacteria 1950
656 Ga0495640_0365558 3300046533 Bacteria 889
657 Ga0495586_0011957 3300046535 Bacteria 4611
658 Ga0495598_0002624 3300046537 Bacteria 3722
659 Ga0495609_0029943 3300046538 Bacteria 2477
660 Ga0495609_0070700 3300046538 Bacteria 1534
661 Ga0495621_0091796 3300046539 Unclassified 1145
662 Ga0495621_0307785 3300046539 Bacteria 658
663 Ga0495622_0178440 3300046557 Unclassified 953
664 Ga0495633_0367589 3300046558 Bacteria 651
665 Ga0495633_0490530 3300046558 Unclassified 554
666 Ga0495667_0607962 3300046559 Unclassified 681
667 Ga0495656_0020197 3300046615 Bacteria 2581
668 Ga0495656_0468026 3300046615 Bacteria 665
669 Ga0495668_0115958 3300046616 Bacteria 1465
670 Ga0495668_0842471 3300046616 Unclassified 508
671 Ga0495634_0270683 3300046642 Bacteria 1034
672 Ga0495611_0165473 3300046648 Unclassified 1034
673 Ga0495659_0034272 3300046664 Bacteria 1785
674 Ga0495659_0054242 3300046664 Bacteria 1466
675 Ga0495657_0391294 3300046675 Unclassified 819
676 Ga0495599_0418419 3300046678 Bacteria 796
677 Ga0495658_0090430 3300046683 Bacteria 1812
678 Ga0495658_0236207 3300046683 Bacteria 1147
679 Ga0495613_0029948 3300046689 Bacteria 4044
680 Ga0495670_0076392 3300046691 Bacteria 1702
681 Ga0495670_0182764 3300046691 Bacteria 1107
682 Ga0495671_0023230 3300046692 Unclassified 3241
683 Ga0495671_0240615 3300046692 Bacteria 874
684 Ga0495589_0091290 3300046794 Bacteria 1479
685 Ga0495660_0052786 3300046810 Bacteria 2208
686 Ga0495581_0449843 3300047315 Unclassified 750
687 Ga0495636_0309298 3300047318 Bacteria 740
688 Ga0495636_0350394 3300047318 Unclassified 697
689 Ga0495674_0037327 3300047319 Bacteria 4366
690 Ga0495674_0057423 3300047319 Bacteria 3406
691 Ga0495676_0004439 3300047321 Bacteria 12831
692 Ga0495676_0152464 3300047321 Bacteria 1643
693 Ga0495683_0134032 3300047323 Unclassified 1166
694 Ga0495677_0102244 3300047445 Bacteria 1086
695 Ga0495679_077589 3300047446 Bacteria 948
696 Ga0495685_060001 3300047447 Bacteria 1283
697 Ga0495684_0239030 3300047471 Bacteria 1326
698 Ga0495614_0185542 3300048089 Bacteria 937
699 Ga0495615_0040955 3300048090 Bacteria 1156
700 Ga0495615_0158045 3300048090 Unclassified 679
701 Ga0495626_0406239 3300048091 Unclassified 526
702 Ga0496100_0107149 3300048903 Unclassified 1935
703 Ga0496100_0546977 3300048903 Unclassified 895
704 Ga0496102_0069469 3300048905 Bacteria 3233
705 Ga0496102_0332158 3300048905 Unclassified 1432
706 Ga0496102_1118018 3300048905 Bacteria 708
707 Ga0496103_0001272 3300048906 Bacteria 17185
708 Ga0496104_0068050 3300048907 Bacteria 3383
709 Ga0496104_0145904 3300048907 Bacteria 2272
710 Ga0496105_0040024 3300048908 Bacteria 3864
711 Ga0496105_0087274 3300048908 Bacteria 2577
712 Ga0496108_0030725 3300048911 Bacteria 4451
713 Ga0496108_0031161 3300048911 Bacteria 4422
714 Ga0496108_0080685 3300048911 Bacteria 2756
715 Ga0496109_0017493 3300048912 Bacteria 6285
716 Ga0496109_0045948 3300048912 Bacteria 3965
717 Ga0496109_0391846 3300048912 Bacteria 1312
718 Ga0496109_0658730 3300048912 Archaea 984
719 Ga0496109_0697472 3300048912 Bacteria 952
720 Ga0496109_0759751 3300048912 Bacteria 907
721 Ga0496110_0027599 3300048913 Bacteria 4867
722 Ga0496110_0040053 3300048913 Bacteria 4082
723 Ga0496110_0343280 3300048913 Bacteria 1360
724 Ga0496110_0621323 3300048913 Bacteria 979
725 Ga0496111_0028098 3300048914 Bacteria 3984
726 Ga0496111_0974635 3300048914 Bacteria 608
727 Ga0496112_0140642 3300048915 Bacteria 2383
728 Ga0496112_0154778 3300048915 Bacteria 2260
729 Ga0496113_0049910 3300048916 Bacteria 3117
730 Ga0496113_0285579 3300048916 Bacteria 1320
731 Ga0496113_0476688 3300048916 Unclassified 1002
732 Ga0496113_1308342 3300048916 Bacteria 563
733 Ga0496115_0301259 3300048918 Unclassified 1313
734 Ga0501031_0791810 3300049568 Bacteria 608
735 Ga0501032_0086020 3300049569 Bacteria 2090
736 Ga0501032_0207989 3300049569 Bacteria 1276
737 Ga0501033_0152133 3300049570 Unclassified 1669
738 Ga0501036_0008255 3300049572 Bacteria 8536
739 Ga0501036_0054381 3300049572 Bacteria 3391
740 Ga0501036_0182990 3300049572 Bacteria 1764
741 Ga0501036_1503353 3300049572 Bacteria 545
742 Ga0501037_0177334 3300049573 Bacteria 1513
743 Ga0501037_0191611 3300049573 Bacteria 1447
744 Ga0501038_0102375 3300049574 Bacteria 2383
745 Ga0501038_0135942 3300049574 Unclassified 2014
746 Ga0501038_1087868 3300049574 Bacteria 584
747 Ga0501039_0005748 3300049575 Bacteria 9390
748 Ga0501039_0040396 3300049575 Bacteria 3601
749 Ga0501039_0288171 3300049575 Bacteria 1291
750 Ga0501040_0014913 3300049576 Bacteria 5131
751 Ga0501040_0122600 3300049576 Unclassified 1824
752 Ga0501040_0434922 3300049576 Bacteria 944
753 Ga0501040_0543641 3300049576 Bacteria 838
754 Ga0501040_0869225 3300049576 Bacteria 653
755 Ga0501041_0013301 3300049577 Bacteria 4876
756 Ga0501041_0193853 3300049577 Bacteria 1273
757 Ga0501041_0355648 3300049577 Bacteria 926
758 Ga0501041_0724316 3300049577 Bacteria 637
759 Ga0501042_0012634 3300049578 Bacteria 5728
760 Ga0501043_0134523 3300049579 Bacteria 1937
761 Ga0501043_0216468 3300049579 Unclassified 1483
762 Ga0501046_0015766 3300049580 Bacteria 6344
763 Ga0501046_0073305 3300049580 Bacteria 2657
764 Ga0501048_0016652 3300049582 Bacteria 5420
765 Ga0501048_0110789 3300049582 Unclassified 1938
766 Ga0501067_0007929 3300049583 Bacteria 5898
767 Ga0501067_0008781 3300049583 Bacteria 5598
768 Ga0501067_0163793 3300049583 Bacteria 1238
769 Ga0501067_0591902 3300049583 Bacteria 622
770 Ga0501067_0759140 3300049583 Bacteria 546
771 Ga0501068_0028112 3300049584 Bacteria 3323
772 Ga0501068_0317711 3300049584 Bacteria 998
773 Ga0501068_0461380 3300049584 Bacteria 822
774 Ga0501068_0797315 3300049584 Bacteria 619
775 Ga0501068_1027469 3300049584 Bacteria 544
776 Ga0501069_0006739 3300049585 Bacteria 6012
777 Ga0501069_0040999 3300049585 Bacteria 2558
778 Ga0501069_0089266 3300049585 Bacteria 1742
779 Ga0501070_0098290 3300049586 Unclassified 2421
780 Ga0501070_0174680 3300049586 Bacteria 1769
781 Ga0501070_0282188 3300049586 Bacteria 1355
782 Ga0501071_0003446 3300049587 Bacteria 9881
783 Ga0501071_0017284 3300049587 Bacteria 4972
784 Ga0501071_0047094 3300049587 Bacteria 3097
785 Ga0501071_0426790 3300049587 Bacteria 1013
786 Ga0501072_0002483 3300049588 Bacteria 13814
787 Ga0501072_0004929 3300049588 Bacteria 10151
788 Ga0501072_0073843 3300049588 Bacteria 2696
789 Ga0501072_0255406 3300049588 Bacteria 1395
790 Ga0501073_0090545 3300049589 Bacteria 2126
791 Ga0501074_0025245 3300049590 Bacteria 4317
792 Ga0501074_0261882 3300049590 Bacteria 1229
793 Ga0501075_0016749 3300049591 Bacteria 5286
794 Ga0501075_0059032 3300049591 Bacteria 2889
795 Ga0501075_0060058 3300049591 Bacteria 2865
796 Ga0501075_0265228 3300049591 Bacteria 1309
797 Ga0501076_0004215 3300049592 Bacteria 10176
798 Ga0501076_0007588 3300049592 Bacteria 7897
799 Ga0501077_0005911 3300049593 Bacteria 7464
800 Ga0501077_0023566 3300049593 Bacteria 3903
801 Ga0501079_0001382 3300049741 Bacteria 17096
802 Ga0501079_0005016 3300049741 Bacteria 9819
803 Ga0501079_0015422 3300049741 Bacteria 5831
804 Ga0501079_0244225 3300049741 Bacteria 1403
805 Ga0501080_0002032 3300049742 Bacteria 17493
806 Ga0501080_0162035 3300049742 Bacteria 2065
807 Ga0501081_0006195 3300049743 Bacteria 7748
808 Ga0501081_0012524 3300049743 Bacteria 5577
809 Ga0501081_0055419 3300049743 Bacteria 2740
810 Ga0501081_0476230 3300049743 Unclassified 929
811 Ga0501083_0111851 3300049744 Bacteria 1795
812 Ga0501035_0019017 3300049822 Bacteria 6323
813 Ga0501035_1279037 3300049822 Bacteria 566
814 Ga0501044_0237734 3300049823 Bacteria 1767
815 Ga0501045_0026787 3300049824 Bacteria 4149
816 Ga0501045_0044759 3300049824 Bacteria 3224
817 Ga0501045_0078100 3300049824 Bacteria 2440
818 Ga0501045_0341451 3300049824 Bacteria 1115
819 Ga0501045_0661007 3300049824 Bacteria 772
820 nmdc:mga03n38_236587_c1 3300050490 Unclassified 959
821 nmdc:mga00v17_24047_c1 3300050491 Bacteria 3530
822 nmdc:mga0yw44_195849_c1 3300050492 Bacteria 1333
823 nmdc:mga0yw44_243554_c1 3300050492 Unclassified 1196
824 nmdc:mga0yw44_369402_c1 3300050492 Bacteria 968
825 nmdc:mga06z11_7552_c1 3300050494 Bacteria 4482
826 nmdc:mga05p37_159332_c1 3300050507 Bacteria 2757
827 nmdc:mga05p37_4691_c2 3300050507 Bacteria 8253
828 nmdc:mga09592_4692_c1 3300050508 Bacteria 11062
829 nmdc:mga06r32_282208_c1 3300050510 Bacteria 1648
830 nmdc:mga08y16_100664_c1 3300050511 Bacteria 3009
831 nmdc:mga08y16_2176447_c1 3300050511 Bacteria 501
832 nmdc:mga08y16_334025_c1 3300050511 Bacteria 1559
833 nmdc:mga08y16_458110_c1 3300050511 Bacteria 1300
834 nmdc:mga08y16_56074_c1 3300050511 Bacteria 4119
835 nmdc:mga08y16_716998_c1 3300050511 Bacteria 999
836 nmdc:mga08y16_759948_c1 3300050511 Unclassified 965
837 nmdc:mga08y16_8793_c1 3300050511 Bacteria 10600
838 nmdc:mga0n895_1130384_c1 3300050512 Bacteria 760
839 nmdc:mga0n895_1581838_c1 3300050512 Unclassified 620
840 nmdc:mga0n895_46478_c1 3300050512 Bacteria 4241
841 nmdc:mga0n895_565935_c1 3300050512 Bacteria 1141
842 nmdc:mga0n895_608643_c1 3300050512 Unclassified 1094
843 nmdc:mga0n895_72506_c1 3300050512 Bacteria 3416
844 nmdc:mga0n895_929025_c1 3300050512 Unclassified 854
845 nmdc:mga0rr50_13665_c1 3300050513 Bacteria 5296
846 nmdc:mga0rr50_1633915_c1 3300050513 Bacteria 544
847 nmdc:mga0rr50_54017_c1 3300050513 Unclassified 2991
848 nmdc:mga0rr50_640727_c1 3300050513 Bacteria 907
849 nmdc:mga08x19_28639_c1 3300050514 Bacteria 3490
850 nmdc:mga0a205_1165110_c1 3300050515 Bacteria 618
851 nmdc:mga0a205_29555_c1 3300050515 Bacteria 5245
852 nmdc:mga0a205_491719_c1 3300050515 Unclassified 1084
853 nmdc:mga0a205_60942_c1 3300050515 Bacteria 3644
854 nmdc:mga0a205_65347_c1 3300050515 Bacteria 3515
855 Ga0495612_0474198 3300053078 Bacteria 573
856 Ga0495619_0914415 3300053085 Bacteria 590
857 Ga0501084_0001654 3300054114 Bacteria 17736
858 Ga0501084_0003270 3300054114 Bacteria 13109
859 Ga0501084_0083263 3300054114 Bacteria 2685
860 Ga0501084_0263187 3300054114 Unclassified 1456
861 Ga0501082_0047898 3300060353 Bacteria 3683
862 Ga0501082_0378196 3300060353 Bacteria 1236
863 Ga0501082_0462488 3300060353 Bacteria 1109
864 Ga0501082_0897358 3300060353 Bacteria 775
865 Ga0466962_0052428 3300061719 Bacteria 1950
866 Ga0466962_0363666 3300061719 Unclassified 721
867 Ga0466962_0476138 3300061719 Bacteria 630
868 Ga0530510_0004090 3300061734 Bacteria 10065
869 Ga0530510_0024164 3300061734 Bacteria 4335
870 Ga0530510_0049813 3300061734 Unclassified 3025
871 Ga0530510_0058423 3300061734 Bacteria 2789
872 Ga0530510_0166606 3300061734 Bacteria 1631
873 Ga0530510_0201631 3300061734 Bacteria 1478
874 Ga0530510_0362616 3300061734 Bacteria 1089
875 Ga0530510_0482666 3300061734 Bacteria 939
876 Ga0530510_0665806 3300061734 Bacteria 793
877 Ga0530510_0711399 3300061734 Bacteria 766

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009551 Ga0105238_10942751 Ga0105238_109427511 85
2 3300005337 Ga0070682_100039472 Ga0070682_1000394723 86
3 3300005344 Ga0070661_100211329 Ga0070661_1002113292 86
4 3300005364 Ga0070673_100643777 Ga0070673_1006437772 86
5 3300005434 Ga0070709_10065998 Ga0070709_100659982 86
6 3300005455 Ga0070663_100018125 Ga0070663_1000181253 86
7 3300005456 Ga0070678_100093151 Ga0070678_1000931513 86
8 3300005458 Ga0070681_10039157 Ga0070681_100391574 86
9 3300005530 Ga0070679_100171922 Ga0070679_1001719222 86
10 3300005544 Ga0070686_100012297 Ga0070686_1000122973 86
11 3300005578 Ga0068854_100182523 Ga0068854_1001825232 86
12 3300005615 Ga0070702_101256906 Ga0070702_1012569061 86
13 3300005840 Ga0068870_10041791 Ga0068870_100417912 86
14 3300005937 Ga0081455_10140085 Ga0081455_101400852 86
15 3300006237 Ga0097621_100038619 Ga0097621_1000386192 86
16 3300006871 Ga0075434_101199660 Ga0075434_1011996601 86
17 3300009094 Ga0111539_10273113 Ga0111539_102731132 86
18 3300009147 Ga0114129_12824929 Ga0114129_128249292 86
19 3300009174 Ga0105241_10043669 Ga0105241_100436692 86
20 3300010375 Ga0105239_10273783 Ga0105239_102737832 86
21 3300012510 Ga0157316_1003391 Ga0157316_10033912 86
22 3300014325 Ga0163163_10664589 Ga0163163_106645892 86
23 3300014497 Ga0182008_10573538 Ga0182008_105735382 86
24 3300014969 Ga0157376_10051798 Ga0157376_100517982 86
25 3300020082 Ga0206353_10019772 Ga0206353_100197721 86
26 3300025898 Ga0207692_10798034 Ga0207692_107980341 86
27 3300025911 Ga0207654_10051699 Ga0207654_100516992 86
28 3300025912 Ga0207707_10071510 Ga0207707_100715102 86
29 3300025915 Ga0207693_10061795 Ga0207693_100617951 86
30 3300025916 Ga0207663_10019136 Ga0207663_100191365 86
31 3300025921 Ga0207652_10069746 Ga0207652_100697462 86
32 3300025939 Ga0207665_10001983 Ga0207665_100019832 86
33 3300025944 Ga0207661_11360667 Ga0207661_113606672 86
34 3300025945 Ga0207679_10181219 Ga0207679_101812192 86
35 3300025960 Ga0207651_11981131 Ga0207651_119811312 86
36 3300025981 Ga0207640_10259968 Ga0207640_102599682 86
37 3300026067 Ga0207678_10080492 Ga0207678_100804922 86
38 3300026095 Ga0207676_10477075 Ga0207676_104770752 86
39 3300027907 Ga0207428_10352850 Ga0207428_103528502 86
40 3300027907 Ga0207428_10436726 Ga0207428_104367262 86
41 3300034816 Ga0373930_0154200 Ga0373930_0154200_289_549 86
42 3300037466 Ga0395898_1018596 Ga0395898_1018596_442_702 86
43 3300037466 Ga0395898_1444569 Ga0395898_1444569_341_601 86
44 3300038443 Ga0395901_0166266 Ga0395901_0166266_1289_1549 86
45 3300045976 Ga0466967_0323005 Ga0466967_0323005_499_759 86
46 3300048903 Ga0496100_0107149 Ga0496100_0107149_1260_1520 86
47 3300048905 Ga0496102_0332158 Ga0496102_0332158_1145_1405 86
48 3300048906 Ga0496103_0001272 Ga0496103_0001272_15261_15521 86
49 3300048907 Ga0496104_0068050 Ga0496104_0068050_2455_2715 86
50 3300048908 Ga0496105_0087274 Ga0496105_0087274_157_417 86
51 3300048911 Ga0496108_0031161 Ga0496108_0031161_2759_3019 86
52 3300048912 Ga0496109_0391846 Ga0496109_0391846_60_320 86
53 3300048913 Ga0496110_0040053 Ga0496110_0040053_1692_1952 86
54 3300048914 Ga0496111_0028098 Ga0496111_0028098_1927_2187 86
55 3300048915 Ga0496112_0140642 Ga0496112_0140642_627_887 86
56 3300048916 Ga0496113_0476688 Ga0496113_0476688_327_587 86
57 3300048916 Ga0496113_1308342 Ga0496113_1308342_21_281 86
58 3300048918 Ga0496115_0301259 Ga0496115_0301259_350_610 86
59 3300049568 Ga0501031_0791810 Ga0501031_0791810_144_404 86
60 3300049572 Ga0501036_0182990 Ga0501036_0182990_1006_1266 86
61 3300049575 Ga0501039_0288171 Ga0501039_0288171_370_630 86
62 3300049576 Ga0501040_0869225 Ga0501040_0869225_104_364 86
63 3300049577 Ga0501041_0193853 Ga0501041_0193853_365_625 86
64 3300049583 Ga0501067_0008781 Ga0501067_0008781_2981_3241 86
65 3300049583 Ga0501067_0591902 Ga0501067_0591902_114_374 86
66 3300049584 Ga0501068_1027469 Ga0501068_1027469_264_524 86
67 3300049585 Ga0501069_0006739 Ga0501069_0006739_2446_2706 86
68 3300049586 Ga0501070_0098290 Ga0501070_0098290_1410_1670 86
69 3300049587 Ga0501071_0017284 Ga0501071_0017284_2512_2772 86
70 3300049588 Ga0501072_0073843 Ga0501072_0073843_1941_2201 86
71 3300049588 Ga0501072_0255406 Ga0501072_0255406_233_493 86
72 3300049590 Ga0501074_0261882 Ga0501074_0261882_77_337 86
73 3300049591 Ga0501075_0060058 Ga0501075_0060058_875_1135 86
74 3300049741 Ga0501079_0015422 Ga0501079_0015422_1135_1395 86
75 3300049741 Ga0501079_0244225 Ga0501079_0244225_389_649 86
76 3300049743 Ga0501081_0055419 Ga0501081_0055419_2076_2336 86
77 3300049822 Ga0501035_1279037 Ga0501035_1279037_180_440 86
78 3300049824 Ga0501045_0078100 Ga0501045_0078100_1856_2116 86
79 3300050511 nmdc:mga08y16_458110_c1 nmdc:mga08y16_458110_c1_15_275 86
80 3300050511 nmdc:mga08y16_716998_c1 nmdc:mga08y16_716998_c1_313_573 86
81 3300050511 nmdc:mga08y16_759948_c1 nmdc:mga08y16_759948_c1_237_497 86
82 3300050512 nmdc:mga0n895_565935_c1 nmdc:mga0n895_565935_c1_47_307 86
83 3300050512 nmdc:mga0n895_608643_c1 nmdc:mga0n895_608643_c1_163_423 86
84 3300050512 nmdc:mga0n895_929025_c1 nmdc:mga0n895_929025_c1_475_735 86
85 3300050515 nmdc:mga0a205_1165110_c1 nmdc:mga0a205_1165110_c1_346_606 86
86 3300050515 nmdc:mga0a205_60942_c1 nmdc:mga0a205_60942_c1_141_401 86
87 3300054114 Ga0501084_0083263 Ga0501084_0083263_973_1233 86
88 3300060353 Ga0501082_0378196 Ga0501082_0378196_433_693 86
89 3300060353 Ga0501082_0897358 Ga0501082_0897358_431_691 86
90 3300061734 Ga0530510_0049813 Ga0530510_0049813_1464_1724 86
91 3300061734 Ga0530510_0058423 Ga0530510_0058423_941_1201 86
92 3300061734 Ga0530510_0711399 Ga0530510_0711399_251_511 86
93 3300005338 Ga0068868_100076443 Ga0068868_1000764433 87
94 3300005341 Ga0070691_10034986 Ga0070691_100349863 87
95 3300005341 Ga0070691_10277784 Ga0070691_102777842 87
96 3300005345 Ga0070692_10877169 Ga0070692_108771691 87
97 3300005347 Ga0070668_100012799 Ga0070668_1000127993 87
98 3300005353 Ga0070669_100220227 Ga0070669_1002202272 87
99 3300005434 Ga0070709_10602433 Ga0070709_106024331 87
100 3300005440 Ga0070705_101454682 Ga0070705_1014546821 87
101 3300005444 Ga0070694_100204639 Ga0070694_1002046392 87
102 3300005455 Ga0070663_101461948 Ga0070663_1014619482 87
103 3300005456 Ga0070678_101752876 Ga0070678_1017528761 87
104 3300005457 Ga0070662_100026481 Ga0070662_1000264815 87
105 3300005458 Ga0070681_10712138 Ga0070681_107121382 87
106 3300005459 Ga0068867_100223726 Ga0068867_1002237262 87
107 3300005459 Ga0068867_101451400 Ga0068867_1014514001 87
108 3300005536 Ga0070697_100588795 Ga0070697_1005887952 87
109 3300005545 Ga0070695_101449799 Ga0070695_1014497991 87
110 3300005546 Ga0070696_100486377 Ga0070696_1004863772 87
111 3300005549 Ga0070704_100268357 Ga0070704_1002683572 87
112 3300005549 Ga0070704_100462325 Ga0070704_1004623252 87
113 3300005549 Ga0070704_102123821 Ga0070704_1021238211 87
114 3300005563 Ga0068855_100056594 Ga0068855_1000565944 87
115 3300005563 Ga0068855_100085283 Ga0068855_1000852833 87
116 3300005578 Ga0068854_101361307 Ga0068854_1013613072 87
117 3300005718 Ga0068866_10067979 Ga0068866_100679792 87
118 3300005719 Ga0068861_100004039 Ga0068861_1000040398 87
119 3300005840 Ga0068870_11222205 Ga0068870_112222051 87
120 3300005842 Ga0068858_100883428 Ga0068858_1008834281 87
121 3300005843 Ga0068860_102427781 Ga0068860_1024277811 87
122 3300006881 Ga0068865_100159037 Ga0068865_1001590372 87
123 3300006881 Ga0068865_100818612 Ga0068865_1008186122 87
124 3300009093 Ga0105240_10268400 Ga0105240_102684002 87
125 3300009098 Ga0105245_10059662 Ga0105245_100596622 87
126 3300009098 Ga0105245_12025969 Ga0105245_120259691 87
127 3300009148 Ga0105243_10034919 Ga0105243_100349192 87
128 3300009176 Ga0105242_10220483 Ga0105242_102204832 87
129 3300009553 Ga0105249_10022281 Ga0105249_100222814 87
130 3300009553 Ga0105249_10665554 Ga0105249_106655542 87
131 3300009553 Ga0105249_12325366 Ga0105249_123253662 87
132 3300010375 Ga0105239_10292632 Ga0105239_102926322 87
133 3300013104 Ga0157370_10020774 Ga0157370_100207742 87
134 3300013105 Ga0157369_10192440 Ga0157369_101924403 87
135 3300013306 Ga0163162_10173123 Ga0163162_101731232 87
136 3300013306 Ga0163162_10530942 Ga0163162_105309422 87
137 3300013307 Ga0157372_13043469 Ga0157372_130434692 87
138 3300013308 Ga0157375_11561608 Ga0157375_115616081 87
139 3300014326 Ga0157380_11052040 Ga0157380_110520401 87
140 3300014326 Ga0157380_12369182 Ga0157380_123691822 87
141 3300014745 Ga0157377_11197990 Ga0157377_111979902 87
142 3300017792 Ga0163161_10020642 Ga0163161_100206424 87
143 3300020070 Ga0206356_11691718 Ga0206356_116917182 87
144 3300025899 Ga0207642_10106239 Ga0207642_101062392 87
145 3300025901 Ga0207688_10088948 Ga0207688_100889483 87
146 3300025912 Ga0207707_11604343 Ga0207707_116043431 87
147 3300025915 Ga0207693_10814431 Ga0207693_108144312 87
148 3300025927 Ga0207687_11117551 Ga0207687_111175512 87
149 3300025929 Ga0207664_11462055 Ga0207664_114620552 87
150 3300025933 Ga0207706_10006904 Ga0207706_100069041 87
151 3300025935 Ga0207709_10048106 Ga0207709_100481063 87
152 3300025938 Ga0207704_10335049 Ga0207704_103350492 87
153 3300025938 Ga0207704_10468823 Ga0207704_104688232 87
154 3300025944 Ga0207661_10450548 Ga0207661_104505482 87
155 3300025949 Ga0207667_10076403 Ga0207667_100764033 87
156 3300025949 Ga0207667_10166210 Ga0207667_101662103 87
157 3300025961 Ga0207712_10024008 Ga0207712_100240081 87
158 3300025972 Ga0207668_10322373 Ga0207668_103223731 87
159 3300026089 Ga0207648_10067794 Ga0207648_100677943 87
160 3300026089 Ga0207648_10981468 Ga0207648_109814681 87
161 3300026118 Ga0207675_100000792 Ga0207675_1000007924 87
162 3300026142 Ga0207698_10221785 Ga0207698_102217853 87
163 3300031731 Ga0307405_10043409 Ga0307405_100434092 87
164 3300031824 Ga0307413_10779240 Ga0307413_107792401 87
165 3300031901 Ga0307406_11723478 Ga0307406_117234782 87
166 3300031911 Ga0307412_10669810 Ga0307412_106698102 87
167 3300032002 Ga0307416_100130815 Ga0307416_1001308153 87
168 3300032002 Ga0307416_100158582 Ga0307416_1001585823 87
169 3300037312 Ga0395899_0664437 Ga0395899_0664437_181_444 87
170 3300037418 Ga0395900_0132501 Ga0395900_0132501_274_537 87
171 3300037418 Ga0395900_0505405 Ga0395900_0505405_550_813 87
172 3300037466 Ga0395898_0127401 Ga0395898_0127401_1244_1507 87
173 3300037466 Ga0395898_0139447 Ga0395898_0139447_1982_2245 87
174 3300037466 Ga0395898_0199860 Ga0395898_0199860_1355_1618 87
175 3300037466 Ga0395898_0751481 Ga0395898_0751481_79_342 87
176 3300037471 Ga0395905_0196194 Ga0395905_0196194_1246_1509 87
177 3300037471 Ga0395905_0857099 Ga0395905_0857099_134_397 87
178 3300038443 Ga0395901_0099773 Ga0395901_0099773_969_1232 87
179 3300038443 Ga0395901_0143288 Ga0395901_0143288_1780_2103 87
180 3300038443 Ga0395901_0154003 Ga0395901_0154003_1956_2219 87
181 3300038443 Ga0395901_0434011 Ga0395901_0434011_809_1072 87
182 3300044694 Ga0466963_0003907 Ga0466963_0003907_2780_3043 87
183 3300044706 Ga0466964_0371995 Ga0466964_0371995_277_540 87
184 3300044842 Ga0466957_0035500 Ga0466957_0035500_346_609 87
185 3300045836 Ga0466958_0188522 Ga0466958_0188522_237_500 87
186 3300045976 Ga0466967_0017646 Ga0466967_0017646_5002_5265 87
187 3300046491 Ga0495584_0113837 Ga0495584_0113837_933_1196 87
188 3300046539 Ga0495621_0307785 Ga0495621_0307785_83_346 87
189 3300047318 Ga0495636_0309298 Ga0495636_0309298_25_288 87
190 3300048905 Ga0496102_1118018 Ga0496102_1118018_132_395 87
191 3300048913 Ga0496110_0343280 Ga0496110_0343280_481_744 87
192 3300049569 Ga0501032_0207989 Ga0501032_0207989_818_1081 87
193 3300049572 Ga0501036_0008255 Ga0501036_0008255_5574_5837 87
194 3300049572 Ga0501036_1503353 Ga0501036_1503353_21_284 87
195 3300049573 Ga0501037_0177334 Ga0501037_0177334_514_777 87
196 3300049574 Ga0501038_0102375 Ga0501038_0102375_76_339 87
197 3300049574 Ga0501038_1087868 Ga0501038_1087868_130_393 87
198 3300049575 Ga0501039_0005748 Ga0501039_0005748_2846_3109 87
199 3300049576 Ga0501040_0014913 Ga0501040_0014913_2818_3081 87
200 3300049576 Ga0501040_0434922 Ga0501040_0434922_409_672 87
201 3300049576 Ga0501040_0543641 Ga0501040_0543641_407_670 87
202 3300049577 Ga0501041_0013301 Ga0501041_0013301_1970_2233 87
203 3300049577 Ga0501041_0355648 Ga0501041_0355648_200_463 87
204 3300049577 Ga0501041_0724316 Ga0501041_0724316_320_583 87
205 3300049578 Ga0501042_0012634 Ga0501042_0012634_3312_3575 87
206 3300049579 Ga0501043_0134523 Ga0501043_0134523_130_393 87
207 3300049580 Ga0501046_0073305 Ga0501046_0073305_979_1242 87
208 3300049582 Ga0501048_0016652 Ga0501048_0016652_1600_1863 87
209 3300049584 Ga0501068_0797315 Ga0501068_0797315_170_433 87
210 3300049585 Ga0501069_0040999 Ga0501069_0040999_1352_1615 87
211 3300049586 Ga0501070_0282188 Ga0501070_0282188_58_321 87
212 3300049587 Ga0501071_0003446 Ga0501071_0003446_4808_5071 87
213 3300049587 Ga0501071_0426790 Ga0501071_0426790_364_627 87
214 3300049588 Ga0501072_0002483 Ga0501072_0002483_8294_8557 87
215 3300049589 Ga0501073_0090545 Ga0501073_0090545_1499_1762 87
216 3300049591 Ga0501075_0016749 Ga0501075_0016749_3076_3339 87
217 3300049591 Ga0501075_0265228 Ga0501075_0265228_419_682 87
218 3300049592 Ga0501076_0007588 Ga0501076_0007588_4605_4868 87
219 3300049593 Ga0501077_0023566 Ga0501077_0023566_2713_2976 87
220 3300049741 Ga0501079_0001382 Ga0501079_0001382_8512_8775 87
221 3300049742 Ga0501080_0162035 Ga0501080_0162035_421_684 87
222 3300049743 Ga0501081_0006195 Ga0501081_0006195_1496_1759 87
223 3300049743 Ga0501081_0476230 Ga0501081_0476230_264_527 87
224 3300049822 Ga0501035_0019017 Ga0501035_0019017_6043_6306 87
225 3300049823 Ga0501044_0237734 Ga0501044_0237734_1494_1757 87
226 3300049824 Ga0501045_0026787 Ga0501045_0026787_3862_4125 87
227 3300049824 Ga0501045_0341451 Ga0501045_0341451_699_962 87
228 3300049824 Ga0501045_0661007 Ga0501045_0661007_339_602 87
229 3300053085 Ga0495619_0914415 Ga0495619_0914415_124_387 87
230 3300054114 Ga0501084_0003270 Ga0501084_0003270_4477_4740 87
231 3300054114 Ga0501084_0263187 Ga0501084_0263187_435_698 87
232 3300060353 Ga0501082_0047898 Ga0501082_0047898_2589_2852 87
233 3300061719 Ga0466962_0363666 Ga0466962_0363666_392_655 87
234 3300061734 Ga0530510_0024164 Ga0530510_0024164_1013_1276 87
235 3300061734 Ga0530510_0201631 Ga0530510_0201631_121_384 87
236 3300061734 Ga0530510_0362616 Ga0530510_0362616_793_1056 87
237 2209111006 2214844107 2213886949 88
238 3300000652 ARCol0yngRDRAFT_1001207 ARCol0yngRDRAFT_10012072 88
239 3300001978 JGI24747J21853_1052053 JGI24747J21853_10520532 88
240 3300001990 JGI24737J22298_10086399 JGI24737J22298_100863992 88
241 3300002070 JGI24750J21931_1056447 JGI24750J21931_10564471 88
242 3300002459 JGI24751J29686_10086328 JGI24751J29686_100863282 88
243 3300005327 Ga0070658_10973777 Ga0070658_109737771 88
244 3300005327 Ga0070658_11031398 Ga0070658_110313982 88
245 3300005328 Ga0070676_10262441 Ga0070676_102624412 88
246 3300005329 Ga0070683_100029646 Ga0070683_1000296462 88
247 3300005329 Ga0070683_100113027 Ga0070683_1001130272 88
248 3300005329 Ga0070683_100155888 Ga0070683_1001558882 88
249 3300005329 Ga0070683_100731772 Ga0070683_1007317721 88
250 3300005331 Ga0070670_100004293 Ga0070670_1000042932 88
251 3300005331 Ga0070670_101284636 Ga0070670_1012846362 88
252 3300005334 Ga0068869_100765152 Ga0068869_1007651522 88
253 3300005336 Ga0070680_100017076 Ga0070680_1000170764 88
254 3300005336 Ga0070680_100047883 Ga0070680_1000478832 88
255 3300005336 Ga0070680_100184404 Ga0070680_1001844042 88
256 3300005337 Ga0070682_100027482 Ga0070682_1000274823 88
257 3300005337 Ga0070682_100069359 Ga0070682_1000693592 88
258 3300005337 Ga0070682_100207939 Ga0070682_1002079392 88
259 3300005337 Ga0070682_100422299 Ga0070682_1004222992 88
260 3300005337 Ga0070682_100538241 Ga0070682_1005382412 88
261 3300005338 Ga0068868_100052357 Ga0068868_1000523573 88
262 3300005338 Ga0068868_100274197 Ga0068868_1002741972 88
263 3300005339 Ga0070660_100004020 Ga0070660_1000040206 88
264 3300005339 Ga0070660_100051687 Ga0070660_1000516872 88
265 3300005339 Ga0070660_100054676 Ga0070660_1000546762 88
266 3300005339 Ga0070660_100069690 Ga0070660_1000696903 88
267 3300005339 Ga0070660_100741137 Ga0070660_1007411372 88
268 3300005340 Ga0070689_100003774 Ga0070689_1000037742 88
269 3300005341 Ga0070691_10007080 Ga0070691_100070802 88
270 3300005341 Ga0070691_10067369 Ga0070691_100673692 88
271 3300005341 Ga0070691_10100715 Ga0070691_101007152 88
272 3300005341 Ga0070691_10201465 Ga0070691_102014651 88
273 3300005343 Ga0070687_100175273 Ga0070687_1001752732 88
274 3300005344 Ga0070661_100032624 Ga0070661_1000326242 88
275 3300005344 Ga0070661_100040181 Ga0070661_1000401812 88
276 3300005344 Ga0070661_100051438 Ga0070661_1000514382 88
277 3300005344 Ga0070661_100061220 Ga0070661_1000612203 88
278 3300005344 Ga0070661_100327878 Ga0070661_1003278781 88
279 3300005345 Ga0070692_10263196 Ga0070692_102631962 88
280 3300005345 Ga0070692_10313588 Ga0070692_103135882 88
281 3300005347 Ga0070668_100106381 Ga0070668_1001063812 88
282 3300005353 Ga0070669_101617951 Ga0070669_1016179511 88
283 3300005354 Ga0070675_100022753 Ga0070675_1000227534 88
284 3300005354 Ga0070675_100088535 Ga0070675_1000885352 88
285 3300005355 Ga0070671_100050170 Ga0070671_1000501703 88
286 3300005356 Ga0070674_100048016 Ga0070674_1000480162 88
287 3300005364 Ga0070673_100125318 Ga0070673_1001253182 88
288 3300005365 Ga0070688_100013097 Ga0070688_1000130973 88
289 3300005366 Ga0070659_100004191 Ga0070659_1000041913 88
290 3300005366 Ga0070659_100139846 Ga0070659_1001398462 88
291 3300005366 Ga0070659_100191809 Ga0070659_1001918092 88
292 3300005366 Ga0070659_100248844 Ga0070659_1002488442 88
293 3300005366 Ga0070659_100455386 Ga0070659_1004553862 88
294 3300005366 Ga0070659_100781266 Ga0070659_1007812662 88
295 3300005438 Ga0070701_10036135 Ga0070701_100361352 88
296 3300005440 Ga0070705_100124794 Ga0070705_1001247942 88
297 3300005441 Ga0070700_100022475 Ga0070700_1000224752 88
298 3300005441 Ga0070700_100183854 Ga0070700_1001838542 88
299 3300005444 Ga0070694_100378890 Ga0070694_1003788902 88
300 3300005444 Ga0070694_100510143 Ga0070694_1005101432 88
301 3300005445 Ga0070708_100026347 Ga0070708_1000263475 88
302 3300005445 Ga0070708_100543202 Ga0070708_1005432022 88
303 3300005455 Ga0070663_100377550 Ga0070663_1003775502 88
304 3300005455 Ga0070663_100745347 Ga0070663_1007453472 88
305 3300005455 Ga0070663_100851697 Ga0070663_1008516972 88
306 3300005456 Ga0070678_100113926 Ga0070678_1001139262 88
307 3300005458 Ga0070681_10004205 Ga0070681_100042054 88
308 3300005458 Ga0070681_10026421 Ga0070681_100264215 88
309 3300005458 Ga0070681_10029317 Ga0070681_100293175 88
310 3300005458 Ga0070681_10120245 Ga0070681_101202452 88
311 3300005458 Ga0070681_10133318 Ga0070681_101333182 88
312 3300005459 Ga0068867_100344255 Ga0068867_1003442552 88
313 3300005459 Ga0068867_100356219 Ga0068867_1003562192 88
314 3300005459 Ga0068867_101923455 Ga0068867_1019234552 88
315 3300005466 Ga0070685_10002617 Ga0070685_100026178 88
316 3300005466 Ga0070685_10214238 Ga0070685_102142382 88
317 3300005467 Ga0070706_100100250 Ga0070706_1001002503 88
318 3300005471 Ga0070698_100012820 Ga0070698_1000128205 88
319 3300005518 Ga0070699_100725371 Ga0070699_1007253712 88
320 3300005530 Ga0070679_100016489 Ga0070679_1000164892 88
321 3300005530 Ga0070679_100051786 Ga0070679_1000517865 88
322 3300005530 Ga0070679_100053802 Ga0070679_1000538022 88
323 3300005530 Ga0070679_100370840 Ga0070679_1003708402 88
324 3300005530 Ga0070679_100398849 Ga0070679_1003988492 88
325 3300005535 Ga0070684_100026963 Ga0070684_1000269633 88
326 3300005535 Ga0070684_100059030 Ga0070684_1000590304 88
327 3300005535 Ga0070684_100083164 Ga0070684_1000831643 88
328 3300005535 Ga0070684_101123807 Ga0070684_1011238072 88
329 3300005539 Ga0068853_100061202 Ga0068853_1000612022 88
330 3300005539 Ga0068853_100204397 Ga0068853_1002043972 88
331 3300005539 Ga0068853_100534876 Ga0068853_1005348762 88
332 3300005539 Ga0068853_100554622 Ga0068853_1005546222 88
333 3300005543 Ga0070672_100340813 Ga0070672_1003408132 88
334 3300005544 Ga0070686_100061669 Ga0070686_1000616691 88
335 3300005544 Ga0070686_101124669 Ga0070686_1011246691 88
336 3300005545 Ga0070695_100325320 Ga0070695_1003253202 88
337 3300005546 Ga0070696_100046066 Ga0070696_1000460662 88
338 3300005546 Ga0070696_100090361 Ga0070696_1000903612 88
339 3300005546 Ga0070696_100619929 Ga0070696_1006199292 88
340 3300005547 Ga0070693_100002576 Ga0070693_1000025762 88
341 3300005547 Ga0070693_100028915 Ga0070693_1000289152 88
342 3300005547 Ga0070693_100523434 Ga0070693_1005234342 88
343 3300005548 Ga0070665_100003372 Ga0070665_1000033722 88
344 3300005548 Ga0070665_100004675 Ga0070665_1000046752 88
345 3300005549 Ga0070704_100161901 Ga0070704_1001619012 88
346 3300005563 Ga0068855_100026901 Ga0068855_1000269016 88
347 3300005563 Ga0068855_100087106 Ga0068855_1000871062 88
348 3300005563 Ga0068855_100099792 Ga0068855_1000997922 88
349 3300005563 Ga0068855_100145330 Ga0068855_1001453303 88
350 3300005563 Ga0068855_100383957 Ga0068855_1003839572 88
351 3300005564 Ga0070664_100056774 Ga0070664_1000567742 88
352 3300005564 Ga0070664_100569298 Ga0070664_1005692982 88
353 3300005564 Ga0070664_100632732 Ga0070664_1006327322 88
354 3300005577 Ga0068857_100052743 Ga0068857_1000527431 88
355 3300005577 Ga0068857_100081880 Ga0068857_1000818802 88
356 3300005577 Ga0068857_100274491 Ga0068857_1002744912 88
357 3300005577 Ga0068857_101073422 Ga0068857_1010734222 88
358 3300005578 Ga0068854_100057292 Ga0068854_1000572923 88
359 3300005578 Ga0068854_100069149 Ga0068854_1000691492 88
360 3300005578 Ga0068854_100616682 Ga0068854_1006166822 88
361 3300005614 Ga0068856_100030809 Ga0068856_1000308092 88
362 3300005614 Ga0068856_100208424 Ga0068856_1002084242 88
363 3300005614 Ga0068856_100491018 Ga0068856_1004910182 88
364 3300005614 Ga0068856_101498064 Ga0068856_1014980642 88
365 3300005614 Ga0068856_101982363 Ga0068856_1019823632 88
366 3300005615 Ga0070702_100030952 Ga0070702_1000309524 88
367 3300005615 Ga0070702_100185144 Ga0070702_1001851442 88
368 3300005616 Ga0068852_100052926 Ga0068852_1000529262 88
369 3300005616 Ga0068852_100404257 Ga0068852_1004042572 88
370 3300005616 Ga0068852_100958545 Ga0068852_1009585452 88
371 3300005616 Ga0068852_101491142 Ga0068852_1014911422 88
372 3300005617 Ga0068859_100742505 Ga0068859_1007425052 88
373 3300005718 Ga0068866_10616268 Ga0068866_106162682 88
374 3300005719 Ga0068861_100453555 Ga0068861_1004535552 88
375 3300005834 Ga0068851_10228045 Ga0068851_102280452 88
376 3300005840 Ga0068870_10434679 Ga0068870_104346792 88
377 3300005840 Ga0068870_10470001 Ga0068870_104700012 88
378 3300005840 Ga0068870_10714179 Ga0068870_107141792 88
379 3300005840 Ga0068870_10818601 Ga0068870_108186012 88
380 3300005841 Ga0068863_100896296 Ga0068863_1008962961 88
381 3300005843 Ga0068860_102257699 Ga0068860_1022576991 88
382 3300005844 Ga0068862_100087547 Ga0068862_1000875472 88
383 3300005937 Ga0081455_10006006 Ga0081455_1000600610 88
384 3300005983 Ga0081540_1002188 Ga0081540_100218816 88
385 3300005983 Ga0081540_1030610 Ga0081540_10306102 88
386 3300006038 Ga0075365_10194479 Ga0075365_101944792 88
387 3300006048 Ga0075363_100229734 Ga0075363_1002297342 88
388 3300006058 Ga0075432_10000461 Ga0075432_100004615 88
389 3300006058 Ga0075432_10018005 Ga0075432_100180053 88
390 3300006173 Ga0070716_101119217 Ga0070716_1011192172 88
391 3300006178 Ga0075367_10027362 Ga0075367_100273622 88
392 3300006844 Ga0075428_100002927 Ga0075428_1000029274 88
393 3300006844 Ga0075428_100056461 Ga0075428_1000564612 88
394 3300006844 Ga0075428_100116177 Ga0075428_1001161773 88
395 3300006844 Ga0075428_100216755 Ga0075428_1002167552 88
396 3300006847 Ga0075431_100108803 Ga0075431_1001088033 88
397 3300006847 Ga0075431_100295335 Ga0075431_1002953352 88
398 3300006852 Ga0075433_10035247 Ga0075433_100352474 88
399 3300006852 Ga0075433_10224985 Ga0075433_102249852 88
400 3300006852 Ga0075433_11465387 Ga0075433_114653872 88
401 3300006871 Ga0075434_100057148 Ga0075434_1000571482 88
402 3300006871 Ga0075434_100083197 Ga0075434_1000831972 88
403 3300006871 Ga0075434_100417130 Ga0075434_1004171302 88
404 3300006880 Ga0075429_100054406 Ga0075429_1000544062 88
405 3300006880 Ga0075429_100641003 Ga0075429_1006410032 88
406 3300006881 Ga0068865_100039816 Ga0068865_1000398163 88
407 3300006881 Ga0068865_100083672 Ga0068865_1000836722 88
408 3300006881 Ga0068865_101348879 Ga0068865_1013488792 88
409 3300006914 Ga0075436_100122633 Ga0075436_1001226332 88
410 3300006914 Ga0075436_100779747 Ga0075436_1007797471 88
411 3300006931 Ga0097620_100742438 Ga0097620_1007424382 88
412 3300007076 Ga0075435_100011630 Ga0075435_1000116302 88
413 3300007076 Ga0075435_100083320 Ga0075435_1000833202 88
414 3300007076 Ga0075435_100246405 Ga0075435_1002464052 88
415 3300007076 Ga0075435_101050587 Ga0075435_1010505872 88
416 3300009036 Ga0105244_10555514 Ga0105244_105555142 88
417 3300009093 Ga0105240_10071711 Ga0105240_100717112 88
418 3300009093 Ga0105240_10424666 Ga0105240_104246662 88
419 3300009093 Ga0105240_11454002 Ga0105240_114540022 88
420 3300009094 Ga0111539_10000483 Ga0111539_1000048318 88
421 3300009094 Ga0111539_10004184 Ga0111539_100041845 88
422 3300009094 Ga0111539_10164031 Ga0111539_101640312 88
423 3300009098 Ga0105245_10001379 Ga0105245_1000137918 88
424 3300009098 Ga0105245_10020869 Ga0105245_100208695 88
425 3300009098 Ga0105245_10108014 Ga0105245_101080142 88
426 3300009098 Ga0105245_10275884 Ga0105245_102758842 88
427 3300009147 Ga0114129_10026232 Ga0114129_100262322 88
428 3300009147 Ga0114129_10517947 Ga0114129_105179472 88
429 3300009147 Ga0114129_11111957 Ga0114129_111119572 88
430 3300009148 Ga0105243_10075909 Ga0105243_100759092 88
431 3300009174 Ga0105241_10279762 Ga0105241_102797622 88
432 3300009174 Ga0105241_10872022 Ga0105241_108720222 88
433 3300009176 Ga0105242_10343508 Ga0105242_103435081 88
434 3300009177 Ga0105248_10085552 Ga0105248_100855523 88
435 3300009545 Ga0105237_10022728 Ga0105237_100227282 88
436 3300009545 Ga0105237_10150488 Ga0105237_101504882 88
437 3300009545 Ga0105237_12424549 Ga0105237_124245492 88
438 3300009551 Ga0105238_10028446 Ga0105238_100284463 88
439 3300009551 Ga0105238_10057436 Ga0105238_100574361 88
440 3300009551 Ga0105238_10719059 Ga0105238_107190592 88
441 3300009553 Ga0105249_10136595 Ga0105249_101365952 88
442 3300009553 Ga0105249_12774164 Ga0105249_127741642 88
443 3300010375 Ga0105239_10151122 Ga0105239_101511222 88
444 3300010375 Ga0105239_10180465 Ga0105239_101804653 88
445 3300010375 Ga0105239_10882106 Ga0105239_108821062 88
446 3300010375 Ga0105239_13214856 Ga0105239_132148562 88
447 3300011119 Ga0105246_10015407 Ga0105246_100154072 88
448 3300011119 Ga0105246_10102170 Ga0105246_101021703 88
449 3300011119 Ga0105246_10731582 Ga0105246_107315822 88
450 3300011119 Ga0105246_11710392 Ga0105246_117103921 88
451 3300013100 Ga0157373_10010162 Ga0157373_100101623 88
452 3300013100 Ga0157373_10178559 Ga0157373_101785592 88
453 3300013100 Ga0157373_10309800 Ga0157373_103098002 88
454 3300013100 Ga0157373_10448377 Ga0157373_104483771 88
455 3300013100 Ga0157373_11293122 Ga0157373_112931221 88
456 3300013102 Ga0157371_10251315 Ga0157371_102513152 88
457 3300013102 Ga0157371_10568442 Ga0157371_105684422 88
458 3300013104 Ga0157370_10020350 Ga0157370_100203505 88
459 3300013104 Ga0157370_10148352 Ga0157370_101483523 88
460 3300013104 Ga0157370_10353642 Ga0157370_103536422 88
461 3300013105 Ga0157369_10015314 Ga0157369_100153146 88
462 3300013105 Ga0157369_10051364 Ga0157369_100513643 88
463 3300013105 Ga0157369_10778406 Ga0157369_107784062 88
464 3300013105 Ga0157369_11614538 Ga0157369_116145381 88
465 3300013296 Ga0157374_10262783 Ga0157374_102627832 88
466 3300013296 Ga0157374_11099496 Ga0157374_110994961 88
467 3300013296 Ga0157374_11705925 Ga0157374_117059252 88
468 3300013297 Ga0157378_11120696 Ga0157378_111206962 88
469 3300013306 Ga0163162_10122856 Ga0163162_101228562 88
470 3300013307 Ga0157372_10007863 Ga0157372_100078633 88
471 3300013307 Ga0157372_10119843 Ga0157372_101198431 88
472 3300013307 Ga0157372_10437467 Ga0157372_104374671 88
473 3300013307 Ga0157372_11594983 Ga0157372_115949832 88
474 3300013307 Ga0157372_12148938 Ga0157372_121489382 88
475 3300013308 Ga0157375_10050701 Ga0157375_100507012 88
476 3300013308 Ga0157375_12222052 Ga0157375_122220522 88
477 3300014325 Ga0163163_10061159 Ga0163163_100611592 88
478 3300014325 Ga0163163_10190410 Ga0163163_101904102 88
479 3300014325 Ga0163163_10240064 Ga0163163_102400642 88
480 3300014325 Ga0163163_13284084 Ga0163163_132840842 88
481 3300014497 Ga0182008_10378925 Ga0182008_103789252 88
482 3300014745 Ga0157377_10052985 Ga0157377_100529852 88
483 3300014745 Ga0157377_10068182 Ga0157377_100681822 88
484 3300014745 Ga0157377_10165281 Ga0157377_101652812 88
485 3300014969 Ga0157376_10703166 Ga0157376_107031662 88
486 3300014969 Ga0157376_11033325 Ga0157376_110333252 88
487 3300017792 Ga0163161_10101804 Ga0163161_101018042 88
488 3300020069 Ga0197907_10381642 Ga0197907_103816422 88
489 3300020070 Ga0206356_10893813 Ga0206356_108938131 88
490 3300020081 Ga0206354_10655524 Ga0206354_106555243 88
491 3300020081 Ga0206354_11064529 Ga0206354_110645292 88
492 3300020082 Ga0206353_10184386 Ga0206353_101843862 88
493 3300020082 Ga0206353_10588121 Ga0206353_105881212 88
494 3300020082 Ga0206353_11289376 Ga0206353_112893761 88
495 3300022467 Ga0224712_10285904 Ga0224712_102859042 88
496 3300025898 Ga0207692_10571233 Ga0207692_105712332 88
497 3300025901 Ga0207688_10029329 Ga0207688_100293292 88
498 3300025906 Ga0207699_10237408 Ga0207699_102374082 88
499 3300025907 Ga0207645_10034937 Ga0207645_100349372 88
500 3300025908 Ga0207643_10001826 Ga0207643_100018264 88
501 3300025908 Ga0207643_10046142 Ga0207643_100461422 88
502 3300025909 Ga0207705_10027534 Ga0207705_100275344 88
503 3300025909 Ga0207705_10129551 Ga0207705_101295512 88
504 3300025910 Ga0207684_10062371 Ga0207684_100623712 88
505 3300025910 Ga0207684_10190423 Ga0207684_101904232 88
506 3300025911 Ga0207654_10154676 Ga0207654_101546761 88
507 3300025911 Ga0207654_10566411 Ga0207654_105664112 88
508 3300025912 Ga0207707_10054970 Ga0207707_100549704 88
509 3300025912 Ga0207707_10072380 Ga0207707_100723804 88
510 3300025912 Ga0207707_10105283 Ga0207707_101052832 88
511 3300025912 Ga0207707_10251253 Ga0207707_102512532 88
512 3300025913 Ga0207695_10192103 Ga0207695_101921032 88
513 3300025913 Ga0207695_11129340 Ga0207695_111293401 88
514 3300025914 Ga0207671_10151354 Ga0207671_101513542 88
515 3300025914 Ga0207671_10153650 Ga0207671_101536502 88
516 3300025914 Ga0207671_11082927 Ga0207671_110829271 88
517 3300025917 Ga0207660_10032133 Ga0207660_100321332 88
518 3300025917 Ga0207660_10035433 Ga0207660_100354332 88
519 3300025917 Ga0207660_10184149 Ga0207660_101841492 88
520 3300025917 Ga0207660_10195234 Ga0207660_101952343 88
521 3300025918 Ga0207662_10036660 Ga0207662_100366602 88
522 3300025919 Ga0207657_10000467 Ga0207657_1000046728 88
523 3300025919 Ga0207657_10000731 Ga0207657_100007316 88
524 3300025919 Ga0207657_10033593 Ga0207657_100335932 88
525 3300025919 Ga0207657_10072051 Ga0207657_100720513 88
526 3300025919 Ga0207657_10170245 Ga0207657_101702452 88
527 3300025919 Ga0207657_10184231 Ga0207657_101842312 88
528 3300025919 Ga0207657_10500669 Ga0207657_105006692 88
529 3300025920 Ga0207649_10014002 Ga0207649_100140024 88
530 3300025920 Ga0207649_10067545 Ga0207649_100675452 88
531 3300025920 Ga0207649_10201225 Ga0207649_102012252 88
532 3300025920 Ga0207649_10291502 Ga0207649_102915022 88
533 3300025921 Ga0207652_10029820 Ga0207652_100298202 88
534 3300025921 Ga0207652_10047514 Ga0207652_100475144 88
535 3300025921 Ga0207652_10071978 Ga0207652_100719782 88
536 3300025921 Ga0207652_10113398 Ga0207652_101133982 88
537 3300025921 Ga0207652_10191399 Ga0207652_101913992 88
538 3300025921 Ga0207652_10200392 Ga0207652_102003922 88
539 3300025921 Ga0207652_10360937 Ga0207652_103609372 88
540 3300025922 Ga0207646_10475425 Ga0207646_104754252 88
541 3300025923 Ga0207681_10427786 Ga0207681_104277861 88
542 3300025924 Ga0207694_10046466 Ga0207694_100464663 88
543 3300025924 Ga0207694_10143163 Ga0207694_101431632 88
544 3300025924 Ga0207694_10819375 Ga0207694_108193752 88
545 3300025925 Ga0207650_10475642 Ga0207650_104756422 88
546 3300025926 Ga0207659_10077356 Ga0207659_100773562 88
547 3300025927 Ga0207687_10039162 Ga0207687_100391622 88
548 3300025927 Ga0207687_10499823 Ga0207687_104998232 88
549 3300025931 Ga0207644_10151842 Ga0207644_101518422 88
550 3300025932 Ga0207690_10026602 Ga0207690_100266023 88
551 3300025932 Ga0207690_10264722 Ga0207690_102647222 88
552 3300025932 Ga0207690_11583860 Ga0207690_115838602 88
553 3300025934 Ga0207686_10257160 Ga0207686_102571602 88
554 3300025935 Ga0207709_10570505 Ga0207709_105705052 88
555 3300025937 Ga0207669_10005301 Ga0207669_100053013 88
556 3300025937 Ga0207669_10099012 Ga0207669_100990122 88
557 3300025938 Ga0207704_10007727 Ga0207704_100077274 88
558 3300025939 Ga0207665_10395148 Ga0207665_103951481 88
559 3300025939 Ga0207665_10600325 Ga0207665_106003252 88
560 3300025941 Ga0207711_10485872 Ga0207711_104858722 88
561 3300025942 Ga0207689_10027077 Ga0207689_100270772 88
562 3300025942 Ga0207689_10131692 Ga0207689_101316922 88
563 3300025942 Ga0207689_10302189 Ga0207689_103021892 88
564 3300025942 Ga0207689_10339157 Ga0207689_103391571 88
565 3300025944 Ga0207661_10219589 Ga0207661_102195892 88
566 3300025944 Ga0207661_10237678 Ga0207661_102376782 88
567 3300025944 Ga0207661_11184357 Ga0207661_111843571 88
568 3300025944 Ga0207661_11381924 Ga0207661_113819242 88
569 3300025944 Ga0207661_11748784 Ga0207661_117487842 88
570 3300025944 Ga0207661_11921883 Ga0207661_119218831 88
571 3300025945 Ga0207679_10228018 Ga0207679_102280183 88
572 3300025945 Ga0207679_10702118 Ga0207679_107021182 88
573 3300025945 Ga0207679_11234490 Ga0207679_112344902 88
574 3300025949 Ga0207667_10047992 Ga0207667_100479922 88
575 3300025949 Ga0207667_10055691 Ga0207667_100556913 88
576 3300025949 Ga0207667_10138219 Ga0207667_101382193 88
577 3300025949 Ga0207667_10334528 Ga0207667_103345282 88
578 3300025949 Ga0207667_12145574 Ga0207667_121455741 88
579 3300025960 Ga0207651_10100351 Ga0207651_101003512 88
580 3300025961 Ga0207712_10033899 Ga0207712_100338993 88
581 3300025972 Ga0207668_10098019 Ga0207668_100980192 88
582 3300025972 Ga0207668_10118821 Ga0207668_101188212 88
583 3300025981 Ga0207640_10075865 Ga0207640_100758652 88
584 3300025981 Ga0207640_10082353 Ga0207640_100823533 88
585 3300026041 Ga0207639_10083877 Ga0207639_100838772 88
586 3300026067 Ga0207678_11013350 Ga0207678_110133501 88
587 3300026075 Ga0207708_10011473 Ga0207708_100114735 88
588 3300026075 Ga0207708_10037886 Ga0207708_100378864 88
589 3300026075 Ga0207708_10209939 Ga0207708_102099392 88
590 3300026075 Ga0207708_10275707 Ga0207708_102757072 88
591 3300026078 Ga0207702_10256927 Ga0207702_102569272 88
592 3300026078 Ga0207702_10804426 Ga0207702_108044262 88
593 3300026088 Ga0207641_10803993 Ga0207641_108039932 88
594 3300026089 Ga0207648_10314967 Ga0207648_103149672 88
595 3300026089 Ga0207648_10631573 Ga0207648_106315732 88
596 3300026116 Ga0207674_10017840 Ga0207674_100178402 88
597 3300026116 Ga0207674_10224371 Ga0207674_102243712 88
598 3300026116 Ga0207674_10669002 Ga0207674_106690022 88
599 3300026118 Ga0207675_100142480 Ga0207675_1001424802 88
600 3300026121 Ga0207683_10017553 Ga0207683_100175534 88
601 3300026121 Ga0207683_10026950 Ga0207683_100269503 88
602 3300026142 Ga0207698_10031836 Ga0207698_100318362 88
603 3300026142 Ga0207698_10054316 Ga0207698_100543162 88
604 3300026142 Ga0207698_11262251 Ga0207698_112622512 88
605 3300027695 Ga0209966_1109360 Ga0209966_11093601 88
606 3300027907 Ga0207428_10000196 Ga0207428_1000019673 88
607 3300027907 Ga0207428_10023492 Ga0207428_100234922 88
608 3300027907 Ga0207428_10038882 Ga0207428_100388822 88
609 3300027907 Ga0207428_10123914 Ga0207428_101239142 88
610 3300028379 Ga0268266_10134451 Ga0268266_101344511 88
611 3300028379 Ga0268266_10693120 Ga0268266_106931202 88
612 3300028380 Ga0268265_10113510 Ga0268265_101135102 88
613 3300028380 Ga0268265_10380175 Ga0268265_103801752 88
614 3300028381 Ga0268264_10898715 Ga0268264_108987152 88
615 3300028381 Ga0268264_11594476 Ga0268264_115944761 88
616 3300031995 Ga0307409_100861911 Ga0307409_1008619112 88
617 3300034957 Ga0373938_0020233 Ga0373938_0020233_612_878 88
618 3300035090 Ga0373949_0120091 Ga0373949_0120091_269_535 88
619 3300035090 Ga0373949_0233749 Ga0373949_0233749_103_375 88
620 3300035092 Ga0373952_0210989 Ga0373952_0210989_37_309 88
621 3300035112 Ga0373932_0235368 Ga0373932_0235368_27_293 88
622 3300035113 Ga0373936_0069926 Ga0373936_0069926_379_645 88
623 3300035114 Ga0373939_0013189 Ga0373939_0013189_1442_1714 88
624 3300035116 Ga0373945_0009560 Ga0373945_0009560_1094_1360 88
625 3300035116 Ga0373945_0177961 Ga0373945_0177961_74_340 88
626 3300035121 Ga0373960_0021450 Ga0373960_0021450_523_795 88
627 3300035170 Ga0373943_0010858 Ga0373943_0010858_3453_3719 88
628 3300035170 Ga0373943_0092909 Ga0373943_0092909_1282_1548 88
629 3300035171 Ga0373946_0763483 Ga0373946_0763483_130_396 88
630 3300035691 Ga0373931_0375379 Ga0373931_0375379_437_709 88
631 3300035692 Ga0373935_0054335 Ga0373935_0054335_567_833 88
632 3300035692 Ga0373935_0075407 Ga0373935_0075407_1667_1933 88
633 3300035725 Ga0373947_0000533 Ga0373947_0000533_5984_6250 88
634 3300035725 Ga0373947_0007052 Ga0373947_0007052_4757_5023 88
635 3300037068 Ga0373925_0004302 Ga0373925_0004302_5789_6055 88
636 3300037068 Ga0373925_0005142 Ga0373925_0005142_7862_8128 88
637 3300037312 Ga0395899_0019101 Ga0395899_0019101_2375_2647 88
638 3300037312 Ga0395899_0103369 Ga0395899_0103369_1558_1824 88
639 3300037312 Ga0395899_0342688 Ga0395899_0342688_176_442 88
640 3300037418 Ga0395900_0002857 Ga0395900_0002857_16283_16549 88
641 3300037418 Ga0395900_0007033 Ga0395900_0007033_7315_7587 88
642 3300037418 Ga0395900_0024664 Ga0395900_0024664_4077_4343 88
643 3300037418 Ga0395900_0223612 Ga0395900_0223612_129_395 88
644 3300037418 Ga0395900_0496441 Ga0395900_0496441_348_614 88
645 3300037418 Ga0395900_0585983 Ga0395900_0585983_481_747 88
646 3300037418 Ga0395900_1794388 Ga0395900_1794388_195_464 88
647 3300037466 Ga0395898_0005912 Ga0395898_0005912_2304_2570 88
648 3300037466 Ga0395898_0049255 Ga0395898_0049255_3713_3979 88
649 3300037466 Ga0395898_0119559 Ga0395898_0119559_1774_2040 88
650 3300037466 Ga0395898_0210539 Ga0395898_0210539_14_286 88
651 3300037466 Ga0395898_0244486 Ga0395898_0244486_991_1257 88
652 3300037466 Ga0395898_1399223 Ga0395898_1399223_306_572 88
653 3300037471 Ga0395905_0000568 Ga0395905_0000568_30559_30825 88
654 3300037471 Ga0395905_0074777 Ga0395905_0074777_764_1036 88
655 3300037471 Ga0395905_0155309 Ga0395905_0155309_997_1263 88
656 3300037471 Ga0395905_0272235 Ga0395905_0272235_833_1099 88
657 3300037471 Ga0395905_0799707 Ga0395905_0799707_156_422 88
658 3300037853 Ga0436364_0135606 Ga0436364_0135606_130_396 88
659 3300038443 Ga0395901_0001508 Ga0395901_0001508_3379_3645 88
660 3300038443 Ga0395901_0001844 Ga0395901_0001844_1446_1718 88
661 3300038443 Ga0395901_0020113 Ga0395901_0020113_3806_4072 88
662 3300038443 Ga0395901_0022801 Ga0395901_0022801_4705_4971 88
663 3300038443 Ga0395901_0273538 Ga0395901_0273538_176_442 88
664 3300038443 Ga0395901_1552502 Ga0395901_1552502_287_553 88
665 3300038443 Ga0395901_1718000 Ga0395901_1718000_266_532 88
666 3300039437 Ga0436365_1360505 Ga0436365_1360505_4094_4360 88
667 3300039450 Ga0436363_1283513 Ga0436363_1283513_851_1117 88
668 3300041459 Ga0451800_1206920 Ga0451800_1206920_422_697 88
669 3300041498 Ga0451841_0962610 Ga0451841_0962610_521_787 88
670 3300041512 Ga0451853_3046892 Ga0451853_3046892_518_787 88
671 3300042005 Ga0439448_0036216 Ga0439448_0036216_80_346 88
672 3300042005 Ga0439448_0050431 Ga0439448_0050431_124_390 88
673 3300042008 Ga0439450_191670 Ga0439450_191670_207_479 88
674 3300042008 Ga0439450_214576 Ga0439450_214576_48_314 88
675 3300042157 Ga0439458_0024941 Ga0439458_0024941_779_1051 88
676 3300042438 Ga0439459_0008300 Ga0439459_0008300_619_891 88
677 3300042461 Ga0439460_0302318 Ga0439460_0302318_15_287 88
678 3300044683 Ga0466965_0213282 Ga0466965_0213282_524_793 88
679 3300044683 Ga0466965_0556251 Ga0466965_0556251_71_337 88
680 3300044684 Ga0466966_0012700 Ga0466966_0012700_1408_1674 88
681 3300044693 Ga0466961_0062856 Ga0466961_0062856_56_322 88
682 3300044693 Ga0466961_0222985 Ga0466961_0222985_366_638 88
683 3300044694 Ga0466963_0000743 Ga0466963_0000743_7804_8070 88
684 3300044694 Ga0466963_0011801 Ga0466963_0011801_3817_4095 88
685 3300044694 Ga0466963_0016083 Ga0466963_0016083_1983_2255 88
686 3300044694 Ga0466963_0702603 Ga0466963_0702603_361_630 88
687 3300044706 Ga0466964_0057077 Ga0466964_0057077_665_931 88
688 3300044706 Ga0466964_0288249 Ga0466964_0288249_219_485 88
689 3300044719 Ga0466971_0253830 Ga0466971_0253830_438_707 88
690 3300044735 Ga0466968_0102500 Ga0466968_0102500_978_1250 88
691 3300044842 Ga0466957_0037750 Ga0466957_0037750_637_903 88
692 3300044842 Ga0466957_1166679 Ga0466957_1166679_223_492 88
693 3300044842 Ga0466957_1365385 Ga0466957_1365385_194_460 88
694 3300044901 Ga0466960_0059143 Ga0466960_0059143_894_1160 88
695 3300044901 Ga0466960_0199030 Ga0466960_0199030_60_326 88
696 3300044901 Ga0466960_0404126 Ga0466960_0404126_286_552 88
697 3300045049 Ga0466959_0116832 Ga0466959_0116832_227_493 88
698 3300045049 Ga0466959_0117305 Ga0466959_0117305_532_801 88
699 3300045049 Ga0466959_0414820 Ga0466959_0414820_50_322 88
700 3300045049 Ga0466959_0470427 Ga0466959_0470427_32_304 88
701 3300045051 Ga0451576_0076759 Ga0451576_0076759_2668_2934 88
702 3300045051 Ga0451576_0799670 Ga0451576_0799670_281_553 88
703 3300045051 Ga0451576_1672917 Ga0451576_1672917_361_627 88
704 3300045836 Ga0466958_0215460 Ga0466958_0215460_259_528 88
705 3300045836 Ga0466958_0735974 Ga0466958_0735974_56_322 88
706 3300045976 Ga0466967_0025753 Ga0466967_0025753_1736_2002 88
707 3300045976 Ga0466967_0086552 Ga0466967_0086552_1084_1356 88
708 3300045976 Ga0466967_0150849 Ga0466967_0150849_729_1001 88
709 3300045976 Ga0466967_0252259 Ga0466967_0252259_463_732 88
710 3300045976 Ga0466967_0466491 Ga0466967_0466491_793_1071 88
711 3300045976 Ga0466967_0563334 Ga0466967_0563334_557_829 88
712 3300045976 Ga0466967_1419134 Ga0466967_1419134_365_637 88
713 3300045976 Ga0466967_1680503 Ga0466967_1680503_249_521 88
714 3300046452 Ga0495617_196152 Ga0495617_196152_220_486 88
715 3300046453 Ga0495627_209246 Ga0495627_209246_213_482 88
716 3300046454 Ga0495592_0358570 Ga0495592_0358570_206_478 88
717 3300046455 Ga0495603_0001442 Ga0495603_0001442_2547_2813 88
718 3300046457 Ga0495590_0161515 Ga0495590_0161515_364_633 88
719 3300046458 Ga0495591_093021 Ga0495591_093021_439_705 88
720 3300046459 Ga0495629_0281263 Ga0495629_0281263_613_879 88
721 3300046460 Ga0495638_0220396 Ga0495638_0220396_279_545 88
722 3300046461 Ga0495641_0001137 Ga0495641_0001137_5524_5790 88
723 3300046462 Ga0495651_0540941 Ga0495651_0540941_225_497 88
724 3300046463 Ga0495653_0319535 Ga0495653_0319535_216_488 88
725 3300046472 Ga0495580_0024689 Ga0495580_0024689_3780_4046 88
726 3300046473 Ga0495582_0508520 Ga0495582_0508520_414_680 88
727 3300046474 Ga0495605_0152583 Ga0495605_0152583_357_626 88
728 3300046474 Ga0495605_0229594 Ga0495605_0229594_402_668 88
729 3300046475 Ga0495639_0092991 Ga0495639_0092991_982_1248 88
730 3300046477 Ga0495664_0871479 Ga0495664_0871479_101_373 88
731 3300046491 Ga0495584_0031556 Ga0495584_0031556_947_1216 88
732 3300046491 Ga0495584_0102989 Ga0495584_0102989_1116_1382 88
733 3300046491 Ga0495584_0147462 Ga0495584_0147462_583_849 88
734 3300046492 Ga0495585_0073866 Ga0495585_0073866_1567_1836 88
735 3300046500 Ga0495596_0148636 Ga0495596_0148636_46_312 88
736 3300046501 Ga0495607_0099665 Ga0495607_0099665_1264_1530 88
737 3300046501 Ga0495607_0116113 Ga0495607_0116113_770_1039 88
738 3300046511 Ga0495608_0118464 Ga0495608_0118464_708_980 88
739 3300046513 Ga0495616_0062508 Ga0495616_0062508_548_814 88
740 3300046514 Ga0495618_0576325 Ga0495618_0576325_171_443 88
741 3300046516 Ga0495628_0089479 Ga0495628_0089479_377_649 88
742 3300046517 Ga0495630_0241726 Ga0495630_0241726_698_964 88
743 3300046517 Ga0495630_0329553 Ga0495630_0329553_411_677 88
744 3300046520 Ga0495637_0072954 Ga0495637_0072954_208_474 88
745 3300046522 Ga0495643_0115895 Ga0495643_0115895_496_762 88
746 3300046523 Ga0495644_0040461 Ga0495644_0040461_417_683 88
747 3300046523 Ga0495644_0361866 Ga0495644_0361866_23_292 88
748 3300046525 Ga0495663_0039737 Ga0495663_0039737_419_688 88
749 3300046526 Ga0495666_0030512 Ga0495666_0030512_1159_1425 88
750 3300046529 Ga0495652_0060460 Ga0495652_0060460_1030_1302 88
751 3300046530 Ga0495654_0054023 Ga0495654_0054023_1100_1369 88
752 3300046533 Ga0495640_0365558 Ga0495640_0365558_352_624 88
753 3300046535 Ga0495586_0011957 Ga0495586_0011957_2964_3230 88
754 3300046537 Ga0495598_0002624 Ga0495598_0002624_1240_1509 88
755 3300046538 Ga0495609_0029943 Ga0495609_0029943_222_488 88
756 3300046538 Ga0495609_0070700 Ga0495609_0070700_169_438 88
757 3300046539 Ga0495621_0091796 Ga0495621_0091796_858_1124 88
758 3300046557 Ga0495622_0178440 Ga0495622_0178440_538_804 88
759 3300046558 Ga0495633_0367589 Ga0495633_0367589_92_361 88
760 3300046558 Ga0495633_0490530 Ga0495633_0490530_38_304 88
761 3300046559 Ga0495667_0607962 Ga0495667_0607962_364_636 88
762 3300046615 Ga0495656_0020197 Ga0495656_0020197_957_1226 88
763 3300046615 Ga0495656_0468026 Ga0495656_0468026_230_496 88
764 3300046616 Ga0495668_0115958 Ga0495668_0115958_286_555 88
765 3300046616 Ga0495668_0842471 Ga0495668_0842471_15_281 88
766 3300046642 Ga0495634_0270683 Ga0495634_0270683_325_591 88
767 3300046648 Ga0495611_0165473 Ga0495611_0165473_590_859 88
768 3300046664 Ga0495659_0034272 Ga0495659_0034272_280_549 88
769 3300046664 Ga0495659_0054242 Ga0495659_0054242_547_813 88
770 3300046675 Ga0495657_0391294 Ga0495657_0391294_231_503 88
771 3300046678 Ga0495599_0418419 Ga0495599_0418419_53_325 88
772 3300046683 Ga0495658_0090430 Ga0495658_0090430_495_761 88
773 3300046683 Ga0495658_0236207 Ga0495658_0236207_508_774 88
774 3300046689 Ga0495613_0029948 Ga0495613_0029948_794_1060 88
775 3300046691 Ga0495670_0076392 Ga0495670_0076392_14_280 88
776 3300046691 Ga0495670_0182764 Ga0495670_0182764_93_362 88
777 3300046692 Ga0495671_0023230 Ga0495671_0023230_2058_2324 88
778 3300046692 Ga0495671_0240615 Ga0495671_0240615_574_843 88
779 3300046794 Ga0495589_0091290 Ga0495589_0091290_1051_1320 88
780 3300046810 Ga0495660_0052786 Ga0495660_0052786_298_564 88
781 3300047315 Ga0495581_0449843 Ga0495581_0449843_448_714 88
782 3300047318 Ga0495636_0350394 Ga0495636_0350394_223_489 88
783 3300047319 Ga0495674_0037327 Ga0495674_0037327_1771_2043 88
784 3300047319 Ga0495674_0057423 Ga0495674_0057423_2772_3038 88
785 3300047321 Ga0495676_0004439 Ga0495676_0004439_3547_3813 88
786 3300047321 Ga0495676_0152464 Ga0495676_0152464_860_1126 88
787 3300047323 Ga0495683_0134032 Ga0495683_0134032_76_342 88
788 3300047445 Ga0495677_0102244 Ga0495677_0102244_801_1070 88
789 3300047446 Ga0495679_077589 Ga0495679_077589_565_831 88
790 3300047447 Ga0495685_060001 Ga0495685_060001_292_561 88
791 3300047471 Ga0495684_0239030 Ga0495684_0239030_691_963 88
792 3300048089 Ga0495614_0185542 Ga0495614_0185542_143_409 88
793 3300048090 Ga0495615_0040955 Ga0495615_0040955_755_1024 88
794 3300048090 Ga0495615_0158045 Ga0495615_0158045_320_586 88
795 3300048091 Ga0495626_0406239 Ga0495626_0406239_79_345 88
796 3300048903 Ga0496100_0546977 Ga0496100_0546977_444_710 88
797 3300048905 Ga0496102_0069469 Ga0496102_0069469_1897_2163 88
798 3300048907 Ga0496104_0145904 Ga0496104_0145904_685_951 88
799 3300048908 Ga0496105_0040024 Ga0496105_0040024_2202_2468 88
800 3300048911 Ga0496108_0030725 Ga0496108_0030725_1376_1642 88
801 3300048911 Ga0496108_0080685 Ga0496108_0080685_2203_2475 88
802 3300048912 Ga0496109_0017493 Ga0496109_0017493_1693_1965 88
803 3300048912 Ga0496109_0045948 Ga0496109_0045948_3462_3728 88
804 3300048912 Ga0496109_0658730 Ga0496109_0658730_386_652 88
805 3300048912 Ga0496109_0697472 Ga0496109_0697472_377_643 88
806 3300048912 Ga0496109_0759751 Ga0496109_0759751_275_541 88
807 3300048913 Ga0496110_0027599 Ga0496110_0027599_1997_2263 88
808 3300048913 Ga0496110_0621323 Ga0496110_0621323_379_645 88
809 3300048914 Ga0496111_0974635 Ga0496111_0974635_242_514 88
810 3300048915 Ga0496112_0154778 Ga0496112_0154778_1955_2221 88
811 3300048916 Ga0496113_0049910 Ga0496113_0049910_1084_1350 88
812 3300048916 Ga0496113_0285579 Ga0496113_0285579_518_790 88
813 3300049569 Ga0501032_0086020 Ga0501032_0086020_479_745 88
814 3300049570 Ga0501033_0152133 Ga0501033_0152133_396_662 88
815 3300049572 Ga0501036_0054381 Ga0501036_0054381_1745_2011 88
816 3300049573 Ga0501037_0191611 Ga0501037_0191611_1081_1347 88
817 3300049574 Ga0501038_0135942 Ga0501038_0135942_119_385 88
818 3300049575 Ga0501039_0040396 Ga0501039_0040396_2037_2303 88
819 3300049576 Ga0501040_0122600 Ga0501040_0122600_1492_1758 88
820 3300049579 Ga0501043_0216468 Ga0501043_0216468_1130_1396 88
821 3300049580 Ga0501046_0015766 Ga0501046_0015766_1329_1595 88
822 3300049582 Ga0501048_0110789 Ga0501048_0110789_62_328 88
823 3300049583 Ga0501067_0007929 Ga0501067_0007929_1386_1652 88
824 3300049583 Ga0501067_0163793 Ga0501067_0163793_582_848 88
825 3300049583 Ga0501067_0759140 Ga0501067_0759140_126_392 88
826 3300049584 Ga0501068_0028112 Ga0501068_0028112_1470_1736 88
827 3300049584 Ga0501068_0317711 Ga0501068_0317711_433_699 88
828 3300049584 Ga0501068_0461380 Ga0501068_0461380_488_760 88
829 3300049585 Ga0501069_0089266 Ga0501069_0089266_1259_1525 88
830 3300049586 Ga0501070_0174680 Ga0501070_0174680_974_1240 88
831 3300049587 Ga0501071_0047094 Ga0501071_0047094_1252_1518 88
832 3300049588 Ga0501072_0004929 Ga0501072_0004929_5158_5424 88
833 3300049590 Ga0501074_0025245 Ga0501074_0025245_2115_2381 88
834 3300049591 Ga0501075_0059032 Ga0501075_0059032_1580_1846 88
835 3300049592 Ga0501076_0004215 Ga0501076_0004215_2868_3134 88
836 3300049593 Ga0501077_0005911 Ga0501077_0005911_2370_2636 88
837 3300049741 Ga0501079_0005016 Ga0501079_0005016_7414_7680 88
838 3300049742 Ga0501080_0002032 Ga0501080_0002032_7237_7503 88
839 3300049743 Ga0501081_0012524 Ga0501081_0012524_3546_3812 88
840 3300049744 Ga0501083_0111851 Ga0501083_0111851_87_353 88
841 3300049824 Ga0501045_0044759 Ga0501045_0044759_1372_1638 88
842 3300050490 nmdc:mga03n38_236587_c1 nmdc:mga03n38_236587_c1_210_476 88
843 3300050491 nmdc:mga00v17_24047_c1 nmdc:mga00v17_24047_c1_3187_3453 88
844 3300050492 nmdc:mga0yw44_195849_c1 nmdc:mga0yw44_195849_c1_82_348 88
845 3300050492 nmdc:mga0yw44_243554_c1 nmdc:mga0yw44_243554_c1_737_1003 88
846 3300050492 nmdc:mga0yw44_369402_c1 nmdc:mga0yw44_369402_c1_618_884 88
847 3300050494 nmdc:mga06z11_7552_c1 nmdc:mga06z11_7552_c1_1330_1596 88
848 3300050507 nmdc:mga05p37_159332_c1 nmdc:mga05p37_159332_c1_2291_2563 88
849 3300050507 nmdc:mga05p37_4691_c2 nmdc:mga05p37_4691_c2_7117_7383 88
850 3300050508 nmdc:mga09592_4692_c1 nmdc:mga09592_4692_c1_1020_1286 88
851 3300050510 nmdc:mga06r32_282208_c1 nmdc:mga06r32_282208_c1_309_581 88
852 3300050511 nmdc:mga08y16_100664_c1 nmdc:mga08y16_100664_c1_1817_2089 88
853 3300050511 nmdc:mga08y16_2176447_c1 nmdc:mga08y16_2176447_c1_150_416 88
854 3300050511 nmdc:mga08y16_334025_c1 nmdc:mga08y16_334025_c1_907_1179 88
855 3300050511 nmdc:mga08y16_56074_c1 nmdc:mga08y16_56074_c1_1088_1354 88
856 3300050511 nmdc:mga08y16_8793_c1 nmdc:mga08y16_8793_c1_9489_9755 88
857 3300050512 nmdc:mga0n895_1130384_c1 nmdc:mga0n895_1130384_c1_327_599 88
858 3300050512 nmdc:mga0n895_1581838_c1 nmdc:mga0n895_1581838_c1_253_519 88
859 3300050512 nmdc:mga0n895_46478_c1 nmdc:mga0n895_46478_c1_942_1208 88
860 3300050512 nmdc:mga0n895_72506_c1 nmdc:mga0n895_72506_c1_1552_1818 88
861 3300050513 nmdc:mga0rr50_13665_c1 nmdc:mga0rr50_13665_c1_791_1057 88
862 3300050513 nmdc:mga0rr50_1633915_c1 nmdc:mga0rr50_1633915_c1_261_533 88
863 3300050513 nmdc:mga0rr50_54017_c1 nmdc:mga0rr50_54017_c1_1264_1530 88
864 3300050513 nmdc:mga0rr50_640727_c1 nmdc:mga0rr50_640727_c1_345_617 88
865 3300050514 nmdc:mga08x19_28639_c1 nmdc:mga08x19_28639_c1_2246_2518 88
866 3300050515 nmdc:mga0a205_29555_c1 nmdc:mga0a205_29555_c1_3620_3886 88
867 3300050515 nmdc:mga0a205_491719_c1 nmdc:mga0a205_491719_c1_749_1015 88
868 3300050515 nmdc:mga0a205_65347_c1 nmdc:mga0a205_65347_c1_1016_1288 88
869 3300053078 Ga0495612_0474198 Ga0495612_0474198_94_366 88
870 3300054114 Ga0501084_0001654 Ga0501084_0001654_7488_7754 88
871 3300060353 Ga0501082_0462488 Ga0501082_0462488_557_823 88
872 3300061719 Ga0466962_0052428 Ga0466962_0052428_1189_1455 88
873 3300061719 Ga0466962_0476138 Ga0466962_0476138_258_527 88
874 3300061734 Ga0530510_0004090 Ga0530510_0004090_7016_7282 88
875 3300061734 Ga0530510_0166606 Ga0530510_0166606_902_1168 88
876 3300061734 Ga0530510_0482666 Ga0530510_0482666_360_626 88
877 3300061734 Ga0530510_0665806 Ga0530510_0665806_70_342 88

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01649

Ribosomal_S20p

Ribosomal protein S20

22

104

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mfk-assembly1.cif.gz_A structure of the clostridium perfringens gh89 in complex with alpha-hnjnac 0.9868 24 59
4b6x-assembly2.cif.gz_B crystal structure of in planta processed avrrps4 0.9385 17 65
7o3e-assembly1.cif.gz_c murine supercomplex ciii2civ in the intermediate locked conformation 0.9368 19 58
4v47-assembly1.cif.gz_BT real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the ef-g.gtp state of e. coli 70s ribosome 0.9346 8 86
4v4w-assembly1.cif.gz_AT structure of a secm-stalled e. coli ribosome complex obtained by fitting atomic models for rna and protein components into cryo-em map emd-1143 0.9338 8 86
ID Description Score Start End Superfamily
af_Q9BPX3_363_558_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9751 12 64 1.25.10.10
af_Q54DW5_515_797_1.20.120.670 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);N-acetyl-b-d-glucoasminidase 0.9613 24 59 1.20.120.670
af_Q9UI47_502_632_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.9596 21 60 1.20.120.230
af_A5A8R3_1_166_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9533 16 64 1.20.1270.60
af_A0A0R0H600_74_264_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.9439 17 65 1.20.120.80
ID Description Score Start End GO Terms
AF-X1J7I0-F1-model_v4 30S ribosomal protein S20 0.9671 12 86 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-X1Q509-F1-model_v4 30S ribosomal protein S20 0.967 16 86 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-X1FE40-F1-model_v4 30S ribosomal protein S20 0.9655 10 86 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A419FMU6-F1-model_v4 Small ribosomal subunit protein bS20 (30S ribosomal protein S20) 0.9561 19 86 GO:0003735
GO:0005829
GO:0006412
GO:0015935
GO:0070181
AF-A0A6L6B8C7-F1-model_v4 Small ribosomal subunit protein bS20 (30S ribosomal protein S20) 0.9539 19 87 GO:0003735
GO:0005829
GO:0006412
GO:0015935
GO:0070181

Feature Viewer

pLDDT pTM Quality
92.55 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map