F484398

General Info

Members Datasets Scaffolds Average Seq Length
877 445 842 139

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0046600|Ga0436361_0046600_49_474
Length 141
Sequence MRITQGCFSFLPDLTDAQIRTQVQYCIDKGWAVNLEFTDDPHPRNTFWEMWGLPMFDIKDAAAVMMELAACRKVHGDRAYVRVSGFDASHGWESVKISFIAHRPKEEPGFRLVRQESEGRNITYTLQAYATDLPEGERYGA

Samples

Sample ID Description Type Environment
1 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
2 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
3 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
4 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
5 2643221660 Methylibium sp. Root1272 Isolate Unclassified
6 2738541277 Variovorax sp. GV051 Isolate Unclassified
7 2738543019 Variovorax sp. GV040 Isolate Unclassified
8 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
9 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
10 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
11 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
12 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
13 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
14 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
15 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
16 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
17 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
18 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
19 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
20 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
21 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
22 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
23 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
24 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
25 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
26 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
27 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
28 2929520902 Variovorax beijingensis 502 Isolate Unclassified
29 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
30 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
31 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
32 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
33 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
34 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
35 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
36 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
37 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
38 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
39 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
40 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
41 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
44 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
47 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
65 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
72 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
78 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
79 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
95 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
96 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
97 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
98 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
99 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
100 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
101 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
102 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
103 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
106 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
111 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
124 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
138 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
139 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
143 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
147 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
149 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
154 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
156 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
199 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
205 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
206 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
207 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
208 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
209 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
210 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
211 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
212 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
213 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
214 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
215 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
216 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
217 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
218 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
219 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
220 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
221 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
222 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
223 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
224 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
225 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
226 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
227 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
228 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
229 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
234 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
241 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
242 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
243 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
244 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
245 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
246 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
247 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
248 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
249 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
250 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
251 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
252 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
253 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
254 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
255 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
256 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
257 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
258 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
259 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
260 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
261 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
262 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
263 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
264 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
265 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
266 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
267 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
268 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
269 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
270 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
271 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
272 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
273 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
274 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
275 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
276 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
277 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
278 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
279 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
280 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
281 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
282 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
283 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
284 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
285 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
286 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
287 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
288 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
289 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
290 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
291 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
292 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
293 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
294 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
295 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
296 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
297 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
298 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
299 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
300 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
301 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
302 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
303 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
304 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
305 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
306 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
307 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
308 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
309 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
310 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
311 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
312 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
313 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
314 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
315 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
316 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
317 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
318 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
319 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
320 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
321 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
322 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
323 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
324 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
325 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
326 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
327 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
328 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
329 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
330 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
331 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
332 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
333 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
334 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
335 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
336 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
337 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
338 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
339 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
340 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
341 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
342 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
343 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
344 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
345 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
346 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
347 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
348 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
349 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
350 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
351 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
352 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
353 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
354 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
355 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
356 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
357 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
358 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
359 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
360 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
361 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
362 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
363 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
364 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
378 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
379 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
380 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
381 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
382 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
383 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
384 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
385 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
386 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
387 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
388 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
389 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
390 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
391 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
392 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
393 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
394 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
397 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
398 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
399 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
400 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
401 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
402 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
403 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
404 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
405 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
406 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
407 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
408 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
409 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
410 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
411 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
412 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
413 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
414 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
415 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
416 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
417 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
418 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
419 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
420 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
421 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
422 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
423 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
443 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
444 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
445 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.45
Metatranscriptomes 4.56
Isolates 3.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.55
Nodule 1.6
Rhizoplane 3.65
Rhizosphere 78.45
Stem 0
Stem Tuber 0
Unclassified 7.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10013989 3300003187 Bacteria 3593
2 rootH1_10197737 3300003323 Unclassified 1067
3 rootH1_10342955 3300003323 Bacteria 1001
4 Ga0007416J51690_1062202 3300003577 Unclassified 1039
5 Ga0055537_1000031 3300003773 Bacteria 99208
6 Ga0055534_1000091 3300003784 Bacteria 71324
7 Ga0055528_1000237 3300003790 Bacteria 46144
8 Ga0058861_11899052 3300004800 Bacteria 1340
9 Ga0058862_11428235 3300004803 Bacteria 910
10 Ga0065704_10350557 3300005289 Bacteria 810
11 Ga0065707_10083026 3300005295 Bacteria 10777
12 Ga0070683_100149523 3300005329 Bacteria 2214
13 Ga0070683_100222286 3300005329 Bacteria 1795
14 Ga0070683_100350078 3300005329 Bacteria 1407
15 Ga0070690_100115809 3300005330 Bacteria 1794
16 Ga0070677_10137679 3300005333 Bacteria 1122
17 Ga0070666_10423012 3300005335 Bacteria 960
18 Ga0070666_11163125 3300005335 Bacteria 574
19 Ga0070680_100002272 3300005336 Bacteria 14211
20 Ga0070680_100054814 3300005336 Bacteria 3256
21 Ga0070680_100210072 3300005336 Bacteria 1642
22 Ga0070680_100489952 3300005336 Bacteria 1051
23 Ga0070680_100612113 3300005336 Bacteria 935
24 Ga0070680_101239291 3300005336 Bacteria 645
25 Ga0070682_100429128 3300005337 Bacteria 1007
26 Ga0068868_100216387 3300005338 Bacteria 1603
27 Ga0068868_100231660 3300005338 Bacteria 1550
28 Ga0070691_10395840 3300005341 Bacteria 777
29 Ga0070661_101079788 3300005344 Bacteria 668
30 Ga0070668_100174748 3300005347 Bacteria 1751
31 Ga0070669_100842900 3300005353 Bacteria 781
32 Ga0070671_100000182 3300005355 Bacteria 41975
33 Ga0070671_100088684 3300005355 Bacteria 2589
34 Ga0070674_101383634 3300005356 Bacteria 630
35 Ga0070673_100084201 3300005364 Bacteria 2586
36 Ga0070673_100174299 3300005364 Bacteria 1837
37 Ga0070688_100224657 3300005365 Bacteria 1325
38 Ga0070659_100693978 3300005366 Bacteria 880
39 Ga0070667_100054646 3300005367 Bacteria 3372
40 Ga0070667_100786611 3300005367 Bacteria 883
41 Ga0070667_100875641 3300005367 Bacteria 835
42 Ga0070667_101121107 3300005367 Bacteria 736
43 Ga0070709_10206284 3300005434 Bacteria 1395
44 Ga0070713_100913627 3300005436 Bacteria 845
45 Ga0070710_10459449 3300005437 Bacteria 865
46 Ga0070710_11482374 3300005437 Bacteria 509
47 Ga0070708_100052798 3300005445 Bacteria 3605
48 Ga0070663_100598938 3300005455 Bacteria 927
49 Ga0070678_100219571 3300005456 Bacteria 1579
50 Ga0070681_10000436 3300005458 Bacteria 33941
51 Ga0070681_10004460 3300005458 Bacteria 13334
52 Ga0070681_10009629 3300005458 Bacteria 9502
53 Ga0070681_10016296 3300005458 Bacteria 7416
54 Ga0070681_10032105 3300005458 Bacteria 5270
55 Ga0070681_10200921 3300005458 Bacteria 1911
56 Ga0068867_100017657 3300005459 Bacteria 5066
57 Ga0068867_100072358 3300005459 Bacteria 2580
58 Ga0068867_100131642 3300005459 Bacteria 1945
59 Ga0070685_10317582 3300005466 Bacteria 1055
60 Ga0070685_10833538 3300005466 Bacteria 682
61 Ga0070707_100046185 3300005468 Bacteria 4168
62 Ga0070698_101280321 3300005471 Bacteria 683
63 Ga0070679_100009702 3300005530 Bacteria 9106
64 Ga0070679_100046866 3300005530 Bacteria 4309
65 Ga0070679_100049877 3300005530 Bacteria 4170
66 Ga0070679_100179819 3300005530 Bacteria 2088
67 Ga0070679_100245951 3300005530 Bacteria 1745
68 Ga0070679_100258242 3300005530 Bacteria 1698
69 Ga0070679_100589524 3300005530 Bacteria 1055
70 Ga0070684_100298250 3300005535 Bacteria 1478
71 Ga0070684_100376661 3300005535 Bacteria 1307
72 Ga0070684_100740874 3300005535 Bacteria 917
73 Ga0070697_100302829 3300005536 Bacteria 1374
74 Ga0068853_100015474 3300005539 Bacteria 6267
75 Ga0068853_100733601 3300005539 Bacteria 944
76 Ga0070672_100190896 3300005543 Bacteria 1710
77 Ga0070686_100214006 3300005544 Bacteria 1389
78 Ga0070686_100670634 3300005544 Bacteria 824
79 Ga0070693_101446554 3300005547 Bacteria 536
80 Ga0070665_100000894 3300005548 Bacteria 38327
81 Ga0070665_100002017 3300005548 Bacteria 22832
82 Ga0070665_100077289 3300005548 Bacteria 3335
83 Ga0070665_100686744 3300005548 Bacteria 1037
84 Ga0068855_100004475 3300005563 Bacteria 17073
85 Ga0068855_100011278 3300005563 Bacteria 10791
86 Ga0068855_100041746 3300005563 Bacteria 5435
87 Ga0068855_100188623 3300005563 Bacteria 2327
88 Ga0068855_100277542 3300005563 Bacteria 1862
89 Ga0068855_101009202 3300005563 Bacteria 874
90 Ga0068855_101111756 3300005563 Bacteria 826
91 Ga0068855_101841820 3300005563 Bacteria 614
92 Ga0068857_100151089 3300005577 Bacteria 2104
93 Ga0068857_100300917 3300005577 Bacteria 1478
94 Ga0068857_101119810 3300005577 Bacteria 761
95 Ga0068854_100126429 3300005578 Bacteria 1947
96 Ga0068854_100704270 3300005578 Bacteria 872
97 Ga0068854_101075506 3300005578 Bacteria 716
98 Ga0068856_100508342 3300005614 Bacteria 1226
99 Ga0068856_101929294 3300005614 Bacteria 601
100 Ga0068856_102213181 3300005614 Bacteria 559
101 Ga0068852_101065469 3300005616 Bacteria 828
102 Ga0068852_101118687 3300005616 Bacteria 808
103 Ga0068859_100000520 3300005617 Bacteria 38244
104 Ga0068859_100420510 3300005617 Bacteria 1433
105 Ga0068859_100906620 3300005617 Bacteria 966
106 Ga0068859_100944714 3300005617 Bacteria 946
107 Ga0068866_10188164 3300005718 Bacteria 1225
108 Ga0068866_10848300 3300005718 Bacteria 639
109 Ga0068861_100473397 3300005719 Bacteria 1127
110 Ga0068861_101816067 3300005719 Bacteria 605
111 Ga0068863_100002040 3300005841 Bacteria 20019
112 Ga0068863_100203413 3300005841 Bacteria 1905
113 Ga0068863_101868559 3300005841 Bacteria 610
114 Ga0068858_100000238 3300005842 Bacteria 59573
115 Ga0068858_100248130 3300005842 Bacteria 1691
116 Ga0068858_101020577 3300005842 Bacteria 811
117 Ga0068858_101219736 3300005842 Bacteria 740
118 Ga0068860_100030988 3300005843 Bacteria 5142
119 Ga0068860_100068490 3300005843 Bacteria 3372
120 Ga0068860_100706964 3300005843 Bacteria 1018
121 Ga0068860_101391978 3300005843 Bacteria 723
122 Ga0068862_100081566 3300005844 Bacteria 2806
123 Ga0068862_100238412 3300005844 Bacteria 1653
124 Ga0081455_10000519 3300005937 Bacteria 50012
125 Ga0081455_10398852 3300005937 Bacteria 955
126 Ga0081538_10000326 3300005981 Bacteria 54485
127 Ga0081538_10010430 3300005981 Bacteria 7619
128 Ga0081539_10000118 3300005985 Bacteria 184562
129 Ga0081539_10000302 3300005985 Bacteria 111364
130 Ga0075368_10019180 3300006042 Bacteria 2580
131 Ga0075368_10200405 3300006042 Bacteria 845
132 Ga0075363_100007460 3300006048 Bacteria 5030
133 Ga0075432_10129798 3300006058 Bacteria 954
134 Ga0075432_10162313 3300006058 Bacteria 865
135 Ga0075432_10308850 3300006058 Bacteria 659
136 Ga0075362_10069434 3300006177 Bacteria 1606
137 Ga0075362_10094322 3300006177 Bacteria 1392
138 Ga0075362_10377752 3300006177 Bacteria 712
139 Ga0075367_10170055 3300006178 Bacteria 1357
140 Ga0075367_10212579 3300006178 Bacteria 1209
141 Ga0075367_10398849 3300006178 Bacteria 870
142 Ga0075369_10198906 3300006186 Bacteria 924
143 Ga0075366_10091873 3300006195 Bacteria 1818
144 Ga0075366_10117380 3300006195 Bacteria 1602
145 Ga0075366_10220156 3300006195 Bacteria 1156
146 Ga0075366_10256253 3300006195 Bacteria 1067
147 Ga0075370_10002134 3300006353 Bacteria 9037
148 Ga0075370_10080980 3300006353 Bacteria 1866
149 Ga0075370_10247444 3300006353 Bacteria 1056
150 Ga0075370_10267506 3300006353 Bacteria 1014
151 Ga0068871_100331372 3300006358 Bacteria 1342
152 Ga0068871_100474382 3300006358 Bacteria 1124
153 Ga0075428_100050198 3300006844 Bacteria 4577
154 Ga0075430_100178607 3300006846 Bacteria 1766
155 Ga0068865_100061356 3300006881 Bacteria 2635
156 Ga0068865_100295809 3300006881 Bacteria 1294
157 Ga0075436_101062670 3300006914 Bacteria 609
158 Ga0097620_100000520 3300006931 Bacteria 38244
159 Ga0097620_100420492 3300006931 Bacteria 1433
160 Ga0097620_100906559 3300006931 Bacteria 966
161 Ga0097620_100944725 3300006931 Bacteria 946
162 Ga0099826_10067367 3300006948 Bacteria 2291
163 Ga0105250_10038591 3300009092 Bacteria 1915
164 Ga0105240_10001162 3300009093 Bacteria 46146
165 Ga0105240_10001667 3300009093 Bacteria 37697
166 Ga0105240_10015663 3300009093 Bacteria 10296
167 Ga0105240_10021151 3300009093 Bacteria 8661
168 Ga0105240_10047887 3300009093 Bacteria 5406
169 Ga0105240_10074921 3300009093 Bacteria 4176
170 Ga0105240_10106085 3300009093 Bacteria 3409
171 Ga0105240_10152858 3300009093 Bacteria 2747
172 Ga0105240_10239642 3300009093 Bacteria 2103
173 Ga0105240_10409484 3300009093 Bacteria 1525
174 Ga0105247_10000317 3300009101 Bacteria 43370
175 Ga0105247_10601347 3300009101 Bacteria 815
176 Ga0105243_10569224 3300009148 Bacteria 1086
177 Ga0105243_10615050 3300009148 Bacteria 1048
178 Ga0105241_10327387 3300009174 Bacteria 1323
179 Ga0105242_10220758 3300009176 Bacteria 1694
180 Ga0105242_10434518 3300009176 Bacteria 1233
181 Ga0105248_10010633 3300009177 Bacteria 10148
182 Ga0105248_10055365 3300009177 Bacteria 4448
183 Ga0105248_12511268 3300009177 Bacteria 587
184 Ga0105237_10019273 3300009545 Bacteria 7048
185 Ga0105237_10075708 3300009545 Bacteria 3356
186 Ga0105237_10087812 3300009545 Bacteria 3099
187 Ga0105237_10153844 3300009545 Bacteria 2296
188 Ga0105237_10265108 3300009545 Bacteria 1721
189 Ga0105238_10001249 3300009551 Bacteria 25597
190 Ga0105238_10446996 3300009551 Bacteria 1289
191 Ga0105238_10457379 3300009551 Bacteria 1274
192 Ga0105238_10753255 3300009551 Bacteria 988
193 Ga0105238_10943328 3300009551 Unclassified 882
194 Ga0105238_11179053 3300009551 Unclassified 790
195 Ga0105249_10035103 3300009553 Bacteria 4546
196 Ga0105249_10093275 3300009553 Bacteria 2820
197 Ga0105249_10103087 3300009553 Bacteria 2686
198 Ga0105249_10260800 3300009553 Bacteria 1722
199 Ga0105249_10415449 3300009553 Bacteria 1378
200 Ga0105239_10006291 3300010375 Bacteria 13803
201 Ga0105239_10259093 3300010375 Bacteria 1954
202 Ga0105239_10419475 3300010375 Bacteria 1516
203 Ga0105239_10581895 3300010375 Bacteria 1276
204 Ga0105239_10953284 3300010375 Bacteria 986
205 Ga0105246_10082746 3300011119 Bacteria 2292
206 Ga0105246_10650062 3300011119 Bacteria 918
207 Ga0105246_11879640 3300011119 Bacteria 574
208 Ga0105246_12231625 3300011119 Bacteria 533
209 Ga0157346_1008417 3300012480 Bacteria 710
210 Ga0154012_133202 3300013059 Bacteria 515
211 Ga0157373_10036040 3300013100 Bacteria 3551
212 Ga0157370_10002946 3300013104 Bacteria 20263
213 Ga0157370_10134036 3300013104 Bacteria 2309
214 Ga0157370_10813794 3300013104 Bacteria 850
215 Ga0157369_10071865 3300013105 Bacteria 3713
216 Ga0157369_10072482 3300013105 Bacteria 3697
217 Ga0157369_10140259 3300013105 Bacteria 2558
218 Ga0157369_10349786 3300013105 Bacteria 1535
219 Ga0157369_10553053 3300013105 Bacteria 1189
220 Ga0157374_10179292 3300013296 Bacteria 2069
221 Ga0157374_10186550 3300013296 Bacteria 2028
222 Ga0157374_11963974 3300013296 Bacteria 611
223 Ga0157374_12258653 3300013296 Bacteria 571
224 Ga0163162_10324760 3300013306 Bacteria 1671
225 Ga0163162_10706553 3300013306 Bacteria 1130
226 Ga0163162_11501143 3300013306 Bacteria 768
227 Ga0157372_10331880 3300013307 Bacteria 1771
228 Ga0157372_10625310 3300013307 Bacteria 1255
229 Ga0157372_10976517 3300013307 Bacteria 981
230 Ga0157372_11318126 3300013307 Bacteria 833
231 Ga0157372_11483110 3300013307 Bacteria 781
232 Ga0157372_11696678 3300013307 Bacteria 727
233 Ga0157375_10109192 3300013308 Bacteria 2862
234 Ga0163163_10034925 3300014325 Bacteria 4874
235 Ga0163163_10237106 3300014325 Bacteria 1874
236 Ga0163163_10310041 3300014325 Bacteria 1631
237 Ga0157380_10002413 3300014326 Bacteria 12579
238 Ga0157380_11021630 3300014326 Bacteria 861
239 Ga0182008_10520408 3300014497 Bacteria 657
240 Ga0157379_10005758 3300014968 Bacteria 10664
241 Ga0157379_10111408 3300014968 Bacteria 2458
242 Ga0157379_10122569 3300014968 Bacteria 2339
243 Ga0157379_11879686 3300014968 Bacteria 590
244 Ga0157376_10007118 3300014969 Bacteria 7946
245 Ga0157376_10381886 3300014969 Bacteria 1357
246 Ga0157376_10388174 3300014969 Bacteria 1347
247 Ga0182006_1041130 3300015261 Bacteria 1816
248 Ga0182006_1041882 3300015261 Bacteria 1796
249 Ga0182007_10062239 3300015262 Bacteria 1223
250 Ga0197907_10413154 3300020069 Unclassified 757
251 Ga0197907_11430259 3300020069 Bacteria 579
252 Ga0206356_10150101 3300020070 Bacteria 1401
253 Ga0206356_10154097 3300020070 Bacteria 2524
254 Ga0206349_1014102 3300020075 Bacteria 626
255 Ga0206355_1446838 3300020076 Bacteria 606
256 Ga0206351_10312048 3300020077 Bacteria 542
257 Ga0206351_10444308 3300020077 Bacteria 2027
258 Ga0206352_10235695 3300020078 Bacteria 1443
259 Ga0206354_10279087 3300020081 Bacteria 595
260 Ga0213872_10134835 3300021361 Bacteria 1086
261 Ga0224712_10049638 3300022467 Bacteria 1626
262 Ga0209233_1010192 3300025261 Bacteria 2828
263 Ga0209565_1000087 3300025263 Bacteria 152027
264 Ga0209673_1000145 3300025273 Bacteria 152027
265 Ga0209675_1000085 3300025291 Bacteria 152027
266 Ga0209676_1027819 3300025292 Bacteria 1772
267 Ga0209025_1056253 3300025294 Bacteria 1514
268 Ga0209564_1048598 3300025295 Bacteria 1058
269 Ga0209758_1130091 3300025297 Bacteria 667
270 Ga0209051_1008057 3300025303 Bacteria 5642
271 Ga0207692_10204403 3300025898 Bacteria 1163
272 Ga0207692_10402123 3300025898 Bacteria 854
273 Ga0207642_10382096 3300025899 Bacteria 838
274 Ga0207642_10406550 3300025899 Bacteria 816
275 Ga0207710_10000323 3300025900 Bacteria 36602
276 Ga0207680_10137618 3300025903 Bacteria 1616
277 Ga0207680_10464441 3300025903 Bacteria 899
278 Ga0207680_11063096 3300025903 Bacteria 579
279 Ga0207647_10000883 3300025904 Bacteria 23261
280 Ga0207699_10243311 3300025906 Bacteria 1237
281 Ga0207645_10495790 3300025907 Bacteria 827
282 Ga0207684_10003211 3300025910 Bacteria 16048
283 Ga0207654_10591849 3300025911 Bacteria 791
284 Ga0207707_10000035 3300025912 Bacteria 147299
285 Ga0207707_10000591 3300025912 Bacteria 36552
286 Ga0207707_10014435 3300025912 Bacteria 6882
287 Ga0207707_10017249 3300025912 Bacteria 6292
288 Ga0207707_10019236 3300025912 Bacteria 5960
289 Ga0207707_10055496 3300025912 Bacteria 3446
290 Ga0207707_10135238 3300025912 Bacteria 2155
291 Ga0207695_10003023 3300025913 Bacteria 24154
292 Ga0207695_10042598 3300025913 Bacteria 4846
293 Ga0207695_10049299 3300025913 Bacteria 4441
294 Ga0207695_10050901 3300025913 Bacteria 4354
295 Ga0207695_10054673 3300025913 Bacteria 4166
296 Ga0207695_10061520 3300025913 Bacteria 3880
297 Ga0207695_10073016 3300025913 Bacteria 3497
298 Ga0207695_10098888 3300025913 Bacteria 2916
299 Ga0207695_10254683 3300025913 Bacteria 1654
300 Ga0207695_10395849 3300025913 Bacteria 1266
301 Ga0207671_10065192 3300025914 Bacteria 2708
302 Ga0207671_10133611 3300025914 Bacteria 1906
303 Ga0207671_10269604 3300025914 Bacteria 1341
304 Ga0207671_10420981 3300025914 Bacteria 1063
305 Ga0207660_10029544 3300025917 Bacteria 3761
306 Ga0207660_10068052 3300025917 Bacteria 2581
307 Ga0207660_10096148 3300025917 Bacteria 2205
308 Ga0207660_10195048 3300025917 Bacteria 1579
309 Ga0207660_10633968 3300025917 Unclassified 871
310 Ga0207660_11091230 3300025917 Bacteria 650
311 Ga0207652_10001126 3300025921 Bacteria 24078
312 Ga0207652_10035735 3300025921 Bacteria 4196
313 Ga0207652_10039665 3300025921 Bacteria 3997
314 Ga0207652_10084245 3300025921 Bacteria 2785
315 Ga0207652_10522750 3300025921 Bacteria 1068
316 Ga0207681_10531466 3300025923 Bacteria 966
317 Ga0207694_10030487 3300025924 Bacteria 4119
318 Ga0207694_10044347 3300025924 Bacteria 3434
319 Ga0207694_10473590 3300025924 Bacteria 1047
320 Ga0207694_10491999 3300025924 Bacteria 1026
321 Ga0207694_11714079 3300025924 Bacteria 529
322 Ga0207650_10453410 3300025925 Bacteria 1067
323 Ga0207700_10140699 3300025928 Bacteria 1982
324 Ga0207700_10466101 3300025928 Bacteria 1115
325 Ga0207644_10017250 3300025931 Bacteria 4872
326 Ga0207709_10191223 3300025935 Bacteria 1454
327 Ga0207709_10377197 3300025935 Bacteria 1078
328 Ga0207709_10532277 3300025935 Bacteria 921
329 Ga0207709_10763963 3300025935 Bacteria 778
330 Ga0207670_10062949 3300025936 Bacteria 2537
331 Ga0207669_10300162 3300025937 Bacteria 1220
332 Ga0207665_10957966 3300025939 Bacteria 680
333 Ga0207691_10049884 3300025940 Bacteria 3834
334 Ga0207711_10061041 3300025941 Bacteria 3250
335 Ga0207711_10942310 3300025941 Bacteria 802
336 Ga0207661_10081576 3300025944 Bacteria 2672
337 Ga0207661_10109963 3300025944 Bacteria 2329
338 Ga0207667_10034479 3300025949 Bacteria 5434
339 Ga0207667_10086834 3300025949 Bacteria 3236
340 Ga0207667_10127246 3300025949 Bacteria 2624
341 Ga0207667_10849128 3300025949 Bacteria 907
342 Ga0207712_10046447 3300025961 Bacteria 3011
343 Ga0207712_10074032 3300025961 Bacteria 2458
344 Ga0207712_10125596 3300025961 Bacteria 1947
345 Ga0207712_10685403 3300025961 Bacteria 893
346 Ga0207640_10260182 3300025981 Bacteria 1352
347 Ga0207640_10723938 3300025981 Bacteria 855
348 Ga0207658_10315236 3300025986 Bacteria 1352
349 Ga0207658_10583965 3300025986 Bacteria 1002
350 Ga0207658_10790284 3300025986 Bacteria 861
351 Ga0207677_10754155 3300026023 Bacteria 868
352 Ga0207703_10000911 3300026035 Bacteria 28871
353 Ga0207703_10272687 3300026035 Bacteria 1533
354 Ga0207703_10401786 3300026035 Bacteria 1271
355 Ga0207639_10307309 3300026041 Bacteria 1404
356 Ga0207678_10084391 3300026067 Bacteria 2716
357 Ga0207702_10916730 3300026078 Bacteria 868
358 Ga0207702_10966259 3300026078 Bacteria 845
359 Ga0207702_11494150 3300026078 Bacteria 669
360 Ga0207702_11495845 3300026078 Bacteria 669
361 Ga0207702_11818525 3300026078 Bacteria 601
362 Ga0207641_10004471 3300026088 Bacteria 12103
363 Ga0207641_10311737 3300026088 Bacteria 1489
364 Ga0207641_11439354 3300026088 Bacteria 690
365 Ga0207648_10028691 3300026089 Bacteria 4933
366 Ga0207648_10043845 3300026089 Bacteria 3926
367 Ga0207648_10053380 3300026089 Bacteria 3533
368 Ga0207674_10030361 3300026116 Bacteria 5683
369 Ga0207674_10060944 3300026116 Bacteria 3814
370 Ga0207674_10706202 3300026116 Bacteria 973
371 Ga0207675_100933661 3300026118 Bacteria 885
372 Ga0207675_101275892 3300026118 Bacteria 755
373 Ga0207683_10155770 3300026121 Bacteria 2063
374 Ga0207683_10368550 3300026121 Bacteria 1319
375 Ga0207683_10426413 3300026121 Bacteria 1222
376 Ga0207698_11389335 3300026142 Bacteria 717
377 Ga0209282_1000304 3300027666 Bacteria 24377
378 Ga0209998_10141887 3300027717 Bacteria 614
379 Ga0209974_10030485 3300027876 Bacteria 1787
380 Ga0268266_10002272 3300028379 Bacteria 20880
381 Ga0268266_10005412 3300028379 Bacteria 11911
382 Ga0268266_10023766 3300028379 Bacteria 5216
383 Ga0268266_10092788 3300028379 Bacteria 2649
384 Ga0268266_10896049 3300028379 Bacteria 858
385 Ga0268265_10006056 3300028380 Bacteria 8221
386 Ga0268265_10354534 3300028380 Bacteria 1341
387 Ga0268264_10831818 3300028381 Bacteria 924
388 Ga0307517_10296662 3300028786 Bacteria 909
389 Ga0307515_10000692 3300028794 Bacteria 77763
390 Ga0307515_10005767 3300028794 Bacteria 25022
391 Ga0307515_10694272 3300028794 Bacteria 633
392 Ga0307511_10000066 3300030521 Bacteria 87505
393 Ga0307511_10042895 3300030521 Bacteria 3791
394 Ga0316176_1051753 3300030732 Bacteria 2219
395 Ga0316183_1029607 3300030742 Bacteria 12311
396 Ga0265325_10196107 3300031241 Bacteria 934
397 Ga0265316_10059793 3300031344 Bacteria 2963
398 Ga0307509_10000003 3300031507 Bacteria 577578
399 Ga0307408_100369660 3300031548 Bacteria 1222
400 Ga0307508_10000909 3300031616 Bacteria 34527
401 Ga0307508_10494399 3300031616 Bacteria 818
402 Ga0265314_10170207 3300031711 Bacteria 1316
403 Ga0316576_10001058 3300031727 Bacteria 14292
404 Ga0316576_10253096 3300031727 Bacteria 1322
405 Ga0316576_11083987 3300031727 Bacteria 568
406 Ga0316577_10018697 3300031733 Bacteria 3833
407 Ga0307413_10252925 3300031824 Bacteria 1308
408 Ga0307518_10330609 3300031838 Bacteria 903
409 Ga0307416_101618615 3300032002 Bacteria 753
410 Ga0307414_10508731 3300032004 Bacteria 1067
411 Ga0307414_11696558 3300032004 Bacteria 589
412 Ga0307411_10591647 3300032005 Bacteria 953
413 Ga0307415_101363996 3300032126 Bacteria 674
414 Ga0316583_10040801 3300032133 Bacteria 1643
415 Ga0316580_10018788 3300032139 Bacteria 2128
416 Ga0307510_10000001 3300033180 Bacteria 1172244
417 Ga0307510_10029875 3300033180 Bacteria 6190
418 Ga0307510_10030121 3300033180 Bacteria 6158
419 Ga0307510_10123884 3300033180 Bacteria 2280
420 Ga0307510_10378917 3300033180 Bacteria 860
421 Ga0373929_0076463 3300035085 Bacteria 809
422 Ga0373940_0018278 3300035088 Bacteria 1757
423 Ga0373939_0065438 3300035114 Bacteria 1169
424 Ga0373956_0047759 3300035119 Bacteria 1916
425 Ga0373943_0727079 3300035170 Bacteria 589
426 Ga0316574_0100488 3300035398 Bacteria 1851
427 Ga0373931_0046417 3300035691 Bacteria 2296
428 Ga0373927_0096669 3300035695 Bacteria 1920
429 Ga0316584_0185249 3300036712 Bacteria 1540
430 Ga0395900_0312943 3300037418 Bacteria 1553
431 Ga0395900_0453681 3300037418 Bacteria 1238
432 Ga0395900_0671146 3300037418 Bacteria 972
433 Ga0395898_0012166 3300037466 Bacteria 8902
434 Ga0395898_0030222 3300037466 Bacteria 5422
435 Ga0395898_0402728 3300037466 Bacteria 1305
436 Ga0395898_0826767 3300037466 Bacteria 866
437 Ga0316581_0005800 3300037588 Bacteria 3241
438 Ga0395901_0603155 3300038443 Bacteria 1107
439 Ga0436365_0910310 3300039437 Bacteria 1030
440 Ga0436360_1159934 3300039438 Bacteria 563
441 Ga0436361_0046600 3300039447 Bacteria 1076
442 Ga0436361_0085081 3300039447 Bacteria 31412
443 Ga0436363_0525771 3300039450 Bacteria 1059
444 Ga0439436_0066993 3300041404 Bacteria 1002
445 Ga0439447_030412 3300041407 Bacteria 1361
446 Ga0439466_0029987 3300041411 Bacteria 1868
447 Ga0439465_0013609 3300041413 Bacteria 2534
448 Ga0439465_0201946 3300041413 Bacteria 724
449 Ga0451789_0877240 3300041443 Bacteria 670
450 Ga0451798_1133053 3300041458 Bacteria 587
451 Ga0451800_0561777 3300041459 Bacteria 622
452 Ga0451804_1054772 3300041463 Bacteria 582
453 Ga0451837_0412873 3300041494 Bacteria 593
454 Ga0451841_0321022 3300041498 Bacteria 2498
455 Ga0451849_1329306 3300041505 Bacteria 557
456 Ga0451843_0460145 3300041509 Bacteria 516
457 Ga0451853_0858138 3300041512 Bacteria 545
458 Ga0451853_2174092 3300041512 Bacteria 1108
459 Ga0451853_3203100 3300041512 Bacteria 1244
460 Ga0451853_4094737 3300041512 Bacteria 633
461 Ga0439442_017587 3300042002 Bacteria 1476
462 Ga0439442_024107 3300042002 Bacteria 1265
463 Ga0439442_030527 3300042002 Bacteria 1125
464 Ga0439445_0018338 3300042004 Bacteria 1737
465 Ga0439445_0047600 3300042004 Bacteria 1152
466 Ga0439445_0105864 3300042004 Bacteria 800
467 Ga0439432_026342 3300042006 Bacteria 1903
468 Ga0439432_076300 3300042006 Bacteria 1018
469 Ga0439449_0001524 3300042007 Bacteria 9071
470 Ga0439452_051499 3300042010 Bacteria 942
471 Ga0450911_021682 3300042115 Bacteria 838
472 Ga0450920_038479 3300042122 Bacteria 951
473 Ga0450923_011382 3300042125 Bacteria 1598
474 Ga0450892_037154 3300042130 Bacteria 527
475 Ga0450906_004944 3300042145 Bacteria 2767
476 Ga0450907_007698 3300042146 Bacteria 1797
477 Ga0450910_004617 3300042147 Bacteria 1863
478 Ga0450908_005650 3300042184 Bacteria 2392
479 Ga0439434_0095217 3300042435 Bacteria 955
480 Ga0450918_001232 3300042531 Bacteria 5200
481 Ga0450893_0013544 3300042532 Bacteria 1361
482 Ga0466969_0007263 3300044656 Bacteria 5893
483 Ga0466969_0026062 3300044656 Bacteria 3000
484 Ga0466969_0027188 3300044656 Bacteria 2930
485 Ga0466965_0067375 3300044683 Bacteria 1797
486 Ga0466966_0004979 3300044684 Bacteria 8733
487 Ga0466966_0082942 3300044684 Bacteria 1995
488 Ga0466966_0089068 3300044684 Bacteria 1917
489 Ga0466966_0136638 3300044684 Bacteria 1499
490 Ga0466966_0185026 3300044684 Bacteria 1263
491 Ga0466966_0442695 3300044684 Bacteria 781
492 Ga0466961_0000480 3300044693 Bacteria 25359
493 Ga0466961_0036032 3300044693 Bacteria 3176
494 Ga0466963_1329470 3300044694 Bacteria 504
495 Ga0466964_0000160 3300044706 Bacteria 18532
496 Ga0453684_0203861 3300044712 Bacteria 2303
497 Ga0453684_1009376 3300044712 Bacteria 884
498 Ga0466971_0000238 3300044719 Bacteria 20975
499 Ga0466971_0144131 3300044719 Bacteria 1110
500 Ga0466968_0053401 3300044735 Bacteria 1731
501 Ga0466968_0348242 3300044735 Bacteria 719
502 Ga0466970_0000364 3300044765 Bacteria 22005
503 Ga0466970_0011225 3300044765 Bacteria 4565
504 Ga0466957_0196527 3300044842 Bacteria 1323
505 Ga0466959_0007062 3300045049 Bacteria 7850
506 Ga0466959_0010129 3300045049 Bacteria 6724
507 Ga0466959_0018297 3300045049 Bacteria 5144
508 Ga0466959_0026567 3300045049 Bacteria 4290
509 Ga0466959_0049772 3300045049 Bacteria 3078
510 Ga0466959_0054997 3300045049 Bacteria 2907
511 Ga0466959_0152313 3300045049 Bacteria 1629
512 Ga0451576_0080312 3300045051 Bacteria 3393
513 Ga0451576_2343414 3300045051 Bacteria 547
514 Ga0466958_0132853 3300045836 Bacteria 1564
515 Ga0495629_0604946 3300046459 Bacteria 733
516 Ga0495638_0001474 3300046460 Bacteria 21249
517 Ga0495638_0060229 3300046460 Bacteria 2349
518 Ga0495650_0004986 3300046471 Bacteria 8845
519 Ga0495580_0400565 3300046472 Bacteria 925
520 Ga0495582_0661853 3300046473 Bacteria 604
521 Ga0495605_0005411 3300046474 Bacteria 7437
522 Ga0495605_0056737 3300046474 Bacteria 1888
523 Ga0495584_0189131 3300046491 Bacteria 1046
524 Ga0495585_0001873 3300046492 Bacteria 15877
525 Ga0495596_0028000 3300046500 Bacteria 2263
526 Ga0495596_0060673 3300046500 Bacteria 1473
527 Ga0495583_0316976 3300046506 Bacteria 618
528 Ga0495606_0201739 3300046507 Bacteria 1133
529 Ga0495606_0271622 3300046507 Bacteria 931
530 Ga0495606_0419619 3300046507 Bacteria 692
531 Ga0495610_0113972 3300046512 Bacteria 1194
532 Ga0495610_0120520 3300046512 Bacteria 1150
533 Ga0495620_0199217 3300046515 Bacteria 770
534 Ga0495631_0002780 3300046518 Bacteria 9702
535 Ga0495631_0033298 3300046518 Bacteria 2316
536 Ga0495631_0270415 3300046518 Bacteria 724
537 Ga0495632_0023143 3300046519 Bacteria 3321
538 Ga0495632_0045460 3300046519 Bacteria 2187
539 Ga0495637_0037864 3300046520 Bacteria 2091
540 Ga0495637_0107835 3300046520 Bacteria 1082
541 Ga0495643_0103037 3300046522 Bacteria 1460
542 Ga0495648_0395461 3300046524 Bacteria 619
543 Ga0495642_0021934 3300046528 Bacteria 2513
544 Ga0495642_0225353 3300046528 Bacteria 819
545 Ga0495654_0001432 3300046530 Bacteria 16416
546 Ga0495654_0100168 3300046530 Bacteria 1335
547 Ga0495665_0112033 3300046531 Bacteria 1431
548 Ga0495586_0022810 3300046535 Bacteria 3340
549 Ga0495598_0125615 3300046537 Bacteria 874
550 Ga0495609_0015522 3300046538 Bacteria 3564
551 Ga0495609_0212352 3300046538 Bacteria 806
552 Ga0495597_0000247 3300046542 Bacteria 49379
553 Ga0495597_0006202 3300046542 Bacteria 6204
554 Ga0495597_0006566 3300046542 Bacteria 5999
555 Ga0495597_0026037 3300046542 Bacteria 2689
556 Ga0495597_0105138 3300046542 Bacteria 1187
557 Ga0495622_0339689 3300046557 Bacteria 651
558 Ga0495633_0006692 3300046558 Bacteria 6784
559 Ga0495633_0175176 3300046558 Bacteria 988
560 Ga0495668_0013620 3300046616 Bacteria 4790
561 Ga0495668_0016359 3300046616 Bacteria 4311
562 Ga0495668_0153935 3300046616 Bacteria 1259
563 Ga0495668_0343665 3300046616 Bacteria 819
564 Ga0495611_0014166 3300046648 Bacteria 3403
565 Ga0495625_0000012 3300046660 Bacteria 363006
566 Ga0495625_0008569 3300046660 Bacteria 8704
567 Ga0495625_0064368 3300046660 Bacteria 2586
568 Ga0495625_0235619 3300046660 Bacteria 1194
569 Ga0495635_0015395 3300046663 Bacteria 5349
570 Ga0495659_0245138 3300046664 Bacteria 745
571 Ga0495661_0000917 3300046665 Bacteria 27026
572 Ga0495661_0272388 3300046665 Bacteria 856
573 Ga0495647_0155160 3300046681 Bacteria 984
574 Ga0495613_0056607 3300046689 Bacteria 2879
575 Ga0495613_0534501 3300046689 Bacteria 786
576 Ga0495670_0000164 3300046691 Bacteria 29058
577 Ga0495670_0304846 3300046691 Bacteria 854
578 Ga0495671_0195832 3300046692 Bacteria 981
579 Ga0495649_0011013 3300046694 Bacteria 5327
580 Ga0495649_0098412 3300046694 Bacteria 1556
581 Ga0495649_0225673 3300046694 Bacteria 968
582 Ga0495649_0247977 3300046694 Bacteria 915
583 Ga0495589_0000994 3300046794 Bacteria 17205
584 Ga0495589_0008215 3300046794 Bacteria 5457
585 Ga0495660_0024909 3300046810 Bacteria 3403
586 Ga0495660_0177636 3300046810 Bacteria 1032
587 Ga0495660_0201694 3300046810 Bacteria 949
588 Ga0495604_0016868 3300047317 Bacteria 5839
589 Ga0495636_0018153 3300047318 Bacteria 2821
590 Ga0495636_0259750 3300047318 Bacteria 805
591 Ga0495674_0047598 3300047319 Bacteria 3801
592 Ga0495674_0641986 3300047319 Bacteria 838
593 Ga0495672_0000093 3300047320 Bacteria 145111
594 Ga0495672_0002148 3300047320 Bacteria 18433
595 Ga0495672_0111975 3300047320 Bacteria 1463
596 Ga0495672_0270936 3300047320 Bacteria 815
597 Ga0495680_0003473 3300047322 Bacteria 15490
598 Ga0495683_0004538 3300047323 Bacteria 7858
599 Ga0495683_0008031 3300047323 Bacteria 5666
600 Ga0495683_0062904 3300047323 Bacteria 1835
601 Ga0495687_011099 3300047443 Bacteria 4872
602 Ga0495687_071676 3300047443 Bacteria 1387
603 Ga0495675_0491627 3300047444 Bacteria 705
604 Ga0495677_0007568 3300047445 Bacteria 4054
605 Ga0495679_081727 3300047446 Bacteria 916
606 Ga0495681_0000363 3300047470 Bacteria 35486
607 Ga0495686_0000148 3300047472 Bacteria 137236
608 Ga0495686_0273076 3300047472 Bacteria 942
609 Ga0495593_0064424 3300047673 Bacteria 1913
610 Ga0495614_0013968 3300048089 Bacteria 3520
611 Ga0495626_0001431 3300048091 Bacteria 18978
612 Ga0495626_0079080 3300048091 Bacteria 1463
613 Ga0495626_0085083 3300048091 Bacteria 1399
614 Ga0495626_0133624 3300048091 Bacteria 1057
615 Ga0496100_0303717 3300048903 Bacteria 1195
616 Ga0496100_0563834 3300048903 Bacteria 882
617 Ga0496101_0078367 3300048904 Bacteria 2437
618 Ga0496101_0375965 3300048904 Bacteria 1117
619 Ga0496102_0028337 3300048905 Bacteria 5001
620 Ga0496102_0081592 3300048905 Bacteria 2982
621 Ga0496102_1040571 3300048905 Bacteria 739
622 Ga0496103_0152174 3300048906 Bacteria 1482
623 Ga0496103_0220705 3300048906 Bacteria 1219
624 Ga0496103_0572378 3300048906 Bacteria 720
625 Ga0496104_0064221 3300048907 Bacteria 3483
626 Ga0496104_0275303 3300048907 Bacteria 1596
627 Ga0496104_0479330 3300048907 Bacteria 1155
628 Ga0496105_0105397 3300048908 Bacteria 2327
629 Ga0496105_0399064 3300048908 Bacteria 1092
630 Ga0496106_0676042 3300048909 Bacteria 824
631 Ga0496107_0317377 3300048910 Bacteria 1160
632 Ga0496107_0354722 3300048910 Bacteria 1091
633 Ga0496108_0147306 3300048911 Bacteria 2030
634 Ga0496108_0844141 3300048911 Bacteria 788
635 Ga0496109_0228554 3300048912 Bacteria 1750
636 Ga0496110_1673255 3300048913 Unclassified 546
637 Ga0496112_0020656 3300048915 Bacteria 6245
638 Ga0496112_0222165 3300048915 Bacteria 1845
639 Ga0496112_0234606 3300048915 Bacteria 1788
640 Ga0496114_1620495 3300048917 Unclassified 535
641 Ga0496116_0000634 3300048919 Bacteria 46010
642 Ga0496116_0037456 3300048919 Bacteria 3382
643 Ga0496117_0000155 3300048920 Bacteria 146091
644 Ga0496118_0000066 3300048921 Bacteria 207678
645 Ga0496118_0254997 3300048921 Bacteria 994
646 Ga0496119_0000499 3300048922 Bacteria 53522
647 Ga0496119_0122632 3300048922 Bacteria 1426
648 Ga0496120_0000370 3300048923 Bacteria 73138
649 Ga0496120_0018632 3300048923 Bacteria 4466
650 Ga0496120_0359487 3300048923 Bacteria 652
651 Ga0496120_0409370 3300048923 Bacteria 597
652 Ga0496121_0000619 3300048924 Bacteria 66079
653 Ga0496121_0006925 3300048924 Bacteria 13821
654 Ga0496121_0185966 3300048924 Bacteria 1494
655 Ga0496121_0298945 3300048924 Bacteria 1093
656 Ga0496121_0506058 3300048924 Bacteria 765
657 Ga0496121_0598494 3300048924 Bacteria 681
658 Ga0496124_0016299 3300048927 Bacteria 7074
659 Ga0496125_0004890 3300048928 Bacteria 15196
660 Ga0496125_0022603 3300048928 Bacteria 5834
661 Ga0496125_0148458 3300048928 Bacteria 1615
662 Ga0496125_0194237 3300048928 Bacteria 1337
663 Ga0496125_0561475 3300048928 Bacteria 630
664 Ga0496126_0002850 3300048929 Bacteria 22616
665 Ga0496126_0010810 3300048929 Bacteria 9526
666 Ga0496126_0191826 3300048929 Bacteria 1730
667 Ga0496126_0213899 3300048929 Bacteria 1622
668 Ga0496126_1328475 3300048929 Bacteria 522
669 Ga0495682_0003801 3300049460 Bacteria 6638
670 Ga0501031_0319494 3300049568 Bacteria 1006
671 Ga0501033_0000805 3300049570 Bacteria 28711
672 Ga0501036_0028410 3300049572 Bacteria 4726
673 Ga0501036_0108082 3300049572 Bacteria 2352
674 Ga0501036_0216209 3300049572 Bacteria 1610
675 Ga0501036_0814688 3300049572 Bacteria 768
676 Ga0501037_0000582 3300049573 Bacteria 28727
677 Ga0501037_0098752 3300049573 Bacteria 2109
678 Ga0501037_0323154 3300049573 Bacteria 1068
679 Ga0501037_0461574 3300049573 Bacteria 865
680 Ga0501038_0003235 3300049574 Bacteria 15179
681 Ga0501038_0009487 3300049574 Bacteria 8929
682 Ga0501038_0099982 3300049574 Bacteria 2417
683 Ga0501038_0162454 3300049574 Bacteria 1814
684 Ga0501039_0033474 3300049575 Bacteria 3962
685 Ga0501039_0096621 3300049575 Bacteria 2303
686 Ga0501039_0325494 3300049575 Bacteria 1208
687 Ga0501039_0505008 3300049575 Bacteria 949
688 Ga0501040_0004099 3300049576 Bacteria 9475
689 Ga0501040_0033773 3300049576 Bacteria 3468
690 Ga0501040_0313074 3300049576 Bacteria 1122
691 Ga0501041_0000590 3300049577 Bacteria 18968
692 Ga0501041_0004782 3300049577 Bacteria 7863
693 Ga0501041_0305120 3300049577 Bacteria 1003
694 Ga0501042_0005517 3300049578 Bacteria 8154
695 Ga0501042_0079843 3300049578 Bacteria 2344
696 Ga0501043_0002452 3300049579 Bacteria 15684
697 Ga0501043_0135359 3300049579 Bacteria 1930
698 Ga0501043_0282417 3300049579 Bacteria 1272
699 Ga0501043_0366304 3300049579 Bacteria 1093
700 Ga0501043_0545686 3300049579 Bacteria 862
701 Ga0501046_0008944 3300049580 Bacteria 8699
702 Ga0501046_0013750 3300049580 Bacteria 6843
703 Ga0501046_0115662 3300049580 Bacteria 2045
704 Ga0501047_0396962 3300049581 Bacteria 1212
705 Ga0501047_0983265 3300049581 Bacteria 657
706 Ga0501047_1298074 3300049581 Bacteria 542
707 Ga0501048_0003792 3300049582 Bacteria 11540
708 Ga0501048_0054360 3300049582 Bacteria 2844
709 Ga0501048_0087171 3300049582 Bacteria 2203
710 Ga0501048_0120558 3300049582 Bacteria 1853
711 Ga0501068_0014074 3300049584 Bacteria 4567
712 Ga0501068_0152570 3300049584 Bacteria 1452
713 Ga0501068_0437529 3300049584 Bacteria 845
714 Ga0501068_0575896 3300049584 Bacteria 733
715 Ga0501069_0000003 3300049585 Bacteria 210301
716 Ga0501070_0000647 3300049586 Bacteria 32035
717 Ga0501070_1050392 3300049586 Bacteria 630
718 Ga0501071_0002353 3300049587 Bacteria 11436
719 Ga0501071_0004332 3300049587 Bacteria 8997
720 Ga0501071_0037511 3300049587 Bacteria 3461
721 Ga0501071_0040348 3300049587 Bacteria 3340
722 Ga0501072_0076318 3300049588 Bacteria 2651
723 Ga0501072_0212164 3300049588 Bacteria 1543
724 Ga0501072_0403614 3300049588 Bacteria 1084
725 Ga0501073_0025325 3300049589 Bacteria 4256
726 Ga0501074_0000677 3300049590 Bacteria 21291
727 Ga0501074_0026694 3300049590 Bacteria 4187
728 Ga0501075_0000868 3300049591 Bacteria 19100
729 Ga0501075_0029945 3300049591 Bacteria 4027
730 Ga0501075_0112911 3300049591 Bacteria 2066
731 Ga0501075_0247000 3300049591 Bacteria 1360
732 Ga0501076_0001007 3300049592 Bacteria 18491
733 Ga0501076_0007528 3300049592 Bacteria 7922
734 Ga0501076_0075842 3300049592 Bacteria 2696
735 Ga0501076_0125139 3300049592 Bacteria 2083
736 Ga0501077_0002578 3300049593 Bacteria 10868
737 Ga0501077_0059908 3300049593 Bacteria 2416
738 Ga0501249_001312 3300049679 Bacteria 5177
739 Ga0501225_0001764 3300049705 Bacteria 6775
740 Ga0501079_0001595 3300049741 Bacteria 16122
741 Ga0501079_0213692 3300049741 Bacteria 1506
742 Ga0501080_0000590 3300049742 Bacteria 28661
743 Ga0501080_0007272 3300049742 Bacteria 9990
744 Ga0501080_0008284 3300049742 Bacteria 9418
745 Ga0501080_0172049 3300049742 Bacteria 1997
746 Ga0501081_0008038 3300049743 Bacteria 6844
747 Ga0501081_0014939 3300049743 Bacteria 5121
748 Ga0501081_0086002 3300049743 Bacteria 2207
749 Ga0501083_0000036 3300049744 Bacteria 95904
750 Ga0501083_0081084 3300049744 Bacteria 2151
751 Ga0501262_000301 3300049759 Bacteria 6024
752 Ga0501035_0000358 3300049822 Bacteria 52587
753 Ga0501035_0057686 3300049822 Bacteria 3461
754 Ga0501044_0000016 3300049823 Bacteria 231626
755 Ga0501044_0625815 3300049823 Bacteria 967
756 Ga0501044_0985325 3300049823 Bacteria 715
757 Ga0501045_0004235 3300049824 Bacteria 9890
758 Ga0501045_0006020 3300049824 Bacteria 8397
759 Ga0501045_0150506 3300049824 Bacteria 1731
760 Ga0501045_0534335 3300049824 Bacteria 870
761 nmdc:mga03683_31787_c1 3300050489 Bacteria 2120
762 nmdc:mga03683_403646_c1 3300050489 Bacteria 653
763 nmdc:mga03683_42155_c1 3300050489 Bacteria 1877
764 nmdc:mga03683_48688_c1 3300050489 Bacteria 1762
765 nmdc:mga03n38_119231_c1 3300050490 Bacteria 1295
766 nmdc:mga03n38_25127_c1 3300050490 Bacteria 2442
767 nmdc:mga03n38_40863_c1 3300050490 Bacteria 2018
768 nmdc:mga00v17_276016_c1 3300050491 Bacteria 1091
769 nmdc:mga00v17_801971_c1 3300050491 Bacteria 600
770 nmdc:mga00v17_85704_c1 3300050491 Bacteria 1973
771 nmdc:mga0yw44_33585_c1 3300050492 Bacteria 2999
772 nmdc:mga0k408_156427_c1 3300050493 Bacteria 1358
773 nmdc:mga0k408_21239_c1 3300050493 Bacteria 3645
774 nmdc:mga0k408_22223_c1 3300050493 Bacteria 3571
775 nmdc:mga0k408_231214_c1 3300050493 Bacteria 1104
776 nmdc:mga0k408_482024_c1 3300050493 Bacteria 736
777 nmdc:mga0k408_565517_c1 3300050493 Bacteria 672
778 nmdc:mga06z11_212815_c1 3300050494 Bacteria 1127
779 nmdc:mga06z11_532656_c1 3300050494 Bacteria 712
780 nmdc:mga06z11_644078_c1 3300050494 Bacteria 645
781 nmdc:mga06z11_690634_c1 3300050494 Bacteria 622
782 nmdc:mga04h51_59450_c1 3300050495 Bacteria 1306
783 nmdc:mga07m45_2210_c1 3300050496 Bacteria 9083
784 nmdc:mga07m45_262033_c1 3300050496 Bacteria 1006
785 nmdc:mga07m45_7307_c1 3300050496 Bacteria 5636
786 nmdc:mga09592_424975_c1 3300050508 Bacteria 1147
787 nmdc:mga0sz30_179089_c1 3300050516 Bacteria 940
788 Ga0500583_0147949 3300053092 Bacteria 1168
789 Ga0500651_0446278 3300053093 Bacteria 720
790 Ga0500651_0758586 3300053093 Unclassified 515
791 Ga0500558_143548 3300053106 Unclassified 896
792 Ga0500572_004400 3300053111 Unclassified 3196
793 Ga0500607_061847 3300053121 Bacteria 1958
794 Ga0500614_035000 3300053123 Bacteria 1249
795 Ga0500658_0498490 3300053134 Bacteria 551
796 Ga0500559_0159209 3300053136 Bacteria 1061
797 Ga0500559_0286239 3300053136 Bacteria 775
798 Ga0500559_0504094 3300053136 Bacteria 556
799 Ga0500568_0000342 3300053139 Bacteria 36454
800 Ga0500616_0051636 3300053153 Bacteria 2166
801 Ga0500619_152871 3300053154 Bacteria 784
802 Ga0500622_0087080 3300053156 Bacteria 1555
803 Ga0500639_056863 3300053163 Bacteria 2025
804 Ga0500639_119401 3300053163 Unclassified 1269
805 Ga0500637_0038941 3300053178 Bacteria 2680
806 Ga0501084_0003968 3300054114 Bacteria 12052
807 Ga0501084_0007594 3300054114 Bacteria 8938
808 Ga0501084_0401097 3300054114 Bacteria 1159
809 Ga0590074_033097 3300059423 Bacteria 917
810 Ga0587084_060776 3300059477 Bacteria 692
811 Ga0587066_028045 3300059490 Bacteria 983
812 Ga0587066_106019 3300059490 Bacteria 645
813 Ga0587066_189452 3300059490 Unclassified 535
814 Ga0587070_122989 3300059491 Bacteria 623
815 Ga0587073_0145987 3300059492 Bacteria 664
816 Ga0587073_0214665 3300059492 Unclassified 584
817 Ga0587077_093617 3300059493 Bacteria 710
818 Ga0587080_053967 3300059503 Bacteria 766
819 Ga0587082_019999 3300059504 Bacteria 1080
820 Ga0587083_0118141 3300059505 Bacteria 682
821 Ga0587086_047045 3300059507 Unclassified 685
822 Ga0587088_071466 3300059508 Bacteria 724
823 Ga0587090_002505 3300059510 Bacteria 2032
824 Ga0587090_040870 3300059510 Bacteria 816
825 Ga0587090_054707 3300059510 Bacteria 741
826 Ga0587092_052743 3300059512 Unclassified 741
827 Ga0587067_064632 3300059640 Bacteria 776
828 Ga0587068_074027 3300059641 Unclassified 677
829 Ga0587076_064626 3300059645 Bacteria 746
830 Ga0587079_098194 3300059647 Unclassified 695
831 Ga0587107_047316 3300059652 Bacteria 717
832 Ga0587071_048307 3300060344 Bacteria 873
833 Ga0587071_078314 3300060344 Bacteria 732
834 Ga0587111_0092050 3300060346 Unclassified 742
835 Ga0501082_0014009 3300060353 Bacteria 6896
836 Ga0501082_0039248 3300060353 Bacteria 4085
837 Ga0501082_0294363 3300060353 Bacteria 1413
838 Ga0501082_0366662 3300060353 Bacteria 1256
839 Ga0501082_0618569 3300060353 Bacteria 948
840 Ga0466962_0008046 3300061719 Bacteria 5053
841 Ga0530510_0002196 3300061734 Bacteria 13384
842 Ga0530510_0011076 3300061734 Bacteria 6326

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005471 Ga0070698_101280321 Ga0070698_1012803211 130
2 3300049573 Ga0501037_0461574 Ga0501037_0461574_141_536 131
3 3300049574 Ga0501038_0162454 Ga0501038_0162454_440_835 131
4 3300049575 Ga0501039_0505008 Ga0501039_0505008_176_571 131
5 3300049576 Ga0501040_0033773 Ga0501040_0033773_1434_1829 131
6 3300049577 Ga0501041_0305120 Ga0501041_0305120_53_448 131
7 3300049579 Ga0501043_0366304 Ga0501043_0366304_250_645 131
8 3300049580 Ga0501046_0115662 Ga0501046_0115662_480_875 131
9 3300049582 Ga0501048_0120558 Ga0501048_0120558_192_587 131
10 3300049587 Ga0501071_0037511 Ga0501071_0037511_527_922 131
11 3300049588 Ga0501072_0212164 Ga0501072_0212164_911_1306 131
12 3300049591 Ga0501075_0112911 Ga0501075_0112911_1300_1695 131
13 3300049592 Ga0501076_0125139 Ga0501076_0125139_455_850 131
14 3300049743 Ga0501081_0086002 Ga0501081_0086002_572_967 131
15 3300049824 Ga0501045_0150506 Ga0501045_0150506_147_542 131
16 3300060353 Ga0501082_0294363 Ga0501082_0294363_411_806 131
17 3300037588 Ga0316581_0005800 Ga0316581_0005800_500_916 134
18 3300039438 Ga0436360_1159934 Ga0436360_1159934_48_452 134
19 iso_pu_bacteria 2513237146 2513927167 134
20 iso_pu_bacteria 2599185170 2599415394 134
21 iso_pu_bacteria 2765235802 2765468310 134
22 iso_pu_bacteria 2767802442 2770196272 134
23 iso_pu_bacteria 2775506902 2776268587 134
24 iso_pu_bacteria 2775506904 2776285332 134
25 iso_pu_bacteria 2837678835 2837681354 134
26 iso_pu_bacteria 2838035591 2838038884 134
27 iso_pu_bacteria 2838661181 2838664526 134
28 iso_pu_bacteria 2839993093 2839997629 134
29 iso_pu_bacteria 2840764183 2840770562 134
30 iso_pu_bacteria 2874123672 2874124814 134
31 iso_pu_bacteria 2885312484 2885318590 134
32 iso_pu_bacteria 2885326080 2885328027 134
33 iso_pu_bacteria 2885334103 2885337101 134
34 iso_pu_bacteria 2889790730 2889795580 134
35 iso_pu_bacteria 2889914905 2889916142 134
36 iso_pu_bacteria 2894652903 2894657366 134
37 iso_pu_bacteria 2904578770 2904581893 134
38 iso_pu_bacteria 2919119836 2919123561 134
39 iso_pu_bacteria 2928521798 2928525375 134
40 iso_pu_bacteria 2933016740 2933019139 134
41 iso_pu_bacteria 2954011201 2954011641 134
42 iso_pu_bacteria 2977864932 2977867944 134
43 iso_pu_bacteria 2996336353 2996341190 134
44 iso_pu_bacteria 3003930520 3003935601 134
45 iso_pu_bacteria 2513237150 2513955304 135
46 iso_pu_bacteria 2643221628 2644159308 135
47 iso_pu_bacteria 2643221660 2644338254 135
48 iso_pu_bacteria 2738541277 2738721228 135
49 iso_pu_bacteria 2738543019 2739280427 135
50 iso_pu_bacteria 2919462493 2919466836 135
51 iso_pu_bacteria 2929520902 2929524849 135
52 iso_pu_bacteria 2945972063 2945976957 135
53 iso_pu_bacteria 644736347 644751725 135
54 3300003323 rootH1_10197737 rootH1_101977372 138
55 3300003323 rootH1_10342955 rootH1_103429552 138
56 3300003577 Ga0007416J51690_1062202 Ga0007416J51690_10622022 138
57 3300004800 Ga0058861_11899052 Ga0058861_118990521 138
58 3300004803 Ga0058862_11428235 Ga0058862_114282351 138
59 3300005289 Ga0065704_10350557 Ga0065704_103505572 138
60 3300005295 Ga0065707_10083026 Ga0065707_100830269 138
61 3300005329 Ga0070683_100149523 Ga0070683_1001495232 138
62 3300005329 Ga0070683_100222286 Ga0070683_1002222862 138
63 3300005329 Ga0070683_100350078 Ga0070683_1003500782 138
64 3300005335 Ga0070666_11163125 Ga0070666_111631251 138
65 3300005336 Ga0070680_100002272 Ga0070680_1000022722 138
66 3300005336 Ga0070680_100054814 Ga0070680_1000548142 138
67 3300005336 Ga0070680_100210072 Ga0070680_1002100722 138
68 3300005336 Ga0070680_100489952 Ga0070680_1004899522 138
69 3300005336 Ga0070680_100612113 Ga0070680_1006121132 138
70 3300005336 Ga0070680_101239291 Ga0070680_1012392911 138
71 3300005341 Ga0070691_10395840 Ga0070691_103958402 138
72 3300005344 Ga0070661_101079788 Ga0070661_1010797881 138
73 3300005355 Ga0070671_100000182 Ga0070671_10000018223 138
74 3300005356 Ga0070674_101383634 Ga0070674_1013836342 138
75 3300005367 Ga0070667_100054646 Ga0070667_1000546463 138
76 3300005367 Ga0070667_100786611 Ga0070667_1007866112 138
77 3300005367 Ga0070667_100875641 Ga0070667_1008756411 138
78 3300005434 Ga0070709_10206284 Ga0070709_102062841 138
79 3300005436 Ga0070713_100913627 Ga0070713_1009136272 138
80 3300005437 Ga0070710_10459449 Ga0070710_104594491 138
81 3300005437 Ga0070710_11482374 Ga0070710_114823741 138
82 3300005458 Ga0070681_10000436 Ga0070681_1000043629 138
83 3300005458 Ga0070681_10004460 Ga0070681_100044604 138
84 3300005458 Ga0070681_10009629 Ga0070681_100096293 138
85 3300005458 Ga0070681_10016296 Ga0070681_100162966 138
86 3300005458 Ga0070681_10032105 Ga0070681_100321055 138
87 3300005458 Ga0070681_10200921 Ga0070681_102009212 138
88 3300005459 Ga0068867_100131642 Ga0068867_1001316422 138
89 3300005466 Ga0070685_10833538 Ga0070685_108335382 138
90 3300005530 Ga0070679_100009702 Ga0070679_1000097024 138
91 3300005530 Ga0070679_100046866 Ga0070679_1000468664 138
92 3300005530 Ga0070679_100049877 Ga0070679_1000498774 138
93 3300005530 Ga0070679_100179819 Ga0070679_1001798192 138
94 3300005530 Ga0070679_100245951 Ga0070679_1002459511 138
95 3300005530 Ga0070679_100589524 Ga0070679_1005895242 138
96 3300005535 Ga0070684_100298250 Ga0070684_1002982502 138
97 3300005535 Ga0070684_100376661 Ga0070684_1003766612 138
98 3300005536 Ga0070697_100302829 Ga0070697_1003028292 138
99 3300005544 Ga0070686_100214006 Ga0070686_1002140062 138
100 3300005548 Ga0070665_100000894 Ga0070665_10000089426 138
101 3300005548 Ga0070665_100002017 Ga0070665_1000020175 138
102 3300005548 Ga0070665_100077289 Ga0070665_1000772892 138
103 3300005563 Ga0068855_100004475 Ga0068855_1000044754 138
104 3300005563 Ga0068855_100011278 Ga0068855_10001127810 138
105 3300005563 Ga0068855_100041746 Ga0068855_1000417465 138
106 3300005563 Ga0068855_100188623 Ga0068855_1001886233 138
107 3300005563 Ga0068855_100277542 Ga0068855_1002775422 138
108 3300005563 Ga0068855_101009202 Ga0068855_1010092022 138
109 3300005563 Ga0068855_101841820 Ga0068855_1018418202 138
110 3300005577 Ga0068857_100151089 Ga0068857_1001510892 138
111 3300005614 Ga0068856_100508342 Ga0068856_1005083422 138
112 3300005614 Ga0068856_101929294 Ga0068856_1019292941 138
113 3300005614 Ga0068856_102213181 Ga0068856_1022131812 138
114 3300005616 Ga0068852_101065469 Ga0068852_1010654692 138
115 3300005616 Ga0068852_101118687 Ga0068852_1011186872 138
116 3300005617 Ga0068859_100000520 Ga0068859_10000052011 138
117 3300005617 Ga0068859_100906620 Ga0068859_1009066202 138
118 3300005617 Ga0068859_100944714 Ga0068859_1009447142 138
119 3300005719 Ga0068861_101816067 Ga0068861_1018160672 138
120 3300005841 Ga0068863_100002040 Ga0068863_1000020409 138
121 3300005841 Ga0068863_101868559 Ga0068863_1018685591 138
122 3300005842 Ga0068858_100000238 Ga0068858_10000023842 138
123 3300005842 Ga0068858_101020577 Ga0068858_1010205772 138
124 3300005843 Ga0068860_100068490 Ga0068860_1000684903 138
125 3300005844 Ga0068862_100081566 Ga0068862_1000815664 138
126 3300005844 Ga0068862_100238412 Ga0068862_1002384122 138
127 3300005937 Ga0081455_10000519 Ga0081455_1000051915 138
128 3300005937 Ga0081455_10398852 Ga0081455_103988522 138
129 3300005981 Ga0081538_10000326 Ga0081538_1000032625 138
130 3300005981 Ga0081538_10010430 Ga0081538_100104305 138
131 3300005985 Ga0081539_10000302 Ga0081539_1000030269 138
132 3300006042 Ga0075368_10019180 Ga0075368_100191803 138
133 3300006178 Ga0075367_10212579 Ga0075367_102125792 138
134 3300006178 Ga0075367_10398849 Ga0075367_103988492 138
135 3300006844 Ga0075428_100050198 Ga0075428_1000501985 138
136 3300006846 Ga0075430_100178607 Ga0075430_1001786072 138
137 3300006931 Ga0097620_100000520 Ga0097620_10000052011 138
138 3300006931 Ga0097620_100906559 Ga0097620_1009065592 138
139 3300006931 Ga0097620_100944725 Ga0097620_1009447251 138
140 3300009092 Ga0105250_10038591 Ga0105250_100385912 138
141 3300009093 Ga0105240_10001162 Ga0105240_1000116218 138
142 3300009093 Ga0105240_10001667 Ga0105240_1000166719 138
143 3300009093 Ga0105240_10015663 Ga0105240_1001566310 138
144 3300009093 Ga0105240_10021151 Ga0105240_100211517 138
145 3300009093 Ga0105240_10047887 Ga0105240_100478875 138
146 3300009093 Ga0105240_10074921 Ga0105240_100749213 138
147 3300009093 Ga0105240_10106085 Ga0105240_101060853 138
148 3300009093 Ga0105240_10152858 Ga0105240_101528582 138
149 3300009093 Ga0105240_10409484 Ga0105240_104094842 138
150 3300009101 Ga0105247_10000317 Ga0105247_100003177 138
151 3300009174 Ga0105241_10327387 Ga0105241_103273872 138
152 3300009177 Ga0105248_10010633 Ga0105248_100106339 138
153 3300009177 Ga0105248_12511268 Ga0105248_125112682 138
154 3300009545 Ga0105237_10019273 Ga0105237_100192737 138
155 3300009545 Ga0105237_10087812 Ga0105237_100878123 138
156 3300009545 Ga0105237_10153844 Ga0105237_101538443 138
157 3300009545 Ga0105237_10265108 Ga0105237_102651082 138
158 3300009551 Ga0105238_10001249 Ga0105238_1000124912 138
159 3300009551 Ga0105238_10446996 Ga0105238_104469962 138
160 3300009551 Ga0105238_10457379 Ga0105238_104573792 138
161 3300009551 Ga0105238_10753255 Ga0105238_107532551 138
162 3300009551 Ga0105238_10943328 Ga0105238_109433282 138
163 3300009551 Ga0105238_11179053 Ga0105238_111790532 138
164 3300009553 Ga0105249_10035103 Ga0105249_100351032 138
165 3300009553 Ga0105249_10103087 Ga0105249_101030872 138
166 3300009553 Ga0105249_10260800 Ga0105249_102608002 138
167 3300010375 Ga0105239_10259093 Ga0105239_102590932 138
168 3300010375 Ga0105239_10419475 Ga0105239_104194753 138
169 3300010375 Ga0105239_10581895 Ga0105239_105818952 138
170 3300011119 Ga0105246_10082746 Ga0105246_100827462 138
171 3300011119 Ga0105246_11879640 Ga0105246_118796401 138
172 3300013059 Ga0154012_133202 Ga0154012_1332021 138
173 3300013104 Ga0157370_10002946 Ga0157370_1000294620 138
174 3300013104 Ga0157370_10134036 Ga0157370_101340362 138
175 3300013104 Ga0157370_10813794 Ga0157370_108137942 138
176 3300013105 Ga0157369_10071865 Ga0157369_100718652 138
177 3300013105 Ga0157369_10072482 Ga0157369_100724823 138
178 3300013105 Ga0157369_10140259 Ga0157369_101402592 138
179 3300013105 Ga0157369_10349786 Ga0157369_103497862 138
180 3300013105 Ga0157369_10553053 Ga0157369_105530532 138
181 3300013296 Ga0157374_10186550 Ga0157374_101865502 138
182 3300013296 Ga0157374_11963974 Ga0157374_119639741 138
183 3300013306 Ga0163162_10706553 Ga0163162_107065532 138
184 3300013306 Ga0163162_11501143 Ga0163162_115011432 138
185 3300013307 Ga0157372_10331880 Ga0157372_103318803 138
186 3300013307 Ga0157372_10625310 Ga0157372_106253102 138
187 3300013307 Ga0157372_10976517 Ga0157372_109765171 138
188 3300013307 Ga0157372_11318126 Ga0157372_113181261 138
189 3300013307 Ga0157372_11483110 Ga0157372_114831102 138
190 3300013307 Ga0157372_11696678 Ga0157372_116966781 138
191 3300014325 Ga0163163_10034925 Ga0163163_100349254 138
192 3300014325 Ga0163163_10237106 Ga0163163_102371062 138
193 3300014325 Ga0163163_10310041 Ga0163163_103100412 138
194 3300014326 Ga0157380_10002413 Ga0157380_100024132 138
195 3300014326 Ga0157380_11021630 Ga0157380_110216302 138
196 3300014968 Ga0157379_10005758 Ga0157379_100057586 138
197 3300014968 Ga0157379_10111408 Ga0157379_101114083 138
198 3300014968 Ga0157379_10122569 Ga0157379_101225692 138
199 3300014969 Ga0157376_10388174 Ga0157376_103881742 138
200 3300020069 Ga0197907_10413154 Ga0197907_104131541 138
201 3300020069 Ga0197907_11430259 Ga0197907_114302592 138
202 3300020070 Ga0206356_10150101 Ga0206356_101501011 138
203 3300020070 Ga0206356_10154097 Ga0206356_101540972 138
204 3300020075 Ga0206349_1014102 Ga0206349_10141021 138
205 3300020076 Ga0206355_1446838 Ga0206355_14468382 138
206 3300020077 Ga0206351_10312048 Ga0206351_103120481 138
207 3300020077 Ga0206351_10444308 Ga0206351_104443081 138
208 3300020078 Ga0206352_10235695 Ga0206352_102356952 138
209 3300020081 Ga0206354_10279087 Ga0206354_102790871 138
210 3300021361 Ga0213872_10134835 Ga0213872_101348352 138
211 3300022467 Ga0224712_10049638 Ga0224712_100496382 138
212 3300025261 Ga0209233_1010192 Ga0209233_10101922 138
213 3300025297 Ga0209758_1130091 Ga0209758_11300912 138
214 3300025898 Ga0207692_10204403 Ga0207692_102044032 138
215 3300025898 Ga0207692_10402123 Ga0207692_104021231 138
216 3300025900 Ga0207710_10000323 Ga0207710_1000032313 138
217 3300025903 Ga0207680_10137618 Ga0207680_101376182 138
218 3300025903 Ga0207680_11063096 Ga0207680_110630961 138
219 3300025904 Ga0207647_10000883 Ga0207647_100008835 138
220 3300025906 Ga0207699_10243311 Ga0207699_102433112 138
221 3300025911 Ga0207654_10591849 Ga0207654_105918492 138
222 3300025912 Ga0207707_10000035 Ga0207707_1000003589 138
223 3300025912 Ga0207707_10000591 Ga0207707_1000059113 138
224 3300025912 Ga0207707_10014435 Ga0207707_100144355 138
225 3300025912 Ga0207707_10017249 Ga0207707_100172495 138
226 3300025912 Ga0207707_10019236 Ga0207707_100192362 138
227 3300025912 Ga0207707_10055496 Ga0207707_100554963 138
228 3300025912 Ga0207707_10135238 Ga0207707_101352382 138
229 3300025913 Ga0207695_10003023 Ga0207695_1000302319 138
230 3300025913 Ga0207695_10042598 Ga0207695_100425983 138
231 3300025913 Ga0207695_10049299 Ga0207695_100492994 138
232 3300025913 Ga0207695_10050901 Ga0207695_100509015 138
233 3300025913 Ga0207695_10054673 Ga0207695_100546733 138
234 3300025913 Ga0207695_10073016 Ga0207695_100730163 138
235 3300025913 Ga0207695_10098888 Ga0207695_100988883 138
236 3300025913 Ga0207695_10254683 Ga0207695_102546832 138
237 3300025913 Ga0207695_10395849 Ga0207695_103958492 138
238 3300025914 Ga0207671_10065192 Ga0207671_100651922 138
239 3300025914 Ga0207671_10133611 Ga0207671_101336112 138
240 3300025914 Ga0207671_10269604 Ga0207671_102696042 138
241 3300025917 Ga0207660_10029544 Ga0207660_100295443 138
242 3300025917 Ga0207660_10068052 Ga0207660_100680521 138
243 3300025917 Ga0207660_10096148 Ga0207660_100961481 138
244 3300025917 Ga0207660_10195048 Ga0207660_101950482 138
245 3300025917 Ga0207660_10633968 Ga0207660_106339682 138
246 3300025917 Ga0207660_11091230 Ga0207660_110912301 138
247 3300025921 Ga0207652_10001126 Ga0207652_100011262 138
248 3300025921 Ga0207652_10035735 Ga0207652_100357353 138
249 3300025921 Ga0207652_10039665 Ga0207652_100396652 138
250 3300025921 Ga0207652_10084245 Ga0207652_100842452 138
251 3300025921 Ga0207652_10522750 Ga0207652_105227502 138
252 3300025924 Ga0207694_10030487 Ga0207694_100304872 138
253 3300025924 Ga0207694_10044347 Ga0207694_100443474 138
254 3300025924 Ga0207694_10473590 Ga0207694_104735902 138
255 3300025924 Ga0207694_10491999 Ga0207694_104919992 138
256 3300025924 Ga0207694_11714079 Ga0207694_117140791 138
257 3300025928 Ga0207700_10140699 Ga0207700_101406992 138
258 3300025928 Ga0207700_10466101 Ga0207700_104661012 138
259 3300025931 Ga0207644_10017250 Ga0207644_100172504 138
260 3300025941 Ga0207711_10061041 Ga0207711_100610412 138
261 3300025944 Ga0207661_10081576 Ga0207661_100815762 138
262 3300025944 Ga0207661_10109963 Ga0207661_101099632 138
263 3300025949 Ga0207667_10034479 Ga0207667_100344795 138
264 3300025949 Ga0207667_10086834 Ga0207667_100868342 138
265 3300025949 Ga0207667_10127246 Ga0207667_101272463 138
266 3300025961 Ga0207712_10046447 Ga0207712_100464473 138
267 3300025961 Ga0207712_10125596 Ga0207712_101255963 138
268 3300025981 Ga0207640_10723938 Ga0207640_107239382 138
269 3300025986 Ga0207658_10583965 Ga0207658_105839652 138
270 3300025986 Ga0207658_10790284 Ga0207658_107902842 138
271 3300026035 Ga0207703_10000911 Ga0207703_1000091110 138
272 3300026035 Ga0207703_10401786 Ga0207703_104017862 138
273 3300026078 Ga0207702_10916730 Ga0207702_109167302 138
274 3300026078 Ga0207702_10966259 Ga0207702_109662592 138
275 3300026078 Ga0207702_11494150 Ga0207702_114941501 138
276 3300026078 Ga0207702_11495845 Ga0207702_114958452 138
277 3300026088 Ga0207641_10004471 Ga0207641_100044718 138
278 3300026088 Ga0207641_11439354 Ga0207641_114393541 138
279 3300026089 Ga0207648_10043845 Ga0207648_100438452 138
280 3300026116 Ga0207674_10060944 Ga0207674_100609442 138
281 3300026116 Ga0207674_10706202 Ga0207674_107062022 138
282 3300026118 Ga0207675_100933661 Ga0207675_1009336611 138
283 3300026121 Ga0207683_10426413 Ga0207683_104264132 138
284 3300028379 Ga0268266_10002272 Ga0268266_1000227215 138
285 3300028379 Ga0268266_10005412 Ga0268266_100054127 138
286 3300028379 Ga0268266_10023766 Ga0268266_100237662 138
287 3300028379 Ga0268266_10092788 Ga0268266_100927882 138
288 3300028380 Ga0268265_10006056 Ga0268265_100060569 138
289 3300028380 Ga0268265_10354534 Ga0268265_103545342 138
290 3300028794 Ga0307515_10005767 Ga0307515_1000576717 138
291 3300028794 Ga0307515_10694272 Ga0307515_106942721 138
292 3300030521 Ga0307511_10000066 Ga0307511_1000006615 138
293 3300030521 Ga0307511_10042895 Ga0307511_100428952 138
294 3300031241 Ga0265325_10196107 Ga0265325_101961072 138
295 3300031344 Ga0265316_10059793 Ga0265316_100597932 138
296 3300031507 Ga0307509_10000003 Ga0307509_10000003478 138
297 3300031616 Ga0307508_10494399 Ga0307508_104943992 138
298 3300031711 Ga0265314_10170207 Ga0265314_101702072 138
299 3300031727 Ga0316576_10001058 Ga0316576_1000105811 138
300 3300031727 Ga0316576_10253096 Ga0316576_102530962 138
301 3300031727 Ga0316576_11083987 Ga0316576_110839871 138
302 3300031733 Ga0316577_10018697 Ga0316577_100186974 138
303 3300031838 Ga0307518_10330609 Ga0307518_103306092 138
304 3300032004 Ga0307414_10508731 Ga0307414_105087312 138
305 3300032126 Ga0307415_101363996 Ga0307415_1013639961 138
306 3300032133 Ga0316583_10040801 Ga0316583_100408013 138
307 3300032139 Ga0316580_10018788 Ga0316580_100187882 138
308 3300033180 Ga0307510_10000001 Ga0307510_10000001714 138
309 3300033180 Ga0307510_10029875 Ga0307510_100298754 138
310 3300035085 Ga0373929_0076463 Ga0373929_0076463_290_709 138
311 3300035088 Ga0373940_0018278 Ga0373940_0018278_24_443 138
312 3300035114 Ga0373939_0065438 Ga0373939_0065438_258_677 138
313 3300035170 Ga0373943_0727079 Ga0373943_0727079_10_426 138
314 3300035398 Ga0316574_0100488 Ga0316574_0100488_580_1014 138
315 3300035691 Ga0373931_0046417 Ga0373931_0046417_205_624 138
316 3300035695 Ga0373927_0096669 Ga0373927_0096669_495_914 138
317 3300036712 Ga0316584_0185249 Ga0316584_0185249_531_953 138
318 3300037418 Ga0395900_0312943 Ga0395900_0312943_592_1008 138
319 3300037418 Ga0395900_0453681 Ga0395900_0453681_342_758 138
320 3300037418 Ga0395900_0671146 Ga0395900_0671146_533_958 138
321 3300037466 Ga0395898_0012166 Ga0395898_0012166_248_664 138
322 3300037466 Ga0395898_0030222 Ga0395898_0030222_951_1367 138
323 3300037466 Ga0395898_0402728 Ga0395898_0402728_532_960 138
324 3300037466 Ga0395898_0826767 Ga0395898_0826767_234_650 138
325 3300038443 Ga0395901_0603155 Ga0395901_0603155_189_605 138
326 3300039437 Ga0436365_0910310 Ga0436365_0910310_397_813 138
327 3300039447 Ga0436361_0046600 Ga0436361_0046600_49_474 138
328 3300039447 Ga0436361_0085081 Ga0436361_0085081_10967_11407 138
329 3300039450 Ga0436363_0525771 Ga0436363_0525771_283_705 138
330 3300041413 Ga0439465_0013609 Ga0439465_0013609_1110_1529 138
331 3300041413 Ga0439465_0201946 Ga0439465_0201946_20_439 138
332 3300041458 Ga0451798_1133053 Ga0451798_1133053_131_547 138
333 3300041498 Ga0451841_0321022 Ga0451841_0321022_1406_1822 138
334 3300041505 Ga0451849_1329306 Ga0451849_1329306_95_511 138
335 3300041512 Ga0451853_2174092 Ga0451853_2174092_410_826 138
336 3300042004 Ga0439445_0105864 Ga0439445_0105864_292_711 138
337 3300042006 Ga0439432_076300 Ga0439432_076300_31_450 138
338 3300044656 Ga0466969_0007263 Ga0466969_0007263_3706_4140 138
339 3300044656 Ga0466969_0026062 Ga0466969_0026062_876_1292 138
340 3300044656 Ga0466969_0027188 Ga0466969_0027188_2254_2670 138
341 3300044683 Ga0466965_0067375 Ga0466965_0067375_968_1384 138
342 3300044684 Ga0466966_0004979 Ga0466966_0004979_2870_3286 138
343 3300044684 Ga0466966_0082942 Ga0466966_0082942_332_748 138
344 3300044684 Ga0466966_0089068 Ga0466966_0089068_293_709 138
345 3300044684 Ga0466966_0136638 Ga0466966_0136638_251_787 138
346 3300044684 Ga0466966_0185026 Ga0466966_0185026_803_1219 138
347 3300044684 Ga0466966_0442695 Ga0466966_0442695_40_456 138
348 3300044693 Ga0466961_0000480 Ga0466961_0000480_8752_9168 138
349 3300044693 Ga0466961_0036032 Ga0466961_0036032_715_1149 138
350 3300044694 Ga0466963_1329470 Ga0466963_1329470_75_491 138
351 3300044706 Ga0466964_0000160 Ga0466964_0000160_17535_17951 138
352 3300044712 Ga0453684_0203861 Ga0453684_0203861_1202_1639 138
353 3300044712 Ga0453684_1009376 Ga0453684_1009376_230_652 138
354 3300044719 Ga0466971_0000238 Ga0466971_0000238_20517_20933 138
355 3300044719 Ga0466971_0144131 Ga0466971_0144131_595_1011 138
356 3300044735 Ga0466968_0053401 Ga0466968_0053401_274_690 138
357 3300044735 Ga0466968_0348242 Ga0466968_0348242_42_458 138
358 3300044765 Ga0466970_0000364 Ga0466970_0000364_483_899 138
359 3300044765 Ga0466970_0011225 Ga0466970_0011225_3284_3718 138
360 3300044842 Ga0466957_0196527 Ga0466957_0196527_769_1185 138
361 3300045049 Ga0466959_0007062 Ga0466959_0007062_3851_4285 138
362 3300045049 Ga0466959_0010129 Ga0466959_0010129_3851_4267 138
363 3300045049 Ga0466959_0018297 Ga0466959_0018297_4266_4682 138
364 3300045049 Ga0466959_0026567 Ga0466959_0026567_3264_3680 138
365 3300045049 Ga0466959_0049772 Ga0466959_0049772_352_768 138
366 3300045049 Ga0466959_0054997 Ga0466959_0054997_902_1438 138
367 3300045049 Ga0466959_0152313 Ga0466959_0152313_555_971 138
368 3300045051 Ga0451576_0080312 Ga0451576_0080312_2663_3100 138
369 3300045836 Ga0466958_0132853 Ga0466958_0132853_188_604 138
370 3300046460 Ga0495638_0001474 Ga0495638_0001474_17558_17992 138
371 3300046473 Ga0495582_0661853 Ga0495582_0661853_50_478 138
372 3300046507 Ga0495606_0201739 Ga0495606_0201739_664_1080 138
373 3300046507 Ga0495606_0419619 Ga0495606_0419619_261_677 138
374 3300046519 Ga0495632_0045460 Ga0495632_0045460_888_1304 138
375 3300046522 Ga0495643_0103037 Ga0495643_0103037_484_900 138
376 3300046538 Ga0495609_0212352 Ga0495609_0212352_243_659 138
377 3300046557 Ga0495622_0339689 Ga0495622_0339689_200_616 138
378 3300046558 Ga0495633_0175176 Ga0495633_0175176_533_949 138
379 3300046660 Ga0495625_0008569 Ga0495625_0008569_7179_7613 138
380 3300046664 Ga0495659_0245138 Ga0495659_0245138_36_452 138
381 3300046691 Ga0495670_0304846 Ga0495670_0304846_32_451 138
382 3300046694 Ga0495649_0225673 Ga0495649_0225673_455_871 138
383 3300047319 Ga0495674_0641986 Ga0495674_0641986_113_529 138
384 3300047320 Ga0495672_0111975 Ga0495672_0111975_636_1064 138
385 3300047443 Ga0495687_071676 Ga0495687_071676_493_909 138
386 3300048903 Ga0496100_0563834 Ga0496100_0563834_288_707 138
387 3300048905 Ga0496102_0028337 Ga0496102_0028337_2144_2560 138
388 3300048906 Ga0496103_0152174 Ga0496103_0152174_513_929 138
389 3300048906 Ga0496103_0220705 Ga0496103_0220705_228_644 138
390 3300048907 Ga0496104_0275303 Ga0496104_0275303_368_787 138
391 3300048907 Ga0496104_0479330 Ga0496104_0479330_480_899 138
392 3300048908 Ga0496105_0399064 Ga0496105_0399064_212_631 138
393 3300048909 Ga0496106_0676042 Ga0496106_0676042_254_673 138
394 3300048910 Ga0496107_0354722 Ga0496107_0354722_589_1005 138
395 3300048911 Ga0496108_0147306 Ga0496108_0147306_528_944 138
396 3300048911 Ga0496108_0844141 Ga0496108_0844141_227_646 138
397 3300048912 Ga0496109_0228554 Ga0496109_0228554_427_843 138
398 3300048913 Ga0496110_1673255 Ga0496110_1673255_35_454 138
399 3300048915 Ga0496112_0020656 Ga0496112_0020656_1712_2128 138
400 3300048915 Ga0496112_0234606 Ga0496112_0234606_239_658 138
401 3300048917 Ga0496114_1620495 Ga0496114_1620495_90_506 138
402 3300048919 Ga0496116_0037456 Ga0496116_0037456_668_1084 138
403 3300048920 Ga0496117_0000155 Ga0496117_0000155_116248_116664 138
404 3300048921 Ga0496118_0000066 Ga0496118_0000066_90883_91299 138
405 3300048921 Ga0496118_0254997 Ga0496118_0254997_306_740 138
406 3300048922 Ga0496119_0000499 Ga0496119_0000499_14500_14916 138
407 3300048922 Ga0496119_0122632 Ga0496119_0122632_151_567 138
408 3300048923 Ga0496120_0000370 Ga0496120_0000370_52010_52426 138
409 3300048923 Ga0496120_0018632 Ga0496120_0018632_115_531 138
410 3300048923 Ga0496120_0359487 Ga0496120_0359487_156_575 138
411 3300048923 Ga0496120_0409370 Ga0496120_0409370_123_539 138
412 3300048924 Ga0496121_0000619 Ga0496121_0000619_37068_37484 138
413 3300048924 Ga0496121_0185966 Ga0496121_0185966_549_983 138
414 3300048924 Ga0496121_0298945 Ga0496121_0298945_310_726 138
415 3300048924 Ga0496121_0506058 Ga0496121_0506058_61_477 138
416 3300048927 Ga0496124_0016299 Ga0496124_0016299_6081_6497 138
417 3300048928 Ga0496125_0004890 Ga0496125_0004890_9441_9857 138
418 3300048928 Ga0496125_0022603 Ga0496125_0022603_3713_4129 138
419 3300048928 Ga0496125_0148458 Ga0496125_0148458_330_770 138
420 3300048928 Ga0496125_0194237 Ga0496125_0194237_891_1307 138
421 3300048928 Ga0496125_0561475 Ga0496125_0561475_90_506 138
422 3300048929 Ga0496126_0002850 Ga0496126_0002850_15892_16356 138
423 3300048929 Ga0496126_0010810 Ga0496126_0010810_1909_2325 138
424 3300048929 Ga0496126_0191826 Ga0496126_0191826_454_870 138
425 3300048929 Ga0496126_0213899 Ga0496126_0213899_880_1308 138
426 3300048929 Ga0496126_1328475 Ga0496126_1328475_87_503 138
427 3300049568 Ga0501031_0319494 Ga0501031_0319494_493_915 138
428 3300049570 Ga0501033_0000805 Ga0501033_0000805_3418_3837 138
429 3300049572 Ga0501036_0028410 Ga0501036_0028410_2607_3029 138
430 3300049572 Ga0501036_0108082 Ga0501036_0108082_1117_1536 138
431 3300049572 Ga0501036_0216209 Ga0501036_0216209_1115_1537 138
432 3300049572 Ga0501036_0814688 Ga0501036_0814688_101_520 138
433 3300049573 Ga0501037_0000582 Ga0501037_0000582_3426_3845 138
434 3300049573 Ga0501037_0098752 Ga0501037_0098752_1311_1730 138
435 3300049573 Ga0501037_0323154 Ga0501037_0323154_404_826 138
436 3300049574 Ga0501038_0003235 Ga0501038_0003235_8331_8753 138
437 3300049574 Ga0501038_0009487 Ga0501038_0009487_4880_5302 138
438 3300049574 Ga0501038_0099982 Ga0501038_0099982_680_1099 138
439 3300049575 Ga0501039_0033474 Ga0501039_0033474_198_620 138
440 3300049575 Ga0501039_0096621 Ga0501039_0096621_1736_2158 138
441 3300049575 Ga0501039_0325494 Ga0501039_0325494_688_1107 138
442 3300049576 Ga0501040_0004099 Ga0501040_0004099_2714_3136 138
443 3300049576 Ga0501040_0313074 Ga0501040_0313074_448_870 138
444 3300049577 Ga0501041_0000590 Ga0501041_0000590_10829_11251 138
445 3300049577 Ga0501041_0004782 Ga0501041_0004782_2007_2429 138
446 3300049578 Ga0501042_0005517 Ga0501042_0005517_1714_2136 138
447 3300049578 Ga0501042_0079843 Ga0501042_0079843_1466_1888 138
448 3300049579 Ga0501043_0002452 Ga0501043_0002452_3428_3847 138
449 3300049579 Ga0501043_0135359 Ga0501043_0135359_398_820 138
450 3300049579 Ga0501043_0282417 Ga0501043_0282417_588_1010 138
451 3300049579 Ga0501043_0545686 Ga0501043_0545686_268_687 138
452 3300049580 Ga0501046_0008944 Ga0501046_0008944_6892_7314 138
453 3300049580 Ga0501046_0013750 Ga0501046_0013750_1544_1966 138
454 3300049581 Ga0501047_0396962 Ga0501047_0396962_677_1096 138
455 3300049581 Ga0501047_0983265 Ga0501047_0983265_66_494 138
456 3300049581 Ga0501047_1298074 Ga0501047_1298074_74_493 138
457 3300049582 Ga0501048_0003792 Ga0501048_0003792_7911_8333 138
458 3300049582 Ga0501048_0054360 Ga0501048_0054360_425_847 138
459 3300049582 Ga0501048_0087171 Ga0501048_0087171_817_1236 138
460 3300049584 Ga0501068_0014074 Ga0501068_0014074_440_862 138
461 3300049584 Ga0501068_0152570 Ga0501068_0152570_598_1017 138
462 3300049584 Ga0501068_0437529 Ga0501068_0437529_312_734 138
463 3300049584 Ga0501068_0575896 Ga0501068_0575896_229_648 138
464 3300049585 Ga0501069_0000003 Ga0501069_0000003_3446_3865 138
465 3300049586 Ga0501070_0000647 Ga0501070_0000647_3446_3865 138
466 3300049586 Ga0501070_1050392 Ga0501070_1050392_129_551 138
467 3300049587 Ga0501071_0002353 Ga0501071_0002353_6092_6514 138
468 3300049587 Ga0501071_0004332 Ga0501071_0004332_6145_6567 138
469 3300049587 Ga0501071_0040348 Ga0501071_0040348_1327_1746 138
470 3300049588 Ga0501072_0076318 Ga0501072_0076318_2006_2428 138
471 3300049588 Ga0501072_0403614 Ga0501072_0403614_608_1030 138
472 3300049589 Ga0501073_0025325 Ga0501073_0025325_3433_3852 138
473 3300049590 Ga0501074_0000677 Ga0501074_0000677_13004_13423 138
474 3300049590 Ga0501074_0026694 Ga0501074_0026694_988_1410 138
475 3300049591 Ga0501075_0000868 Ga0501075_0000868_5343_5765 138
476 3300049591 Ga0501075_0029945 Ga0501075_0029945_3189_3611 138
477 3300049591 Ga0501075_0247000 Ga0501075_0247000_351_773 138
478 3300049592 Ga0501076_0001007 Ga0501076_0001007_17719_18141 138
479 3300049592 Ga0501076_0007528 Ga0501076_0007528_7326_7748 138
480 3300049592 Ga0501076_0075842 Ga0501076_0075842_1864_2286 138
481 3300049593 Ga0501077_0002578 Ga0501077_0002578_3499_3921 138
482 3300049593 Ga0501077_0059908 Ga0501077_0059908_533_955 138
483 3300049741 Ga0501079_0001595 Ga0501079_0001595_4681_5103 138
484 3300049741 Ga0501079_0213692 Ga0501079_0213692_263_685 138
485 3300049742 Ga0501080_0000590 Ga0501080_0000590_24825_25244 138
486 3300049742 Ga0501080_0007272 Ga0501080_0007272_2519_2941 138
487 3300049742 Ga0501080_0008284 Ga0501080_0008284_425_847 138
488 3300049742 Ga0501080_0172049 Ga0501080_0172049_354_773 138
489 3300049743 Ga0501081_0008038 Ga0501081_0008038_4538_4960 138
490 3300049743 Ga0501081_0014939 Ga0501081_0014939_4264_4686 138
491 3300049744 Ga0501083_0000036 Ga0501083_0000036_22648_23067 138
492 3300049744 Ga0501083_0081084 Ga0501083_0081084_40_462 138
493 3300049822 Ga0501035_0000358 Ga0501035_0000358_48734_49153 138
494 3300049822 Ga0501035_0057686 Ga0501035_0057686_846_1268 138
495 3300049823 Ga0501044_0000016 Ga0501044_0000016_3438_3857 138
496 3300049823 Ga0501044_0625815 Ga0501044_0625815_440_859 138
497 3300049823 Ga0501044_0985325 Ga0501044_0985325_148_567 138
498 3300049824 Ga0501045_0004235 Ga0501045_0004235_9190_9612 138
499 3300049824 Ga0501045_0006020 Ga0501045_0006020_6731_7153 138
500 3300049824 Ga0501045_0534335 Ga0501045_0534335_336_758 138
501 3300050494 nmdc:mga06z11_212815_c1 nmdc:mga06z11_212815_c1_302_721 138
502 3300050494 nmdc:mga06z11_532656_c1 nmdc:mga06z11_532656_c1_98_517 138
503 3300050495 nmdc:mga04h51_59450_c1 nmdc:mga04h51_59450_c1_455_874 138
504 3300050508 nmdc:mga09592_424975_c1 nmdc:mga09592_424975_c1_221_637 138
505 3300053092 Ga0500583_0147949 Ga0500583_0147949_696_1112 138
506 3300053093 Ga0500651_0758586 Ga0500651_0758586_11_427 138
507 3300053106 Ga0500558_143548 Ga0500558_143548_105_521 138
508 3300053111 Ga0500572_004400 Ga0500572_004400_2146_2562 138
509 3300053123 Ga0500614_035000 Ga0500614_035000_721_1137 138
510 3300053136 Ga0500559_0159209 Ga0500559_0159209_30_446 138
511 3300053136 Ga0500559_0286239 Ga0500559_0286239_180_596 138
512 3300053136 Ga0500559_0504094 Ga0500559_0504094_27_443 138
513 3300053139 Ga0500568_0000342 Ga0500568_0000342_27986_28408 138
514 3300053153 Ga0500616_0051636 Ga0500616_0051636_148_567 138
515 3300053156 Ga0500622_0087080 Ga0500622_0087080_98_514 138
516 3300053163 Ga0500639_056863 Ga0500639_056863_1300_1716 138
517 3300053163 Ga0500639_119401 Ga0500639_119401_457_873 138
518 3300053178 Ga0500637_0038941 Ga0500637_0038941_165_584 138
519 3300054114 Ga0501084_0003968 Ga0501084_0003968_5384_5806 138
520 3300054114 Ga0501084_0007594 Ga0501084_0007594_7051_7473 138
521 3300054114 Ga0501084_0401097 Ga0501084_0401097_85_507 138
522 3300059423 Ga0590074_033097 Ga0590074_033097_298_714 138
523 3300059477 Ga0587084_060776 Ga0587084_060776_97_513 138
524 3300059490 Ga0587066_028045 Ga0587066_028045_313_729 138
525 3300059490 Ga0587066_106019 Ga0587066_106019_189_605 138
526 3300059490 Ga0587066_189452 Ga0587066_189452_72_488 138
527 3300059491 Ga0587070_122989 Ga0587070_122989_153_569 138
528 3300059492 Ga0587073_0145987 Ga0587073_0145987_89_505 138
529 3300059492 Ga0587073_0214665 Ga0587073_0214665_36_452 138
530 3300059493 Ga0587077_093617 Ga0587077_093617_160_576 138
531 3300059503 Ga0587080_053967 Ga0587080_053967_35_451 138
532 3300059504 Ga0587082_019999 Ga0587082_019999_93_509 138
533 3300059505 Ga0587083_0118141 Ga0587083_0118141_212_628 138
534 3300059507 Ga0587086_047045 Ga0587086_047045_225_641 138
535 3300059508 Ga0587088_071466 Ga0587088_071466_268_684 138
536 3300059510 Ga0587090_002505 Ga0587090_002505_1486_1914 138
537 3300059510 Ga0587090_040870 Ga0587090_040870_184_600 138
538 3300059510 Ga0587090_054707 Ga0587090_054707_296_712 138
539 3300059512 Ga0587092_052743 Ga0587092_052743_232_648 138
540 3300059640 Ga0587067_064632 Ga0587067_064632_267_683 138
541 3300059641 Ga0587068_074027 Ga0587068_074027_168_584 138
542 3300059645 Ga0587076_064626 Ga0587076_064626_225_641 138
543 3300059647 Ga0587079_098194 Ga0587079_098194_45_461 138
544 3300059652 Ga0587107_047316 Ga0587107_047316_140_556 138
545 3300060344 Ga0587071_048307 Ga0587071_048307_332_760 138
546 3300060344 Ga0587071_078314 Ga0587071_078314_221_637 138
547 3300060346 Ga0587111_0092050 Ga0587111_0092050_105_521 138
548 3300060353 Ga0501082_0014009 Ga0501082_0014009_29_451 138
549 3300060353 Ga0501082_0039248 Ga0501082_0039248_3404_3826 138
550 3300060353 Ga0501082_0366662 Ga0501082_0366662_654_1073 138
551 3300060353 Ga0501082_0618569 Ga0501082_0618569_109_528 138
552 3300061719 Ga0466962_0008046 Ga0466962_0008046_2059_2475 138
553 3300061734 Ga0530510_0002196 Ga0530510_0002196_7408_7830 138
554 3300061734 Ga0530510_0011076 Ga0530510_0011076_3275_3697 138
555 3300003187 JGI25151J46595_10013989 JGI25151J46595_100139892 139
556 3300003773 Ga0055537_1000031 Ga0055537_100003176 139
557 3300003784 Ga0055534_1000091 Ga0055534_100009154 139
558 3300003790 Ga0055528_1000237 Ga0055528_10002375 139
559 3300005330 Ga0070690_100115809 Ga0070690_1001158092 139
560 3300005333 Ga0070677_10137679 Ga0070677_101376792 139
561 3300005335 Ga0070666_10423012 Ga0070666_104230121 139
562 3300005337 Ga0070682_100429128 Ga0070682_1004291282 139
563 3300005338 Ga0068868_100216387 Ga0068868_1002163872 139
564 3300005338 Ga0068868_100231660 Ga0068868_1002316602 139
565 3300005347 Ga0070668_100174748 Ga0070668_1001747482 139
566 3300005353 Ga0070669_100842900 Ga0070669_1008429001 139
567 3300005355 Ga0070671_100088684 Ga0070671_1000886842 139
568 3300005364 Ga0070673_100084201 Ga0070673_1000842014 139
569 3300005364 Ga0070673_100174299 Ga0070673_1001742992 139
570 3300005365 Ga0070688_100224657 Ga0070688_1002246572 139
571 3300005366 Ga0070659_100693978 Ga0070659_1006939781 139
572 3300005367 Ga0070667_101121107 Ga0070667_1011211072 139
573 3300005445 Ga0070708_100052798 Ga0070708_1000527984 139
574 3300005455 Ga0070663_100598938 Ga0070663_1005989381 139
575 3300005456 Ga0070678_100219571 Ga0070678_1002195712 139
576 3300005459 Ga0068867_100017657 Ga0068867_1000176572 139
577 3300005459 Ga0068867_100072358 Ga0068867_1000723584 139
578 3300005466 Ga0070685_10317582 Ga0070685_103175821 139
579 3300005468 Ga0070707_100046185 Ga0070707_1000461852 139
580 3300005530 Ga0070679_100258242 Ga0070679_1002582422 139
581 3300005535 Ga0070684_100740874 Ga0070684_1007408741 139
582 3300005539 Ga0068853_100015474 Ga0068853_1000154745 139
583 3300005539 Ga0068853_100733601 Ga0068853_1007336012 139
584 3300005543 Ga0070672_100190896 Ga0070672_1001908962 139
585 3300005544 Ga0070686_100670634 Ga0070686_1006706342 139
586 3300005547 Ga0070693_101446554 Ga0070693_1014465541 139
587 3300005548 Ga0070665_100686744 Ga0070665_1006867442 139
588 3300005563 Ga0068855_101111756 Ga0068855_1011117562 139
589 3300005577 Ga0068857_100300917 Ga0068857_1003009171 139
590 3300005577 Ga0068857_101119810 Ga0068857_1011198102 139
591 3300005578 Ga0068854_100126429 Ga0068854_1001264292 139
592 3300005578 Ga0068854_100704270 Ga0068854_1007042702 139
593 3300005578 Ga0068854_101075506 Ga0068854_1010755062 139
594 3300005617 Ga0068859_100420510 Ga0068859_1004205102 139
595 3300005718 Ga0068866_10188164 Ga0068866_101881642 139
596 3300005718 Ga0068866_10848300 Ga0068866_108483002 139
597 3300005719 Ga0068861_100473397 Ga0068861_1004733972 139
598 3300005841 Ga0068863_100203413 Ga0068863_1002034132 139
599 3300005842 Ga0068858_100248130 Ga0068858_1002481302 139
600 3300005842 Ga0068858_101219736 Ga0068858_1012197362 139
601 3300005843 Ga0068860_100030988 Ga0068860_1000309885 139
602 3300005843 Ga0068860_100706964 Ga0068860_1007069642 139
603 3300005843 Ga0068860_101391978 Ga0068860_1013919782 139
604 3300005985 Ga0081539_10000118 Ga0081539_1000011876 139
605 3300006042 Ga0075368_10200405 Ga0075368_102004052 139
606 3300006048 Ga0075363_100007460 Ga0075363_1000074602 139
607 3300006058 Ga0075432_10129798 Ga0075432_101297982 139
608 3300006058 Ga0075432_10162313 Ga0075432_101623132 139
609 3300006058 Ga0075432_10308850 Ga0075432_103088502 139
610 3300006177 Ga0075362_10069434 Ga0075362_100694341 139
611 3300006177 Ga0075362_10094322 Ga0075362_100943221 139
612 3300006177 Ga0075362_10377752 Ga0075362_103777522 139
613 3300006178 Ga0075367_10170055 Ga0075367_101700552 139
614 3300006186 Ga0075369_10198906 Ga0075369_101989062 139
615 3300006195 Ga0075366_10091873 Ga0075366_100918732 139
616 3300006195 Ga0075366_10117380 Ga0075366_101173802 139
617 3300006195 Ga0075366_10220156 Ga0075366_102201562 139
618 3300006195 Ga0075366_10256253 Ga0075366_102562532 139
619 3300006353 Ga0075370_10002134 Ga0075370_100021344 139
620 3300006353 Ga0075370_10080980 Ga0075370_100809802 139
621 3300006353 Ga0075370_10247444 Ga0075370_102474441 139
622 3300006353 Ga0075370_10267506 Ga0075370_102675062 139
623 3300006358 Ga0068871_100331372 Ga0068871_1003313722 139
624 3300006358 Ga0068871_100474382 Ga0068871_1004743821 139
625 3300006881 Ga0068865_100061356 Ga0068865_1000613562 139
626 3300006881 Ga0068865_100295809 Ga0068865_1002958092 139
627 3300006914 Ga0075436_101062670 Ga0075436_1010626702 139
628 3300006931 Ga0097620_100420492 Ga0097620_1004204922 139
629 3300006948 Ga0099826_10067367 Ga0099826_100673672 139
630 3300009093 Ga0105240_10239642 Ga0105240_102396422 139
631 3300009101 Ga0105247_10601347 Ga0105247_106013472 139
632 3300009148 Ga0105243_10569224 Ga0105243_105692242 139
633 3300009148 Ga0105243_10615050 Ga0105243_106150502 139
634 3300009176 Ga0105242_10220758 Ga0105242_102207582 139
635 3300009176 Ga0105242_10434518 Ga0105242_104345181 139
636 3300009177 Ga0105248_10055365 Ga0105248_100553655 139
637 3300009545 Ga0105237_10075708 Ga0105237_100757082 139
638 3300009553 Ga0105249_10093275 Ga0105249_100932753 139
639 3300009553 Ga0105249_10415449 Ga0105249_104154492 139
640 3300010375 Ga0105239_10006291 Ga0105239_1000629110 139
641 3300010375 Ga0105239_10953284 Ga0105239_109532841 139
642 3300011119 Ga0105246_10650062 Ga0105246_106500621 139
643 3300011119 Ga0105246_12231625 Ga0105246_122316251 139
644 3300012480 Ga0157346_1008417 Ga0157346_10084171 139
645 3300013100 Ga0157373_10036040 Ga0157373_100360404 139
646 3300013296 Ga0157374_10179292 Ga0157374_101792923 139
647 3300013296 Ga0157374_12258653 Ga0157374_122586532 139
648 3300013306 Ga0163162_10324760 Ga0163162_103247602 139
649 3300013308 Ga0157375_10109192 Ga0157375_101091922 139
650 3300014497 Ga0182008_10520408 Ga0182008_105204082 139
651 3300014968 Ga0157379_11879686 Ga0157379_118796861 139
652 3300014969 Ga0157376_10007118 Ga0157376_100071185 139
653 3300014969 Ga0157376_10381886 Ga0157376_103818862 139
654 3300015261 Ga0182006_1041130 Ga0182006_10411302 139
655 3300015261 Ga0182006_1041882 Ga0182006_10418822 139
656 3300015262 Ga0182007_10062239 Ga0182007_100622392 139
657 3300025263 Ga0209565_1000087 Ga0209565_1000087124 139
658 3300025273 Ga0209673_1000145 Ga0209673_1000145124 139
659 3300025291 Ga0209675_1000085 Ga0209675_1000085124 139
660 3300025292 Ga0209676_1027819 Ga0209676_10278192 139
661 3300025294 Ga0209025_1056253 Ga0209025_10562532 139
662 3300025295 Ga0209564_1048598 Ga0209564_10485981 139
663 3300025303 Ga0209051_1008057 Ga0209051_10080574 139
664 3300025899 Ga0207642_10382096 Ga0207642_103820962 139
665 3300025899 Ga0207642_10406550 Ga0207642_104065501 139
666 3300025903 Ga0207680_10464441 Ga0207680_104644412 139
667 3300025907 Ga0207645_10495790 Ga0207645_104957901 139
668 3300025910 Ga0207684_10003211 Ga0207684_100032113 139
669 3300025913 Ga0207695_10061520 Ga0207695_100615206 139
670 3300025914 Ga0207671_10420981 Ga0207671_104209812 139
671 3300025923 Ga0207681_10531466 Ga0207681_105314661 139
672 3300025925 Ga0207650_10453410 Ga0207650_104534102 139
673 3300025935 Ga0207709_10191223 Ga0207709_101912232 139
674 3300025935 Ga0207709_10377197 Ga0207709_103771972 139
675 3300025935 Ga0207709_10532277 Ga0207709_105322772 139
676 3300025935 Ga0207709_10763963 Ga0207709_107639632 139
677 3300025936 Ga0207670_10062949 Ga0207670_100629493 139
678 3300025937 Ga0207669_10300162 Ga0207669_103001622 139
679 3300025939 Ga0207665_10957966 Ga0207665_109579662 139
680 3300025940 Ga0207691_10049884 Ga0207691_100498841 139
681 3300025941 Ga0207711_10942310 Ga0207711_109423102 139
682 3300025949 Ga0207667_10849128 Ga0207667_108491282 139
683 3300025961 Ga0207712_10074032 Ga0207712_100740322 139
684 3300025961 Ga0207712_10685403 Ga0207712_106854031 139
685 3300025981 Ga0207640_10260182 Ga0207640_102601822 139
686 3300025986 Ga0207658_10315236 Ga0207658_103152362 139
687 3300026023 Ga0207677_10754155 Ga0207677_107541551 139
688 3300026035 Ga0207703_10272687 Ga0207703_102726872 139
689 3300026041 Ga0207639_10307309 Ga0207639_103073092 139
690 3300026067 Ga0207678_10084391 Ga0207678_100843911 139
691 3300026078 Ga0207702_11818525 Ga0207702_118185251 139
692 3300026088 Ga0207641_10311737 Ga0207641_103117372 139
693 3300026089 Ga0207648_10028691 Ga0207648_100286912 139
694 3300026089 Ga0207648_10053380 Ga0207648_100533802 139
695 3300026116 Ga0207674_10030361 Ga0207674_100303611 139
696 3300026118 Ga0207675_101275892 Ga0207675_1012758921 139
697 3300026121 Ga0207683_10155770 Ga0207683_101557702 139
698 3300026121 Ga0207683_10368550 Ga0207683_103685502 139
699 3300026142 Ga0207698_11389335 Ga0207698_113893352 139
700 3300027666 Ga0209282_1000304 Ga0209282_100030417 139
701 3300027717 Ga0209998_10141887 Ga0209998_101418872 139
702 3300027876 Ga0209974_10030485 Ga0209974_100304852 139
703 3300028379 Ga0268266_10896049 Ga0268266_108960492 139
704 3300028381 Ga0268264_10831818 Ga0268264_108318182 139
705 3300028786 Ga0307517_10296662 Ga0307517_102966622 139
706 3300028794 Ga0307515_10000692 Ga0307515_1000069229 139
707 3300030732 Ga0316176_1051753 Ga0316176_10517532 139
708 3300030742 Ga0316183_1029607 Ga0316183_10296079 139
709 3300031548 Ga0307408_100369660 Ga0307408_1003696602 139
710 3300031616 Ga0307508_10000909 Ga0307508_1000090927 139
711 3300031824 Ga0307413_10252925 Ga0307413_102529251 139
712 3300032002 Ga0307416_101618615 Ga0307416_1016186152 139
713 3300032004 Ga0307414_11696558 Ga0307414_116965581 139
714 3300032005 Ga0307411_10591647 Ga0307411_105916472 139
715 3300033180 Ga0307510_10030121 Ga0307510_100301215 139
716 3300033180 Ga0307510_10123884 Ga0307510_101238843 139
717 3300033180 Ga0307510_10378917 Ga0307510_103789172 139
718 3300035119 Ga0373956_0047759 Ga0373956_0047759_755_1180 139
719 3300041404 Ga0439436_0066993 Ga0439436_0066993_554_973 139
720 3300041407 Ga0439447_030412 Ga0439447_030412_347_766 139
721 3300041411 Ga0439466_0029987 Ga0439466_0029987_664_1083 139
722 3300041443 Ga0451789_0877240 Ga0451789_0877240_146_565 139
723 3300041459 Ga0451800_0561777 Ga0451800_0561777_105_524 139
724 3300041463 Ga0451804_1054772 Ga0451804_1054772_10_432 139
725 3300041494 Ga0451837_0412873 Ga0451837_0412873_53_472 139
726 3300041509 Ga0451843_0460145 Ga0451843_0460145_52_471 139
727 3300041512 Ga0451853_0858138 Ga0451853_0858138_71_490 139
728 3300041512 Ga0451853_3203100 Ga0451853_3203100_175_594 139
729 3300041512 Ga0451853_4094737 Ga0451853_4094737_44_463 139
730 3300042002 Ga0439442_017587 Ga0439442_017587_1042_1461 139
731 3300042002 Ga0439442_024107 Ga0439442_024107_763_1182 139
732 3300042002 Ga0439442_030527 Ga0439442_030527_506_925 139
733 3300042004 Ga0439445_0018338 Ga0439445_0018338_762_1181 139
734 3300042004 Ga0439445_0047600 Ga0439445_0047600_193_612 139
735 3300042006 Ga0439432_026342 Ga0439432_026342_454_873 139
736 3300042007 Ga0439449_0001524 Ga0439449_0001524_2333_2752 139
737 3300042010 Ga0439452_051499 Ga0439452_051499_300_719 139
738 3300042115 Ga0450911_021682 Ga0450911_021682_295_714 139
739 3300042122 Ga0450920_038479 Ga0450920_038479_84_503 139
740 3300042125 Ga0450923_011382 Ga0450923_011382_205_624 139
741 3300042130 Ga0450892_037154 Ga0450892_037154_97_516 139
742 3300042145 Ga0450906_004944 Ga0450906_004944_964_1383 139
743 3300042146 Ga0450907_007698 Ga0450907_007698_499_918 139
744 3300042147 Ga0450910_004617 Ga0450910_004617_866_1285 139
745 3300042184 Ga0450908_005650 Ga0450908_005650_499_918 139
746 3300042435 Ga0439434_0095217 Ga0439434_0095217_255_674 139
747 3300042531 Ga0450918_001232 Ga0450918_001232_3517_3936 139
748 3300042532 Ga0450893_0013544 Ga0450893_0013544_618_1037 139
749 3300045051 Ga0451576_2343414 Ga0451576_2343414_75_497 139
750 3300046459 Ga0495629_0604946 Ga0495629_0604946_23_445 139
751 3300046460 Ga0495638_0060229 Ga0495638_0060229_355_777 139
752 3300046471 Ga0495650_0004986 Ga0495650_0004986_5689_6108 139
753 3300046472 Ga0495580_0400565 Ga0495580_0400565_350_769 139
754 3300046474 Ga0495605_0005411 Ga0495605_0005411_260_682 139
755 3300046474 Ga0495605_0056737 Ga0495605_0056737_1397_1816 139
756 3300046491 Ga0495584_0189131 Ga0495584_0189131_101_532 139
757 3300046492 Ga0495585_0001873 Ga0495585_0001873_8956_9390 139
758 3300046500 Ga0495596_0028000 Ga0495596_0028000_1689_2111 139
759 3300046500 Ga0495596_0060673 Ga0495596_0060673_868_1290 139
760 3300046506 Ga0495583_0316976 Ga0495583_0316976_141_560 139
761 3300046507 Ga0495606_0271622 Ga0495606_0271622_445_867 139
762 3300046512 Ga0495610_0113972 Ga0495610_0113972_429_851 139
763 3300046512 Ga0495610_0120520 Ga0495610_0120520_618_1037 139
764 3300046515 Ga0495620_0199217 Ga0495620_0199217_292_726 139
765 3300046518 Ga0495631_0002780 Ga0495631_0002780_6610_7044 139
766 3300046518 Ga0495631_0033298 Ga0495631_0033298_796_1215 139
767 3300046518 Ga0495631_0270415 Ga0495631_0270415_43_465 139
768 3300046519 Ga0495632_0023143 Ga0495632_0023143_1202_1621 139
769 3300046520 Ga0495637_0037864 Ga0495637_0037864_1496_1915 139
770 3300046520 Ga0495637_0107835 Ga0495637_0107835_424_855 139
771 3300046524 Ga0495648_0395461 Ga0495648_0395461_26_445 139
772 3300046528 Ga0495642_0021934 Ga0495642_0021934_426_878 139
773 3300046528 Ga0495642_0225353 Ga0495642_0225353_237_656 139
774 3300046530 Ga0495654_0001432 Ga0495654_0001432_14590_15042 139
775 3300046530 Ga0495654_0100168 Ga0495654_0100168_56_475 139
776 3300046531 Ga0495665_0112033 Ga0495665_0112033_965_1387 139
777 3300046535 Ga0495586_0022810 Ga0495586_0022810_439_861 139
778 3300046537 Ga0495598_0125615 Ga0495598_0125615_323_742 139
779 3300046538 Ga0495609_0015522 Ga0495609_0015522_596_1048 139
780 3300046542 Ga0495597_0000247 Ga0495597_0000247_27849_28295 139
781 3300046542 Ga0495597_0006202 Ga0495597_0006202_5435_5857 139
782 3300046542 Ga0495597_0006566 Ga0495597_0006566_68_487 139
783 3300046542 Ga0495597_0026037 Ga0495597_0026037_435_866 139
784 3300046542 Ga0495597_0105138 Ga0495597_0105138_449_871 139
785 3300046558 Ga0495633_0006692 Ga0495633_0006692_2663_3097 139
786 3300046616 Ga0495668_0013620 Ga0495668_0013620_2604_3038 139
787 3300046616 Ga0495668_0016359 Ga0495668_0016359_1279_1731 139
788 3300046616 Ga0495668_0153935 Ga0495668_0153935_196_615 139
789 3300046616 Ga0495668_0343665 Ga0495668_0343665_184_630 139
790 3300046648 Ga0495611_0014166 Ga0495611_0014166_1966_2400 139
791 3300046660 Ga0495625_0000012 Ga0495625_0000012_331175_331594 139
792 3300046660 Ga0495625_0064368 Ga0495625_0064368_182_601 139
793 3300046660 Ga0495625_0235619 Ga0495625_0235619_402_833 139
794 3300046663 Ga0495635_0015395 Ga0495635_0015395_2123_2545 139
795 3300046665 Ga0495661_0000917 Ga0495661_0000917_8089_8523 139
796 3300046665 Ga0495661_0272388 Ga0495661_0272388_96_527 139
797 3300046681 Ga0495647_0155160 Ga0495647_0155160_28_450 139
798 3300046689 Ga0495613_0056607 Ga0495613_0056607_1068_1490 139
799 3300046689 Ga0495613_0534501 Ga0495613_0534501_309_731 139
800 3300046691 Ga0495670_0000164 Ga0495670_0000164_10074_10508 139
801 3300046692 Ga0495671_0195832 Ga0495671_0195832_121_540 139
802 3300046694 Ga0495649_0011013 Ga0495649_0011013_948_1367 139
803 3300046694 Ga0495649_0098412 Ga0495649_0098412_580_1002 139
804 3300046694 Ga0495649_0247977 Ga0495649_0247977_384_806 139
805 3300046794 Ga0495589_0000994 Ga0495589_0000994_3395_3841 139
806 3300046794 Ga0495589_0008215 Ga0495589_0008215_4206_4658 139
807 3300046810 Ga0495660_0024909 Ga0495660_0024909_28_447 139
808 3300046810 Ga0495660_0177636 Ga0495660_0177636_375_797 139
809 3300046810 Ga0495660_0201694 Ga0495660_0201694_41_460 139
810 3300047317 Ga0495604_0016868 Ga0495604_0016868_2738_3160 139
811 3300047318 Ga0495636_0018153 Ga0495636_0018153_1922_2341 139
812 3300047318 Ga0495636_0259750 Ga0495636_0259750_143_562 139
813 3300047319 Ga0495674_0047598 Ga0495674_0047598_2713_3132 139
814 3300047320 Ga0495672_0000093 Ga0495672_0000093_108197_108616 139
815 3300047320 Ga0495672_0002148 Ga0495672_0002148_7407_7859 139
816 3300047320 Ga0495672_0270936 Ga0495672_0270936_12_458 139
817 3300047322 Ga0495680_0003473 Ga0495680_0003473_330_752 139
818 3300047323 Ga0495683_0004538 Ga0495683_0004538_3992_4411 139
819 3300047323 Ga0495683_0008031 Ga0495683_0008031_2140_2559 139
820 3300047323 Ga0495683_0062904 Ga0495683_0062904_881_1315 139
821 3300047443 Ga0495687_011099 Ga0495687_011099_506_925 139
822 3300047444 Ga0495675_0491627 Ga0495675_0491627_12_434 139
823 3300047445 Ga0495677_0007568 Ga0495677_0007568_2767_3201 139
824 3300047446 Ga0495679_081727 Ga0495679_081727_437_859 139
825 3300047470 Ga0495681_0000363 Ga0495681_0000363_32012_32446 139
826 3300047472 Ga0495686_0000148 Ga0495686_0000148_88443_88865 139
827 3300047472 Ga0495686_0273076 Ga0495686_0273076_457_876 139
828 3300047673 Ga0495593_0064424 Ga0495593_0064424_233_655 139
829 3300048089 Ga0495614_0013968 Ga0495614_0013968_370_792 139
830 3300048091 Ga0495626_0001431 Ga0495626_0001431_11769_12200 139
831 3300048091 Ga0495626_0079080 Ga0495626_0079080_749_1180 139
832 3300048091 Ga0495626_0085083 Ga0495626_0085083_357_776 139
833 3300048091 Ga0495626_0133624 Ga0495626_0133624_483_905 139
834 3300048903 Ga0496100_0303717 Ga0496100_0303717_465_884 139
835 3300048904 Ga0496101_0078367 Ga0496101_0078367_1701_2120 139
836 3300048904 Ga0496101_0375965 Ga0496101_0375965_421_840 139
837 3300048905 Ga0496102_0081592 Ga0496102_0081592_2405_2824 139
838 3300048905 Ga0496102_1040571 Ga0496102_1040571_210_635 139
839 3300048906 Ga0496103_0572378 Ga0496103_0572378_287_706 139
840 3300048907 Ga0496104_0064221 Ga0496104_0064221_819_1238 139
841 3300048908 Ga0496105_0105397 Ga0496105_0105397_537_956 139
842 3300048910 Ga0496107_0317377 Ga0496107_0317377_326_745 139
843 3300048915 Ga0496112_0222165 Ga0496112_0222165_1043_1462 139
844 3300048919 Ga0496116_0000634 Ga0496116_0000634_9225_9644 139
845 3300048924 Ga0496121_0006925 Ga0496121_0006925_4711_5130 139
846 3300048924 Ga0496121_0598494 Ga0496121_0598494_251_670 139
847 3300049460 Ga0495682_0003801 Ga0495682_0003801_2016_2438 139
848 3300049679 Ga0501249_001312 Ga0501249_001312_2154_2573 139
849 3300049705 Ga0501225_0001764 Ga0501225_0001764_496_915 139
850 3300049759 Ga0501262_000301 Ga0501262_000301_2433_2852 139
851 3300050489 nmdc:mga03683_31787_c1 nmdc:mga03683_31787_c1_944_1363 139
852 3300050489 nmdc:mga03683_403646_c1 nmdc:mga03683_403646_c1_94_513 139
853 3300050489 nmdc:mga03683_42155_c1 nmdc:mga03683_42155_c1_54_473 139
854 3300050489 nmdc:mga03683_48688_c1 nmdc:mga03683_48688_c1_778_1197 139
855 3300050490 nmdc:mga03n38_119231_c1 nmdc:mga03n38_119231_c1_806_1225 139
856 3300050490 nmdc:mga03n38_25127_c1 nmdc:mga03n38_25127_c1_1357_1776 139
857 3300050490 nmdc:mga03n38_40863_c1 nmdc:mga03n38_40863_c1_1419_1838 139
858 3300050491 nmdc:mga00v17_276016_c1 nmdc:mga00v17_276016_c1_454_873 139
859 3300050491 nmdc:mga00v17_801971_c1 nmdc:mga00v17_801971_c1_53_472 139
860 3300050491 nmdc:mga00v17_85704_c1 nmdc:mga00v17_85704_c1_691_1110 139
861 3300050492 nmdc:mga0yw44_33585_c1 nmdc:mga0yw44_33585_c1_2317_2736 139
862 3300050493 nmdc:mga0k408_156427_c1 nmdc:mga0k408_156427_c1_485_904 139
863 3300050493 nmdc:mga0k408_21239_c1 nmdc:mga0k408_21239_c1_2299_2718 139
864 3300050493 nmdc:mga0k408_22223_c1 nmdc:mga0k408_22223_c1_2688_3107 139
865 3300050493 nmdc:mga0k408_231214_c1 nmdc:mga0k408_231214_c1_369_788 139
866 3300050493 nmdc:mga0k408_482024_c1 nmdc:mga0k408_482024_c1_19_438 139
867 3300050493 nmdc:mga0k408_565517_c1 nmdc:mga0k408_565517_c1_88_507 139
868 3300050494 nmdc:mga06z11_644078_c1 nmdc:mga06z11_644078_c1_34_453 139
869 3300050494 nmdc:mga06z11_690634_c1 nmdc:mga06z11_690634_c1_165_584 139
870 3300050496 nmdc:mga07m45_2210_c1 nmdc:mga07m45_2210_c1_3907_4326 139
871 3300050496 nmdc:mga07m45_262033_c1 nmdc:mga07m45_262033_c1_278_697 139
872 3300050496 nmdc:mga07m45_7307_c1 nmdc:mga07m45_7307_c1_4763_5182 139
873 3300050516 nmdc:mga0sz30_179089_c1 nmdc:mga0sz30_179089_c1_378_797 139
874 3300053093 Ga0500651_0446278 Ga0500651_0446278_166_585 139
875 3300053121 Ga0500607_061847 Ga0500607_061847_958_1377 139
876 3300053134 Ga0500658_0498490 Ga0500658_0498490_30_449 139
877 3300053154 Ga0500619_152871 Ga0500619_152871_262_681 139

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00101

RuBisCO_small

Ribulose bisphosphate carboxylase, small chain

5

104

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qsw-assembly1.cif.gz_B-2 l8s8-complex forming rubisco derived from ancestral sequence reconstruction of the last common ancestor of ssu-bearing form i rubiscos 0.9445 8 104
6hbc-assembly1.cif.gz_D structure of the repeat unit in the network formed by ccmm and rubisco from synechococcus elongatus 0.9418 8 103
1bwv-assembly1.cif.gz_S activated ribulose 1,5-bisphosphate carboxylase/oxygenase (rubisco) complexed with the reaction intermediate analogue 2-carboxyarabinitol 1,5-bisphosphate 0.9398 1 139
1iwa-assembly1.cif.gz_N rubisco from galdieria partita 0.9396 1 139
4f0h-assembly1.cif.gz_B unactivated rubisco with oxygen bound 0.9381 1 139
ID Description Score Start End Superfamily
5mz2I00 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribulose bisphosphate carboxylase, small subunit 0.9362 1 139 3.30.190.10
3zxwD00 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribulose bisphosphate carboxylase, small subunit 0.9332 9 103 3.30.190.10
2ybvN00 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribulose bisphosphate carboxylase, small subunit 0.9331 8 103 3.30.190.10
3zxwD00 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribulose bisphosphate carboxylase, small subunit 0.9238 9 103 3.30.190.10
1svdM00 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribulose bisphosphate carboxylase, small subunit 0.8939 1 103 3.30.190.10
ID Description Score Start End GO Terms
AF-A0A529SI85-F1-model_v4 Ribulose bisphosphate carboxylase small subunit 0.969 14 127 GO:0019253
AF-A0A521ZE51-F1-model_v4 Ribulose bisphosphate carboxylase small subunit 0.9687 21 135 GO:0019253
AF-A0A6J4JW78-F1-model_v4 Ribulose bisphosphate carboxylase small subunit (RuBisCO small subunit) 0.9661 22 139 GO:0016984
GO:0019253
AF-A0A7T5JEG5-F1-model_v4 Ribulose bisphosphate carboxylase small subunit (RuBisCO small subunit) 0.9595 10 104 GO:0009853
GO:0016984
GO:0019253
GO:0031470
AF-U6C2G7-F1-model_v4 Ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 0.9595 66 129 GO:0009507

Feature Viewer

pLDDT pTM Quality
83.22 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map