F484398
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 877 | 445 | 842 | 139 |
Family's Representative Sequence
| Representative Sequence | 3300039447|Ga0436361_0046600|Ga0436361_0046600_49_474 |
| Length | 141 |
| Sequence | MRITQGCFSFLPDLTDAQIRTQVQYCIDKGWAVNLEFTDDPHPRNTFWEMWGLPMFDIKDAAAVMMELAACRKVHGDRAYVRVSGFDASHGWESVKISFIAHRPKEEPGFRLVRQESEGRNITYTLQAYATDLPEGERYGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 2 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 3 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 4 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 5 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 6 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 7 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 8 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 9 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 10 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 11 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 12 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 13 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 14 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 15 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 16 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 17 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 18 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 19 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 20 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 21 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 22 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 23 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 24 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 25 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 26 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 27 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 28 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 29 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 30 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 31 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 32 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 33 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 34 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 35 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 36 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 37 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 38 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 39 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 40 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 41 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 42 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 43 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 52 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 77 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 82 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 88 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 96 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 97 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 98 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 99 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 100 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 101 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 102 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 103 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 104 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 105 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 106 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 107 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 108 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 109 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 111 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 124 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 139 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 143 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 147 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 199 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 205 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 206 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 207 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 208 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 209 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 210 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 211 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 212 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 213 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 214 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 216 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 217 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 218 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 219 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 220 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 221 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 222 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 223 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 224 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 225 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 226 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 227 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 229 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 232 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 234 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 237 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 240 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 241 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 242 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 243 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 244 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 245 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 246 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 247 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 252 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 253 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 254 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 255 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 256 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 257 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 258 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 259 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 260 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 261 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 262 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 263 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 264 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 265 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 266 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 267 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 268 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 269 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 270 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 271 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 272 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 273 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 274 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 275 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 276 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 277 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 278 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 279 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 280 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 281 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 282 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 283 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 284 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 285 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 286 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 344 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 345 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 346 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 347 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 348 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 349 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 352 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 353 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 354 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 355 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 356 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 357 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 358 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 359 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 360 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 361 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 362 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 363 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 388 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 389 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 394 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 398 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 399 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 400 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 401 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 402 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 403 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 404 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 405 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 407 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 408 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 409 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 410 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 411 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 412 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 413 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 415 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 416 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 417 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 418 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 419 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 420 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 421 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 423 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 444 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 445 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.45 |
| Metatranscriptomes | 4.56 |
| Isolates | 3.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.55 |
| Nodule | 1.6 |
| Rhizoplane | 3.65 |
| Rhizosphere | 78.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10013989 | 3300003187 | Bacteria | 3593 |
| 2 | rootH1_10197737 | 3300003323 | Unclassified | 1067 |
| 3 | rootH1_10342955 | 3300003323 | Bacteria | 1001 |
| 4 | Ga0007416J51690_1062202 | 3300003577 | Unclassified | 1039 |
| 5 | Ga0055537_1000031 | 3300003773 | Bacteria | 99208 |
| 6 | Ga0055534_1000091 | 3300003784 | Bacteria | 71324 |
| 7 | Ga0055528_1000237 | 3300003790 | Bacteria | 46144 |
| 8 | Ga0058861_11899052 | 3300004800 | Bacteria | 1340 |
| 9 | Ga0058862_11428235 | 3300004803 | Bacteria | 910 |
| 10 | Ga0065704_10350557 | 3300005289 | Bacteria | 810 |
| 11 | Ga0065707_10083026 | 3300005295 | Bacteria | 10777 |
| 12 | Ga0070683_100149523 | 3300005329 | Bacteria | 2214 |
| 13 | Ga0070683_100222286 | 3300005329 | Bacteria | 1795 |
| 14 | Ga0070683_100350078 | 3300005329 | Bacteria | 1407 |
| 15 | Ga0070690_100115809 | 3300005330 | Bacteria | 1794 |
| 16 | Ga0070677_10137679 | 3300005333 | Bacteria | 1122 |
| 17 | Ga0070666_10423012 | 3300005335 | Bacteria | 960 |
| 18 | Ga0070666_11163125 | 3300005335 | Bacteria | 574 |
| 19 | Ga0070680_100002272 | 3300005336 | Bacteria | 14211 |
| 20 | Ga0070680_100054814 | 3300005336 | Bacteria | 3256 |
| 21 | Ga0070680_100210072 | 3300005336 | Bacteria | 1642 |
| 22 | Ga0070680_100489952 | 3300005336 | Bacteria | 1051 |
| 23 | Ga0070680_100612113 | 3300005336 | Bacteria | 935 |
| 24 | Ga0070680_101239291 | 3300005336 | Bacteria | 645 |
| 25 | Ga0070682_100429128 | 3300005337 | Bacteria | 1007 |
| 26 | Ga0068868_100216387 | 3300005338 | Bacteria | 1603 |
| 27 | Ga0068868_100231660 | 3300005338 | Bacteria | 1550 |
| 28 | Ga0070691_10395840 | 3300005341 | Bacteria | 777 |
| 29 | Ga0070661_101079788 | 3300005344 | Bacteria | 668 |
| 30 | Ga0070668_100174748 | 3300005347 | Bacteria | 1751 |
| 31 | Ga0070669_100842900 | 3300005353 | Bacteria | 781 |
| 32 | Ga0070671_100000182 | 3300005355 | Bacteria | 41975 |
| 33 | Ga0070671_100088684 | 3300005355 | Bacteria | 2589 |
| 34 | Ga0070674_101383634 | 3300005356 | Bacteria | 630 |
| 35 | Ga0070673_100084201 | 3300005364 | Bacteria | 2586 |
| 36 | Ga0070673_100174299 | 3300005364 | Bacteria | 1837 |
| 37 | Ga0070688_100224657 | 3300005365 | Bacteria | 1325 |
| 38 | Ga0070659_100693978 | 3300005366 | Bacteria | 880 |
| 39 | Ga0070667_100054646 | 3300005367 | Bacteria | 3372 |
| 40 | Ga0070667_100786611 | 3300005367 | Bacteria | 883 |
| 41 | Ga0070667_100875641 | 3300005367 | Bacteria | 835 |
| 42 | Ga0070667_101121107 | 3300005367 | Bacteria | 736 |
| 43 | Ga0070709_10206284 | 3300005434 | Bacteria | 1395 |
| 44 | Ga0070713_100913627 | 3300005436 | Bacteria | 845 |
| 45 | Ga0070710_10459449 | 3300005437 | Bacteria | 865 |
| 46 | Ga0070710_11482374 | 3300005437 | Bacteria | 509 |
| 47 | Ga0070708_100052798 | 3300005445 | Bacteria | 3605 |
| 48 | Ga0070663_100598938 | 3300005455 | Bacteria | 927 |
| 49 | Ga0070678_100219571 | 3300005456 | Bacteria | 1579 |
| 50 | Ga0070681_10000436 | 3300005458 | Bacteria | 33941 |
| 51 | Ga0070681_10004460 | 3300005458 | Bacteria | 13334 |
| 52 | Ga0070681_10009629 | 3300005458 | Bacteria | 9502 |
| 53 | Ga0070681_10016296 | 3300005458 | Bacteria | 7416 |
| 54 | Ga0070681_10032105 | 3300005458 | Bacteria | 5270 |
| 55 | Ga0070681_10200921 | 3300005458 | Bacteria | 1911 |
| 56 | Ga0068867_100017657 | 3300005459 | Bacteria | 5066 |
| 57 | Ga0068867_100072358 | 3300005459 | Bacteria | 2580 |
| 58 | Ga0068867_100131642 | 3300005459 | Bacteria | 1945 |
| 59 | Ga0070685_10317582 | 3300005466 | Bacteria | 1055 |
| 60 | Ga0070685_10833538 | 3300005466 | Bacteria | 682 |
| 61 | Ga0070707_100046185 | 3300005468 | Bacteria | 4168 |
| 62 | Ga0070698_101280321 | 3300005471 | Bacteria | 683 |
| 63 | Ga0070679_100009702 | 3300005530 | Bacteria | 9106 |
| 64 | Ga0070679_100046866 | 3300005530 | Bacteria | 4309 |
| 65 | Ga0070679_100049877 | 3300005530 | Bacteria | 4170 |
| 66 | Ga0070679_100179819 | 3300005530 | Bacteria | 2088 |
| 67 | Ga0070679_100245951 | 3300005530 | Bacteria | 1745 |
| 68 | Ga0070679_100258242 | 3300005530 | Bacteria | 1698 |
| 69 | Ga0070679_100589524 | 3300005530 | Bacteria | 1055 |
| 70 | Ga0070684_100298250 | 3300005535 | Bacteria | 1478 |
| 71 | Ga0070684_100376661 | 3300005535 | Bacteria | 1307 |
| 72 | Ga0070684_100740874 | 3300005535 | Bacteria | 917 |
| 73 | Ga0070697_100302829 | 3300005536 | Bacteria | 1374 |
| 74 | Ga0068853_100015474 | 3300005539 | Bacteria | 6267 |
| 75 | Ga0068853_100733601 | 3300005539 | Bacteria | 944 |
| 76 | Ga0070672_100190896 | 3300005543 | Bacteria | 1710 |
| 77 | Ga0070686_100214006 | 3300005544 | Bacteria | 1389 |
| 78 | Ga0070686_100670634 | 3300005544 | Bacteria | 824 |
| 79 | Ga0070693_101446554 | 3300005547 | Bacteria | 536 |
| 80 | Ga0070665_100000894 | 3300005548 | Bacteria | 38327 |
| 81 | Ga0070665_100002017 | 3300005548 | Bacteria | 22832 |
| 82 | Ga0070665_100077289 | 3300005548 | Bacteria | 3335 |
| 83 | Ga0070665_100686744 | 3300005548 | Bacteria | 1037 |
| 84 | Ga0068855_100004475 | 3300005563 | Bacteria | 17073 |
| 85 | Ga0068855_100011278 | 3300005563 | Bacteria | 10791 |
| 86 | Ga0068855_100041746 | 3300005563 | Bacteria | 5435 |
| 87 | Ga0068855_100188623 | 3300005563 | Bacteria | 2327 |
| 88 | Ga0068855_100277542 | 3300005563 | Bacteria | 1862 |
| 89 | Ga0068855_101009202 | 3300005563 | Bacteria | 874 |
| 90 | Ga0068855_101111756 | 3300005563 | Bacteria | 826 |
| 91 | Ga0068855_101841820 | 3300005563 | Bacteria | 614 |
| 92 | Ga0068857_100151089 | 3300005577 | Bacteria | 2104 |
| 93 | Ga0068857_100300917 | 3300005577 | Bacteria | 1478 |
| 94 | Ga0068857_101119810 | 3300005577 | Bacteria | 761 |
| 95 | Ga0068854_100126429 | 3300005578 | Bacteria | 1947 |
| 96 | Ga0068854_100704270 | 3300005578 | Bacteria | 872 |
| 97 | Ga0068854_101075506 | 3300005578 | Bacteria | 716 |
| 98 | Ga0068856_100508342 | 3300005614 | Bacteria | 1226 |
| 99 | Ga0068856_101929294 | 3300005614 | Bacteria | 601 |
| 100 | Ga0068856_102213181 | 3300005614 | Bacteria | 559 |
| 101 | Ga0068852_101065469 | 3300005616 | Bacteria | 828 |
| 102 | Ga0068852_101118687 | 3300005616 | Bacteria | 808 |
| 103 | Ga0068859_100000520 | 3300005617 | Bacteria | 38244 |
| 104 | Ga0068859_100420510 | 3300005617 | Bacteria | 1433 |
| 105 | Ga0068859_100906620 | 3300005617 | Bacteria | 966 |
| 106 | Ga0068859_100944714 | 3300005617 | Bacteria | 946 |
| 107 | Ga0068866_10188164 | 3300005718 | Bacteria | 1225 |
| 108 | Ga0068866_10848300 | 3300005718 | Bacteria | 639 |
| 109 | Ga0068861_100473397 | 3300005719 | Bacteria | 1127 |
| 110 | Ga0068861_101816067 | 3300005719 | Bacteria | 605 |
| 111 | Ga0068863_100002040 | 3300005841 | Bacteria | 20019 |
| 112 | Ga0068863_100203413 | 3300005841 | Bacteria | 1905 |
| 113 | Ga0068863_101868559 | 3300005841 | Bacteria | 610 |
| 114 | Ga0068858_100000238 | 3300005842 | Bacteria | 59573 |
| 115 | Ga0068858_100248130 | 3300005842 | Bacteria | 1691 |
| 116 | Ga0068858_101020577 | 3300005842 | Bacteria | 811 |
| 117 | Ga0068858_101219736 | 3300005842 | Bacteria | 740 |
| 118 | Ga0068860_100030988 | 3300005843 | Bacteria | 5142 |
| 119 | Ga0068860_100068490 | 3300005843 | Bacteria | 3372 |
| 120 | Ga0068860_100706964 | 3300005843 | Bacteria | 1018 |
| 121 | Ga0068860_101391978 | 3300005843 | Bacteria | 723 |
| 122 | Ga0068862_100081566 | 3300005844 | Bacteria | 2806 |
| 123 | Ga0068862_100238412 | 3300005844 | Bacteria | 1653 |
| 124 | Ga0081455_10000519 | 3300005937 | Bacteria | 50012 |
| 125 | Ga0081455_10398852 | 3300005937 | Bacteria | 955 |
| 126 | Ga0081538_10000326 | 3300005981 | Bacteria | 54485 |
| 127 | Ga0081538_10010430 | 3300005981 | Bacteria | 7619 |
| 128 | Ga0081539_10000118 | 3300005985 | Bacteria | 184562 |
| 129 | Ga0081539_10000302 | 3300005985 | Bacteria | 111364 |
| 130 | Ga0075368_10019180 | 3300006042 | Bacteria | 2580 |
| 131 | Ga0075368_10200405 | 3300006042 | Bacteria | 845 |
| 132 | Ga0075363_100007460 | 3300006048 | Bacteria | 5030 |
| 133 | Ga0075432_10129798 | 3300006058 | Bacteria | 954 |
| 134 | Ga0075432_10162313 | 3300006058 | Bacteria | 865 |
| 135 | Ga0075432_10308850 | 3300006058 | Bacteria | 659 |
| 136 | Ga0075362_10069434 | 3300006177 | Bacteria | 1606 |
| 137 | Ga0075362_10094322 | 3300006177 | Bacteria | 1392 |
| 138 | Ga0075362_10377752 | 3300006177 | Bacteria | 712 |
| 139 | Ga0075367_10170055 | 3300006178 | Bacteria | 1357 |
| 140 | Ga0075367_10212579 | 3300006178 | Bacteria | 1209 |
| 141 | Ga0075367_10398849 | 3300006178 | Bacteria | 870 |
| 142 | Ga0075369_10198906 | 3300006186 | Bacteria | 924 |
| 143 | Ga0075366_10091873 | 3300006195 | Bacteria | 1818 |
| 144 | Ga0075366_10117380 | 3300006195 | Bacteria | 1602 |
| 145 | Ga0075366_10220156 | 3300006195 | Bacteria | 1156 |
| 146 | Ga0075366_10256253 | 3300006195 | Bacteria | 1067 |
| 147 | Ga0075370_10002134 | 3300006353 | Bacteria | 9037 |
| 148 | Ga0075370_10080980 | 3300006353 | Bacteria | 1866 |
| 149 | Ga0075370_10247444 | 3300006353 | Bacteria | 1056 |
| 150 | Ga0075370_10267506 | 3300006353 | Bacteria | 1014 |
| 151 | Ga0068871_100331372 | 3300006358 | Bacteria | 1342 |
| 152 | Ga0068871_100474382 | 3300006358 | Bacteria | 1124 |
| 153 | Ga0075428_100050198 | 3300006844 | Bacteria | 4577 |
| 154 | Ga0075430_100178607 | 3300006846 | Bacteria | 1766 |
| 155 | Ga0068865_100061356 | 3300006881 | Bacteria | 2635 |
| 156 | Ga0068865_100295809 | 3300006881 | Bacteria | 1294 |
| 157 | Ga0075436_101062670 | 3300006914 | Bacteria | 609 |
| 158 | Ga0097620_100000520 | 3300006931 | Bacteria | 38244 |
| 159 | Ga0097620_100420492 | 3300006931 | Bacteria | 1433 |
| 160 | Ga0097620_100906559 | 3300006931 | Bacteria | 966 |
| 161 | Ga0097620_100944725 | 3300006931 | Bacteria | 946 |
| 162 | Ga0099826_10067367 | 3300006948 | Bacteria | 2291 |
| 163 | Ga0105250_10038591 | 3300009092 | Bacteria | 1915 |
| 164 | Ga0105240_10001162 | 3300009093 | Bacteria | 46146 |
| 165 | Ga0105240_10001667 | 3300009093 | Bacteria | 37697 |
| 166 | Ga0105240_10015663 | 3300009093 | Bacteria | 10296 |
| 167 | Ga0105240_10021151 | 3300009093 | Bacteria | 8661 |
| 168 | Ga0105240_10047887 | 3300009093 | Bacteria | 5406 |
| 169 | Ga0105240_10074921 | 3300009093 | Bacteria | 4176 |
| 170 | Ga0105240_10106085 | 3300009093 | Bacteria | 3409 |
| 171 | Ga0105240_10152858 | 3300009093 | Bacteria | 2747 |
| 172 | Ga0105240_10239642 | 3300009093 | Bacteria | 2103 |
| 173 | Ga0105240_10409484 | 3300009093 | Bacteria | 1525 |
| 174 | Ga0105247_10000317 | 3300009101 | Bacteria | 43370 |
| 175 | Ga0105247_10601347 | 3300009101 | Bacteria | 815 |
| 176 | Ga0105243_10569224 | 3300009148 | Bacteria | 1086 |
| 177 | Ga0105243_10615050 | 3300009148 | Bacteria | 1048 |
| 178 | Ga0105241_10327387 | 3300009174 | Bacteria | 1323 |
| 179 | Ga0105242_10220758 | 3300009176 | Bacteria | 1694 |
| 180 | Ga0105242_10434518 | 3300009176 | Bacteria | 1233 |
| 181 | Ga0105248_10010633 | 3300009177 | Bacteria | 10148 |
| 182 | Ga0105248_10055365 | 3300009177 | Bacteria | 4448 |
| 183 | Ga0105248_12511268 | 3300009177 | Bacteria | 587 |
| 184 | Ga0105237_10019273 | 3300009545 | Bacteria | 7048 |
| 185 | Ga0105237_10075708 | 3300009545 | Bacteria | 3356 |
| 186 | Ga0105237_10087812 | 3300009545 | Bacteria | 3099 |
| 187 | Ga0105237_10153844 | 3300009545 | Bacteria | 2296 |
| 188 | Ga0105237_10265108 | 3300009545 | Bacteria | 1721 |
| 189 | Ga0105238_10001249 | 3300009551 | Bacteria | 25597 |
| 190 | Ga0105238_10446996 | 3300009551 | Bacteria | 1289 |
| 191 | Ga0105238_10457379 | 3300009551 | Bacteria | 1274 |
| 192 | Ga0105238_10753255 | 3300009551 | Bacteria | 988 |
| 193 | Ga0105238_10943328 | 3300009551 | Unclassified | 882 |
| 194 | Ga0105238_11179053 | 3300009551 | Unclassified | 790 |
| 195 | Ga0105249_10035103 | 3300009553 | Bacteria | 4546 |
| 196 | Ga0105249_10093275 | 3300009553 | Bacteria | 2820 |
| 197 | Ga0105249_10103087 | 3300009553 | Bacteria | 2686 |
| 198 | Ga0105249_10260800 | 3300009553 | Bacteria | 1722 |
| 199 | Ga0105249_10415449 | 3300009553 | Bacteria | 1378 |
| 200 | Ga0105239_10006291 | 3300010375 | Bacteria | 13803 |
| 201 | Ga0105239_10259093 | 3300010375 | Bacteria | 1954 |
| 202 | Ga0105239_10419475 | 3300010375 | Bacteria | 1516 |
| 203 | Ga0105239_10581895 | 3300010375 | Bacteria | 1276 |
| 204 | Ga0105239_10953284 | 3300010375 | Bacteria | 986 |
| 205 | Ga0105246_10082746 | 3300011119 | Bacteria | 2292 |
| 206 | Ga0105246_10650062 | 3300011119 | Bacteria | 918 |
| 207 | Ga0105246_11879640 | 3300011119 | Bacteria | 574 |
| 208 | Ga0105246_12231625 | 3300011119 | Bacteria | 533 |
| 209 | Ga0157346_1008417 | 3300012480 | Bacteria | 710 |
| 210 | Ga0154012_133202 | 3300013059 | Bacteria | 515 |
| 211 | Ga0157373_10036040 | 3300013100 | Bacteria | 3551 |
| 212 | Ga0157370_10002946 | 3300013104 | Bacteria | 20263 |
| 213 | Ga0157370_10134036 | 3300013104 | Bacteria | 2309 |
| 214 | Ga0157370_10813794 | 3300013104 | Bacteria | 850 |
| 215 | Ga0157369_10071865 | 3300013105 | Bacteria | 3713 |
| 216 | Ga0157369_10072482 | 3300013105 | Bacteria | 3697 |
| 217 | Ga0157369_10140259 | 3300013105 | Bacteria | 2558 |
| 218 | Ga0157369_10349786 | 3300013105 | Bacteria | 1535 |
| 219 | Ga0157369_10553053 | 3300013105 | Bacteria | 1189 |
| 220 | Ga0157374_10179292 | 3300013296 | Bacteria | 2069 |
| 221 | Ga0157374_10186550 | 3300013296 | Bacteria | 2028 |
| 222 | Ga0157374_11963974 | 3300013296 | Bacteria | 611 |
| 223 | Ga0157374_12258653 | 3300013296 | Bacteria | 571 |
| 224 | Ga0163162_10324760 | 3300013306 | Bacteria | 1671 |
| 225 | Ga0163162_10706553 | 3300013306 | Bacteria | 1130 |
| 226 | Ga0163162_11501143 | 3300013306 | Bacteria | 768 |
| 227 | Ga0157372_10331880 | 3300013307 | Bacteria | 1771 |
| 228 | Ga0157372_10625310 | 3300013307 | Bacteria | 1255 |
| 229 | Ga0157372_10976517 | 3300013307 | Bacteria | 981 |
| 230 | Ga0157372_11318126 | 3300013307 | Bacteria | 833 |
| 231 | Ga0157372_11483110 | 3300013307 | Bacteria | 781 |
| 232 | Ga0157372_11696678 | 3300013307 | Bacteria | 727 |
| 233 | Ga0157375_10109192 | 3300013308 | Bacteria | 2862 |
| 234 | Ga0163163_10034925 | 3300014325 | Bacteria | 4874 |
| 235 | Ga0163163_10237106 | 3300014325 | Bacteria | 1874 |
| 236 | Ga0163163_10310041 | 3300014325 | Bacteria | 1631 |
| 237 | Ga0157380_10002413 | 3300014326 | Bacteria | 12579 |
| 238 | Ga0157380_11021630 | 3300014326 | Bacteria | 861 |
| 239 | Ga0182008_10520408 | 3300014497 | Bacteria | 657 |
| 240 | Ga0157379_10005758 | 3300014968 | Bacteria | 10664 |
| 241 | Ga0157379_10111408 | 3300014968 | Bacteria | 2458 |
| 242 | Ga0157379_10122569 | 3300014968 | Bacteria | 2339 |
| 243 | Ga0157379_11879686 | 3300014968 | Bacteria | 590 |
| 244 | Ga0157376_10007118 | 3300014969 | Bacteria | 7946 |
| 245 | Ga0157376_10381886 | 3300014969 | Bacteria | 1357 |
| 246 | Ga0157376_10388174 | 3300014969 | Bacteria | 1347 |
| 247 | Ga0182006_1041130 | 3300015261 | Bacteria | 1816 |
| 248 | Ga0182006_1041882 | 3300015261 | Bacteria | 1796 |
| 249 | Ga0182007_10062239 | 3300015262 | Bacteria | 1223 |
| 250 | Ga0197907_10413154 | 3300020069 | Unclassified | 757 |
| 251 | Ga0197907_11430259 | 3300020069 | Bacteria | 579 |
| 252 | Ga0206356_10150101 | 3300020070 | Bacteria | 1401 |
| 253 | Ga0206356_10154097 | 3300020070 | Bacteria | 2524 |
| 254 | Ga0206349_1014102 | 3300020075 | Bacteria | 626 |
| 255 | Ga0206355_1446838 | 3300020076 | Bacteria | 606 |
| 256 | Ga0206351_10312048 | 3300020077 | Bacteria | 542 |
| 257 | Ga0206351_10444308 | 3300020077 | Bacteria | 2027 |
| 258 | Ga0206352_10235695 | 3300020078 | Bacteria | 1443 |
| 259 | Ga0206354_10279087 | 3300020081 | Bacteria | 595 |
| 260 | Ga0213872_10134835 | 3300021361 | Bacteria | 1086 |
| 261 | Ga0224712_10049638 | 3300022467 | Bacteria | 1626 |
| 262 | Ga0209233_1010192 | 3300025261 | Bacteria | 2828 |
| 263 | Ga0209565_1000087 | 3300025263 | Bacteria | 152027 |
| 264 | Ga0209673_1000145 | 3300025273 | Bacteria | 152027 |
| 265 | Ga0209675_1000085 | 3300025291 | Bacteria | 152027 |
| 266 | Ga0209676_1027819 | 3300025292 | Bacteria | 1772 |
| 267 | Ga0209025_1056253 | 3300025294 | Bacteria | 1514 |
| 268 | Ga0209564_1048598 | 3300025295 | Bacteria | 1058 |
| 269 | Ga0209758_1130091 | 3300025297 | Bacteria | 667 |
| 270 | Ga0209051_1008057 | 3300025303 | Bacteria | 5642 |
| 271 | Ga0207692_10204403 | 3300025898 | Bacteria | 1163 |
| 272 | Ga0207692_10402123 | 3300025898 | Bacteria | 854 |
| 273 | Ga0207642_10382096 | 3300025899 | Bacteria | 838 |
| 274 | Ga0207642_10406550 | 3300025899 | Bacteria | 816 |
| 275 | Ga0207710_10000323 | 3300025900 | Bacteria | 36602 |
| 276 | Ga0207680_10137618 | 3300025903 | Bacteria | 1616 |
| 277 | Ga0207680_10464441 | 3300025903 | Bacteria | 899 |
| 278 | Ga0207680_11063096 | 3300025903 | Bacteria | 579 |
| 279 | Ga0207647_10000883 | 3300025904 | Bacteria | 23261 |
| 280 | Ga0207699_10243311 | 3300025906 | Bacteria | 1237 |
| 281 | Ga0207645_10495790 | 3300025907 | Bacteria | 827 |
| 282 | Ga0207684_10003211 | 3300025910 | Bacteria | 16048 |
| 283 | Ga0207654_10591849 | 3300025911 | Bacteria | 791 |
| 284 | Ga0207707_10000035 | 3300025912 | Bacteria | 147299 |
| 285 | Ga0207707_10000591 | 3300025912 | Bacteria | 36552 |
| 286 | Ga0207707_10014435 | 3300025912 | Bacteria | 6882 |
| 287 | Ga0207707_10017249 | 3300025912 | Bacteria | 6292 |
| 288 | Ga0207707_10019236 | 3300025912 | Bacteria | 5960 |
| 289 | Ga0207707_10055496 | 3300025912 | Bacteria | 3446 |
| 290 | Ga0207707_10135238 | 3300025912 | Bacteria | 2155 |
| 291 | Ga0207695_10003023 | 3300025913 | Bacteria | 24154 |
| 292 | Ga0207695_10042598 | 3300025913 | Bacteria | 4846 |
| 293 | Ga0207695_10049299 | 3300025913 | Bacteria | 4441 |
| 294 | Ga0207695_10050901 | 3300025913 | Bacteria | 4354 |
| 295 | Ga0207695_10054673 | 3300025913 | Bacteria | 4166 |
| 296 | Ga0207695_10061520 | 3300025913 | Bacteria | 3880 |
| 297 | Ga0207695_10073016 | 3300025913 | Bacteria | 3497 |
| 298 | Ga0207695_10098888 | 3300025913 | Bacteria | 2916 |
| 299 | Ga0207695_10254683 | 3300025913 | Bacteria | 1654 |
| 300 | Ga0207695_10395849 | 3300025913 | Bacteria | 1266 |
| 301 | Ga0207671_10065192 | 3300025914 | Bacteria | 2708 |
| 302 | Ga0207671_10133611 | 3300025914 | Bacteria | 1906 |
| 303 | Ga0207671_10269604 | 3300025914 | Bacteria | 1341 |
| 304 | Ga0207671_10420981 | 3300025914 | Bacteria | 1063 |
| 305 | Ga0207660_10029544 | 3300025917 | Bacteria | 3761 |
| 306 | Ga0207660_10068052 | 3300025917 | Bacteria | 2581 |
| 307 | Ga0207660_10096148 | 3300025917 | Bacteria | 2205 |
| 308 | Ga0207660_10195048 | 3300025917 | Bacteria | 1579 |
| 309 | Ga0207660_10633968 | 3300025917 | Unclassified | 871 |
| 310 | Ga0207660_11091230 | 3300025917 | Bacteria | 650 |
| 311 | Ga0207652_10001126 | 3300025921 | Bacteria | 24078 |
| 312 | Ga0207652_10035735 | 3300025921 | Bacteria | 4196 |
| 313 | Ga0207652_10039665 | 3300025921 | Bacteria | 3997 |
| 314 | Ga0207652_10084245 | 3300025921 | Bacteria | 2785 |
| 315 | Ga0207652_10522750 | 3300025921 | Bacteria | 1068 |
| 316 | Ga0207681_10531466 | 3300025923 | Bacteria | 966 |
| 317 | Ga0207694_10030487 | 3300025924 | Bacteria | 4119 |
| 318 | Ga0207694_10044347 | 3300025924 | Bacteria | 3434 |
| 319 | Ga0207694_10473590 | 3300025924 | Bacteria | 1047 |
| 320 | Ga0207694_10491999 | 3300025924 | Bacteria | 1026 |
| 321 | Ga0207694_11714079 | 3300025924 | Bacteria | 529 |
| 322 | Ga0207650_10453410 | 3300025925 | Bacteria | 1067 |
| 323 | Ga0207700_10140699 | 3300025928 | Bacteria | 1982 |
| 324 | Ga0207700_10466101 | 3300025928 | Bacteria | 1115 |
| 325 | Ga0207644_10017250 | 3300025931 | Bacteria | 4872 |
| 326 | Ga0207709_10191223 | 3300025935 | Bacteria | 1454 |
| 327 | Ga0207709_10377197 | 3300025935 | Bacteria | 1078 |
| 328 | Ga0207709_10532277 | 3300025935 | Bacteria | 921 |
| 329 | Ga0207709_10763963 | 3300025935 | Bacteria | 778 |
| 330 | Ga0207670_10062949 | 3300025936 | Bacteria | 2537 |
| 331 | Ga0207669_10300162 | 3300025937 | Bacteria | 1220 |
| 332 | Ga0207665_10957966 | 3300025939 | Bacteria | 680 |
| 333 | Ga0207691_10049884 | 3300025940 | Bacteria | 3834 |
| 334 | Ga0207711_10061041 | 3300025941 | Bacteria | 3250 |
| 335 | Ga0207711_10942310 | 3300025941 | Bacteria | 802 |
| 336 | Ga0207661_10081576 | 3300025944 | Bacteria | 2672 |
| 337 | Ga0207661_10109963 | 3300025944 | Bacteria | 2329 |
| 338 | Ga0207667_10034479 | 3300025949 | Bacteria | 5434 |
| 339 | Ga0207667_10086834 | 3300025949 | Bacteria | 3236 |
| 340 | Ga0207667_10127246 | 3300025949 | Bacteria | 2624 |
| 341 | Ga0207667_10849128 | 3300025949 | Bacteria | 907 |
| 342 | Ga0207712_10046447 | 3300025961 | Bacteria | 3011 |
| 343 | Ga0207712_10074032 | 3300025961 | Bacteria | 2458 |
| 344 | Ga0207712_10125596 | 3300025961 | Bacteria | 1947 |
| 345 | Ga0207712_10685403 | 3300025961 | Bacteria | 893 |
| 346 | Ga0207640_10260182 | 3300025981 | Bacteria | 1352 |
| 347 | Ga0207640_10723938 | 3300025981 | Bacteria | 855 |
| 348 | Ga0207658_10315236 | 3300025986 | Bacteria | 1352 |
| 349 | Ga0207658_10583965 | 3300025986 | Bacteria | 1002 |
| 350 | Ga0207658_10790284 | 3300025986 | Bacteria | 861 |
| 351 | Ga0207677_10754155 | 3300026023 | Bacteria | 868 |
| 352 | Ga0207703_10000911 | 3300026035 | Bacteria | 28871 |
| 353 | Ga0207703_10272687 | 3300026035 | Bacteria | 1533 |
| 354 | Ga0207703_10401786 | 3300026035 | Bacteria | 1271 |
| 355 | Ga0207639_10307309 | 3300026041 | Bacteria | 1404 |
| 356 | Ga0207678_10084391 | 3300026067 | Bacteria | 2716 |
| 357 | Ga0207702_10916730 | 3300026078 | Bacteria | 868 |
| 358 | Ga0207702_10966259 | 3300026078 | Bacteria | 845 |
| 359 | Ga0207702_11494150 | 3300026078 | Bacteria | 669 |
| 360 | Ga0207702_11495845 | 3300026078 | Bacteria | 669 |
| 361 | Ga0207702_11818525 | 3300026078 | Bacteria | 601 |
| 362 | Ga0207641_10004471 | 3300026088 | Bacteria | 12103 |
| 363 | Ga0207641_10311737 | 3300026088 | Bacteria | 1489 |
| 364 | Ga0207641_11439354 | 3300026088 | Bacteria | 690 |
| 365 | Ga0207648_10028691 | 3300026089 | Bacteria | 4933 |
| 366 | Ga0207648_10043845 | 3300026089 | Bacteria | 3926 |
| 367 | Ga0207648_10053380 | 3300026089 | Bacteria | 3533 |
| 368 | Ga0207674_10030361 | 3300026116 | Bacteria | 5683 |
| 369 | Ga0207674_10060944 | 3300026116 | Bacteria | 3814 |
| 370 | Ga0207674_10706202 | 3300026116 | Bacteria | 973 |
| 371 | Ga0207675_100933661 | 3300026118 | Bacteria | 885 |
| 372 | Ga0207675_101275892 | 3300026118 | Bacteria | 755 |
| 373 | Ga0207683_10155770 | 3300026121 | Bacteria | 2063 |
| 374 | Ga0207683_10368550 | 3300026121 | Bacteria | 1319 |
| 375 | Ga0207683_10426413 | 3300026121 | Bacteria | 1222 |
| 376 | Ga0207698_11389335 | 3300026142 | Bacteria | 717 |
| 377 | Ga0209282_1000304 | 3300027666 | Bacteria | 24377 |
| 378 | Ga0209998_10141887 | 3300027717 | Bacteria | 614 |
| 379 | Ga0209974_10030485 | 3300027876 | Bacteria | 1787 |
| 380 | Ga0268266_10002272 | 3300028379 | Bacteria | 20880 |
| 381 | Ga0268266_10005412 | 3300028379 | Bacteria | 11911 |
| 382 | Ga0268266_10023766 | 3300028379 | Bacteria | 5216 |
| 383 | Ga0268266_10092788 | 3300028379 | Bacteria | 2649 |
| 384 | Ga0268266_10896049 | 3300028379 | Bacteria | 858 |
| 385 | Ga0268265_10006056 | 3300028380 | Bacteria | 8221 |
| 386 | Ga0268265_10354534 | 3300028380 | Bacteria | 1341 |
| 387 | Ga0268264_10831818 | 3300028381 | Bacteria | 924 |
| 388 | Ga0307517_10296662 | 3300028786 | Bacteria | 909 |
| 389 | Ga0307515_10000692 | 3300028794 | Bacteria | 77763 |
| 390 | Ga0307515_10005767 | 3300028794 | Bacteria | 25022 |
| 391 | Ga0307515_10694272 | 3300028794 | Bacteria | 633 |
| 392 | Ga0307511_10000066 | 3300030521 | Bacteria | 87505 |
| 393 | Ga0307511_10042895 | 3300030521 | Bacteria | 3791 |
| 394 | Ga0316176_1051753 | 3300030732 | Bacteria | 2219 |
| 395 | Ga0316183_1029607 | 3300030742 | Bacteria | 12311 |
| 396 | Ga0265325_10196107 | 3300031241 | Bacteria | 934 |
| 397 | Ga0265316_10059793 | 3300031344 | Bacteria | 2963 |
| 398 | Ga0307509_10000003 | 3300031507 | Bacteria | 577578 |
| 399 | Ga0307408_100369660 | 3300031548 | Bacteria | 1222 |
| 400 | Ga0307508_10000909 | 3300031616 | Bacteria | 34527 |
| 401 | Ga0307508_10494399 | 3300031616 | Bacteria | 818 |
| 402 | Ga0265314_10170207 | 3300031711 | Bacteria | 1316 |
| 403 | Ga0316576_10001058 | 3300031727 | Bacteria | 14292 |
| 404 | Ga0316576_10253096 | 3300031727 | Bacteria | 1322 |
| 405 | Ga0316576_11083987 | 3300031727 | Bacteria | 568 |
| 406 | Ga0316577_10018697 | 3300031733 | Bacteria | 3833 |
| 407 | Ga0307413_10252925 | 3300031824 | Bacteria | 1308 |
| 408 | Ga0307518_10330609 | 3300031838 | Bacteria | 903 |
| 409 | Ga0307416_101618615 | 3300032002 | Bacteria | 753 |
| 410 | Ga0307414_10508731 | 3300032004 | Bacteria | 1067 |
| 411 | Ga0307414_11696558 | 3300032004 | Bacteria | 589 |
| 412 | Ga0307411_10591647 | 3300032005 | Bacteria | 953 |
| 413 | Ga0307415_101363996 | 3300032126 | Bacteria | 674 |
| 414 | Ga0316583_10040801 | 3300032133 | Bacteria | 1643 |
| 415 | Ga0316580_10018788 | 3300032139 | Bacteria | 2128 |
| 416 | Ga0307510_10000001 | 3300033180 | Bacteria | 1172244 |
| 417 | Ga0307510_10029875 | 3300033180 | Bacteria | 6190 |
| 418 | Ga0307510_10030121 | 3300033180 | Bacteria | 6158 |
| 419 | Ga0307510_10123884 | 3300033180 | Bacteria | 2280 |
| 420 | Ga0307510_10378917 | 3300033180 | Bacteria | 860 |
| 421 | Ga0373929_0076463 | 3300035085 | Bacteria | 809 |
| 422 | Ga0373940_0018278 | 3300035088 | Bacteria | 1757 |
| 423 | Ga0373939_0065438 | 3300035114 | Bacteria | 1169 |
| 424 | Ga0373956_0047759 | 3300035119 | Bacteria | 1916 |
| 425 | Ga0373943_0727079 | 3300035170 | Bacteria | 589 |
| 426 | Ga0316574_0100488 | 3300035398 | Bacteria | 1851 |
| 427 | Ga0373931_0046417 | 3300035691 | Bacteria | 2296 |
| 428 | Ga0373927_0096669 | 3300035695 | Bacteria | 1920 |
| 429 | Ga0316584_0185249 | 3300036712 | Bacteria | 1540 |
| 430 | Ga0395900_0312943 | 3300037418 | Bacteria | 1553 |
| 431 | Ga0395900_0453681 | 3300037418 | Bacteria | 1238 |
| 432 | Ga0395900_0671146 | 3300037418 | Bacteria | 972 |
| 433 | Ga0395898_0012166 | 3300037466 | Bacteria | 8902 |
| 434 | Ga0395898_0030222 | 3300037466 | Bacteria | 5422 |
| 435 | Ga0395898_0402728 | 3300037466 | Bacteria | 1305 |
| 436 | Ga0395898_0826767 | 3300037466 | Bacteria | 866 |
| 437 | Ga0316581_0005800 | 3300037588 | Bacteria | 3241 |
| 438 | Ga0395901_0603155 | 3300038443 | Bacteria | 1107 |
| 439 | Ga0436365_0910310 | 3300039437 | Bacteria | 1030 |
| 440 | Ga0436360_1159934 | 3300039438 | Bacteria | 563 |
| 441 | Ga0436361_0046600 | 3300039447 | Bacteria | 1076 |
| 442 | Ga0436361_0085081 | 3300039447 | Bacteria | 31412 |
| 443 | Ga0436363_0525771 | 3300039450 | Bacteria | 1059 |
| 444 | Ga0439436_0066993 | 3300041404 | Bacteria | 1002 |
| 445 | Ga0439447_030412 | 3300041407 | Bacteria | 1361 |
| 446 | Ga0439466_0029987 | 3300041411 | Bacteria | 1868 |
| 447 | Ga0439465_0013609 | 3300041413 | Bacteria | 2534 |
| 448 | Ga0439465_0201946 | 3300041413 | Bacteria | 724 |
| 449 | Ga0451789_0877240 | 3300041443 | Bacteria | 670 |
| 450 | Ga0451798_1133053 | 3300041458 | Bacteria | 587 |
| 451 | Ga0451800_0561777 | 3300041459 | Bacteria | 622 |
| 452 | Ga0451804_1054772 | 3300041463 | Bacteria | 582 |
| 453 | Ga0451837_0412873 | 3300041494 | Bacteria | 593 |
| 454 | Ga0451841_0321022 | 3300041498 | Bacteria | 2498 |
| 455 | Ga0451849_1329306 | 3300041505 | Bacteria | 557 |
| 456 | Ga0451843_0460145 | 3300041509 | Bacteria | 516 |
| 457 | Ga0451853_0858138 | 3300041512 | Bacteria | 545 |
| 458 | Ga0451853_2174092 | 3300041512 | Bacteria | 1108 |
| 459 | Ga0451853_3203100 | 3300041512 | Bacteria | 1244 |
| 460 | Ga0451853_4094737 | 3300041512 | Bacteria | 633 |
| 461 | Ga0439442_017587 | 3300042002 | Bacteria | 1476 |
| 462 | Ga0439442_024107 | 3300042002 | Bacteria | 1265 |
| 463 | Ga0439442_030527 | 3300042002 | Bacteria | 1125 |
| 464 | Ga0439445_0018338 | 3300042004 | Bacteria | 1737 |
| 465 | Ga0439445_0047600 | 3300042004 | Bacteria | 1152 |
| 466 | Ga0439445_0105864 | 3300042004 | Bacteria | 800 |
| 467 | Ga0439432_026342 | 3300042006 | Bacteria | 1903 |
| 468 | Ga0439432_076300 | 3300042006 | Bacteria | 1018 |
| 469 | Ga0439449_0001524 | 3300042007 | Bacteria | 9071 |
| 470 | Ga0439452_051499 | 3300042010 | Bacteria | 942 |
| 471 | Ga0450911_021682 | 3300042115 | Bacteria | 838 |
| 472 | Ga0450920_038479 | 3300042122 | Bacteria | 951 |
| 473 | Ga0450923_011382 | 3300042125 | Bacteria | 1598 |
| 474 | Ga0450892_037154 | 3300042130 | Bacteria | 527 |
| 475 | Ga0450906_004944 | 3300042145 | Bacteria | 2767 |
| 476 | Ga0450907_007698 | 3300042146 | Bacteria | 1797 |
| 477 | Ga0450910_004617 | 3300042147 | Bacteria | 1863 |
| 478 | Ga0450908_005650 | 3300042184 | Bacteria | 2392 |
| 479 | Ga0439434_0095217 | 3300042435 | Bacteria | 955 |
| 480 | Ga0450918_001232 | 3300042531 | Bacteria | 5200 |
| 481 | Ga0450893_0013544 | 3300042532 | Bacteria | 1361 |
| 482 | Ga0466969_0007263 | 3300044656 | Bacteria | 5893 |
| 483 | Ga0466969_0026062 | 3300044656 | Bacteria | 3000 |
| 484 | Ga0466969_0027188 | 3300044656 | Bacteria | 2930 |
| 485 | Ga0466965_0067375 | 3300044683 | Bacteria | 1797 |
| 486 | Ga0466966_0004979 | 3300044684 | Bacteria | 8733 |
| 487 | Ga0466966_0082942 | 3300044684 | Bacteria | 1995 |
| 488 | Ga0466966_0089068 | 3300044684 | Bacteria | 1917 |
| 489 | Ga0466966_0136638 | 3300044684 | Bacteria | 1499 |
| 490 | Ga0466966_0185026 | 3300044684 | Bacteria | 1263 |
| 491 | Ga0466966_0442695 | 3300044684 | Bacteria | 781 |
| 492 | Ga0466961_0000480 | 3300044693 | Bacteria | 25359 |
| 493 | Ga0466961_0036032 | 3300044693 | Bacteria | 3176 |
| 494 | Ga0466963_1329470 | 3300044694 | Bacteria | 504 |
| 495 | Ga0466964_0000160 | 3300044706 | Bacteria | 18532 |
| 496 | Ga0453684_0203861 | 3300044712 | Bacteria | 2303 |
| 497 | Ga0453684_1009376 | 3300044712 | Bacteria | 884 |
| 498 | Ga0466971_0000238 | 3300044719 | Bacteria | 20975 |
| 499 | Ga0466971_0144131 | 3300044719 | Bacteria | 1110 |
| 500 | Ga0466968_0053401 | 3300044735 | Bacteria | 1731 |
| 501 | Ga0466968_0348242 | 3300044735 | Bacteria | 719 |
| 502 | Ga0466970_0000364 | 3300044765 | Bacteria | 22005 |
| 503 | Ga0466970_0011225 | 3300044765 | Bacteria | 4565 |
| 504 | Ga0466957_0196527 | 3300044842 | Bacteria | 1323 |
| 505 | Ga0466959_0007062 | 3300045049 | Bacteria | 7850 |
| 506 | Ga0466959_0010129 | 3300045049 | Bacteria | 6724 |
| 507 | Ga0466959_0018297 | 3300045049 | Bacteria | 5144 |
| 508 | Ga0466959_0026567 | 3300045049 | Bacteria | 4290 |
| 509 | Ga0466959_0049772 | 3300045049 | Bacteria | 3078 |
| 510 | Ga0466959_0054997 | 3300045049 | Bacteria | 2907 |
| 511 | Ga0466959_0152313 | 3300045049 | Bacteria | 1629 |
| 512 | Ga0451576_0080312 | 3300045051 | Bacteria | 3393 |
| 513 | Ga0451576_2343414 | 3300045051 | Bacteria | 547 |
| 514 | Ga0466958_0132853 | 3300045836 | Bacteria | 1564 |
| 515 | Ga0495629_0604946 | 3300046459 | Bacteria | 733 |
| 516 | Ga0495638_0001474 | 3300046460 | Bacteria | 21249 |
| 517 | Ga0495638_0060229 | 3300046460 | Bacteria | 2349 |
| 518 | Ga0495650_0004986 | 3300046471 | Bacteria | 8845 |
| 519 | Ga0495580_0400565 | 3300046472 | Bacteria | 925 |
| 520 | Ga0495582_0661853 | 3300046473 | Bacteria | 604 |
| 521 | Ga0495605_0005411 | 3300046474 | Bacteria | 7437 |
| 522 | Ga0495605_0056737 | 3300046474 | Bacteria | 1888 |
| 523 | Ga0495584_0189131 | 3300046491 | Bacteria | 1046 |
| 524 | Ga0495585_0001873 | 3300046492 | Bacteria | 15877 |
| 525 | Ga0495596_0028000 | 3300046500 | Bacteria | 2263 |
| 526 | Ga0495596_0060673 | 3300046500 | Bacteria | 1473 |
| 527 | Ga0495583_0316976 | 3300046506 | Bacteria | 618 |
| 528 | Ga0495606_0201739 | 3300046507 | Bacteria | 1133 |
| 529 | Ga0495606_0271622 | 3300046507 | Bacteria | 931 |
| 530 | Ga0495606_0419619 | 3300046507 | Bacteria | 692 |
| 531 | Ga0495610_0113972 | 3300046512 | Bacteria | 1194 |
| 532 | Ga0495610_0120520 | 3300046512 | Bacteria | 1150 |
| 533 | Ga0495620_0199217 | 3300046515 | Bacteria | 770 |
| 534 | Ga0495631_0002780 | 3300046518 | Bacteria | 9702 |
| 535 | Ga0495631_0033298 | 3300046518 | Bacteria | 2316 |
| 536 | Ga0495631_0270415 | 3300046518 | Bacteria | 724 |
| 537 | Ga0495632_0023143 | 3300046519 | Bacteria | 3321 |
| 538 | Ga0495632_0045460 | 3300046519 | Bacteria | 2187 |
| 539 | Ga0495637_0037864 | 3300046520 | Bacteria | 2091 |
| 540 | Ga0495637_0107835 | 3300046520 | Bacteria | 1082 |
| 541 | Ga0495643_0103037 | 3300046522 | Bacteria | 1460 |
| 542 | Ga0495648_0395461 | 3300046524 | Bacteria | 619 |
| 543 | Ga0495642_0021934 | 3300046528 | Bacteria | 2513 |
| 544 | Ga0495642_0225353 | 3300046528 | Bacteria | 819 |
| 545 | Ga0495654_0001432 | 3300046530 | Bacteria | 16416 |
| 546 | Ga0495654_0100168 | 3300046530 | Bacteria | 1335 |
| 547 | Ga0495665_0112033 | 3300046531 | Bacteria | 1431 |
| 548 | Ga0495586_0022810 | 3300046535 | Bacteria | 3340 |
| 549 | Ga0495598_0125615 | 3300046537 | Bacteria | 874 |
| 550 | Ga0495609_0015522 | 3300046538 | Bacteria | 3564 |
| 551 | Ga0495609_0212352 | 3300046538 | Bacteria | 806 |
| 552 | Ga0495597_0000247 | 3300046542 | Bacteria | 49379 |
| 553 | Ga0495597_0006202 | 3300046542 | Bacteria | 6204 |
| 554 | Ga0495597_0006566 | 3300046542 | Bacteria | 5999 |
| 555 | Ga0495597_0026037 | 3300046542 | Bacteria | 2689 |
| 556 | Ga0495597_0105138 | 3300046542 | Bacteria | 1187 |
| 557 | Ga0495622_0339689 | 3300046557 | Bacteria | 651 |
| 558 | Ga0495633_0006692 | 3300046558 | Bacteria | 6784 |
| 559 | Ga0495633_0175176 | 3300046558 | Bacteria | 988 |
| 560 | Ga0495668_0013620 | 3300046616 | Bacteria | 4790 |
| 561 | Ga0495668_0016359 | 3300046616 | Bacteria | 4311 |
| 562 | Ga0495668_0153935 | 3300046616 | Bacteria | 1259 |
| 563 | Ga0495668_0343665 | 3300046616 | Bacteria | 819 |
| 564 | Ga0495611_0014166 | 3300046648 | Bacteria | 3403 |
| 565 | Ga0495625_0000012 | 3300046660 | Bacteria | 363006 |
| 566 | Ga0495625_0008569 | 3300046660 | Bacteria | 8704 |
| 567 | Ga0495625_0064368 | 3300046660 | Bacteria | 2586 |
| 568 | Ga0495625_0235619 | 3300046660 | Bacteria | 1194 |
| 569 | Ga0495635_0015395 | 3300046663 | Bacteria | 5349 |
| 570 | Ga0495659_0245138 | 3300046664 | Bacteria | 745 |
| 571 | Ga0495661_0000917 | 3300046665 | Bacteria | 27026 |
| 572 | Ga0495661_0272388 | 3300046665 | Bacteria | 856 |
| 573 | Ga0495647_0155160 | 3300046681 | Bacteria | 984 |
| 574 | Ga0495613_0056607 | 3300046689 | Bacteria | 2879 |
| 575 | Ga0495613_0534501 | 3300046689 | Bacteria | 786 |
| 576 | Ga0495670_0000164 | 3300046691 | Bacteria | 29058 |
| 577 | Ga0495670_0304846 | 3300046691 | Bacteria | 854 |
| 578 | Ga0495671_0195832 | 3300046692 | Bacteria | 981 |
| 579 | Ga0495649_0011013 | 3300046694 | Bacteria | 5327 |
| 580 | Ga0495649_0098412 | 3300046694 | Bacteria | 1556 |
| 581 | Ga0495649_0225673 | 3300046694 | Bacteria | 968 |
| 582 | Ga0495649_0247977 | 3300046694 | Bacteria | 915 |
| 583 | Ga0495589_0000994 | 3300046794 | Bacteria | 17205 |
| 584 | Ga0495589_0008215 | 3300046794 | Bacteria | 5457 |
| 585 | Ga0495660_0024909 | 3300046810 | Bacteria | 3403 |
| 586 | Ga0495660_0177636 | 3300046810 | Bacteria | 1032 |
| 587 | Ga0495660_0201694 | 3300046810 | Bacteria | 949 |
| 588 | Ga0495604_0016868 | 3300047317 | Bacteria | 5839 |
| 589 | Ga0495636_0018153 | 3300047318 | Bacteria | 2821 |
| 590 | Ga0495636_0259750 | 3300047318 | Bacteria | 805 |
| 591 | Ga0495674_0047598 | 3300047319 | Bacteria | 3801 |
| 592 | Ga0495674_0641986 | 3300047319 | Bacteria | 838 |
| 593 | Ga0495672_0000093 | 3300047320 | Bacteria | 145111 |
| 594 | Ga0495672_0002148 | 3300047320 | Bacteria | 18433 |
| 595 | Ga0495672_0111975 | 3300047320 | Bacteria | 1463 |
| 596 | Ga0495672_0270936 | 3300047320 | Bacteria | 815 |
| 597 | Ga0495680_0003473 | 3300047322 | Bacteria | 15490 |
| 598 | Ga0495683_0004538 | 3300047323 | Bacteria | 7858 |
| 599 | Ga0495683_0008031 | 3300047323 | Bacteria | 5666 |
| 600 | Ga0495683_0062904 | 3300047323 | Bacteria | 1835 |
| 601 | Ga0495687_011099 | 3300047443 | Bacteria | 4872 |
| 602 | Ga0495687_071676 | 3300047443 | Bacteria | 1387 |
| 603 | Ga0495675_0491627 | 3300047444 | Bacteria | 705 |
| 604 | Ga0495677_0007568 | 3300047445 | Bacteria | 4054 |
| 605 | Ga0495679_081727 | 3300047446 | Bacteria | 916 |
| 606 | Ga0495681_0000363 | 3300047470 | Bacteria | 35486 |
| 607 | Ga0495686_0000148 | 3300047472 | Bacteria | 137236 |
| 608 | Ga0495686_0273076 | 3300047472 | Bacteria | 942 |
| 609 | Ga0495593_0064424 | 3300047673 | Bacteria | 1913 |
| 610 | Ga0495614_0013968 | 3300048089 | Bacteria | 3520 |
| 611 | Ga0495626_0001431 | 3300048091 | Bacteria | 18978 |
| 612 | Ga0495626_0079080 | 3300048091 | Bacteria | 1463 |
| 613 | Ga0495626_0085083 | 3300048091 | Bacteria | 1399 |
| 614 | Ga0495626_0133624 | 3300048091 | Bacteria | 1057 |
| 615 | Ga0496100_0303717 | 3300048903 | Bacteria | 1195 |
| 616 | Ga0496100_0563834 | 3300048903 | Bacteria | 882 |
| 617 | Ga0496101_0078367 | 3300048904 | Bacteria | 2437 |
| 618 | Ga0496101_0375965 | 3300048904 | Bacteria | 1117 |
| 619 | Ga0496102_0028337 | 3300048905 | Bacteria | 5001 |
| 620 | Ga0496102_0081592 | 3300048905 | Bacteria | 2982 |
| 621 | Ga0496102_1040571 | 3300048905 | Bacteria | 739 |
| 622 | Ga0496103_0152174 | 3300048906 | Bacteria | 1482 |
| 623 | Ga0496103_0220705 | 3300048906 | Bacteria | 1219 |
| 624 | Ga0496103_0572378 | 3300048906 | Bacteria | 720 |
| 625 | Ga0496104_0064221 | 3300048907 | Bacteria | 3483 |
| 626 | Ga0496104_0275303 | 3300048907 | Bacteria | 1596 |
| 627 | Ga0496104_0479330 | 3300048907 | Bacteria | 1155 |
| 628 | Ga0496105_0105397 | 3300048908 | Bacteria | 2327 |
| 629 | Ga0496105_0399064 | 3300048908 | Bacteria | 1092 |
| 630 | Ga0496106_0676042 | 3300048909 | Bacteria | 824 |
| 631 | Ga0496107_0317377 | 3300048910 | Bacteria | 1160 |
| 632 | Ga0496107_0354722 | 3300048910 | Bacteria | 1091 |
| 633 | Ga0496108_0147306 | 3300048911 | Bacteria | 2030 |
| 634 | Ga0496108_0844141 | 3300048911 | Bacteria | 788 |
| 635 | Ga0496109_0228554 | 3300048912 | Bacteria | 1750 |
| 636 | Ga0496110_1673255 | 3300048913 | Unclassified | 546 |
| 637 | Ga0496112_0020656 | 3300048915 | Bacteria | 6245 |
| 638 | Ga0496112_0222165 | 3300048915 | Bacteria | 1845 |
| 639 | Ga0496112_0234606 | 3300048915 | Bacteria | 1788 |
| 640 | Ga0496114_1620495 | 3300048917 | Unclassified | 535 |
| 641 | Ga0496116_0000634 | 3300048919 | Bacteria | 46010 |
| 642 | Ga0496116_0037456 | 3300048919 | Bacteria | 3382 |
| 643 | Ga0496117_0000155 | 3300048920 | Bacteria | 146091 |
| 644 | Ga0496118_0000066 | 3300048921 | Bacteria | 207678 |
| 645 | Ga0496118_0254997 | 3300048921 | Bacteria | 994 |
| 646 | Ga0496119_0000499 | 3300048922 | Bacteria | 53522 |
| 647 | Ga0496119_0122632 | 3300048922 | Bacteria | 1426 |
| 648 | Ga0496120_0000370 | 3300048923 | Bacteria | 73138 |
| 649 | Ga0496120_0018632 | 3300048923 | Bacteria | 4466 |
| 650 | Ga0496120_0359487 | 3300048923 | Bacteria | 652 |
| 651 | Ga0496120_0409370 | 3300048923 | Bacteria | 597 |
| 652 | Ga0496121_0000619 | 3300048924 | Bacteria | 66079 |
| 653 | Ga0496121_0006925 | 3300048924 | Bacteria | 13821 |
| 654 | Ga0496121_0185966 | 3300048924 | Bacteria | 1494 |
| 655 | Ga0496121_0298945 | 3300048924 | Bacteria | 1093 |
| 656 | Ga0496121_0506058 | 3300048924 | Bacteria | 765 |
| 657 | Ga0496121_0598494 | 3300048924 | Bacteria | 681 |
| 658 | Ga0496124_0016299 | 3300048927 | Bacteria | 7074 |
| 659 | Ga0496125_0004890 | 3300048928 | Bacteria | 15196 |
| 660 | Ga0496125_0022603 | 3300048928 | Bacteria | 5834 |
| 661 | Ga0496125_0148458 | 3300048928 | Bacteria | 1615 |
| 662 | Ga0496125_0194237 | 3300048928 | Bacteria | 1337 |
| 663 | Ga0496125_0561475 | 3300048928 | Bacteria | 630 |
| 664 | Ga0496126_0002850 | 3300048929 | Bacteria | 22616 |
| 665 | Ga0496126_0010810 | 3300048929 | Bacteria | 9526 |
| 666 | Ga0496126_0191826 | 3300048929 | Bacteria | 1730 |
| 667 | Ga0496126_0213899 | 3300048929 | Bacteria | 1622 |
| 668 | Ga0496126_1328475 | 3300048929 | Bacteria | 522 |
| 669 | Ga0495682_0003801 | 3300049460 | Bacteria | 6638 |
| 670 | Ga0501031_0319494 | 3300049568 | Bacteria | 1006 |
| 671 | Ga0501033_0000805 | 3300049570 | Bacteria | 28711 |
| 672 | Ga0501036_0028410 | 3300049572 | Bacteria | 4726 |
| 673 | Ga0501036_0108082 | 3300049572 | Bacteria | 2352 |
| 674 | Ga0501036_0216209 | 3300049572 | Bacteria | 1610 |
| 675 | Ga0501036_0814688 | 3300049572 | Bacteria | 768 |
| 676 | Ga0501037_0000582 | 3300049573 | Bacteria | 28727 |
| 677 | Ga0501037_0098752 | 3300049573 | Bacteria | 2109 |
| 678 | Ga0501037_0323154 | 3300049573 | Bacteria | 1068 |
| 679 | Ga0501037_0461574 | 3300049573 | Bacteria | 865 |
| 680 | Ga0501038_0003235 | 3300049574 | Bacteria | 15179 |
| 681 | Ga0501038_0009487 | 3300049574 | Bacteria | 8929 |
| 682 | Ga0501038_0099982 | 3300049574 | Bacteria | 2417 |
| 683 | Ga0501038_0162454 | 3300049574 | Bacteria | 1814 |
| 684 | Ga0501039_0033474 | 3300049575 | Bacteria | 3962 |
| 685 | Ga0501039_0096621 | 3300049575 | Bacteria | 2303 |
| 686 | Ga0501039_0325494 | 3300049575 | Bacteria | 1208 |
| 687 | Ga0501039_0505008 | 3300049575 | Bacteria | 949 |
| 688 | Ga0501040_0004099 | 3300049576 | Bacteria | 9475 |
| 689 | Ga0501040_0033773 | 3300049576 | Bacteria | 3468 |
| 690 | Ga0501040_0313074 | 3300049576 | Bacteria | 1122 |
| 691 | Ga0501041_0000590 | 3300049577 | Bacteria | 18968 |
| 692 | Ga0501041_0004782 | 3300049577 | Bacteria | 7863 |
| 693 | Ga0501041_0305120 | 3300049577 | Bacteria | 1003 |
| 694 | Ga0501042_0005517 | 3300049578 | Bacteria | 8154 |
| 695 | Ga0501042_0079843 | 3300049578 | Bacteria | 2344 |
| 696 | Ga0501043_0002452 | 3300049579 | Bacteria | 15684 |
| 697 | Ga0501043_0135359 | 3300049579 | Bacteria | 1930 |
| 698 | Ga0501043_0282417 | 3300049579 | Bacteria | 1272 |
| 699 | Ga0501043_0366304 | 3300049579 | Bacteria | 1093 |
| 700 | Ga0501043_0545686 | 3300049579 | Bacteria | 862 |
| 701 | Ga0501046_0008944 | 3300049580 | Bacteria | 8699 |
| 702 | Ga0501046_0013750 | 3300049580 | Bacteria | 6843 |
| 703 | Ga0501046_0115662 | 3300049580 | Bacteria | 2045 |
| 704 | Ga0501047_0396962 | 3300049581 | Bacteria | 1212 |
| 705 | Ga0501047_0983265 | 3300049581 | Bacteria | 657 |
| 706 | Ga0501047_1298074 | 3300049581 | Bacteria | 542 |
| 707 | Ga0501048_0003792 | 3300049582 | Bacteria | 11540 |
| 708 | Ga0501048_0054360 | 3300049582 | Bacteria | 2844 |
| 709 | Ga0501048_0087171 | 3300049582 | Bacteria | 2203 |
| 710 | Ga0501048_0120558 | 3300049582 | Bacteria | 1853 |
| 711 | Ga0501068_0014074 | 3300049584 | Bacteria | 4567 |
| 712 | Ga0501068_0152570 | 3300049584 | Bacteria | 1452 |
| 713 | Ga0501068_0437529 | 3300049584 | Bacteria | 845 |
| 714 | Ga0501068_0575896 | 3300049584 | Bacteria | 733 |
| 715 | Ga0501069_0000003 | 3300049585 | Bacteria | 210301 |
| 716 | Ga0501070_0000647 | 3300049586 | Bacteria | 32035 |
| 717 | Ga0501070_1050392 | 3300049586 | Bacteria | 630 |
| 718 | Ga0501071_0002353 | 3300049587 | Bacteria | 11436 |
| 719 | Ga0501071_0004332 | 3300049587 | Bacteria | 8997 |
| 720 | Ga0501071_0037511 | 3300049587 | Bacteria | 3461 |
| 721 | Ga0501071_0040348 | 3300049587 | Bacteria | 3340 |
| 722 | Ga0501072_0076318 | 3300049588 | Bacteria | 2651 |
| 723 | Ga0501072_0212164 | 3300049588 | Bacteria | 1543 |
| 724 | Ga0501072_0403614 | 3300049588 | Bacteria | 1084 |
| 725 | Ga0501073_0025325 | 3300049589 | Bacteria | 4256 |
| 726 | Ga0501074_0000677 | 3300049590 | Bacteria | 21291 |
| 727 | Ga0501074_0026694 | 3300049590 | Bacteria | 4187 |
| 728 | Ga0501075_0000868 | 3300049591 | Bacteria | 19100 |
| 729 | Ga0501075_0029945 | 3300049591 | Bacteria | 4027 |
| 730 | Ga0501075_0112911 | 3300049591 | Bacteria | 2066 |
| 731 | Ga0501075_0247000 | 3300049591 | Bacteria | 1360 |
| 732 | Ga0501076_0001007 | 3300049592 | Bacteria | 18491 |
| 733 | Ga0501076_0007528 | 3300049592 | Bacteria | 7922 |
| 734 | Ga0501076_0075842 | 3300049592 | Bacteria | 2696 |
| 735 | Ga0501076_0125139 | 3300049592 | Bacteria | 2083 |
| 736 | Ga0501077_0002578 | 3300049593 | Bacteria | 10868 |
| 737 | Ga0501077_0059908 | 3300049593 | Bacteria | 2416 |
| 738 | Ga0501249_001312 | 3300049679 | Bacteria | 5177 |
| 739 | Ga0501225_0001764 | 3300049705 | Bacteria | 6775 |
| 740 | Ga0501079_0001595 | 3300049741 | Bacteria | 16122 |
| 741 | Ga0501079_0213692 | 3300049741 | Bacteria | 1506 |
| 742 | Ga0501080_0000590 | 3300049742 | Bacteria | 28661 |
| 743 | Ga0501080_0007272 | 3300049742 | Bacteria | 9990 |
| 744 | Ga0501080_0008284 | 3300049742 | Bacteria | 9418 |
| 745 | Ga0501080_0172049 | 3300049742 | Bacteria | 1997 |
| 746 | Ga0501081_0008038 | 3300049743 | Bacteria | 6844 |
| 747 | Ga0501081_0014939 | 3300049743 | Bacteria | 5121 |
| 748 | Ga0501081_0086002 | 3300049743 | Bacteria | 2207 |
| 749 | Ga0501083_0000036 | 3300049744 | Bacteria | 95904 |
| 750 | Ga0501083_0081084 | 3300049744 | Bacteria | 2151 |
| 751 | Ga0501262_000301 | 3300049759 | Bacteria | 6024 |
| 752 | Ga0501035_0000358 | 3300049822 | Bacteria | 52587 |
| 753 | Ga0501035_0057686 | 3300049822 | Bacteria | 3461 |
| 754 | Ga0501044_0000016 | 3300049823 | Bacteria | 231626 |
| 755 | Ga0501044_0625815 | 3300049823 | Bacteria | 967 |
| 756 | Ga0501044_0985325 | 3300049823 | Bacteria | 715 |
| 757 | Ga0501045_0004235 | 3300049824 | Bacteria | 9890 |
| 758 | Ga0501045_0006020 | 3300049824 | Bacteria | 8397 |
| 759 | Ga0501045_0150506 | 3300049824 | Bacteria | 1731 |
| 760 | Ga0501045_0534335 | 3300049824 | Bacteria | 870 |
| 761 | nmdc:mga03683_31787_c1 | 3300050489 | Bacteria | 2120 |
| 762 | nmdc:mga03683_403646_c1 | 3300050489 | Bacteria | 653 |
| 763 | nmdc:mga03683_42155_c1 | 3300050489 | Bacteria | 1877 |
| 764 | nmdc:mga03683_48688_c1 | 3300050489 | Bacteria | 1762 |
| 765 | nmdc:mga03n38_119231_c1 | 3300050490 | Bacteria | 1295 |
| 766 | nmdc:mga03n38_25127_c1 | 3300050490 | Bacteria | 2442 |
| 767 | nmdc:mga03n38_40863_c1 | 3300050490 | Bacteria | 2018 |
| 768 | nmdc:mga00v17_276016_c1 | 3300050491 | Bacteria | 1091 |
| 769 | nmdc:mga00v17_801971_c1 | 3300050491 | Bacteria | 600 |
| 770 | nmdc:mga00v17_85704_c1 | 3300050491 | Bacteria | 1973 |
| 771 | nmdc:mga0yw44_33585_c1 | 3300050492 | Bacteria | 2999 |
| 772 | nmdc:mga0k408_156427_c1 | 3300050493 | Bacteria | 1358 |
| 773 | nmdc:mga0k408_21239_c1 | 3300050493 | Bacteria | 3645 |
| 774 | nmdc:mga0k408_22223_c1 | 3300050493 | Bacteria | 3571 |
| 775 | nmdc:mga0k408_231214_c1 | 3300050493 | Bacteria | 1104 |
| 776 | nmdc:mga0k408_482024_c1 | 3300050493 | Bacteria | 736 |
| 777 | nmdc:mga0k408_565517_c1 | 3300050493 | Bacteria | 672 |
| 778 | nmdc:mga06z11_212815_c1 | 3300050494 | Bacteria | 1127 |
| 779 | nmdc:mga06z11_532656_c1 | 3300050494 | Bacteria | 712 |
| 780 | nmdc:mga06z11_644078_c1 | 3300050494 | Bacteria | 645 |
| 781 | nmdc:mga06z11_690634_c1 | 3300050494 | Bacteria | 622 |
| 782 | nmdc:mga04h51_59450_c1 | 3300050495 | Bacteria | 1306 |
| 783 | nmdc:mga07m45_2210_c1 | 3300050496 | Bacteria | 9083 |
| 784 | nmdc:mga07m45_262033_c1 | 3300050496 | Bacteria | 1006 |
| 785 | nmdc:mga07m45_7307_c1 | 3300050496 | Bacteria | 5636 |
| 786 | nmdc:mga09592_424975_c1 | 3300050508 | Bacteria | 1147 |
| 787 | nmdc:mga0sz30_179089_c1 | 3300050516 | Bacteria | 940 |
| 788 | Ga0500583_0147949 | 3300053092 | Bacteria | 1168 |
| 789 | Ga0500651_0446278 | 3300053093 | Bacteria | 720 |
| 790 | Ga0500651_0758586 | 3300053093 | Unclassified | 515 |
| 791 | Ga0500558_143548 | 3300053106 | Unclassified | 896 |
| 792 | Ga0500572_004400 | 3300053111 | Unclassified | 3196 |
| 793 | Ga0500607_061847 | 3300053121 | Bacteria | 1958 |
| 794 | Ga0500614_035000 | 3300053123 | Bacteria | 1249 |
| 795 | Ga0500658_0498490 | 3300053134 | Bacteria | 551 |
| 796 | Ga0500559_0159209 | 3300053136 | Bacteria | 1061 |
| 797 | Ga0500559_0286239 | 3300053136 | Bacteria | 775 |
| 798 | Ga0500559_0504094 | 3300053136 | Bacteria | 556 |
| 799 | Ga0500568_0000342 | 3300053139 | Bacteria | 36454 |
| 800 | Ga0500616_0051636 | 3300053153 | Bacteria | 2166 |
| 801 | Ga0500619_152871 | 3300053154 | Bacteria | 784 |
| 802 | Ga0500622_0087080 | 3300053156 | Bacteria | 1555 |
| 803 | Ga0500639_056863 | 3300053163 | Bacteria | 2025 |
| 804 | Ga0500639_119401 | 3300053163 | Unclassified | 1269 |
| 805 | Ga0500637_0038941 | 3300053178 | Bacteria | 2680 |
| 806 | Ga0501084_0003968 | 3300054114 | Bacteria | 12052 |
| 807 | Ga0501084_0007594 | 3300054114 | Bacteria | 8938 |
| 808 | Ga0501084_0401097 | 3300054114 | Bacteria | 1159 |
| 809 | Ga0590074_033097 | 3300059423 | Bacteria | 917 |
| 810 | Ga0587084_060776 | 3300059477 | Bacteria | 692 |
| 811 | Ga0587066_028045 | 3300059490 | Bacteria | 983 |
| 812 | Ga0587066_106019 | 3300059490 | Bacteria | 645 |
| 813 | Ga0587066_189452 | 3300059490 | Unclassified | 535 |
| 814 | Ga0587070_122989 | 3300059491 | Bacteria | 623 |
| 815 | Ga0587073_0145987 | 3300059492 | Bacteria | 664 |
| 816 | Ga0587073_0214665 | 3300059492 | Unclassified | 584 |
| 817 | Ga0587077_093617 | 3300059493 | Bacteria | 710 |
| 818 | Ga0587080_053967 | 3300059503 | Bacteria | 766 |
| 819 | Ga0587082_019999 | 3300059504 | Bacteria | 1080 |
| 820 | Ga0587083_0118141 | 3300059505 | Bacteria | 682 |
| 821 | Ga0587086_047045 | 3300059507 | Unclassified | 685 |
| 822 | Ga0587088_071466 | 3300059508 | Bacteria | 724 |
| 823 | Ga0587090_002505 | 3300059510 | Bacteria | 2032 |
| 824 | Ga0587090_040870 | 3300059510 | Bacteria | 816 |
| 825 | Ga0587090_054707 | 3300059510 | Bacteria | 741 |
| 826 | Ga0587092_052743 | 3300059512 | Unclassified | 741 |
| 827 | Ga0587067_064632 | 3300059640 | Bacteria | 776 |
| 828 | Ga0587068_074027 | 3300059641 | Unclassified | 677 |
| 829 | Ga0587076_064626 | 3300059645 | Bacteria | 746 |
| 830 | Ga0587079_098194 | 3300059647 | Unclassified | 695 |
| 831 | Ga0587107_047316 | 3300059652 | Bacteria | 717 |
| 832 | Ga0587071_048307 | 3300060344 | Bacteria | 873 |
| 833 | Ga0587071_078314 | 3300060344 | Bacteria | 732 |
| 834 | Ga0587111_0092050 | 3300060346 | Unclassified | 742 |
| 835 | Ga0501082_0014009 | 3300060353 | Bacteria | 6896 |
| 836 | Ga0501082_0039248 | 3300060353 | Bacteria | 4085 |
| 837 | Ga0501082_0294363 | 3300060353 | Bacteria | 1413 |
| 838 | Ga0501082_0366662 | 3300060353 | Bacteria | 1256 |
| 839 | Ga0501082_0618569 | 3300060353 | Bacteria | 948 |
| 840 | Ga0466962_0008046 | 3300061719 | Bacteria | 5053 |
| 841 | Ga0530510_0002196 | 3300061734 | Bacteria | 13384 |
| 842 | Ga0530510_0011076 | 3300061734 | Bacteria | 6326 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005471 | Ga0070698_101280321 | Ga0070698_1012803211 | 130 |
| 2 | 3300049573 | Ga0501037_0461574 | Ga0501037_0461574_141_536 | 131 |
| 3 | 3300049574 | Ga0501038_0162454 | Ga0501038_0162454_440_835 | 131 |
| 4 | 3300049575 | Ga0501039_0505008 | Ga0501039_0505008_176_571 | 131 |
| 5 | 3300049576 | Ga0501040_0033773 | Ga0501040_0033773_1434_1829 | 131 |
| 6 | 3300049577 | Ga0501041_0305120 | Ga0501041_0305120_53_448 | 131 |
| 7 | 3300049579 | Ga0501043_0366304 | Ga0501043_0366304_250_645 | 131 |
| 8 | 3300049580 | Ga0501046_0115662 | Ga0501046_0115662_480_875 | 131 |
| 9 | 3300049582 | Ga0501048_0120558 | Ga0501048_0120558_192_587 | 131 |
| 10 | 3300049587 | Ga0501071_0037511 | Ga0501071_0037511_527_922 | 131 |
| 11 | 3300049588 | Ga0501072_0212164 | Ga0501072_0212164_911_1306 | 131 |
| 12 | 3300049591 | Ga0501075_0112911 | Ga0501075_0112911_1300_1695 | 131 |
| 13 | 3300049592 | Ga0501076_0125139 | Ga0501076_0125139_455_850 | 131 |
| 14 | 3300049743 | Ga0501081_0086002 | Ga0501081_0086002_572_967 | 131 |
| 15 | 3300049824 | Ga0501045_0150506 | Ga0501045_0150506_147_542 | 131 |
| 16 | 3300060353 | Ga0501082_0294363 | Ga0501082_0294363_411_806 | 131 |
| 17 | 3300037588 | Ga0316581_0005800 | Ga0316581_0005800_500_916 | 134 |
| 18 | 3300039438 | Ga0436360_1159934 | Ga0436360_1159934_48_452 | 134 |
| 19 | iso_pu_bacteria | 2513237146 | 2513927167 | 134 |
| 20 | iso_pu_bacteria | 2599185170 | 2599415394 | 134 |
| 21 | iso_pu_bacteria | 2765235802 | 2765468310 | 134 |
| 22 | iso_pu_bacteria | 2767802442 | 2770196272 | 134 |
| 23 | iso_pu_bacteria | 2775506902 | 2776268587 | 134 |
| 24 | iso_pu_bacteria | 2775506904 | 2776285332 | 134 |
| 25 | iso_pu_bacteria | 2837678835 | 2837681354 | 134 |
| 26 | iso_pu_bacteria | 2838035591 | 2838038884 | 134 |
| 27 | iso_pu_bacteria | 2838661181 | 2838664526 | 134 |
| 28 | iso_pu_bacteria | 2839993093 | 2839997629 | 134 |
| 29 | iso_pu_bacteria | 2840764183 | 2840770562 | 134 |
| 30 | iso_pu_bacteria | 2874123672 | 2874124814 | 134 |
| 31 | iso_pu_bacteria | 2885312484 | 2885318590 | 134 |
| 32 | iso_pu_bacteria | 2885326080 | 2885328027 | 134 |
| 33 | iso_pu_bacteria | 2885334103 | 2885337101 | 134 |
| 34 | iso_pu_bacteria | 2889790730 | 2889795580 | 134 |
| 35 | iso_pu_bacteria | 2889914905 | 2889916142 | 134 |
| 36 | iso_pu_bacteria | 2894652903 | 2894657366 | 134 |
| 37 | iso_pu_bacteria | 2904578770 | 2904581893 | 134 |
| 38 | iso_pu_bacteria | 2919119836 | 2919123561 | 134 |
| 39 | iso_pu_bacteria | 2928521798 | 2928525375 | 134 |
| 40 | iso_pu_bacteria | 2933016740 | 2933019139 | 134 |
| 41 | iso_pu_bacteria | 2954011201 | 2954011641 | 134 |
| 42 | iso_pu_bacteria | 2977864932 | 2977867944 | 134 |
| 43 | iso_pu_bacteria | 2996336353 | 2996341190 | 134 |
| 44 | iso_pu_bacteria | 3003930520 | 3003935601 | 134 |
| 45 | iso_pu_bacteria | 2513237150 | 2513955304 | 135 |
| 46 | iso_pu_bacteria | 2643221628 | 2644159308 | 135 |
| 47 | iso_pu_bacteria | 2643221660 | 2644338254 | 135 |
| 48 | iso_pu_bacteria | 2738541277 | 2738721228 | 135 |
| 49 | iso_pu_bacteria | 2738543019 | 2739280427 | 135 |
| 50 | iso_pu_bacteria | 2919462493 | 2919466836 | 135 |
| 51 | iso_pu_bacteria | 2929520902 | 2929524849 | 135 |
| 52 | iso_pu_bacteria | 2945972063 | 2945976957 | 135 |
| 53 | iso_pu_bacteria | 644736347 | 644751725 | 135 |
| 54 | 3300003323 | rootH1_10197737 | rootH1_101977372 | 138 |
| 55 | 3300003323 | rootH1_10342955 | rootH1_103429552 | 138 |
| 56 | 3300003577 | Ga0007416J51690_1062202 | Ga0007416J51690_10622022 | 138 |
| 57 | 3300004800 | Ga0058861_11899052 | Ga0058861_118990521 | 138 |
| 58 | 3300004803 | Ga0058862_11428235 | Ga0058862_114282351 | 138 |
| 59 | 3300005289 | Ga0065704_10350557 | Ga0065704_103505572 | 138 |
| 60 | 3300005295 | Ga0065707_10083026 | Ga0065707_100830269 | 138 |
| 61 | 3300005329 | Ga0070683_100149523 | Ga0070683_1001495232 | 138 |
| 62 | 3300005329 | Ga0070683_100222286 | Ga0070683_1002222862 | 138 |
| 63 | 3300005329 | Ga0070683_100350078 | Ga0070683_1003500782 | 138 |
| 64 | 3300005335 | Ga0070666_11163125 | Ga0070666_111631251 | 138 |
| 65 | 3300005336 | Ga0070680_100002272 | Ga0070680_1000022722 | 138 |
| 66 | 3300005336 | Ga0070680_100054814 | Ga0070680_1000548142 | 138 |
| 67 | 3300005336 | Ga0070680_100210072 | Ga0070680_1002100722 | 138 |
| 68 | 3300005336 | Ga0070680_100489952 | Ga0070680_1004899522 | 138 |
| 69 | 3300005336 | Ga0070680_100612113 | Ga0070680_1006121132 | 138 |
| 70 | 3300005336 | Ga0070680_101239291 | Ga0070680_1012392911 | 138 |
| 71 | 3300005341 | Ga0070691_10395840 | Ga0070691_103958402 | 138 |
| 72 | 3300005344 | Ga0070661_101079788 | Ga0070661_1010797881 | 138 |
| 73 | 3300005355 | Ga0070671_100000182 | Ga0070671_10000018223 | 138 |
| 74 | 3300005356 | Ga0070674_101383634 | Ga0070674_1013836342 | 138 |
| 75 | 3300005367 | Ga0070667_100054646 | Ga0070667_1000546463 | 138 |
| 76 | 3300005367 | Ga0070667_100786611 | Ga0070667_1007866112 | 138 |
| 77 | 3300005367 | Ga0070667_100875641 | Ga0070667_1008756411 | 138 |
| 78 | 3300005434 | Ga0070709_10206284 | Ga0070709_102062841 | 138 |
| 79 | 3300005436 | Ga0070713_100913627 | Ga0070713_1009136272 | 138 |
| 80 | 3300005437 | Ga0070710_10459449 | Ga0070710_104594491 | 138 |
| 81 | 3300005437 | Ga0070710_11482374 | Ga0070710_114823741 | 138 |
| 82 | 3300005458 | Ga0070681_10000436 | Ga0070681_1000043629 | 138 |
| 83 | 3300005458 | Ga0070681_10004460 | Ga0070681_100044604 | 138 |
| 84 | 3300005458 | Ga0070681_10009629 | Ga0070681_100096293 | 138 |
| 85 | 3300005458 | Ga0070681_10016296 | Ga0070681_100162966 | 138 |
| 86 | 3300005458 | Ga0070681_10032105 | Ga0070681_100321055 | 138 |
| 87 | 3300005458 | Ga0070681_10200921 | Ga0070681_102009212 | 138 |
| 88 | 3300005459 | Ga0068867_100131642 | Ga0068867_1001316422 | 138 |
| 89 | 3300005466 | Ga0070685_10833538 | Ga0070685_108335382 | 138 |
| 90 | 3300005530 | Ga0070679_100009702 | Ga0070679_1000097024 | 138 |
| 91 | 3300005530 | Ga0070679_100046866 | Ga0070679_1000468664 | 138 |
| 92 | 3300005530 | Ga0070679_100049877 | Ga0070679_1000498774 | 138 |
| 93 | 3300005530 | Ga0070679_100179819 | Ga0070679_1001798192 | 138 |
| 94 | 3300005530 | Ga0070679_100245951 | Ga0070679_1002459511 | 138 |
| 95 | 3300005530 | Ga0070679_100589524 | Ga0070679_1005895242 | 138 |
| 96 | 3300005535 | Ga0070684_100298250 | Ga0070684_1002982502 | 138 |
| 97 | 3300005535 | Ga0070684_100376661 | Ga0070684_1003766612 | 138 |
| 98 | 3300005536 | Ga0070697_100302829 | Ga0070697_1003028292 | 138 |
| 99 | 3300005544 | Ga0070686_100214006 | Ga0070686_1002140062 | 138 |
| 100 | 3300005548 | Ga0070665_100000894 | Ga0070665_10000089426 | 138 |
| 101 | 3300005548 | Ga0070665_100002017 | Ga0070665_1000020175 | 138 |
| 102 | 3300005548 | Ga0070665_100077289 | Ga0070665_1000772892 | 138 |
| 103 | 3300005563 | Ga0068855_100004475 | Ga0068855_1000044754 | 138 |
| 104 | 3300005563 | Ga0068855_100011278 | Ga0068855_10001127810 | 138 |
| 105 | 3300005563 | Ga0068855_100041746 | Ga0068855_1000417465 | 138 |
| 106 | 3300005563 | Ga0068855_100188623 | Ga0068855_1001886233 | 138 |
| 107 | 3300005563 | Ga0068855_100277542 | Ga0068855_1002775422 | 138 |
| 108 | 3300005563 | Ga0068855_101009202 | Ga0068855_1010092022 | 138 |
| 109 | 3300005563 | Ga0068855_101841820 | Ga0068855_1018418202 | 138 |
| 110 | 3300005577 | Ga0068857_100151089 | Ga0068857_1001510892 | 138 |
| 111 | 3300005614 | Ga0068856_100508342 | Ga0068856_1005083422 | 138 |
| 112 | 3300005614 | Ga0068856_101929294 | Ga0068856_1019292941 | 138 |
| 113 | 3300005614 | Ga0068856_102213181 | Ga0068856_1022131812 | 138 |
| 114 | 3300005616 | Ga0068852_101065469 | Ga0068852_1010654692 | 138 |
| 115 | 3300005616 | Ga0068852_101118687 | Ga0068852_1011186872 | 138 |
| 116 | 3300005617 | Ga0068859_100000520 | Ga0068859_10000052011 | 138 |
| 117 | 3300005617 | Ga0068859_100906620 | Ga0068859_1009066202 | 138 |
| 118 | 3300005617 | Ga0068859_100944714 | Ga0068859_1009447142 | 138 |
| 119 | 3300005719 | Ga0068861_101816067 | Ga0068861_1018160672 | 138 |
| 120 | 3300005841 | Ga0068863_100002040 | Ga0068863_1000020409 | 138 |
| 121 | 3300005841 | Ga0068863_101868559 | Ga0068863_1018685591 | 138 |
| 122 | 3300005842 | Ga0068858_100000238 | Ga0068858_10000023842 | 138 |
| 123 | 3300005842 | Ga0068858_101020577 | Ga0068858_1010205772 | 138 |
| 124 | 3300005843 | Ga0068860_100068490 | Ga0068860_1000684903 | 138 |
| 125 | 3300005844 | Ga0068862_100081566 | Ga0068862_1000815664 | 138 |
| 126 | 3300005844 | Ga0068862_100238412 | Ga0068862_1002384122 | 138 |
| 127 | 3300005937 | Ga0081455_10000519 | Ga0081455_1000051915 | 138 |
| 128 | 3300005937 | Ga0081455_10398852 | Ga0081455_103988522 | 138 |
| 129 | 3300005981 | Ga0081538_10000326 | Ga0081538_1000032625 | 138 |
| 130 | 3300005981 | Ga0081538_10010430 | Ga0081538_100104305 | 138 |
| 131 | 3300005985 | Ga0081539_10000302 | Ga0081539_1000030269 | 138 |
| 132 | 3300006042 | Ga0075368_10019180 | Ga0075368_100191803 | 138 |
| 133 | 3300006178 | Ga0075367_10212579 | Ga0075367_102125792 | 138 |
| 134 | 3300006178 | Ga0075367_10398849 | Ga0075367_103988492 | 138 |
| 135 | 3300006844 | Ga0075428_100050198 | Ga0075428_1000501985 | 138 |
| 136 | 3300006846 | Ga0075430_100178607 | Ga0075430_1001786072 | 138 |
| 137 | 3300006931 | Ga0097620_100000520 | Ga0097620_10000052011 | 138 |
| 138 | 3300006931 | Ga0097620_100906559 | Ga0097620_1009065592 | 138 |
| 139 | 3300006931 | Ga0097620_100944725 | Ga0097620_1009447251 | 138 |
| 140 | 3300009092 | Ga0105250_10038591 | Ga0105250_100385912 | 138 |
| 141 | 3300009093 | Ga0105240_10001162 | Ga0105240_1000116218 | 138 |
| 142 | 3300009093 | Ga0105240_10001667 | Ga0105240_1000166719 | 138 |
| 143 | 3300009093 | Ga0105240_10015663 | Ga0105240_1001566310 | 138 |
| 144 | 3300009093 | Ga0105240_10021151 | Ga0105240_100211517 | 138 |
| 145 | 3300009093 | Ga0105240_10047887 | Ga0105240_100478875 | 138 |
| 146 | 3300009093 | Ga0105240_10074921 | Ga0105240_100749213 | 138 |
| 147 | 3300009093 | Ga0105240_10106085 | Ga0105240_101060853 | 138 |
| 148 | 3300009093 | Ga0105240_10152858 | Ga0105240_101528582 | 138 |
| 149 | 3300009093 | Ga0105240_10409484 | Ga0105240_104094842 | 138 |
| 150 | 3300009101 | Ga0105247_10000317 | Ga0105247_100003177 | 138 |
| 151 | 3300009174 | Ga0105241_10327387 | Ga0105241_103273872 | 138 |
| 152 | 3300009177 | Ga0105248_10010633 | Ga0105248_100106339 | 138 |
| 153 | 3300009177 | Ga0105248_12511268 | Ga0105248_125112682 | 138 |
| 154 | 3300009545 | Ga0105237_10019273 | Ga0105237_100192737 | 138 |
| 155 | 3300009545 | Ga0105237_10087812 | Ga0105237_100878123 | 138 |
| 156 | 3300009545 | Ga0105237_10153844 | Ga0105237_101538443 | 138 |
| 157 | 3300009545 | Ga0105237_10265108 | Ga0105237_102651082 | 138 |
| 158 | 3300009551 | Ga0105238_10001249 | Ga0105238_1000124912 | 138 |
| 159 | 3300009551 | Ga0105238_10446996 | Ga0105238_104469962 | 138 |
| 160 | 3300009551 | Ga0105238_10457379 | Ga0105238_104573792 | 138 |
| 161 | 3300009551 | Ga0105238_10753255 | Ga0105238_107532551 | 138 |
| 162 | 3300009551 | Ga0105238_10943328 | Ga0105238_109433282 | 138 |
| 163 | 3300009551 | Ga0105238_11179053 | Ga0105238_111790532 | 138 |
| 164 | 3300009553 | Ga0105249_10035103 | Ga0105249_100351032 | 138 |
| 165 | 3300009553 | Ga0105249_10103087 | Ga0105249_101030872 | 138 |
| 166 | 3300009553 | Ga0105249_10260800 | Ga0105249_102608002 | 138 |
| 167 | 3300010375 | Ga0105239_10259093 | Ga0105239_102590932 | 138 |
| 168 | 3300010375 | Ga0105239_10419475 | Ga0105239_104194753 | 138 |
| 169 | 3300010375 | Ga0105239_10581895 | Ga0105239_105818952 | 138 |
| 170 | 3300011119 | Ga0105246_10082746 | Ga0105246_100827462 | 138 |
| 171 | 3300011119 | Ga0105246_11879640 | Ga0105246_118796401 | 138 |
| 172 | 3300013059 | Ga0154012_133202 | Ga0154012_1332021 | 138 |
| 173 | 3300013104 | Ga0157370_10002946 | Ga0157370_1000294620 | 138 |
| 174 | 3300013104 | Ga0157370_10134036 | Ga0157370_101340362 | 138 |
| 175 | 3300013104 | Ga0157370_10813794 | Ga0157370_108137942 | 138 |
| 176 | 3300013105 | Ga0157369_10071865 | Ga0157369_100718652 | 138 |
| 177 | 3300013105 | Ga0157369_10072482 | Ga0157369_100724823 | 138 |
| 178 | 3300013105 | Ga0157369_10140259 | Ga0157369_101402592 | 138 |
| 179 | 3300013105 | Ga0157369_10349786 | Ga0157369_103497862 | 138 |
| 180 | 3300013105 | Ga0157369_10553053 | Ga0157369_105530532 | 138 |
| 181 | 3300013296 | Ga0157374_10186550 | Ga0157374_101865502 | 138 |
| 182 | 3300013296 | Ga0157374_11963974 | Ga0157374_119639741 | 138 |
| 183 | 3300013306 | Ga0163162_10706553 | Ga0163162_107065532 | 138 |
| 184 | 3300013306 | Ga0163162_11501143 | Ga0163162_115011432 | 138 |
| 185 | 3300013307 | Ga0157372_10331880 | Ga0157372_103318803 | 138 |
| 186 | 3300013307 | Ga0157372_10625310 | Ga0157372_106253102 | 138 |
| 187 | 3300013307 | Ga0157372_10976517 | Ga0157372_109765171 | 138 |
| 188 | 3300013307 | Ga0157372_11318126 | Ga0157372_113181261 | 138 |
| 189 | 3300013307 | Ga0157372_11483110 | Ga0157372_114831102 | 138 |
| 190 | 3300013307 | Ga0157372_11696678 | Ga0157372_116966781 | 138 |
| 191 | 3300014325 | Ga0163163_10034925 | Ga0163163_100349254 | 138 |
| 192 | 3300014325 | Ga0163163_10237106 | Ga0163163_102371062 | 138 |
| 193 | 3300014325 | Ga0163163_10310041 | Ga0163163_103100412 | 138 |
| 194 | 3300014326 | Ga0157380_10002413 | Ga0157380_100024132 | 138 |
| 195 | 3300014326 | Ga0157380_11021630 | Ga0157380_110216302 | 138 |
| 196 | 3300014968 | Ga0157379_10005758 | Ga0157379_100057586 | 138 |
| 197 | 3300014968 | Ga0157379_10111408 | Ga0157379_101114083 | 138 |
| 198 | 3300014968 | Ga0157379_10122569 | Ga0157379_101225692 | 138 |
| 199 | 3300014969 | Ga0157376_10388174 | Ga0157376_103881742 | 138 |
| 200 | 3300020069 | Ga0197907_10413154 | Ga0197907_104131541 | 138 |
| 201 | 3300020069 | Ga0197907_11430259 | Ga0197907_114302592 | 138 |
| 202 | 3300020070 | Ga0206356_10150101 | Ga0206356_101501011 | 138 |
| 203 | 3300020070 | Ga0206356_10154097 | Ga0206356_101540972 | 138 |
| 204 | 3300020075 | Ga0206349_1014102 | Ga0206349_10141021 | 138 |
| 205 | 3300020076 | Ga0206355_1446838 | Ga0206355_14468382 | 138 |
| 206 | 3300020077 | Ga0206351_10312048 | Ga0206351_103120481 | 138 |
| 207 | 3300020077 | Ga0206351_10444308 | Ga0206351_104443081 | 138 |
| 208 | 3300020078 | Ga0206352_10235695 | Ga0206352_102356952 | 138 |
| 209 | 3300020081 | Ga0206354_10279087 | Ga0206354_102790871 | 138 |
| 210 | 3300021361 | Ga0213872_10134835 | Ga0213872_101348352 | 138 |
| 211 | 3300022467 | Ga0224712_10049638 | Ga0224712_100496382 | 138 |
| 212 | 3300025261 | Ga0209233_1010192 | Ga0209233_10101922 | 138 |
| 213 | 3300025297 | Ga0209758_1130091 | Ga0209758_11300912 | 138 |
| 214 | 3300025898 | Ga0207692_10204403 | Ga0207692_102044032 | 138 |
| 215 | 3300025898 | Ga0207692_10402123 | Ga0207692_104021231 | 138 |
| 216 | 3300025900 | Ga0207710_10000323 | Ga0207710_1000032313 | 138 |
| 217 | 3300025903 | Ga0207680_10137618 | Ga0207680_101376182 | 138 |
| 218 | 3300025903 | Ga0207680_11063096 | Ga0207680_110630961 | 138 |
| 219 | 3300025904 | Ga0207647_10000883 | Ga0207647_100008835 | 138 |
| 220 | 3300025906 | Ga0207699_10243311 | Ga0207699_102433112 | 138 |
| 221 | 3300025911 | Ga0207654_10591849 | Ga0207654_105918492 | 138 |
| 222 | 3300025912 | Ga0207707_10000035 | Ga0207707_1000003589 | 138 |
| 223 | 3300025912 | Ga0207707_10000591 | Ga0207707_1000059113 | 138 |
| 224 | 3300025912 | Ga0207707_10014435 | Ga0207707_100144355 | 138 |
| 225 | 3300025912 | Ga0207707_10017249 | Ga0207707_100172495 | 138 |
| 226 | 3300025912 | Ga0207707_10019236 | Ga0207707_100192362 | 138 |
| 227 | 3300025912 | Ga0207707_10055496 | Ga0207707_100554963 | 138 |
| 228 | 3300025912 | Ga0207707_10135238 | Ga0207707_101352382 | 138 |
| 229 | 3300025913 | Ga0207695_10003023 | Ga0207695_1000302319 | 138 |
| 230 | 3300025913 | Ga0207695_10042598 | Ga0207695_100425983 | 138 |
| 231 | 3300025913 | Ga0207695_10049299 | Ga0207695_100492994 | 138 |
| 232 | 3300025913 | Ga0207695_10050901 | Ga0207695_100509015 | 138 |
| 233 | 3300025913 | Ga0207695_10054673 | Ga0207695_100546733 | 138 |
| 234 | 3300025913 | Ga0207695_10073016 | Ga0207695_100730163 | 138 |
| 235 | 3300025913 | Ga0207695_10098888 | Ga0207695_100988883 | 138 |
| 236 | 3300025913 | Ga0207695_10254683 | Ga0207695_102546832 | 138 |
| 237 | 3300025913 | Ga0207695_10395849 | Ga0207695_103958492 | 138 |
| 238 | 3300025914 | Ga0207671_10065192 | Ga0207671_100651922 | 138 |
| 239 | 3300025914 | Ga0207671_10133611 | Ga0207671_101336112 | 138 |
| 240 | 3300025914 | Ga0207671_10269604 | Ga0207671_102696042 | 138 |
| 241 | 3300025917 | Ga0207660_10029544 | Ga0207660_100295443 | 138 |
| 242 | 3300025917 | Ga0207660_10068052 | Ga0207660_100680521 | 138 |
| 243 | 3300025917 | Ga0207660_10096148 | Ga0207660_100961481 | 138 |
| 244 | 3300025917 | Ga0207660_10195048 | Ga0207660_101950482 | 138 |
| 245 | 3300025917 | Ga0207660_10633968 | Ga0207660_106339682 | 138 |
| 246 | 3300025917 | Ga0207660_11091230 | Ga0207660_110912301 | 138 |
| 247 | 3300025921 | Ga0207652_10001126 | Ga0207652_100011262 | 138 |
| 248 | 3300025921 | Ga0207652_10035735 | Ga0207652_100357353 | 138 |
| 249 | 3300025921 | Ga0207652_10039665 | Ga0207652_100396652 | 138 |
| 250 | 3300025921 | Ga0207652_10084245 | Ga0207652_100842452 | 138 |
| 251 | 3300025921 | Ga0207652_10522750 | Ga0207652_105227502 | 138 |
| 252 | 3300025924 | Ga0207694_10030487 | Ga0207694_100304872 | 138 |
| 253 | 3300025924 | Ga0207694_10044347 | Ga0207694_100443474 | 138 |
| 254 | 3300025924 | Ga0207694_10473590 | Ga0207694_104735902 | 138 |
| 255 | 3300025924 | Ga0207694_10491999 | Ga0207694_104919992 | 138 |
| 256 | 3300025924 | Ga0207694_11714079 | Ga0207694_117140791 | 138 |
| 257 | 3300025928 | Ga0207700_10140699 | Ga0207700_101406992 | 138 |
| 258 | 3300025928 | Ga0207700_10466101 | Ga0207700_104661012 | 138 |
| 259 | 3300025931 | Ga0207644_10017250 | Ga0207644_100172504 | 138 |
| 260 | 3300025941 | Ga0207711_10061041 | Ga0207711_100610412 | 138 |
| 261 | 3300025944 | Ga0207661_10081576 | Ga0207661_100815762 | 138 |
| 262 | 3300025944 | Ga0207661_10109963 | Ga0207661_101099632 | 138 |
| 263 | 3300025949 | Ga0207667_10034479 | Ga0207667_100344795 | 138 |
| 264 | 3300025949 | Ga0207667_10086834 | Ga0207667_100868342 | 138 |
| 265 | 3300025949 | Ga0207667_10127246 | Ga0207667_101272463 | 138 |
| 266 | 3300025961 | Ga0207712_10046447 | Ga0207712_100464473 | 138 |
| 267 | 3300025961 | Ga0207712_10125596 | Ga0207712_101255963 | 138 |
| 268 | 3300025981 | Ga0207640_10723938 | Ga0207640_107239382 | 138 |
| 269 | 3300025986 | Ga0207658_10583965 | Ga0207658_105839652 | 138 |
| 270 | 3300025986 | Ga0207658_10790284 | Ga0207658_107902842 | 138 |
| 271 | 3300026035 | Ga0207703_10000911 | Ga0207703_1000091110 | 138 |
| 272 | 3300026035 | Ga0207703_10401786 | Ga0207703_104017862 | 138 |
| 273 | 3300026078 | Ga0207702_10916730 | Ga0207702_109167302 | 138 |
| 274 | 3300026078 | Ga0207702_10966259 | Ga0207702_109662592 | 138 |
| 275 | 3300026078 | Ga0207702_11494150 | Ga0207702_114941501 | 138 |
| 276 | 3300026078 | Ga0207702_11495845 | Ga0207702_114958452 | 138 |
| 277 | 3300026088 | Ga0207641_10004471 | Ga0207641_100044718 | 138 |
| 278 | 3300026088 | Ga0207641_11439354 | Ga0207641_114393541 | 138 |
| 279 | 3300026089 | Ga0207648_10043845 | Ga0207648_100438452 | 138 |
| 280 | 3300026116 | Ga0207674_10060944 | Ga0207674_100609442 | 138 |
| 281 | 3300026116 | Ga0207674_10706202 | Ga0207674_107062022 | 138 |
| 282 | 3300026118 | Ga0207675_100933661 | Ga0207675_1009336611 | 138 |
| 283 | 3300026121 | Ga0207683_10426413 | Ga0207683_104264132 | 138 |
| 284 | 3300028379 | Ga0268266_10002272 | Ga0268266_1000227215 | 138 |
| 285 | 3300028379 | Ga0268266_10005412 | Ga0268266_100054127 | 138 |
| 286 | 3300028379 | Ga0268266_10023766 | Ga0268266_100237662 | 138 |
| 287 | 3300028379 | Ga0268266_10092788 | Ga0268266_100927882 | 138 |
| 288 | 3300028380 | Ga0268265_10006056 | Ga0268265_100060569 | 138 |
| 289 | 3300028380 | Ga0268265_10354534 | Ga0268265_103545342 | 138 |
| 290 | 3300028794 | Ga0307515_10005767 | Ga0307515_1000576717 | 138 |
| 291 | 3300028794 | Ga0307515_10694272 | Ga0307515_106942721 | 138 |
| 292 | 3300030521 | Ga0307511_10000066 | Ga0307511_1000006615 | 138 |
| 293 | 3300030521 | Ga0307511_10042895 | Ga0307511_100428952 | 138 |
| 294 | 3300031241 | Ga0265325_10196107 | Ga0265325_101961072 | 138 |
| 295 | 3300031344 | Ga0265316_10059793 | Ga0265316_100597932 | 138 |
| 296 | 3300031507 | Ga0307509_10000003 | Ga0307509_10000003478 | 138 |
| 297 | 3300031616 | Ga0307508_10494399 | Ga0307508_104943992 | 138 |
| 298 | 3300031711 | Ga0265314_10170207 | Ga0265314_101702072 | 138 |
| 299 | 3300031727 | Ga0316576_10001058 | Ga0316576_1000105811 | 138 |
| 300 | 3300031727 | Ga0316576_10253096 | Ga0316576_102530962 | 138 |
| 301 | 3300031727 | Ga0316576_11083987 | Ga0316576_110839871 | 138 |
| 302 | 3300031733 | Ga0316577_10018697 | Ga0316577_100186974 | 138 |
| 303 | 3300031838 | Ga0307518_10330609 | Ga0307518_103306092 | 138 |
| 304 | 3300032004 | Ga0307414_10508731 | Ga0307414_105087312 | 138 |
| 305 | 3300032126 | Ga0307415_101363996 | Ga0307415_1013639961 | 138 |
| 306 | 3300032133 | Ga0316583_10040801 | Ga0316583_100408013 | 138 |
| 307 | 3300032139 | Ga0316580_10018788 | Ga0316580_100187882 | 138 |
| 308 | 3300033180 | Ga0307510_10000001 | Ga0307510_10000001714 | 138 |
| 309 | 3300033180 | Ga0307510_10029875 | Ga0307510_100298754 | 138 |
| 310 | 3300035085 | Ga0373929_0076463 | Ga0373929_0076463_290_709 | 138 |
| 311 | 3300035088 | Ga0373940_0018278 | Ga0373940_0018278_24_443 | 138 |
| 312 | 3300035114 | Ga0373939_0065438 | Ga0373939_0065438_258_677 | 138 |
| 313 | 3300035170 | Ga0373943_0727079 | Ga0373943_0727079_10_426 | 138 |
| 314 | 3300035398 | Ga0316574_0100488 | Ga0316574_0100488_580_1014 | 138 |
| 315 | 3300035691 | Ga0373931_0046417 | Ga0373931_0046417_205_624 | 138 |
| 316 | 3300035695 | Ga0373927_0096669 | Ga0373927_0096669_495_914 | 138 |
| 317 | 3300036712 | Ga0316584_0185249 | Ga0316584_0185249_531_953 | 138 |
| 318 | 3300037418 | Ga0395900_0312943 | Ga0395900_0312943_592_1008 | 138 |
| 319 | 3300037418 | Ga0395900_0453681 | Ga0395900_0453681_342_758 | 138 |
| 320 | 3300037418 | Ga0395900_0671146 | Ga0395900_0671146_533_958 | 138 |
| 321 | 3300037466 | Ga0395898_0012166 | Ga0395898_0012166_248_664 | 138 |
| 322 | 3300037466 | Ga0395898_0030222 | Ga0395898_0030222_951_1367 | 138 |
| 323 | 3300037466 | Ga0395898_0402728 | Ga0395898_0402728_532_960 | 138 |
| 324 | 3300037466 | Ga0395898_0826767 | Ga0395898_0826767_234_650 | 138 |
| 325 | 3300038443 | Ga0395901_0603155 | Ga0395901_0603155_189_605 | 138 |
| 326 | 3300039437 | Ga0436365_0910310 | Ga0436365_0910310_397_813 | 138 |
| 327 | 3300039447 | Ga0436361_0046600 | Ga0436361_0046600_49_474 | 138 |
| 328 | 3300039447 | Ga0436361_0085081 | Ga0436361_0085081_10967_11407 | 138 |
| 329 | 3300039450 | Ga0436363_0525771 | Ga0436363_0525771_283_705 | 138 |
| 330 | 3300041413 | Ga0439465_0013609 | Ga0439465_0013609_1110_1529 | 138 |
| 331 | 3300041413 | Ga0439465_0201946 | Ga0439465_0201946_20_439 | 138 |
| 332 | 3300041458 | Ga0451798_1133053 | Ga0451798_1133053_131_547 | 138 |
| 333 | 3300041498 | Ga0451841_0321022 | Ga0451841_0321022_1406_1822 | 138 |
| 334 | 3300041505 | Ga0451849_1329306 | Ga0451849_1329306_95_511 | 138 |
| 335 | 3300041512 | Ga0451853_2174092 | Ga0451853_2174092_410_826 | 138 |
| 336 | 3300042004 | Ga0439445_0105864 | Ga0439445_0105864_292_711 | 138 |
| 337 | 3300042006 | Ga0439432_076300 | Ga0439432_076300_31_450 | 138 |
| 338 | 3300044656 | Ga0466969_0007263 | Ga0466969_0007263_3706_4140 | 138 |
| 339 | 3300044656 | Ga0466969_0026062 | Ga0466969_0026062_876_1292 | 138 |
| 340 | 3300044656 | Ga0466969_0027188 | Ga0466969_0027188_2254_2670 | 138 |
| 341 | 3300044683 | Ga0466965_0067375 | Ga0466965_0067375_968_1384 | 138 |
| 342 | 3300044684 | Ga0466966_0004979 | Ga0466966_0004979_2870_3286 | 138 |
| 343 | 3300044684 | Ga0466966_0082942 | Ga0466966_0082942_332_748 | 138 |
| 344 | 3300044684 | Ga0466966_0089068 | Ga0466966_0089068_293_709 | 138 |
| 345 | 3300044684 | Ga0466966_0136638 | Ga0466966_0136638_251_787 | 138 |
| 346 | 3300044684 | Ga0466966_0185026 | Ga0466966_0185026_803_1219 | 138 |
| 347 | 3300044684 | Ga0466966_0442695 | Ga0466966_0442695_40_456 | 138 |
| 348 | 3300044693 | Ga0466961_0000480 | Ga0466961_0000480_8752_9168 | 138 |
| 349 | 3300044693 | Ga0466961_0036032 | Ga0466961_0036032_715_1149 | 138 |
| 350 | 3300044694 | Ga0466963_1329470 | Ga0466963_1329470_75_491 | 138 |
| 351 | 3300044706 | Ga0466964_0000160 | Ga0466964_0000160_17535_17951 | 138 |
| 352 | 3300044712 | Ga0453684_0203861 | Ga0453684_0203861_1202_1639 | 138 |
| 353 | 3300044712 | Ga0453684_1009376 | Ga0453684_1009376_230_652 | 138 |
| 354 | 3300044719 | Ga0466971_0000238 | Ga0466971_0000238_20517_20933 | 138 |
| 355 | 3300044719 | Ga0466971_0144131 | Ga0466971_0144131_595_1011 | 138 |
| 356 | 3300044735 | Ga0466968_0053401 | Ga0466968_0053401_274_690 | 138 |
| 357 | 3300044735 | Ga0466968_0348242 | Ga0466968_0348242_42_458 | 138 |
| 358 | 3300044765 | Ga0466970_0000364 | Ga0466970_0000364_483_899 | 138 |
| 359 | 3300044765 | Ga0466970_0011225 | Ga0466970_0011225_3284_3718 | 138 |
| 360 | 3300044842 | Ga0466957_0196527 | Ga0466957_0196527_769_1185 | 138 |
| 361 | 3300045049 | Ga0466959_0007062 | Ga0466959_0007062_3851_4285 | 138 |
| 362 | 3300045049 | Ga0466959_0010129 | Ga0466959_0010129_3851_4267 | 138 |
| 363 | 3300045049 | Ga0466959_0018297 | Ga0466959_0018297_4266_4682 | 138 |
| 364 | 3300045049 | Ga0466959_0026567 | Ga0466959_0026567_3264_3680 | 138 |
| 365 | 3300045049 | Ga0466959_0049772 | Ga0466959_0049772_352_768 | 138 |
| 366 | 3300045049 | Ga0466959_0054997 | Ga0466959_0054997_902_1438 | 138 |
| 367 | 3300045049 | Ga0466959_0152313 | Ga0466959_0152313_555_971 | 138 |
| 368 | 3300045051 | Ga0451576_0080312 | Ga0451576_0080312_2663_3100 | 138 |
| 369 | 3300045836 | Ga0466958_0132853 | Ga0466958_0132853_188_604 | 138 |
| 370 | 3300046460 | Ga0495638_0001474 | Ga0495638_0001474_17558_17992 | 138 |
| 371 | 3300046473 | Ga0495582_0661853 | Ga0495582_0661853_50_478 | 138 |
| 372 | 3300046507 | Ga0495606_0201739 | Ga0495606_0201739_664_1080 | 138 |
| 373 | 3300046507 | Ga0495606_0419619 | Ga0495606_0419619_261_677 | 138 |
| 374 | 3300046519 | Ga0495632_0045460 | Ga0495632_0045460_888_1304 | 138 |
| 375 | 3300046522 | Ga0495643_0103037 | Ga0495643_0103037_484_900 | 138 |
| 376 | 3300046538 | Ga0495609_0212352 | Ga0495609_0212352_243_659 | 138 |
| 377 | 3300046557 | Ga0495622_0339689 | Ga0495622_0339689_200_616 | 138 |
| 378 | 3300046558 | Ga0495633_0175176 | Ga0495633_0175176_533_949 | 138 |
| 379 | 3300046660 | Ga0495625_0008569 | Ga0495625_0008569_7179_7613 | 138 |
| 380 | 3300046664 | Ga0495659_0245138 | Ga0495659_0245138_36_452 | 138 |
| 381 | 3300046691 | Ga0495670_0304846 | Ga0495670_0304846_32_451 | 138 |
| 382 | 3300046694 | Ga0495649_0225673 | Ga0495649_0225673_455_871 | 138 |
| 383 | 3300047319 | Ga0495674_0641986 | Ga0495674_0641986_113_529 | 138 |
| 384 | 3300047320 | Ga0495672_0111975 | Ga0495672_0111975_636_1064 | 138 |
| 385 | 3300047443 | Ga0495687_071676 | Ga0495687_071676_493_909 | 138 |
| 386 | 3300048903 | Ga0496100_0563834 | Ga0496100_0563834_288_707 | 138 |
| 387 | 3300048905 | Ga0496102_0028337 | Ga0496102_0028337_2144_2560 | 138 |
| 388 | 3300048906 | Ga0496103_0152174 | Ga0496103_0152174_513_929 | 138 |
| 389 | 3300048906 | Ga0496103_0220705 | Ga0496103_0220705_228_644 | 138 |
| 390 | 3300048907 | Ga0496104_0275303 | Ga0496104_0275303_368_787 | 138 |
| 391 | 3300048907 | Ga0496104_0479330 | Ga0496104_0479330_480_899 | 138 |
| 392 | 3300048908 | Ga0496105_0399064 | Ga0496105_0399064_212_631 | 138 |
| 393 | 3300048909 | Ga0496106_0676042 | Ga0496106_0676042_254_673 | 138 |
| 394 | 3300048910 | Ga0496107_0354722 | Ga0496107_0354722_589_1005 | 138 |
| 395 | 3300048911 | Ga0496108_0147306 | Ga0496108_0147306_528_944 | 138 |
| 396 | 3300048911 | Ga0496108_0844141 | Ga0496108_0844141_227_646 | 138 |
| 397 | 3300048912 | Ga0496109_0228554 | Ga0496109_0228554_427_843 | 138 |
| 398 | 3300048913 | Ga0496110_1673255 | Ga0496110_1673255_35_454 | 138 |
| 399 | 3300048915 | Ga0496112_0020656 | Ga0496112_0020656_1712_2128 | 138 |
| 400 | 3300048915 | Ga0496112_0234606 | Ga0496112_0234606_239_658 | 138 |
| 401 | 3300048917 | Ga0496114_1620495 | Ga0496114_1620495_90_506 | 138 |
| 402 | 3300048919 | Ga0496116_0037456 | Ga0496116_0037456_668_1084 | 138 |
| 403 | 3300048920 | Ga0496117_0000155 | Ga0496117_0000155_116248_116664 | 138 |
| 404 | 3300048921 | Ga0496118_0000066 | Ga0496118_0000066_90883_91299 | 138 |
| 405 | 3300048921 | Ga0496118_0254997 | Ga0496118_0254997_306_740 | 138 |
| 406 | 3300048922 | Ga0496119_0000499 | Ga0496119_0000499_14500_14916 | 138 |
| 407 | 3300048922 | Ga0496119_0122632 | Ga0496119_0122632_151_567 | 138 |
| 408 | 3300048923 | Ga0496120_0000370 | Ga0496120_0000370_52010_52426 | 138 |
| 409 | 3300048923 | Ga0496120_0018632 | Ga0496120_0018632_115_531 | 138 |
| 410 | 3300048923 | Ga0496120_0359487 | Ga0496120_0359487_156_575 | 138 |
| 411 | 3300048923 | Ga0496120_0409370 | Ga0496120_0409370_123_539 | 138 |
| 412 | 3300048924 | Ga0496121_0000619 | Ga0496121_0000619_37068_37484 | 138 |
| 413 | 3300048924 | Ga0496121_0185966 | Ga0496121_0185966_549_983 | 138 |
| 414 | 3300048924 | Ga0496121_0298945 | Ga0496121_0298945_310_726 | 138 |
| 415 | 3300048924 | Ga0496121_0506058 | Ga0496121_0506058_61_477 | 138 |
| 416 | 3300048927 | Ga0496124_0016299 | Ga0496124_0016299_6081_6497 | 138 |
| 417 | 3300048928 | Ga0496125_0004890 | Ga0496125_0004890_9441_9857 | 138 |
| 418 | 3300048928 | Ga0496125_0022603 | Ga0496125_0022603_3713_4129 | 138 |
| 419 | 3300048928 | Ga0496125_0148458 | Ga0496125_0148458_330_770 | 138 |
| 420 | 3300048928 | Ga0496125_0194237 | Ga0496125_0194237_891_1307 | 138 |
| 421 | 3300048928 | Ga0496125_0561475 | Ga0496125_0561475_90_506 | 138 |
| 422 | 3300048929 | Ga0496126_0002850 | Ga0496126_0002850_15892_16356 | 138 |
| 423 | 3300048929 | Ga0496126_0010810 | Ga0496126_0010810_1909_2325 | 138 |
| 424 | 3300048929 | Ga0496126_0191826 | Ga0496126_0191826_454_870 | 138 |
| 425 | 3300048929 | Ga0496126_0213899 | Ga0496126_0213899_880_1308 | 138 |
| 426 | 3300048929 | Ga0496126_1328475 | Ga0496126_1328475_87_503 | 138 |
| 427 | 3300049568 | Ga0501031_0319494 | Ga0501031_0319494_493_915 | 138 |
| 428 | 3300049570 | Ga0501033_0000805 | Ga0501033_0000805_3418_3837 | 138 |
| 429 | 3300049572 | Ga0501036_0028410 | Ga0501036_0028410_2607_3029 | 138 |
| 430 | 3300049572 | Ga0501036_0108082 | Ga0501036_0108082_1117_1536 | 138 |
| 431 | 3300049572 | Ga0501036_0216209 | Ga0501036_0216209_1115_1537 | 138 |
| 432 | 3300049572 | Ga0501036_0814688 | Ga0501036_0814688_101_520 | 138 |
| 433 | 3300049573 | Ga0501037_0000582 | Ga0501037_0000582_3426_3845 | 138 |
| 434 | 3300049573 | Ga0501037_0098752 | Ga0501037_0098752_1311_1730 | 138 |
| 435 | 3300049573 | Ga0501037_0323154 | Ga0501037_0323154_404_826 | 138 |
| 436 | 3300049574 | Ga0501038_0003235 | Ga0501038_0003235_8331_8753 | 138 |
| 437 | 3300049574 | Ga0501038_0009487 | Ga0501038_0009487_4880_5302 | 138 |
| 438 | 3300049574 | Ga0501038_0099982 | Ga0501038_0099982_680_1099 | 138 |
| 439 | 3300049575 | Ga0501039_0033474 | Ga0501039_0033474_198_620 | 138 |
| 440 | 3300049575 | Ga0501039_0096621 | Ga0501039_0096621_1736_2158 | 138 |
| 441 | 3300049575 | Ga0501039_0325494 | Ga0501039_0325494_688_1107 | 138 |
| 442 | 3300049576 | Ga0501040_0004099 | Ga0501040_0004099_2714_3136 | 138 |
| 443 | 3300049576 | Ga0501040_0313074 | Ga0501040_0313074_448_870 | 138 |
| 444 | 3300049577 | Ga0501041_0000590 | Ga0501041_0000590_10829_11251 | 138 |
| 445 | 3300049577 | Ga0501041_0004782 | Ga0501041_0004782_2007_2429 | 138 |
| 446 | 3300049578 | Ga0501042_0005517 | Ga0501042_0005517_1714_2136 | 138 |
| 447 | 3300049578 | Ga0501042_0079843 | Ga0501042_0079843_1466_1888 | 138 |
| 448 | 3300049579 | Ga0501043_0002452 | Ga0501043_0002452_3428_3847 | 138 |
| 449 | 3300049579 | Ga0501043_0135359 | Ga0501043_0135359_398_820 | 138 |
| 450 | 3300049579 | Ga0501043_0282417 | Ga0501043_0282417_588_1010 | 138 |
| 451 | 3300049579 | Ga0501043_0545686 | Ga0501043_0545686_268_687 | 138 |
| 452 | 3300049580 | Ga0501046_0008944 | Ga0501046_0008944_6892_7314 | 138 |
| 453 | 3300049580 | Ga0501046_0013750 | Ga0501046_0013750_1544_1966 | 138 |
| 454 | 3300049581 | Ga0501047_0396962 | Ga0501047_0396962_677_1096 | 138 |
| 455 | 3300049581 | Ga0501047_0983265 | Ga0501047_0983265_66_494 | 138 |
| 456 | 3300049581 | Ga0501047_1298074 | Ga0501047_1298074_74_493 | 138 |
| 457 | 3300049582 | Ga0501048_0003792 | Ga0501048_0003792_7911_8333 | 138 |
| 458 | 3300049582 | Ga0501048_0054360 | Ga0501048_0054360_425_847 | 138 |
| 459 | 3300049582 | Ga0501048_0087171 | Ga0501048_0087171_817_1236 | 138 |
| 460 | 3300049584 | Ga0501068_0014074 | Ga0501068_0014074_440_862 | 138 |
| 461 | 3300049584 | Ga0501068_0152570 | Ga0501068_0152570_598_1017 | 138 |
| 462 | 3300049584 | Ga0501068_0437529 | Ga0501068_0437529_312_734 | 138 |
| 463 | 3300049584 | Ga0501068_0575896 | Ga0501068_0575896_229_648 | 138 |
| 464 | 3300049585 | Ga0501069_0000003 | Ga0501069_0000003_3446_3865 | 138 |
| 465 | 3300049586 | Ga0501070_0000647 | Ga0501070_0000647_3446_3865 | 138 |
| 466 | 3300049586 | Ga0501070_1050392 | Ga0501070_1050392_129_551 | 138 |
| 467 | 3300049587 | Ga0501071_0002353 | Ga0501071_0002353_6092_6514 | 138 |
| 468 | 3300049587 | Ga0501071_0004332 | Ga0501071_0004332_6145_6567 | 138 |
| 469 | 3300049587 | Ga0501071_0040348 | Ga0501071_0040348_1327_1746 | 138 |
| 470 | 3300049588 | Ga0501072_0076318 | Ga0501072_0076318_2006_2428 | 138 |
| 471 | 3300049588 | Ga0501072_0403614 | Ga0501072_0403614_608_1030 | 138 |
| 472 | 3300049589 | Ga0501073_0025325 | Ga0501073_0025325_3433_3852 | 138 |
| 473 | 3300049590 | Ga0501074_0000677 | Ga0501074_0000677_13004_13423 | 138 |
| 474 | 3300049590 | Ga0501074_0026694 | Ga0501074_0026694_988_1410 | 138 |
| 475 | 3300049591 | Ga0501075_0000868 | Ga0501075_0000868_5343_5765 | 138 |
| 476 | 3300049591 | Ga0501075_0029945 | Ga0501075_0029945_3189_3611 | 138 |
| 477 | 3300049591 | Ga0501075_0247000 | Ga0501075_0247000_351_773 | 138 |
| 478 | 3300049592 | Ga0501076_0001007 | Ga0501076_0001007_17719_18141 | 138 |
| 479 | 3300049592 | Ga0501076_0007528 | Ga0501076_0007528_7326_7748 | 138 |
| 480 | 3300049592 | Ga0501076_0075842 | Ga0501076_0075842_1864_2286 | 138 |
| 481 | 3300049593 | Ga0501077_0002578 | Ga0501077_0002578_3499_3921 | 138 |
| 482 | 3300049593 | Ga0501077_0059908 | Ga0501077_0059908_533_955 | 138 |
| 483 | 3300049741 | Ga0501079_0001595 | Ga0501079_0001595_4681_5103 | 138 |
| 484 | 3300049741 | Ga0501079_0213692 | Ga0501079_0213692_263_685 | 138 |
| 485 | 3300049742 | Ga0501080_0000590 | Ga0501080_0000590_24825_25244 | 138 |
| 486 | 3300049742 | Ga0501080_0007272 | Ga0501080_0007272_2519_2941 | 138 |
| 487 | 3300049742 | Ga0501080_0008284 | Ga0501080_0008284_425_847 | 138 |
| 488 | 3300049742 | Ga0501080_0172049 | Ga0501080_0172049_354_773 | 138 |
| 489 | 3300049743 | Ga0501081_0008038 | Ga0501081_0008038_4538_4960 | 138 |
| 490 | 3300049743 | Ga0501081_0014939 | Ga0501081_0014939_4264_4686 | 138 |
| 491 | 3300049744 | Ga0501083_0000036 | Ga0501083_0000036_22648_23067 | 138 |
| 492 | 3300049744 | Ga0501083_0081084 | Ga0501083_0081084_40_462 | 138 |
| 493 | 3300049822 | Ga0501035_0000358 | Ga0501035_0000358_48734_49153 | 138 |
| 494 | 3300049822 | Ga0501035_0057686 | Ga0501035_0057686_846_1268 | 138 |
| 495 | 3300049823 | Ga0501044_0000016 | Ga0501044_0000016_3438_3857 | 138 |
| 496 | 3300049823 | Ga0501044_0625815 | Ga0501044_0625815_440_859 | 138 |
| 497 | 3300049823 | Ga0501044_0985325 | Ga0501044_0985325_148_567 | 138 |
| 498 | 3300049824 | Ga0501045_0004235 | Ga0501045_0004235_9190_9612 | 138 |
| 499 | 3300049824 | Ga0501045_0006020 | Ga0501045_0006020_6731_7153 | 138 |
| 500 | 3300049824 | Ga0501045_0534335 | Ga0501045_0534335_336_758 | 138 |
| 501 | 3300050494 | nmdc:mga06z11_212815_c1 | nmdc:mga06z11_212815_c1_302_721 | 138 |
| 502 | 3300050494 | nmdc:mga06z11_532656_c1 | nmdc:mga06z11_532656_c1_98_517 | 138 |
| 503 | 3300050495 | nmdc:mga04h51_59450_c1 | nmdc:mga04h51_59450_c1_455_874 | 138 |
| 504 | 3300050508 | nmdc:mga09592_424975_c1 | nmdc:mga09592_424975_c1_221_637 | 138 |
| 505 | 3300053092 | Ga0500583_0147949 | Ga0500583_0147949_696_1112 | 138 |
| 506 | 3300053093 | Ga0500651_0758586 | Ga0500651_0758586_11_427 | 138 |
| 507 | 3300053106 | Ga0500558_143548 | Ga0500558_143548_105_521 | 138 |
| 508 | 3300053111 | Ga0500572_004400 | Ga0500572_004400_2146_2562 | 138 |
| 509 | 3300053123 | Ga0500614_035000 | Ga0500614_035000_721_1137 | 138 |
| 510 | 3300053136 | Ga0500559_0159209 | Ga0500559_0159209_30_446 | 138 |
| 511 | 3300053136 | Ga0500559_0286239 | Ga0500559_0286239_180_596 | 138 |
| 512 | 3300053136 | Ga0500559_0504094 | Ga0500559_0504094_27_443 | 138 |
| 513 | 3300053139 | Ga0500568_0000342 | Ga0500568_0000342_27986_28408 | 138 |
| 514 | 3300053153 | Ga0500616_0051636 | Ga0500616_0051636_148_567 | 138 |
| 515 | 3300053156 | Ga0500622_0087080 | Ga0500622_0087080_98_514 | 138 |
| 516 | 3300053163 | Ga0500639_056863 | Ga0500639_056863_1300_1716 | 138 |
| 517 | 3300053163 | Ga0500639_119401 | Ga0500639_119401_457_873 | 138 |
| 518 | 3300053178 | Ga0500637_0038941 | Ga0500637_0038941_165_584 | 138 |
| 519 | 3300054114 | Ga0501084_0003968 | Ga0501084_0003968_5384_5806 | 138 |
| 520 | 3300054114 | Ga0501084_0007594 | Ga0501084_0007594_7051_7473 | 138 |
| 521 | 3300054114 | Ga0501084_0401097 | Ga0501084_0401097_85_507 | 138 |
| 522 | 3300059423 | Ga0590074_033097 | Ga0590074_033097_298_714 | 138 |
| 523 | 3300059477 | Ga0587084_060776 | Ga0587084_060776_97_513 | 138 |
| 524 | 3300059490 | Ga0587066_028045 | Ga0587066_028045_313_729 | 138 |
| 525 | 3300059490 | Ga0587066_106019 | Ga0587066_106019_189_605 | 138 |
| 526 | 3300059490 | Ga0587066_189452 | Ga0587066_189452_72_488 | 138 |
| 527 | 3300059491 | Ga0587070_122989 | Ga0587070_122989_153_569 | 138 |
| 528 | 3300059492 | Ga0587073_0145987 | Ga0587073_0145987_89_505 | 138 |
| 529 | 3300059492 | Ga0587073_0214665 | Ga0587073_0214665_36_452 | 138 |
| 530 | 3300059493 | Ga0587077_093617 | Ga0587077_093617_160_576 | 138 |
| 531 | 3300059503 | Ga0587080_053967 | Ga0587080_053967_35_451 | 138 |
| 532 | 3300059504 | Ga0587082_019999 | Ga0587082_019999_93_509 | 138 |
| 533 | 3300059505 | Ga0587083_0118141 | Ga0587083_0118141_212_628 | 138 |
| 534 | 3300059507 | Ga0587086_047045 | Ga0587086_047045_225_641 | 138 |
| 535 | 3300059508 | Ga0587088_071466 | Ga0587088_071466_268_684 | 138 |
| 536 | 3300059510 | Ga0587090_002505 | Ga0587090_002505_1486_1914 | 138 |
| 537 | 3300059510 | Ga0587090_040870 | Ga0587090_040870_184_600 | 138 |
| 538 | 3300059510 | Ga0587090_054707 | Ga0587090_054707_296_712 | 138 |
| 539 | 3300059512 | Ga0587092_052743 | Ga0587092_052743_232_648 | 138 |
| 540 | 3300059640 | Ga0587067_064632 | Ga0587067_064632_267_683 | 138 |
| 541 | 3300059641 | Ga0587068_074027 | Ga0587068_074027_168_584 | 138 |
| 542 | 3300059645 | Ga0587076_064626 | Ga0587076_064626_225_641 | 138 |
| 543 | 3300059647 | Ga0587079_098194 | Ga0587079_098194_45_461 | 138 |
| 544 | 3300059652 | Ga0587107_047316 | Ga0587107_047316_140_556 | 138 |
| 545 | 3300060344 | Ga0587071_048307 | Ga0587071_048307_332_760 | 138 |
| 546 | 3300060344 | Ga0587071_078314 | Ga0587071_078314_221_637 | 138 |
| 547 | 3300060346 | Ga0587111_0092050 | Ga0587111_0092050_105_521 | 138 |
| 548 | 3300060353 | Ga0501082_0014009 | Ga0501082_0014009_29_451 | 138 |
| 549 | 3300060353 | Ga0501082_0039248 | Ga0501082_0039248_3404_3826 | 138 |
| 550 | 3300060353 | Ga0501082_0366662 | Ga0501082_0366662_654_1073 | 138 |
| 551 | 3300060353 | Ga0501082_0618569 | Ga0501082_0618569_109_528 | 138 |
| 552 | 3300061719 | Ga0466962_0008046 | Ga0466962_0008046_2059_2475 | 138 |
| 553 | 3300061734 | Ga0530510_0002196 | Ga0530510_0002196_7408_7830 | 138 |
| 554 | 3300061734 | Ga0530510_0011076 | Ga0530510_0011076_3275_3697 | 138 |
| 555 | 3300003187 | JGI25151J46595_10013989 | JGI25151J46595_100139892 | 139 |
| 556 | 3300003773 | Ga0055537_1000031 | Ga0055537_100003176 | 139 |
| 557 | 3300003784 | Ga0055534_1000091 | Ga0055534_100009154 | 139 |
| 558 | 3300003790 | Ga0055528_1000237 | Ga0055528_10002375 | 139 |
| 559 | 3300005330 | Ga0070690_100115809 | Ga0070690_1001158092 | 139 |
| 560 | 3300005333 | Ga0070677_10137679 | Ga0070677_101376792 | 139 |
| 561 | 3300005335 | Ga0070666_10423012 | Ga0070666_104230121 | 139 |
| 562 | 3300005337 | Ga0070682_100429128 | Ga0070682_1004291282 | 139 |
| 563 | 3300005338 | Ga0068868_100216387 | Ga0068868_1002163872 | 139 |
| 564 | 3300005338 | Ga0068868_100231660 | Ga0068868_1002316602 | 139 |
| 565 | 3300005347 | Ga0070668_100174748 | Ga0070668_1001747482 | 139 |
| 566 | 3300005353 | Ga0070669_100842900 | Ga0070669_1008429001 | 139 |
| 567 | 3300005355 | Ga0070671_100088684 | Ga0070671_1000886842 | 139 |
| 568 | 3300005364 | Ga0070673_100084201 | Ga0070673_1000842014 | 139 |
| 569 | 3300005364 | Ga0070673_100174299 | Ga0070673_1001742992 | 139 |
| 570 | 3300005365 | Ga0070688_100224657 | Ga0070688_1002246572 | 139 |
| 571 | 3300005366 | Ga0070659_100693978 | Ga0070659_1006939781 | 139 |
| 572 | 3300005367 | Ga0070667_101121107 | Ga0070667_1011211072 | 139 |
| 573 | 3300005445 | Ga0070708_100052798 | Ga0070708_1000527984 | 139 |
| 574 | 3300005455 | Ga0070663_100598938 | Ga0070663_1005989381 | 139 |
| 575 | 3300005456 | Ga0070678_100219571 | Ga0070678_1002195712 | 139 |
| 576 | 3300005459 | Ga0068867_100017657 | Ga0068867_1000176572 | 139 |
| 577 | 3300005459 | Ga0068867_100072358 | Ga0068867_1000723584 | 139 |
| 578 | 3300005466 | Ga0070685_10317582 | Ga0070685_103175821 | 139 |
| 579 | 3300005468 | Ga0070707_100046185 | Ga0070707_1000461852 | 139 |
| 580 | 3300005530 | Ga0070679_100258242 | Ga0070679_1002582422 | 139 |
| 581 | 3300005535 | Ga0070684_100740874 | Ga0070684_1007408741 | 139 |
| 582 | 3300005539 | Ga0068853_100015474 | Ga0068853_1000154745 | 139 |
| 583 | 3300005539 | Ga0068853_100733601 | Ga0068853_1007336012 | 139 |
| 584 | 3300005543 | Ga0070672_100190896 | Ga0070672_1001908962 | 139 |
| 585 | 3300005544 | Ga0070686_100670634 | Ga0070686_1006706342 | 139 |
| 586 | 3300005547 | Ga0070693_101446554 | Ga0070693_1014465541 | 139 |
| 587 | 3300005548 | Ga0070665_100686744 | Ga0070665_1006867442 | 139 |
| 588 | 3300005563 | Ga0068855_101111756 | Ga0068855_1011117562 | 139 |
| 589 | 3300005577 | Ga0068857_100300917 | Ga0068857_1003009171 | 139 |
| 590 | 3300005577 | Ga0068857_101119810 | Ga0068857_1011198102 | 139 |
| 591 | 3300005578 | Ga0068854_100126429 | Ga0068854_1001264292 | 139 |
| 592 | 3300005578 | Ga0068854_100704270 | Ga0068854_1007042702 | 139 |
| 593 | 3300005578 | Ga0068854_101075506 | Ga0068854_1010755062 | 139 |
| 594 | 3300005617 | Ga0068859_100420510 | Ga0068859_1004205102 | 139 |
| 595 | 3300005718 | Ga0068866_10188164 | Ga0068866_101881642 | 139 |
| 596 | 3300005718 | Ga0068866_10848300 | Ga0068866_108483002 | 139 |
| 597 | 3300005719 | Ga0068861_100473397 | Ga0068861_1004733972 | 139 |
| 598 | 3300005841 | Ga0068863_100203413 | Ga0068863_1002034132 | 139 |
| 599 | 3300005842 | Ga0068858_100248130 | Ga0068858_1002481302 | 139 |
| 600 | 3300005842 | Ga0068858_101219736 | Ga0068858_1012197362 | 139 |
| 601 | 3300005843 | Ga0068860_100030988 | Ga0068860_1000309885 | 139 |
| 602 | 3300005843 | Ga0068860_100706964 | Ga0068860_1007069642 | 139 |
| 603 | 3300005843 | Ga0068860_101391978 | Ga0068860_1013919782 | 139 |
| 604 | 3300005985 | Ga0081539_10000118 | Ga0081539_1000011876 | 139 |
| 605 | 3300006042 | Ga0075368_10200405 | Ga0075368_102004052 | 139 |
| 606 | 3300006048 | Ga0075363_100007460 | Ga0075363_1000074602 | 139 |
| 607 | 3300006058 | Ga0075432_10129798 | Ga0075432_101297982 | 139 |
| 608 | 3300006058 | Ga0075432_10162313 | Ga0075432_101623132 | 139 |
| 609 | 3300006058 | Ga0075432_10308850 | Ga0075432_103088502 | 139 |
| 610 | 3300006177 | Ga0075362_10069434 | Ga0075362_100694341 | 139 |
| 611 | 3300006177 | Ga0075362_10094322 | Ga0075362_100943221 | 139 |
| 612 | 3300006177 | Ga0075362_10377752 | Ga0075362_103777522 | 139 |
| 613 | 3300006178 | Ga0075367_10170055 | Ga0075367_101700552 | 139 |
| 614 | 3300006186 | Ga0075369_10198906 | Ga0075369_101989062 | 139 |
| 615 | 3300006195 | Ga0075366_10091873 | Ga0075366_100918732 | 139 |
| 616 | 3300006195 | Ga0075366_10117380 | Ga0075366_101173802 | 139 |
| 617 | 3300006195 | Ga0075366_10220156 | Ga0075366_102201562 | 139 |
| 618 | 3300006195 | Ga0075366_10256253 | Ga0075366_102562532 | 139 |
| 619 | 3300006353 | Ga0075370_10002134 | Ga0075370_100021344 | 139 |
| 620 | 3300006353 | Ga0075370_10080980 | Ga0075370_100809802 | 139 |
| 621 | 3300006353 | Ga0075370_10247444 | Ga0075370_102474441 | 139 |
| 622 | 3300006353 | Ga0075370_10267506 | Ga0075370_102675062 | 139 |
| 623 | 3300006358 | Ga0068871_100331372 | Ga0068871_1003313722 | 139 |
| 624 | 3300006358 | Ga0068871_100474382 | Ga0068871_1004743821 | 139 |
| 625 | 3300006881 | Ga0068865_100061356 | Ga0068865_1000613562 | 139 |
| 626 | 3300006881 | Ga0068865_100295809 | Ga0068865_1002958092 | 139 |
| 627 | 3300006914 | Ga0075436_101062670 | Ga0075436_1010626702 | 139 |
| 628 | 3300006931 | Ga0097620_100420492 | Ga0097620_1004204922 | 139 |
| 629 | 3300006948 | Ga0099826_10067367 | Ga0099826_100673672 | 139 |
| 630 | 3300009093 | Ga0105240_10239642 | Ga0105240_102396422 | 139 |
| 631 | 3300009101 | Ga0105247_10601347 | Ga0105247_106013472 | 139 |
| 632 | 3300009148 | Ga0105243_10569224 | Ga0105243_105692242 | 139 |
| 633 | 3300009148 | Ga0105243_10615050 | Ga0105243_106150502 | 139 |
| 634 | 3300009176 | Ga0105242_10220758 | Ga0105242_102207582 | 139 |
| 635 | 3300009176 | Ga0105242_10434518 | Ga0105242_104345181 | 139 |
| 636 | 3300009177 | Ga0105248_10055365 | Ga0105248_100553655 | 139 |
| 637 | 3300009545 | Ga0105237_10075708 | Ga0105237_100757082 | 139 |
| 638 | 3300009553 | Ga0105249_10093275 | Ga0105249_100932753 | 139 |
| 639 | 3300009553 | Ga0105249_10415449 | Ga0105249_104154492 | 139 |
| 640 | 3300010375 | Ga0105239_10006291 | Ga0105239_1000629110 | 139 |
| 641 | 3300010375 | Ga0105239_10953284 | Ga0105239_109532841 | 139 |
| 642 | 3300011119 | Ga0105246_10650062 | Ga0105246_106500621 | 139 |
| 643 | 3300011119 | Ga0105246_12231625 | Ga0105246_122316251 | 139 |
| 644 | 3300012480 | Ga0157346_1008417 | Ga0157346_10084171 | 139 |
| 645 | 3300013100 | Ga0157373_10036040 | Ga0157373_100360404 | 139 |
| 646 | 3300013296 | Ga0157374_10179292 | Ga0157374_101792923 | 139 |
| 647 | 3300013296 | Ga0157374_12258653 | Ga0157374_122586532 | 139 |
| 648 | 3300013306 | Ga0163162_10324760 | Ga0163162_103247602 | 139 |
| 649 | 3300013308 | Ga0157375_10109192 | Ga0157375_101091922 | 139 |
| 650 | 3300014497 | Ga0182008_10520408 | Ga0182008_105204082 | 139 |
| 651 | 3300014968 | Ga0157379_11879686 | Ga0157379_118796861 | 139 |
| 652 | 3300014969 | Ga0157376_10007118 | Ga0157376_100071185 | 139 |
| 653 | 3300014969 | Ga0157376_10381886 | Ga0157376_103818862 | 139 |
| 654 | 3300015261 | Ga0182006_1041130 | Ga0182006_10411302 | 139 |
| 655 | 3300015261 | Ga0182006_1041882 | Ga0182006_10418822 | 139 |
| 656 | 3300015262 | Ga0182007_10062239 | Ga0182007_100622392 | 139 |
| 657 | 3300025263 | Ga0209565_1000087 | Ga0209565_1000087124 | 139 |
| 658 | 3300025273 | Ga0209673_1000145 | Ga0209673_1000145124 | 139 |
| 659 | 3300025291 | Ga0209675_1000085 | Ga0209675_1000085124 | 139 |
| 660 | 3300025292 | Ga0209676_1027819 | Ga0209676_10278192 | 139 |
| 661 | 3300025294 | Ga0209025_1056253 | Ga0209025_10562532 | 139 |
| 662 | 3300025295 | Ga0209564_1048598 | Ga0209564_10485981 | 139 |
| 663 | 3300025303 | Ga0209051_1008057 | Ga0209051_10080574 | 139 |
| 664 | 3300025899 | Ga0207642_10382096 | Ga0207642_103820962 | 139 |
| 665 | 3300025899 | Ga0207642_10406550 | Ga0207642_104065501 | 139 |
| 666 | 3300025903 | Ga0207680_10464441 | Ga0207680_104644412 | 139 |
| 667 | 3300025907 | Ga0207645_10495790 | Ga0207645_104957901 | 139 |
| 668 | 3300025910 | Ga0207684_10003211 | Ga0207684_100032113 | 139 |
| 669 | 3300025913 | Ga0207695_10061520 | Ga0207695_100615206 | 139 |
| 670 | 3300025914 | Ga0207671_10420981 | Ga0207671_104209812 | 139 |
| 671 | 3300025923 | Ga0207681_10531466 | Ga0207681_105314661 | 139 |
| 672 | 3300025925 | Ga0207650_10453410 | Ga0207650_104534102 | 139 |
| 673 | 3300025935 | Ga0207709_10191223 | Ga0207709_101912232 | 139 |
| 674 | 3300025935 | Ga0207709_10377197 | Ga0207709_103771972 | 139 |
| 675 | 3300025935 | Ga0207709_10532277 | Ga0207709_105322772 | 139 |
| 676 | 3300025935 | Ga0207709_10763963 | Ga0207709_107639632 | 139 |
| 677 | 3300025936 | Ga0207670_10062949 | Ga0207670_100629493 | 139 |
| 678 | 3300025937 | Ga0207669_10300162 | Ga0207669_103001622 | 139 |
| 679 | 3300025939 | Ga0207665_10957966 | Ga0207665_109579662 | 139 |
| 680 | 3300025940 | Ga0207691_10049884 | Ga0207691_100498841 | 139 |
| 681 | 3300025941 | Ga0207711_10942310 | Ga0207711_109423102 | 139 |
| 682 | 3300025949 | Ga0207667_10849128 | Ga0207667_108491282 | 139 |
| 683 | 3300025961 | Ga0207712_10074032 | Ga0207712_100740322 | 139 |
| 684 | 3300025961 | Ga0207712_10685403 | Ga0207712_106854031 | 139 |
| 685 | 3300025981 | Ga0207640_10260182 | Ga0207640_102601822 | 139 |
| 686 | 3300025986 | Ga0207658_10315236 | Ga0207658_103152362 | 139 |
| 687 | 3300026023 | Ga0207677_10754155 | Ga0207677_107541551 | 139 |
| 688 | 3300026035 | Ga0207703_10272687 | Ga0207703_102726872 | 139 |
| 689 | 3300026041 | Ga0207639_10307309 | Ga0207639_103073092 | 139 |
| 690 | 3300026067 | Ga0207678_10084391 | Ga0207678_100843911 | 139 |
| 691 | 3300026078 | Ga0207702_11818525 | Ga0207702_118185251 | 139 |
| 692 | 3300026088 | Ga0207641_10311737 | Ga0207641_103117372 | 139 |
| 693 | 3300026089 | Ga0207648_10028691 | Ga0207648_100286912 | 139 |
| 694 | 3300026089 | Ga0207648_10053380 | Ga0207648_100533802 | 139 |
| 695 | 3300026116 | Ga0207674_10030361 | Ga0207674_100303611 | 139 |
| 696 | 3300026118 | Ga0207675_101275892 | Ga0207675_1012758921 | 139 |
| 697 | 3300026121 | Ga0207683_10155770 | Ga0207683_101557702 | 139 |
| 698 | 3300026121 | Ga0207683_10368550 | Ga0207683_103685502 | 139 |
| 699 | 3300026142 | Ga0207698_11389335 | Ga0207698_113893352 | 139 |
| 700 | 3300027666 | Ga0209282_1000304 | Ga0209282_100030417 | 139 |
| 701 | 3300027717 | Ga0209998_10141887 | Ga0209998_101418872 | 139 |
| 702 | 3300027876 | Ga0209974_10030485 | Ga0209974_100304852 | 139 |
| 703 | 3300028379 | Ga0268266_10896049 | Ga0268266_108960492 | 139 |
| 704 | 3300028381 | Ga0268264_10831818 | Ga0268264_108318182 | 139 |
| 705 | 3300028786 | Ga0307517_10296662 | Ga0307517_102966622 | 139 |
| 706 | 3300028794 | Ga0307515_10000692 | Ga0307515_1000069229 | 139 |
| 707 | 3300030732 | Ga0316176_1051753 | Ga0316176_10517532 | 139 |
| 708 | 3300030742 | Ga0316183_1029607 | Ga0316183_10296079 | 139 |
| 709 | 3300031548 | Ga0307408_100369660 | Ga0307408_1003696602 | 139 |
| 710 | 3300031616 | Ga0307508_10000909 | Ga0307508_1000090927 | 139 |
| 711 | 3300031824 | Ga0307413_10252925 | Ga0307413_102529251 | 139 |
| 712 | 3300032002 | Ga0307416_101618615 | Ga0307416_1016186152 | 139 |
| 713 | 3300032004 | Ga0307414_11696558 | Ga0307414_116965581 | 139 |
| 714 | 3300032005 | Ga0307411_10591647 | Ga0307411_105916472 | 139 |
| 715 | 3300033180 | Ga0307510_10030121 | Ga0307510_100301215 | 139 |
| 716 | 3300033180 | Ga0307510_10123884 | Ga0307510_101238843 | 139 |
| 717 | 3300033180 | Ga0307510_10378917 | Ga0307510_103789172 | 139 |
| 718 | 3300035119 | Ga0373956_0047759 | Ga0373956_0047759_755_1180 | 139 |
| 719 | 3300041404 | Ga0439436_0066993 | Ga0439436_0066993_554_973 | 139 |
| 720 | 3300041407 | Ga0439447_030412 | Ga0439447_030412_347_766 | 139 |
| 721 | 3300041411 | Ga0439466_0029987 | Ga0439466_0029987_664_1083 | 139 |
| 722 | 3300041443 | Ga0451789_0877240 | Ga0451789_0877240_146_565 | 139 |
| 723 | 3300041459 | Ga0451800_0561777 | Ga0451800_0561777_105_524 | 139 |
| 724 | 3300041463 | Ga0451804_1054772 | Ga0451804_1054772_10_432 | 139 |
| 725 | 3300041494 | Ga0451837_0412873 | Ga0451837_0412873_53_472 | 139 |
| 726 | 3300041509 | Ga0451843_0460145 | Ga0451843_0460145_52_471 | 139 |
| 727 | 3300041512 | Ga0451853_0858138 | Ga0451853_0858138_71_490 | 139 |
| 728 | 3300041512 | Ga0451853_3203100 | Ga0451853_3203100_175_594 | 139 |
| 729 | 3300041512 | Ga0451853_4094737 | Ga0451853_4094737_44_463 | 139 |
| 730 | 3300042002 | Ga0439442_017587 | Ga0439442_017587_1042_1461 | 139 |
| 731 | 3300042002 | Ga0439442_024107 | Ga0439442_024107_763_1182 | 139 |
| 732 | 3300042002 | Ga0439442_030527 | Ga0439442_030527_506_925 | 139 |
| 733 | 3300042004 | Ga0439445_0018338 | Ga0439445_0018338_762_1181 | 139 |
| 734 | 3300042004 | Ga0439445_0047600 | Ga0439445_0047600_193_612 | 139 |
| 735 | 3300042006 | Ga0439432_026342 | Ga0439432_026342_454_873 | 139 |
| 736 | 3300042007 | Ga0439449_0001524 | Ga0439449_0001524_2333_2752 | 139 |
| 737 | 3300042010 | Ga0439452_051499 | Ga0439452_051499_300_719 | 139 |
| 738 | 3300042115 | Ga0450911_021682 | Ga0450911_021682_295_714 | 139 |
| 739 | 3300042122 | Ga0450920_038479 | Ga0450920_038479_84_503 | 139 |
| 740 | 3300042125 | Ga0450923_011382 | Ga0450923_011382_205_624 | 139 |
| 741 | 3300042130 | Ga0450892_037154 | Ga0450892_037154_97_516 | 139 |
| 742 | 3300042145 | Ga0450906_004944 | Ga0450906_004944_964_1383 | 139 |
| 743 | 3300042146 | Ga0450907_007698 | Ga0450907_007698_499_918 | 139 |
| 744 | 3300042147 | Ga0450910_004617 | Ga0450910_004617_866_1285 | 139 |
| 745 | 3300042184 | Ga0450908_005650 | Ga0450908_005650_499_918 | 139 |
| 746 | 3300042435 | Ga0439434_0095217 | Ga0439434_0095217_255_674 | 139 |
| 747 | 3300042531 | Ga0450918_001232 | Ga0450918_001232_3517_3936 | 139 |
| 748 | 3300042532 | Ga0450893_0013544 | Ga0450893_0013544_618_1037 | 139 |
| 749 | 3300045051 | Ga0451576_2343414 | Ga0451576_2343414_75_497 | 139 |
| 750 | 3300046459 | Ga0495629_0604946 | Ga0495629_0604946_23_445 | 139 |
| 751 | 3300046460 | Ga0495638_0060229 | Ga0495638_0060229_355_777 | 139 |
| 752 | 3300046471 | Ga0495650_0004986 | Ga0495650_0004986_5689_6108 | 139 |
| 753 | 3300046472 | Ga0495580_0400565 | Ga0495580_0400565_350_769 | 139 |
| 754 | 3300046474 | Ga0495605_0005411 | Ga0495605_0005411_260_682 | 139 |
| 755 | 3300046474 | Ga0495605_0056737 | Ga0495605_0056737_1397_1816 | 139 |
| 756 | 3300046491 | Ga0495584_0189131 | Ga0495584_0189131_101_532 | 139 |
| 757 | 3300046492 | Ga0495585_0001873 | Ga0495585_0001873_8956_9390 | 139 |
| 758 | 3300046500 | Ga0495596_0028000 | Ga0495596_0028000_1689_2111 | 139 |
| 759 | 3300046500 | Ga0495596_0060673 | Ga0495596_0060673_868_1290 | 139 |
| 760 | 3300046506 | Ga0495583_0316976 | Ga0495583_0316976_141_560 | 139 |
| 761 | 3300046507 | Ga0495606_0271622 | Ga0495606_0271622_445_867 | 139 |
| 762 | 3300046512 | Ga0495610_0113972 | Ga0495610_0113972_429_851 | 139 |
| 763 | 3300046512 | Ga0495610_0120520 | Ga0495610_0120520_618_1037 | 139 |
| 764 | 3300046515 | Ga0495620_0199217 | Ga0495620_0199217_292_726 | 139 |
| 765 | 3300046518 | Ga0495631_0002780 | Ga0495631_0002780_6610_7044 | 139 |
| 766 | 3300046518 | Ga0495631_0033298 | Ga0495631_0033298_796_1215 | 139 |
| 767 | 3300046518 | Ga0495631_0270415 | Ga0495631_0270415_43_465 | 139 |
| 768 | 3300046519 | Ga0495632_0023143 | Ga0495632_0023143_1202_1621 | 139 |
| 769 | 3300046520 | Ga0495637_0037864 | Ga0495637_0037864_1496_1915 | 139 |
| 770 | 3300046520 | Ga0495637_0107835 | Ga0495637_0107835_424_855 | 139 |
| 771 | 3300046524 | Ga0495648_0395461 | Ga0495648_0395461_26_445 | 139 |
| 772 | 3300046528 | Ga0495642_0021934 | Ga0495642_0021934_426_878 | 139 |
| 773 | 3300046528 | Ga0495642_0225353 | Ga0495642_0225353_237_656 | 139 |
| 774 | 3300046530 | Ga0495654_0001432 | Ga0495654_0001432_14590_15042 | 139 |
| 775 | 3300046530 | Ga0495654_0100168 | Ga0495654_0100168_56_475 | 139 |
| 776 | 3300046531 | Ga0495665_0112033 | Ga0495665_0112033_965_1387 | 139 |
| 777 | 3300046535 | Ga0495586_0022810 | Ga0495586_0022810_439_861 | 139 |
| 778 | 3300046537 | Ga0495598_0125615 | Ga0495598_0125615_323_742 | 139 |
| 779 | 3300046538 | Ga0495609_0015522 | Ga0495609_0015522_596_1048 | 139 |
| 780 | 3300046542 | Ga0495597_0000247 | Ga0495597_0000247_27849_28295 | 139 |
| 781 | 3300046542 | Ga0495597_0006202 | Ga0495597_0006202_5435_5857 | 139 |
| 782 | 3300046542 | Ga0495597_0006566 | Ga0495597_0006566_68_487 | 139 |
| 783 | 3300046542 | Ga0495597_0026037 | Ga0495597_0026037_435_866 | 139 |
| 784 | 3300046542 | Ga0495597_0105138 | Ga0495597_0105138_449_871 | 139 |
| 785 | 3300046558 | Ga0495633_0006692 | Ga0495633_0006692_2663_3097 | 139 |
| 786 | 3300046616 | Ga0495668_0013620 | Ga0495668_0013620_2604_3038 | 139 |
| 787 | 3300046616 | Ga0495668_0016359 | Ga0495668_0016359_1279_1731 | 139 |
| 788 | 3300046616 | Ga0495668_0153935 | Ga0495668_0153935_196_615 | 139 |
| 789 | 3300046616 | Ga0495668_0343665 | Ga0495668_0343665_184_630 | 139 |
| 790 | 3300046648 | Ga0495611_0014166 | Ga0495611_0014166_1966_2400 | 139 |
| 791 | 3300046660 | Ga0495625_0000012 | Ga0495625_0000012_331175_331594 | 139 |
| 792 | 3300046660 | Ga0495625_0064368 | Ga0495625_0064368_182_601 | 139 |
| 793 | 3300046660 | Ga0495625_0235619 | Ga0495625_0235619_402_833 | 139 |
| 794 | 3300046663 | Ga0495635_0015395 | Ga0495635_0015395_2123_2545 | 139 |
| 795 | 3300046665 | Ga0495661_0000917 | Ga0495661_0000917_8089_8523 | 139 |
| 796 | 3300046665 | Ga0495661_0272388 | Ga0495661_0272388_96_527 | 139 |
| 797 | 3300046681 | Ga0495647_0155160 | Ga0495647_0155160_28_450 | 139 |
| 798 | 3300046689 | Ga0495613_0056607 | Ga0495613_0056607_1068_1490 | 139 |
| 799 | 3300046689 | Ga0495613_0534501 | Ga0495613_0534501_309_731 | 139 |
| 800 | 3300046691 | Ga0495670_0000164 | Ga0495670_0000164_10074_10508 | 139 |
| 801 | 3300046692 | Ga0495671_0195832 | Ga0495671_0195832_121_540 | 139 |
| 802 | 3300046694 | Ga0495649_0011013 | Ga0495649_0011013_948_1367 | 139 |
| 803 | 3300046694 | Ga0495649_0098412 | Ga0495649_0098412_580_1002 | 139 |
| 804 | 3300046694 | Ga0495649_0247977 | Ga0495649_0247977_384_806 | 139 |
| 805 | 3300046794 | Ga0495589_0000994 | Ga0495589_0000994_3395_3841 | 139 |
| 806 | 3300046794 | Ga0495589_0008215 | Ga0495589_0008215_4206_4658 | 139 |
| 807 | 3300046810 | Ga0495660_0024909 | Ga0495660_0024909_28_447 | 139 |
| 808 | 3300046810 | Ga0495660_0177636 | Ga0495660_0177636_375_797 | 139 |
| 809 | 3300046810 | Ga0495660_0201694 | Ga0495660_0201694_41_460 | 139 |
| 810 | 3300047317 | Ga0495604_0016868 | Ga0495604_0016868_2738_3160 | 139 |
| 811 | 3300047318 | Ga0495636_0018153 | Ga0495636_0018153_1922_2341 | 139 |
| 812 | 3300047318 | Ga0495636_0259750 | Ga0495636_0259750_143_562 | 139 |
| 813 | 3300047319 | Ga0495674_0047598 | Ga0495674_0047598_2713_3132 | 139 |
| 814 | 3300047320 | Ga0495672_0000093 | Ga0495672_0000093_108197_108616 | 139 |
| 815 | 3300047320 | Ga0495672_0002148 | Ga0495672_0002148_7407_7859 | 139 |
| 816 | 3300047320 | Ga0495672_0270936 | Ga0495672_0270936_12_458 | 139 |
| 817 | 3300047322 | Ga0495680_0003473 | Ga0495680_0003473_330_752 | 139 |
| 818 | 3300047323 | Ga0495683_0004538 | Ga0495683_0004538_3992_4411 | 139 |
| 819 | 3300047323 | Ga0495683_0008031 | Ga0495683_0008031_2140_2559 | 139 |
| 820 | 3300047323 | Ga0495683_0062904 | Ga0495683_0062904_881_1315 | 139 |
| 821 | 3300047443 | Ga0495687_011099 | Ga0495687_011099_506_925 | 139 |
| 822 | 3300047444 | Ga0495675_0491627 | Ga0495675_0491627_12_434 | 139 |
| 823 | 3300047445 | Ga0495677_0007568 | Ga0495677_0007568_2767_3201 | 139 |
| 824 | 3300047446 | Ga0495679_081727 | Ga0495679_081727_437_859 | 139 |
| 825 | 3300047470 | Ga0495681_0000363 | Ga0495681_0000363_32012_32446 | 139 |
| 826 | 3300047472 | Ga0495686_0000148 | Ga0495686_0000148_88443_88865 | 139 |
| 827 | 3300047472 | Ga0495686_0273076 | Ga0495686_0273076_457_876 | 139 |
| 828 | 3300047673 | Ga0495593_0064424 | Ga0495593_0064424_233_655 | 139 |
| 829 | 3300048089 | Ga0495614_0013968 | Ga0495614_0013968_370_792 | 139 |
| 830 | 3300048091 | Ga0495626_0001431 | Ga0495626_0001431_11769_12200 | 139 |
| 831 | 3300048091 | Ga0495626_0079080 | Ga0495626_0079080_749_1180 | 139 |
| 832 | 3300048091 | Ga0495626_0085083 | Ga0495626_0085083_357_776 | 139 |
| 833 | 3300048091 | Ga0495626_0133624 | Ga0495626_0133624_483_905 | 139 |
| 834 | 3300048903 | Ga0496100_0303717 | Ga0496100_0303717_465_884 | 139 |
| 835 | 3300048904 | Ga0496101_0078367 | Ga0496101_0078367_1701_2120 | 139 |
| 836 | 3300048904 | Ga0496101_0375965 | Ga0496101_0375965_421_840 | 139 |
| 837 | 3300048905 | Ga0496102_0081592 | Ga0496102_0081592_2405_2824 | 139 |
| 838 | 3300048905 | Ga0496102_1040571 | Ga0496102_1040571_210_635 | 139 |
| 839 | 3300048906 | Ga0496103_0572378 | Ga0496103_0572378_287_706 | 139 |
| 840 | 3300048907 | Ga0496104_0064221 | Ga0496104_0064221_819_1238 | 139 |
| 841 | 3300048908 | Ga0496105_0105397 | Ga0496105_0105397_537_956 | 139 |
| 842 | 3300048910 | Ga0496107_0317377 | Ga0496107_0317377_326_745 | 139 |
| 843 | 3300048915 | Ga0496112_0222165 | Ga0496112_0222165_1043_1462 | 139 |
| 844 | 3300048919 | Ga0496116_0000634 | Ga0496116_0000634_9225_9644 | 139 |
| 845 | 3300048924 | Ga0496121_0006925 | Ga0496121_0006925_4711_5130 | 139 |
| 846 | 3300048924 | Ga0496121_0598494 | Ga0496121_0598494_251_670 | 139 |
| 847 | 3300049460 | Ga0495682_0003801 | Ga0495682_0003801_2016_2438 | 139 |
| 848 | 3300049679 | Ga0501249_001312 | Ga0501249_001312_2154_2573 | 139 |
| 849 | 3300049705 | Ga0501225_0001764 | Ga0501225_0001764_496_915 | 139 |
| 850 | 3300049759 | Ga0501262_000301 | Ga0501262_000301_2433_2852 | 139 |
| 851 | 3300050489 | nmdc:mga03683_31787_c1 | nmdc:mga03683_31787_c1_944_1363 | 139 |
| 852 | 3300050489 | nmdc:mga03683_403646_c1 | nmdc:mga03683_403646_c1_94_513 | 139 |
| 853 | 3300050489 | nmdc:mga03683_42155_c1 | nmdc:mga03683_42155_c1_54_473 | 139 |
| 854 | 3300050489 | nmdc:mga03683_48688_c1 | nmdc:mga03683_48688_c1_778_1197 | 139 |
| 855 | 3300050490 | nmdc:mga03n38_119231_c1 | nmdc:mga03n38_119231_c1_806_1225 | 139 |
| 856 | 3300050490 | nmdc:mga03n38_25127_c1 | nmdc:mga03n38_25127_c1_1357_1776 | 139 |
| 857 | 3300050490 | nmdc:mga03n38_40863_c1 | nmdc:mga03n38_40863_c1_1419_1838 | 139 |
| 858 | 3300050491 | nmdc:mga00v17_276016_c1 | nmdc:mga00v17_276016_c1_454_873 | 139 |
| 859 | 3300050491 | nmdc:mga00v17_801971_c1 | nmdc:mga00v17_801971_c1_53_472 | 139 |
| 860 | 3300050491 | nmdc:mga00v17_85704_c1 | nmdc:mga00v17_85704_c1_691_1110 | 139 |
| 861 | 3300050492 | nmdc:mga0yw44_33585_c1 | nmdc:mga0yw44_33585_c1_2317_2736 | 139 |
| 862 | 3300050493 | nmdc:mga0k408_156427_c1 | nmdc:mga0k408_156427_c1_485_904 | 139 |
| 863 | 3300050493 | nmdc:mga0k408_21239_c1 | nmdc:mga0k408_21239_c1_2299_2718 | 139 |
| 864 | 3300050493 | nmdc:mga0k408_22223_c1 | nmdc:mga0k408_22223_c1_2688_3107 | 139 |
| 865 | 3300050493 | nmdc:mga0k408_231214_c1 | nmdc:mga0k408_231214_c1_369_788 | 139 |
| 866 | 3300050493 | nmdc:mga0k408_482024_c1 | nmdc:mga0k408_482024_c1_19_438 | 139 |
| 867 | 3300050493 | nmdc:mga0k408_565517_c1 | nmdc:mga0k408_565517_c1_88_507 | 139 |
| 868 | 3300050494 | nmdc:mga06z11_644078_c1 | nmdc:mga06z11_644078_c1_34_453 | 139 |
| 869 | 3300050494 | nmdc:mga06z11_690634_c1 | nmdc:mga06z11_690634_c1_165_584 | 139 |
| 870 | 3300050496 | nmdc:mga07m45_2210_c1 | nmdc:mga07m45_2210_c1_3907_4326 | 139 |
| 871 | 3300050496 | nmdc:mga07m45_262033_c1 | nmdc:mga07m45_262033_c1_278_697 | 139 |
| 872 | 3300050496 | nmdc:mga07m45_7307_c1 | nmdc:mga07m45_7307_c1_4763_5182 | 139 |
| 873 | 3300050516 | nmdc:mga0sz30_179089_c1 | nmdc:mga0sz30_179089_c1_378_797 | 139 |
| 874 | 3300053093 | Ga0500651_0446278 | Ga0500651_0446278_166_585 | 139 |
| 875 | 3300053121 | Ga0500607_061847 | Ga0500607_061847_958_1377 | 139 |
| 876 | 3300053134 | Ga0500658_0498490 | Ga0500658_0498490_30_449 | 139 |
| 877 | 3300053154 | Ga0500619_152871 | Ga0500619_152871_262_681 | 139 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7qsw-assembly1.cif.gz_B-2 | l8s8-complex forming rubisco derived from ancestral sequence reconstruction of the last common ancestor of ssu-bearing form i rubiscos | 0.9445 | 8 | 104 |
| 6hbc-assembly1.cif.gz_D | structure of the repeat unit in the network formed by ccmm and rubisco from synechococcus elongatus | 0.9418 | 8 | 103 |
| 1bwv-assembly1.cif.gz_S | activated ribulose 1,5-bisphosphate carboxylase/oxygenase (rubisco) complexed with the reaction intermediate analogue 2-carboxyarabinitol 1,5-bisphosphate | 0.9398 | 1 | 139 |
| 1iwa-assembly1.cif.gz_N | rubisco from galdieria partita | 0.9396 | 1 | 139 |
| 4f0h-assembly1.cif.gz_B | unactivated rubisco with oxygen bound | 0.9381 | 1 | 139 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5mz2I00 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribulose bisphosphate carboxylase, small subunit | 0.9362 | 1 | 139 | 3.30.190.10 |
| 3zxwD00 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribulose bisphosphate carboxylase, small subunit | 0.9332 | 9 | 103 | 3.30.190.10 |
| 2ybvN00 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribulose bisphosphate carboxylase, small subunit | 0.9331 | 8 | 103 | 3.30.190.10 |
| 3zxwD00 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribulose bisphosphate carboxylase, small subunit | 0.9238 | 9 | 103 | 3.30.190.10 |
| 1svdM00 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribulose bisphosphate carboxylase, small subunit | 0.8939 | 1 | 103 | 3.30.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529SI85-F1-model_v4 | Ribulose bisphosphate carboxylase small subunit | 0.969 | 14 | 127 |
GO:0019253
|
| AF-A0A521ZE51-F1-model_v4 | Ribulose bisphosphate carboxylase small subunit | 0.9687 | 21 | 135 |
GO:0019253
|
| AF-A0A6J4JW78-F1-model_v4 | Ribulose bisphosphate carboxylase small subunit (RuBisCO small subunit) | 0.9661 | 22 | 139 |
GO:0016984
GO:0019253 |
| AF-A0A7T5JEG5-F1-model_v4 | Ribulose bisphosphate carboxylase small subunit (RuBisCO small subunit) | 0.9595 | 10 | 104 |
GO:0009853
GO:0016984 GO:0019253 GO:0031470 |
| AF-U6C2G7-F1-model_v4 | Ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit | 0.9595 | 66 | 129 |
GO:0009507
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar