F484401

General Info

Members Datasets Scaffolds Average Seq Length
877 733 1754 218

Family's Representative Sequence

Representative Sequence 3300042007|Ga0439449_0002061|Ga0439449_0002061_4091_4870
Length 259
Sequence MLWHSVSDAVPQAPARRLLAQNGENLRRADRTVDRRENSMSYAAYVFDAYGTLFDVHAAVRRHADAIGPDGQAFSELWRAKQLEYSWVRSLMGAYVDFWELTEQSLDYAFQRFPSADPGLKKPLLDAYWALDCYPEVPAVLKGLKERGARIAILSNGSPAMLASAVKNAALDIVIDDVFSVDAVKAFKTAPAVYDLVTTSYRLYPQAVSFQSSNRWDIAGATKFGFRTVWINRADGPDEYKDHGPSLILPSLESLQFGV

Samples

Sample ID Description Type Environment
1 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
50 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
51 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
52 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
53 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
54 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
55 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
56 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
86 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
105 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
106 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
110 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
117 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
118 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
119 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
120 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
121 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
122 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
123 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
124 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
125 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
126 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
127 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
131 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
132 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
148 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
149 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
152 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
176 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
177 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
178 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
183 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
188 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
189 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
190 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
191 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
192 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
193 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
194 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
195 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
196 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
197 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
198 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
199 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
200 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
201 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
202 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
203 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
204 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
205 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
208 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
209 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
210 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
211 2509276019 Ensifer aridi TW10 Isolate Nodule
212 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
213 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
214 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
215 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
216 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
217 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
218 2512875024
219 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
220 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
221 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
222 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
223 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
224 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
225 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
226 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
227 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
228 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
229 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
230 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
231 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
232 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
233 2516143018 Ensifer sp. BR816 Isolate Nodule
234 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
235 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
236 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
237 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
238 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
239 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
240 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
241 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
242 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
243 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
244 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
245 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
246 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
247 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
248 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
249 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
250 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
251 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
252 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
253 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
254 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
255 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
256 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
257 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
258 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
259 2643221557 Ensifer sp. Root558 Isolate Unclassified
260 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
261 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
262 2643221607 Rhizobium sp. Root73 Isolate Unclassified
263 2643221610 Ensifer sp. Root74 Isolate Unclassified
264 2643221618 Ensifer sp. Root231 Isolate Unclassified
265 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
266 2643221626 Ensifer sp. Root31 Isolate Unclassified
267 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
268 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
269 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
270 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
271 2643221655 Ensifer sp. Root1252 Isolate Unclassified
272 2643221659 Ensifer sp. Root127 Isolate Unclassified
273 2643221668 Ensifer sp. Root423 Isolate Unclassified
274 2643221675 Ensifer sp. Root1298 Isolate Unclassified
275 2643221680 Ensifer sp. Root1312 Isolate Unclassified
276 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
277 2643221688 Rhizobium sp. Root482 Isolate Unclassified
278 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
279 2643221698 Ensifer sp. Root142 Isolate Unclassified
280 2643221712 Ensifer sp. Root258 Isolate Unclassified
281 2643221718 Rhizobium sp. Root268 Isolate Unclassified
282 2643221719 Rhizobium sp. Root274 Isolate Unclassified
283 2643221723 Ensifer sp. Root278 Isolate Unclassified
284 2643221726 Ensifer sp. Root954 Isolate Unclassified
285 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
286 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
287 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
288 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
289 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
290 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
291 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
292 2738543024 Aminobacter sp. AP02 Isolate Unclassified
293 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
294 2751185800 Brucella pituitosa AA2 Isolate Unclassified
295 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
296 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
297 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
298 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
299 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
300 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
301 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
302 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
303 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
304 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
305 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
306 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
307 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
308 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
309 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
310 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
311 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
312 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
313 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
314 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
315 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
316 2844163670 Ensifer sp. 1H6 Isolate Unclassified
317 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
318 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
319 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
320 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
321 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
322 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
323 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
324 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
325 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
326 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
327 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
328 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
329 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
330 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
331 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
332 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
333 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
334 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
335 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
336 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
337 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
338 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
339 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
340 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
341 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
342 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
343 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
344 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
345 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
346 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
347 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
348 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
349 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
350 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
351 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
352 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
353 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
354 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
355 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
356 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
357 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
358 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
359 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
360 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
361 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
362 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
363 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
364 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
365 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
366 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
367 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
368 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
369 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
370 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
371 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
372 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
373 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
374 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
375 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
376 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
377 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
378 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
379 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
380 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
381 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
382 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
383 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
384 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
385 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
386 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
387 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
388 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
389 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
390 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
391 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
392 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
393 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
394 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
395 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
396 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
397 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
398 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
399 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
400 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
401 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
402 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
403 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
404 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
405 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
406 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
407 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
408 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
409 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
410 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
411 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
412 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
413 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
414 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
415 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
416 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
417 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
418 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
419 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
420 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
421 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
422 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
423 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
424 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
425 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
426 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
427 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
428 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
429 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
430 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
431 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
432 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
433 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
434 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
435 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
436 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
437 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
438 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
439 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
440 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
441 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
442 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
443 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
444 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
445 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
446 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
447 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
448 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
449 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
450 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
451 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
452 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
453 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
454 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
455 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
456 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
457 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
458 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
459 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
460 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
461 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
462 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
463 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
464 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
465 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
466 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
467 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
468 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
469 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
470 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
471 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
472 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
473 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
474 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
475 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
476 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
477 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
478 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
479 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
480 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
481 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
482 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
483 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
484 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
485 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
486 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
487 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
488 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
489 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
490 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
491 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
492 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
493 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
494 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
495 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
496 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
497 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
498 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
499 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
500 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
501 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
502 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
503 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
504 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
505 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
506 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
507 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
508 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
509 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
510 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
511 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
512 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
513 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
514 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
515 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
516 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
517 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
518 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
519 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
520 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
521 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
522 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
523 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
524 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
525 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
526 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
527 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
528 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
529 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
530 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
531 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
532 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
533 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
534 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
535 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
536 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
537 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
538 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
539 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
540 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
541 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
542 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
543 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
544 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
545 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
546 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
547 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
548 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
549 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
550 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
551 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
552 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
553 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
554 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
555 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
556 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
557 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
558 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
559 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
560 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
561 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
562 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
563 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
564 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
565 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
566 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
567 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
568 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
569 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
570 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
571 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
572 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
573 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
574 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
575 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
576 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
577 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
578 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
579 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
580 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
581 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
582 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
583 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
584 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
585 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
586 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
587 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
588 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
589 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
590 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
591 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
592 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
593 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
594 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
595 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
596 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
597 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
598 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
599 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
600 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
601 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
602 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
603 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
604 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
605 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
606 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
607 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
608 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
609 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
610 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
611 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
612 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
613 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
614 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
615 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
616 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
617 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
618 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
619 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
620 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
621 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
622 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
623 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
624 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
625 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
626 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
627 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
628 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
629 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
630 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
631 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
632 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
633 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
634 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
635 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
636 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
637 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
638 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
639 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
640 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
641 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
642 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
643 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
644 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
645 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
646 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
647 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
648 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
649 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
650 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
651 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
652 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
653 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
654 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
655 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
656 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
657 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
658 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
659 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
660 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
661 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
662 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
663 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
664 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
665 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
666 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
667 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
668 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
669 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
670 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
671 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
672 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
673 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
674 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
675 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
676 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
677 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
678 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
679 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
680 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
681 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
682 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
683 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
684 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
685 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
686 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
687 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
688 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
689 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
690 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
691 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
692 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
693 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
694 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
695 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
696 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
697 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
698 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
699 3004167301 Mesorhizobium loti 582 Isolate Unclassified
700 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
701 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
702 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
703 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
704 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
705 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
706 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
707 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
708 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
709 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
710 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
711 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
712 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
713 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
714 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
715 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
716 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
717 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
718 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
719 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
720 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
721 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
722 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
723 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
724 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
725 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
726 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
727 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
728 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
729 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
730 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
731 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
732 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
733 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 39.79
Metatranscriptomes 0
Isolates 60.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.41
Nodule 51.2
Rhizoplane 1.25
Rhizosphere 28.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439449_0002061 3300042007 Bacteria 7913
2 JGI24740J21852_10009030 3300001979 Bacteria 3926
3 JGI25158J39367_1001337 3300002739 Bacteria 4356
4 JGI25159J45721_1000001 3300002987 Bacteria 303489
5 JGI25151J46595_10008750 3300003187 Bacteria 4839
6 JGI25151J46595_10025779 3300003187 Bacteria 2385
7 JGI25165J46597_1000016 3300003214 Bacteria 377866
8 rootH2_10339468 3300003320 Bacteria 1109
9 JGI25160J50197_1000002 3300003354 Bacteria 561707
10 Ga0055542_1004234 3300003762 Bacteria 3557
11 Ga0055529_1006934 3300003763 Bacteria 1557
12 Ga0055526_1001867 3300003771 Bacteria 14584
13 Ga0055524_1000777 3300003775 Bacteria 21429
14 Ga0055524_1024254 3300003775 Bacteria 1929
15 Ga0055530_10040496 3300003791 Bacteria 1143
16 Ga0055531_10031987 3300003794 Bacteria 1729
17 Ga0055543_1000057 3300004625 Bacteria 102841
18 Ga0065165_1000004 3300005262 Bacteria 377081
19 Ga0070658_10391926 3300005327 Bacteria 1192
20 Ga0070666_10095281 3300005335 Bacteria 2048
21 Ga0070668_100298989 3300005347 Bacteria 1349
22 Ga0070674_100184160 3300005356 Bacteria 1602
23 Ga0070667_100430374 3300005367 Bacteria 1204
24 Ga0070663_100110541 3300005455 Bacteria 2064
25 Ga0070663_100645646 3300005455 Bacteria 894
26 Ga0070678_100832481 3300005456 Bacteria 840
27 Ga0068853_100043464 3300005539 Bacteria 3844
28 Ga0070665_100034072 3300005548 Bacteria 5121
29 Ga0070665_100471005 3300005548 Bacteria 1266
30 Ga0068855_100162571 3300005563 Bacteria 2533
31 Ga0070664_100750651 3300005564 Bacteria 911
32 Ga0068857_100104451 3300005577 Bacteria 2543
33 Ga0081455_10018339 3300005937 Bacteria 6670
34 Ga0081540_1023624 3300005983 Bacteria 3590
35 Ga0075365_10004422 3300006038 Bacteria 7442
36 Ga0075365_10012641 3300006038 Bacteria 5022
37 Ga0075363_100012543 3300006048 Bacteria 4091
38 Ga0075363_100213756 3300006048 Bacteria 1104
39 Ga0075362_10027138 3300006177 Bacteria 2450
40 Ga0075362_10028394 3300006177 Bacteria 2403
41 Ga0075367_10019586 3300006178 Bacteria 3754
42 Ga0075369_10119954 3300006186 Bacteria 1190
43 Ga0075370_10026164 3300006353 Bacteria 3231
44 Ga0075370_10077522 3300006353 Bacteria 1907
45 Ga0079104_1007485 3300006946 Bacteria 3950
46 Ga0079104_1014594 3300006946 Bacteria 2364
47 Ga0105240_10026413 3300009093 Bacteria 7617
48 Ga0105240_10281473 3300009093 Bacteria 1910
49 Ga0105237_10031482 3300009545 Bacteria 5378
50 Ga0105237_10077156 3300009545 Bacteria 3322
51 Ga0105237_10163975 3300009545 Bacteria 2221
52 Ga0105237_10294357 3300009545 Bacteria 1626
53 Ga0105238_10011809 3300009551 Bacteria 8800
54 Ga0105239_10044001 3300010375 Bacteria 4895
55 Ga0105239_10076181 3300010375 Bacteria 3689
56 Ga0105239_10150471 3300010375 Bacteria 2598
57 Ga0105239_10466871 3300010375 Bacteria 1433
58 Ga0157370_10607504 3300013104 Bacteria 1001
59 Ga0157369_10276630 3300013105 Bacteria 1749
60 Ga0171463_1001 3300013249 Bacteria 1406070
61 Ga0157374_10564917 3300013296 Bacteria 1146
62 Ga0157378_10680137 3300013297 Bacteria 1047
63 Ga0157372_10668351 3300013307 Bacteria 1209
64 Ga0182008_10128964 3300014497 Bacteria 1260
65 Ga0183363_1045 3300015690 Bacteria 40670
66 Ga0214544_1000008 3300021320 Bacteria 326027
67 Ga0214542_1000010 3300021321 Bacteria 262816
68 Ga0214542_1015383 3300021321 Bacteria 8011
69 Ga0214543_1000003 3300021327 Bacteria 692327
70 Ga0214543_1000004 3300021327 Bacteria 527190
71 Ga0228711_1000001 3300022739 Bacteria 357377
72 Ga0228710_1000001 3300022740 Bacteria 314328
73 Ga0209436_100122 3300025208 Bacteria 38333
74 Ga0209563_105116 3300025230 Bacteria 2416
75 Ga0209646_1011896 3300025246 Bacteria 1341
76 Ga0209026_1000005 3300025250 Bacteria 731387
77 Ga0209148_1000056 3300025254 Bacteria 363380
78 Ga0209759_1000631 3300025256 Bacteria 33354
79 Ga0209233_1000068 3300025261 Bacteria 377969
80 Ga0209455_1000238 3300025272 Bacteria 68798
81 Ga0209130_1000008 3300025284 Bacteria 581232
82 Ga0209676_1002258 3300025292 Bacteria 14147
83 Ga0209025_1000100 3300025294 Bacteria 229182
84 Ga0209025_1000165 3300025294 Bacteria 164692
85 Ga0209564_1000104 3300025295 Bacteria 219017
86 Ga0209758_1005808 3300025297 Bacteria 9249
87 Ga0209050_1015813 3300025298 Bacteria 3138
88 Ga0209256_1000652 3300025299 Bacteria 47238
89 Ga0209256_1002322 3300025299 Bacteria 15924
90 Ga0207426_1000016 3300025302 Bacteria 581232
91 Ga0207680_10098509 3300025903 Bacteria 1874
92 Ga0207647_10053502 3300025904 Bacteria 2487
93 Ga0207645_10077952 3300025907 Bacteria 2123
94 Ga0207695_10333569 3300025913 Bacteria 1405
95 Ga0207695_10824141 3300025913 Bacteria 808
96 Ga0207671_10012030 3300025914 Bacteria 6990
97 Ga0207671_10058466 3300025914 Bacteria 2858
98 Ga0207671_10178806 3300025914 Bacteria 1650
99 Ga0207657_10050734 3300025919 Bacteria 3609
100 Ga0207694_10051200 3300025924 Bacteria 3200
101 Ga0207694_10445342 3300025924 Bacteria 1081
102 Ga0207706_10174245 3300025933 Bacteria 1890
103 Ga0207669_10149290 3300025937 Bacteria 1635
104 Ga0207691_10293169 3300025940 Bacteria 1399
105 Ga0207668_10388562 3300025972 Bacteria 1177
106 Ga0207639_10069737 3300026041 Bacteria 2743
107 Ga0207678_10149256 3300026067 Bacteria 1996
108 Ga0207674_10098525 3300026116 Bacteria 2907
109 Ga0209281_1000164 3300027111 Bacteria 157372
110 Ga0209281_1000626 3300027111 Bacteria 39130
111 Ga0209282_1000007 3300027666 Bacteria 254917
112 Ga0268266_10293056 3300028379 Bacteria 1516
113 Ga0307515_10000420 3300028794 Bacteria 102216
114 Ga0307515_10039061 3300028794 Bacteria 7565
115 Ga0265330_10123466 3300031235 Bacteria 1103
116 Ga0265325_10039985 3300031241 Bacteria 2465
117 Ga0265325_10041422 3300031241 Bacteria 2413
118 Ga0265340_10001536 3300031247 Bacteria 13246
119 Ga0265340_10012513 3300031247 Bacteria 4478
120 Ga0265340_10071750 3300031247 Bacteria 1641
121 Ga0265339_10004396 3300031249 Bacteria 9613
122 Ga0265339_10089722 3300031249 Bacteria 1613
123 Ga0265339_10130413 3300031249 Bacteria 1286
124 Ga0265316_10028899 3300031344 Bacteria 4566
125 Ga0307513_10004196 3300031456 Bacteria 19276
126 Ga0307408_100024952 3300031548 Bacteria 4089
127 Ga0265313_10001426 3300031595 Bacteria 22387
128 Ga0265313_10012669 3300031595 Bacteria 5125
129 Ga0265314_10032908 3300031711 Bacteria 3808
130 Ga0265342_10003927 3300031712 Bacteria 11938
131 Ga0265342_10018567 3300031712 Bacteria 4501
132 Ga0307406_10085121 3300031901 Bacteria 2113
133 Ga0307412_10144470 3300031911 Bacteria 1747
134 Ga0315914_1000006 3300031967 Bacteria 239817
135 Ga0307409_100337798 3300031995 Bacteria 1416
136 Ga0307416_100107466 3300032002 Bacteria 2449
137 Ga0307416_101015167 3300032002 Bacteria 933
138 Ga0315913_1000002 3300033430 Bacteria 241452
139 Ga0315915_1000001 3300033464 Bacteria 481518
140 Ga0316574_0520552 3300035398 Bacteria 740
141 Ga0373931_0166482 3300035691 Bacteria 1296
142 Ga0373935_0285059 3300035692 Bacteria 1164
143 Ga0316582_0070662 3300036647 Bacteria 2259
144 Ga0316584_0079499 3300036712 Bacteria 2457
145 Ga0395900_0084548 3300037418 Bacteria 3261
146 Ga0395900_0338598 3300037418 Bacteria 1480
147 Ga0395898_0063483 3300037466 Bacteria 3584
148 Ga0395898_0339865 3300037466 Bacteria 1432
149 Ga0395905_0101818 3300037471 Bacteria 2696
150 Ga0436364_1041655 3300037853 Bacteria 11173
151 Ga0395901_0037442 3300038443 Bacteria 5017
152 Ga0395901_0041612 3300038443 Bacteria 4763
153 Ga0439461_0068124 3300041410 Bacteria 820
154 Ga0439466_0092196 3300041411 Bacteria 949
155 Ga0439465_0044479 3300041413 Bacteria 1443
156 Ga0439442_066542 3300042002 Bacteria 766
157 Ga0439432_081424 3300042006 Bacteria 980
158 Ga0439462_0031769 3300042015 Bacteria 1399
159 Ga0450906_026455 3300042145 Bacteria 1030
160 Ga0450910_005161 3300042147 Bacteria 1778
161 Ga0439458_0093151 3300042157 Bacteria 777
162 Ga0450918_007376 3300042531 Bacteria 1946
163 Ga0466972_0092202 3300044658 Bacteria 1436
164 Ga0466972_0230596 3300044658 Bacteria 866
165 Ga0466965_0237206 3300044683 Bacteria 976
166 Ga0466960_0081836 3300044901 Bacteria 1629
167 Ga0495638_0098581 3300046460 Bacteria 1751
168 Ga0495585_0252728 3300046492 Bacteria 879
169 Ga0495606_0053804 3300046507 Bacteria 2610
170 Ga0495632_0048643 3300046519 Bacteria 2099
171 Ga0495643_0070648 3300046522 Bacteria 1833
172 Ga0495668_0044581 3300046616 Bacteria 2465
173 Ga0495625_0021781 3300046660 Bacteria 4925
174 Ga0495588_0099043 3300046674 Bacteria 1531
175 Ga0495687_020699 3300047443 Bacteria 3202
176 Ga0495602_0249634 3300048088 Bacteria 1323
177 Ga0495602_0443161 3300048088 Bacteria 918
178 Ga0495626_0056117 3300048091 Bacteria 1804
179 Ga0496102_0831960 3300048905 Bacteria 845
180 Ga0496104_0396809 3300048907 Bacteria 1292
181 Ga0496105_0063843 3300048908 Bacteria 3039
182 Ga0496110_0196310 3300048913 Bacteria 1833
183 Ga0496110_0407293 3300048913 Bacteria 1240
184 Ga0496112_0015726 3300048915 Bacteria 7068
185 Ga0496112_0260718 3300048915 Bacteria 1683
186 Ga0496113_0221816 3300048916 Bacteria 1507
187 Ga0496114_0200085 3300048917 Bacteria 1750
188 Ga0496117_0002204 3300048920 Bacteria 25295
189 Ga0496118_0046814 3300048921 Bacteria 3360
190 Ga0496120_0052491 3300048923 Bacteria 2322
191 Ga0496121_0153319 3300048924 Bacteria 1693
192 Ga0496122_0004346 3300048925 Bacteria 17714
193 Ga0496122_0076809 3300048925 Bacteria 2348
194 Ga0496123_0000103 3300048926 Bacteria 168232
195 Ga0496123_0026920 3300048926 Bacteria 4295
196 Ga0496124_0005072 3300048927 Bacteria 15019
197 Ga0496124_0122222 3300048927 Bacteria 2079
198 Ga0496125_0000879 3300048928 Bacteria 47630
199 Ga0496125_0039027 3300048928 Bacteria 4098
200 Ga0496126_0001336 3300048929 Bacteria 39105
201 Ga0496126_0012132 3300048929 Bacteria 8846
202 Ga0496126_0092384 3300048929 Bacteria 2659
203 Ga0501290_000163 3300049513 Bacteria 10717
204 Ga0501031_0005610 3300049568 Bacteria 8176
205 Ga0501031_0035334 3300049568 Bacteria 3260
206 Ga0501031_0177612 3300049568 Bacteria 1391
207 Ga0501032_0000082 3300049569 Bacteria 82284
208 Ga0501032_0006363 3300049569 Bacteria 8705
209 Ga0501032_0077742 3300049569 Bacteria 2209
210 Ga0501032_0163195 3300049569 Bacteria 1462
211 Ga0501032_0242560 3300049569 Bacteria 1171
212 Ga0501032_0323449 3300049569 Bacteria 995
213 Ga0501032_0477858 3300049569 Bacteria 797
214 Ga0501033_0000070 3300049570 Bacteria 97795
215 Ga0501033_0000500 3300049570 Bacteria 36912
216 Ga0501033_0000503 3300049570 Bacteria 36753
217 Ga0501033_0007653 3300049570 Bacteria 8392
218 Ga0501033_0016653 3300049570 Bacteria 5560
219 Ga0501033_0111103 3300049570 Bacteria 1994
220 Ga0501033_0332300 3300049570 Bacteria 1066
221 Ga0501034_0000087 3300049571 Bacteria 166714
222 Ga0501034_0277704 3300049571 Bacteria 1615
223 Ga0501034_0500559 3300049571 Bacteria 1129
224 Ga0501034_0614244 3300049571 Bacteria 991
225 Ga0501034_0620168 3300049571 Bacteria 985
226 Ga0501036_0000073 3300049572 Bacteria 61346
227 Ga0501036_0100265 3300049572 Bacteria 2449
228 Ga0501036_0119383 3300049572 Bacteria 2227
229 Ga0501036_0167658 3300049572 Bacteria 1850
230 Ga0501036_0297094 3300049572 Bacteria 1351
231 Ga0501036_0698783 3300049572 Bacteria 838
232 Ga0501037_0000014 3300049573 Bacteria 171015
233 Ga0501037_0004549 3300049573 Bacteria 10085
234 Ga0501037_0117480 3300049573 Bacteria 1914
235 Ga0501037_0322388 3300049573 Bacteria 1069
236 Ga0501037_0328514 3300049573 Bacteria 1058
237 Ga0501037_0407722 3300049573 Bacteria 931
238 Ga0501037_0409883 3300049573 Bacteria 929
239 Ga0501038_0000023 3300049574 Bacteria 151469
240 Ga0501038_0024807 3300049574 Bacteria 5345
241 Ga0501038_0168640 3300049574 Bacteria 1774
242 Ga0501039_0000044 3300049575 Bacteria 108828
243 Ga0501039_0317168 3300049575 Bacteria 1225
244 Ga0501039_0468183 3300049575 Bacteria 989
245 Ga0501043_0000022 3300049579 Bacteria 154467
246 Ga0501043_0000088 3300049579 Bacteria 82282
247 Ga0501043_0017381 3300049579 Bacteria 5640
248 Ga0501043_0291265 3300049579 Bacteria 1249
249 Ga0501043_0453175 3300049579 Bacteria 963
250 Ga0501046_0012919 3300049580 Bacteria 7099
251 Ga0501046_0014815 3300049580 Bacteria 6563
252 Ga0501046_0088424 3300049580 Bacteria 2386
253 Ga0501047_0006539 3300049581 Bacteria 10972
254 Ga0501047_0014062 3300049581 Bacteria 7606
255 Ga0501047_0065071 3300049581 Bacteria 3515
256 Ga0501047_0087503 3300049581 Bacteria 2993
257 Ga0501047_0102861 3300049581 Bacteria 2736
258 Ga0501047_0163561 3300049581 Bacteria 2096
259 Ga0501047_0181467 3300049581 Bacteria 1971
260 Ga0501047_0242905 3300049581 Bacteria 1651
261 Ga0501047_0400807 3300049581 Bacteria 1205
262 Ga0501047_0451074 3300049581 Bacteria 1115
263 Ga0501047_0546877 3300049581 Bacteria 982
264 Ga0501067_0022364 3300049583 Bacteria 3499
265 Ga0501068_0031056 3300049584 Bacteria 3172
266 Ga0501068_0222000 3300049584 Bacteria 1201
267 Ga0501069_0000284 3300049585 Bacteria 23001
268 Ga0501069_0017700 3300049585 Bacteria 3840
269 Ga0501070_0000103 3300049586 Bacteria 74597
270 Ga0501070_0007102 3300049586 Bacteria 9521
271 Ga0501070_0014430 3300049586 Bacteria 6648
272 Ga0501070_0134743 3300049586 Bacteria 2039
273 Ga0501070_0152142 3300049586 Bacteria 1909
274 Ga0501070_0246332 3300049586 Bacteria 1462
275 Ga0501070_0367885 3300049586 Bacteria 1166
276 Ga0501071_0050853 3300049587 Bacteria 2985
277 Ga0501073_0016951 3300049589 Bacteria 5276
278 Ga0501073_0062094 3300049589 Bacteria 2606
279 Ga0501073_0081812 3300049589 Bacteria 2246
280 Ga0501073_0254797 3300049589 Bacteria 1211
281 Ga0501073_0392706 3300049589 Bacteria 958
282 Ga0501074_0001426 3300049590 Bacteria 15945
283 Ga0501074_0013544 3300049590 Bacteria 5928
284 Ga0501074_0098204 3300049590 Bacteria 2096
285 Ga0501074_0651818 3300049590 Bacteria 744
286 Ga0501202_018881 3300049652 Bacteria 1358
287 Ga0501222_001521 3300049662 Bacteria 3241
288 Ga0501223_001150 3300049663 Bacteria 6232
289 Ga0501224_006556 3300049664 Bacteria 1688
290 Ga0501079_0467541 3300049741 Bacteria 991
291 Ga0501080_0035831 3300049742 Bacteria 4631
292 Ga0501080_0046275 3300049742 Bacteria 4051
293 Ga0501080_0098650 3300049742 Bacteria 2711
294 Ga0501080_0147726 3300049742 Bacteria 2173
295 Ga0501080_0255827 3300049742 Bacteria 1596
296 Ga0501080_0365547 3300049742 Bacteria 1301
297 Ga0501083_0000374 3300049744 Bacteria 28288
298 Ga0501280_000010 3300049776 Bacteria 63153
299 Ga0501282_001568 3300049778 Bacteria 2526
300 Ga0501035_0000047 3300049822 Bacteria 146497
301 Ga0501035_0002644 3300049822 Bacteria 17442
302 Ga0501035_0002789 3300049822 Bacteria 16895
303 Ga0501035_0003617 3300049822 Bacteria 14753
304 Ga0501035_0016993 3300049822 Bacteria 6705
305 Ga0501035_0020300 3300049822 Bacteria 6099
306 Ga0501035_0044652 3300049822 Bacteria 3990
307 Ga0501035_0128449 3300049822 Bacteria 2211
308 Ga0501035_0132124 3300049822 Bacteria 2175
309 Ga0501035_0132746 3300049822 Bacteria 2169
310 Ga0501044_0003500 3300049823 Bacteria 17677
311 Ga0501044_0007915 3300049823 Bacteria 11686
312 Ga0501044_0013751 3300049823 Bacteria 8747
313 Ga0501044_0048111 3300049823 Bacteria 4407
314 Ga0501044_0114660 3300049823 Bacteria 2700
315 Ga0501044_0164871 3300049823 Bacteria 2190
316 Ga0501044_0165646 3300049823 Bacteria 2184
317 Ga0501044_0197805 3300049823 Bacteria 1969
318 Ga0501044_0277499 3300049823 Bacteria 1610
319 Ga0501044_0329332 3300049823 Bacteria 1450
320 Ga0501044_0379739 3300049823 Bacteria 1328
321 Ga0501044_0521416 3300049823 Bacteria 1088
322 Ga0501045_0300157 3300049824 Bacteria 1195
323 nmdc:mga03683_77172_c1 3300050489 Bacteria 1433
324 nmdc:mga03n38_183648_c1 3300050490 Bacteria 1073
325 nmdc:mga03n38_2998_c1 3300050490 Bacteria 5340
326 nmdc:mga0yw44_1413_c1 3300050492 Bacteria 9522
327 nmdc:mga0yw44_483546_c1 3300050492 Bacteria 840
328 nmdc:mga0yw44_7220_c1 3300050492 Bacteria 5445
329 nmdc:mga06z11_18329_c1 3300050494 Bacteria 3196
330 nmdc:mga06z11_218415_c1 3300050494 Bacteria 1113
331 nmdc:mga06z11_30040_c1 3300050494 Bacteria 2625
332 nmdc:mga06z11_7530_c1 3300050494 Bacteria 4487
333 nmdc:mga04h51_105845_c1 3300050495 Bacteria 1031
334 nmdc:mga0sz30_1456_c1 3300050516 Bacteria 1103
335 Ga0500610_0037028 3300053079 Bacteria 2510
336 Ga0495655_0029661 3300053083 Bacteria 1317
337 Ga0500578_0096475 3300053086 Bacteria 1874
338 Ga0500643_000356 3300053087 Bacteria 36357
339 Ga0500595_049433 3300053119 Bacteria 1310
340 Ga0500658_0150608 3300053134 Bacteria 1048
341 Ga0500568_0000209 3300053139 Bacteria 51143
342 Ga0500604_0015119 3300053151 Bacteria 2109
343 Ga0500604_0117993 3300053151 Bacteria 885
344 Ga0500620_007680 3300053155 Bacteria 2680
345 Ga0500624_036798 3300053157 Bacteria 865
346 Ga0500627_0072549 3300053158 Bacteria 1526
347 Ga0500611_028533 3300053727 Bacteria 1134
348 Ga0500609_012103 3300053731 Bacteria 1167
349 Ga0501082_0064688 3300060353 Bacteria 3150
350 2503203477 2503198000 Bacteria 6884444
351 2509107395 2508501122 Bacteria 6292184
352 2509115895 2508501123 Bacteria 6283661
353 2509373682 2509276018 Bacteria 6910194
354 2509374615 2509276019 Bacteria 6802256
355 2509397894 2509276022 Bacteria 6200534
356 2510304532 2510065057 Bacteria 6649661
357 2510316468 2510065059 Bacteria 6847884
358 2511500849 2511231052 Bacteria 6974333
359 2512532271 2512047086 Bacteria 6850303
360 2512929640 2512875016 Bacteria 6529530
361 2512964421 2512875024 Bacteria 7195110
362 2512972398 2512875026 Bacteria 6861065
363 2513585833 2513237086 Bacteria 7265287
364 2513603477 2513237089 Bacteria 6553624
365 2513608295 2513237090 Bacteria 7096802
366 2513619762 2513237091 Bacteria 6900273
367 2513882825 2513237140 Bacteria 7076289
368 2513906548 2513237143 Bacteria 6664116
369 2513985429 2513237156 Bacteria 6402557
370 2513999329 2513237159 Bacteria 6810126
371 2514004932 2513237160 Bacteria 6650282
372 2514036973 2513237164 Bacteria 7563725
373 2514416728 2513237305 Bacteria 7293571
374 2514591637 2513237351 Bacteria 6968952
375 2515607977 2515154107 Bacteria 6795637
376 2516208731 2516143018 Bacteria 6951533
377 2516892122 2516653046 Bacteria 6989037
378 2517568937 2517487022 Bacteria 7227575
379 2523466202 2523231067 Bacteria 5230452
380 2524450171 2524023207 Bacteria 6813453
381 2551681065 2551306084 Bacteria 8942552
382 2551684813 2551306085 Bacteria 7347181
383 2551695399 2551306086 Bacteria 6843938
384 2551702340 2551306087 Bacteria 7351905
385 2551714704 2551306089 Bacteria 7162724
386 2551721668 2551306090 Bacteria 7953713
387 2551724935 2551306091 Bacteria 7086830
388 2551724966 2551306091 Bacteria 7086830
389 2551733299 2551306092 Bacteria 6992595
390 2551746567 2551306093 Bacteria 7064773
391 2558863643 2558860100 Bacteria 8458965
392 2585165338 2582581283 Bacteria 6030556
393 2585266433 2582581306 Bacteria 6450535
394 2585387411 2582581865 Bacteria 6644329
395 2585394073 2582581866 Bacteria 6859583
396 2588515219 2588253730 Bacteria 6881675
397 2597815180 2597489875 Bacteria 7010078
398 2599939945 2599185301 Bacteria 6161860
399 2600191758 2599185352 Bacteria 7228948
400 2643774108 2643221550 Bacteria 4619371
401 2643774790 2643221551 Bacteria 3750538
402 2643793234 2643221555 Bacteria 3749717
403 2643807384 2643221557 Bacteria 7184309
404 2643838626 2643221564 Bacteria 4193379
405 2643989020 2643221595 Bacteria 6565519
406 2644046791 2643221607 Bacteria 6314006
407 2644069796 2643221610 Bacteria 7480339
408 2644109176 2643221618 Bacteria 7717186
409 2644132742 2643221623 Bacteria 5239945
410 2644151698 2643221626 Bacteria 8069654
411 2644152205 2643221627 Bacteria 6761570
412 2644202498 2643221636 Bacteria 6583769
413 2644206397 2643221637 Bacteria 5345260
414 2644297109 2643221653 Bacteria 4569637
415 2644311832 2643221655 Bacteria 7722067
416 2644330104 2643221659 Bacteria 7890716
417 2644380767 2643221668 Bacteria 7306521
418 2644414672 2643221675 Bacteria 7473456
419 2644448329 2643221680 Bacteria 7473610
420 2644479580 2643221686 Bacteria 6310811
421 2644493573 2643221688 Bacteria 5260751
422 2644500767 2643221689 Bacteria 6042950
423 2644543142 2643221698 Bacteria 7756764
424 2644617630 2643221712 Bacteria 7729434
425 2644650044 2643221718 Bacteria 5345506
426 2644655362 2643221719 Bacteria 4568197
427 2644673726 2643221723 Bacteria 7095460
428 2644689364 2643221726 Bacteria 7455827
429 2657682163 2657244999 Bacteria 5946535
430 2688600308 2687453392 Bacteria 6880454
431 2692316976 2690316117 Bacteria 6800650
432 2694631744 2693429783 Bacteria 7019804
433 2694639796 2693429784 Bacteria 7241525
434 2723577583 2721755686 Bacteria 7343952
435 2738945935 2738541317 Bacteria 5340176
436 2739306639 2738543024 Bacteria 5603683
437 2739347075 2738543031 Bacteria 5769731
438 2753358885 2751185800 Bacteria 5467370
439 2753462969 2751185821 Bacteria 6189929
440 2756673129 2756170246 Bacteria 7451806
441 2776912365 2775507049 Bacteria 6284736
442 2792584011 2791355082 Bacteria 5973319
443 2792622187 2791355091 Bacteria 6135441
444 2792628248 2791355092 Bacteria 6248105
445 2792638494 2791355094 Bacteria 7011481
446 2792750872 2791355123 Bacteria 8049106
447 2793283020 2791355253 Bacteria 5171699
448 2802717580 2802428858 Bacteria 6636079
449 2802723493 2802428859 Bacteria 6667919
450 2802731057 2802428860 Bacteria 6525526
451 2802736063 2802428861 Bacteria 6534206
452 2802743726 2802428862 Bacteria 6633353
453 2802750562 2802428863 Bacteria 6410669
454 2804751181 2802429268 Bacteria 6094027
455 2837652518 2837651117 Bacteria 3772164
456 2838076284 2838074704 Bacteria 6785777
457 2842525121 2842521101 Bacteria 6569494
458 2844005580 2844002411 Bacteria 7168230
459 2844015619 2844009547 Bacteria 6728125
460 2844163813 2844163670 Bacteria 7266046
461 2847417955 2847417321 Bacteria 6913799
462 2847671987 2847670302 Bacteria 6165597
463 2847688218 2847686936 Bacteria 6278406
464 2848992931 2848992105 Bacteria 6810864
465 2850080317 2850079185 Bacteria 6848280
466 2855832040 2855825444 Bacteria 6785811
467 2855840326 2855839649 Bacteria 7135830
468 2855878994 2855872281 Bacteria 6964271
469 2856318281 2856314179 Bacteria 6477897
470 2856324238 2856320880 Bacteria 7263508
471 2856328603 2856328259 Bacteria 6528202
472 2856338481 2856334872 Bacteria 7037011
473 2856345604 2856342000 Bacteria 7176905
474 2856353688 2856349417 Bacteria 6230045
475 2856364816 2856364286 Bacteria 6939991
476 2857354915 2857349434 Bacteria 7926032
477 2857369616 2857367948 Bacteria 6965560
478 2858800857 2858800743 Bacteria 6603254
479 2869165491 2869162929 Bacteria 6399702
480 2869173889 2869169390 Bacteria 6659796
481 2869241264 2869234852 Bacteria 6654993
482 2869242478 2869242130 Bacteria 6609239
483 2869256872 2869249662 Bacteria 6868783
484 2869261680 2869256925 Bacteria 6981691
485 2869264622 2869264136 Bacteria 6880765
486 2869277320 2869271264 Bacteria 6908218
487 2869281764 2869278585 Bacteria 7077053
488 2869289735 2869285874 Bacteria 6901219
489 2871431801 2871429161 Bacteria 6547891
490 2871443119 2871435913 Bacteria 6880295
491 2871445320 2871444079 Bacteria 6423508
492 2871455126 2871451962 Bacteria 7336357
493 2871465758 2871459585 Bacteria 6866887
494 2871468503 2871466892 Bacteria 6923287
495 2871488464 2871481445 Bacteria 6700002
496 2871497517 2871495908 Bacteria 6935695
497 2874108840 2874102143 Bacteria 6342645
498 2874113636 2874109183 Bacteria 6517025
499 2874122629 2874116593 Bacteria 6674494
500 2874127730 2874123672 Bacteria 7238285
501 2874132306 2874131515 Bacteria 6820270
502 2874140568 2874139085 Bacteria 7021506
503 2874155479 2874146452 Bacteria 7533118
504 2874162336 2874155637 Bacteria 6724144
505 2874166570 2874162495 Bacteria 6174670
506 2874175273 2874168670 Bacteria 8062617
507 2876366798 2876363079 Bacteria 6544991
508 2876376846 2876369609 Bacteria 6807521
509 2876378548 2876377896 Bacteria 6565995
510 2876390757 2876386047 Bacteria 6698674
511 2876398754 2876392853 Bacteria 6660880
512 2876400595 2876399893 Bacteria 6927900
513 2876408796 2876406927 Bacteria 6191900
514 2876420824 2876413966 Bacteria 6831344
515 2876426966 2876420981 Bacteria 6687741
516 2878037619 2878035449 Bacteria 6555736
517 2878742352 2878738818 Bacteria 7136951
518 2878748407 2878745973 Bacteria 6867388
519 2878761735 2878760144 Bacteria 6823465
520 2878768703 2878767105 Bacteria 6898628
521 2878778689 2878774303 Bacteria 6108671
522 2878788006 2878781027 Bacteria 6834456
523 2881153845 2881147464 Bacteria 7779814
524 2881157627 2881155292 Bacteria 6461656
525 2881162989 2881161766 Bacteria 7127907
526 2881853953 2881853255 Bacteria 6698367
527 2882635350 2882632389 Bacteria 8154593
528 2885311780 2885305155 Bacteria 7348390
529 2885322892 2885318864 Bacteria 6729568
530 2885340445 2885334103 Bacteria 7216818
531 2885350004 2885342637 Bacteria 7011821
532 2885350819 2885350715 Bacteria 6787678
533 2888341482 2888337043 Bacteria 6629336
534 2888348629 2888343758 Bacteria 6611049
535 2888350818 2888350351 Bacteria 7372807
536 2889013160 2889010040 Bacteria 6749192
537 2889021980 2889016732 Bacteria 6700763
538 2891376483 2891373044 Bacteria 5202277
539 2894776651 2894772417 Bacteria 5305674
540 2896386486 2896384573 Bacteria 7700774
541 2899806335 2899803654 Bacteria 5577784
542 2903452973 2903448605 Bacteria 7357801
543 2903506084 2903492973 Bacteria 13473544
544 2903514942 2903513507 Bacteria 6344008
545 2903524665 2903521522 Bacteria 6525694
546 2903531092 2903528002 Bacteria 6586099
547 2903542312 2903540706 Bacteria 7062119
548 2904665286 2904659560 Bacteria 6685615
549 2906312024 2906308376 Bacteria 6841989
550 2906323762 2906321335 Bacteria 6579571
551 2906331383 2906328253 Bacteria 6585166
552 2906360348 2906354277 Bacteria 6991324
553 2906364863 2906363423 Bacteria 6856682
554 2906377928 2906370794 Bacteria 6881062
555 2906383573 2906378014 Bacteria 6911440
556 2906388958 2906386501 Bacteria 5977019
557 2906395447 2906393657 Bacteria 6790866
558 2906402444 2906401398 Bacteria 6693206
559 2906408404 2906408224 Bacteria 6162342
560 2906418318 2906414383 Bacteria 6580790
561 2906435025 2906427513 Bacteria 6375796
562 2913297591 2913295892 Bacteria 6333755
563 2913310379 2913308742 Bacteria 5350706
564 2915984148 2915980308 Bacteria 6624279
565 2915990236 2915986958 Bacteria 6739310
566 2915997945 2915993759 Bacteria 7016183
567 2916002336 2916000859 Bacteria 6865702
568 2916008582 2916007675 Bacteria 6898660
569 2916020393 2916014648 Bacteria 6946486
570 2916023556 2916021584 Bacteria 6854472
571 2916034549 2916028427 Bacteria 6748433
572 2916035295 2916035215 Bacteria 6755766
573 2916043336 2916041962 Bacteria 6820487
574 2916051055 2916048683 Bacteria 6543552
575 2916057652 2916055098 Bacteria 6758838
576 2916067959 2916061851 Bacteria 6737736
577 2916073406 2916068649 Bacteria 6943657
578 2916080160 2916076590 Bacteria 6596108
579 2920763030 2920760137 Bacteria 7427611
580 2920823673 2920822456 Bacteria 6897201
581 2921207632 2921201388 Bacteria 6926299
582 2921212509 2921208531 Bacteria 6745326
583 2921243873 2921237296 Bacteria 6876710
584 2921245909 2921244191 Bacteria 6568419
585 2921250843 2921250672 Bacteria 6677771
586 2921261070 2921257292 Bacteria 6808382
587 2921269299 2921263974 Bacteria 6864552
588 2921283859 2921282425 Bacteria 6826397
589 2921294810 2921289301 Bacteria 7316391
590 2921301325 2921296804 Bacteria 7176999
591 2922137594 2922130491 Bacteria 7173936
592 2922153274 2922151315 Bacteria 6902399
593 2922159744 2922158528 Bacteria 6573167
594 2922178173 2922172374 Bacteria 6167644
595 2922182441 2922178524 Bacteria 6025201
596 2922193826 2922185730 Bacteria 7113964
597 2924146979 2924144063 Bacteria 6883928
598 2924155945 2924150972 Bacteria 7169444
599 2924160451 2924158325 Bacteria 7188855
600 2924169824 2924165586 Bacteria 7260590
601 2924178605 2924172951 Bacteria 6749356
602 2924180331 2924179722 Bacteria 6843264
603 2924191395 2924186466 Bacteria 6876637
604 2924196011 2924193448 Bacteria 6955718
605 2924204446 2924200457 Bacteria 6757188
606 2924207481 2924207177 Bacteria 6917007
607 2924217016 2924214083 Bacteria 7080103
608 2924228847 2924221636 Bacteria 7113495
609 2924231396 2924228884 Bacteria 6633132
610 2924718829 2924718760 Bacteria 6331356
611 2924728136 2924726620 Bacteria 6271473
612 2924740377 2924733363 Bacteria 7574837
613 2924742750 2924741084 Bacteria 6661321
614 2924752574 2924748358 Bacteria 6154725
615 2924761515 2924754689 Bacteria 6774424
616 2924764449 2924762789 Bacteria 6561353
617 2924780152 2924776078 Bacteria 7492003
618 2936999197 2936996657 Bacteria 6298727
619 2937003334 2937002841 Bacteria 6934057
620 2937010638 2937009748 Bacteria 6746052
621 2937016795 2937016420 Bacteria 6782579
622 2937028046 2937023124 Bacteria 6815156
623 2937029979 2937029754 Bacteria 6424026
624 2937038027 2937036028 Bacteria 6846469
625 2937044649 2937042894 Bacteria 6741576
626 2937052699 2937049772 Bacteria 6757901
627 2937061655 2937056579 Bacteria 7107896
628 2937066534 2937063883 Bacteria 7199456
629 2937072374 2937071275 Bacteria 6984483
630 2937083122 2937078374 Bacteria 6610289
631 2937089123 2937084907 Bacteria 6618516
632 2937097903 2937091812 Bacteria 6979387
633 2937103749 2937098957 Bacteria 7249374
634 2937107360 2937106411 Bacteria 6947143
635 2937119800 2937113482 Bacteria 6505872
636 2937120900 2937119839 Bacteria 6597547
637 2937130207 2937126314 Bacteria 6771275
638 2937818153 2937813078 Bacteria 7783518
639 2937829086 2937822353 Bacteria 7290551
640 2937842738 2937836603 Bacteria 6811263
641 2937846622 2937843397 Bacteria 5256375
642 2937850683 2937848649 Bacteria 6983481
643 2937868726 2937861824 Bacteria 6660327
644 2937873784 2937868953 Bacteria 6639878
645 2937882672 2937877337 Bacteria 7246526
646 2937892084 2937891427 Bacteria 6357007
647 2937973355 2937972304 Bacteria 7532020
648 2937988116 2937980651 Bacteria 6517427
649 2937996167 2937994558 Bacteria 7036190
650 2938015045 2938014810 Bacteria 6700592
651 2941500402 2941499720 Bacteria 7599444
652 2957380138 2957375807 Bacteria 6425588
653 2957385191 2957382221 Bacteria 6737050
654 2957389253 2957388812 Bacteria 6778072
655 2957397057 2957395598 Bacteria 6822399
656 2957402728 2957402308 Bacteria 6741770
657 2957415159 2957408893 Bacteria 6558585
658 2957417215 2957415311 Bacteria 6991633
659 2957423549 2957422303 Bacteria 7172205
660 2957436451 2957430029 Bacteria 7022557
661 2957439865 2957437181 Bacteria 6568994
662 2957449962 2957443900 Bacteria 6869977
663 2957453364 2957450854 Bacteria 6765715
664 2957457882 2957457609 Bacteria 6967680
665 2957466393 2957464669 Bacteria 6568877
666 2957475054 2957471148 Bacteria 6797643
667 2957483785 2957478035 Bacteria 6756658
668 2957490521 2957484790 Bacteria 6703082
669 2957495873 2957491536 Bacteria 6695180
670 2957499273 2957498199 Bacteria 7126688
671 2957507934 2957505466 Bacteria 7253085
672 2958037725 2958034702 Bacteria 6989922
673 2958047437 2958041894 Bacteria 13082850
674 2958066105 2958064165 Bacteria 7158582
675 2958074952 2958071322 Bacteria 6815895
676 2958089797 2958084443 Bacteria 7312792
677 2958097711 2958092219 Bacteria 6861151
678 2958107868 2958100919 Bacteria 6800575
679 2958113009 2958108152 Bacteria 6681128
680 2958116820 2958115193 Bacteria 6923548
681 2958130021 2958122699 Bacteria 7280457
682 2958134108 2958130278 Bacteria 6897202
683 2958142803 2958137437 Bacteria 6050276
684 2958146776 2958144490 Bacteria 6677056
685 2958163468 2958158011 Bacteria 6058449
686 2958166637 2958165035 Bacteria 6906348
687 2958178260 2958172287 Bacteria 6716688
688 2958183754 2958179912 Bacteria 6874908
689 2960587957 2960584000 Bacteria 6864594
690 2960595459 2960591022 Bacteria 6622873
691 2960600697 2960597568 Bacteria 6550735
692 2960604671 2960603979 Bacteria 6898737
693 2960613853 2960610863 Bacteria 6691244
694 2960617584 2960617483 Bacteria 6727748
695 2960626668 2960624210 Bacteria 6875384
696 2960633341 2960631154 Bacteria 6732508
697 2960642094 2960637947 Bacteria 7296468
698 2960649797 2960645483 Bacteria 7211087
699 2960656850 2960652885 Bacteria 7083688
700 2960662261 2960660292 Bacteria 7041660
701 2960668487 2960667422 Bacteria 6763020
702 2960677573 2960674078 Bacteria 6609048
703 2960685728 2960680706 Bacteria 6624464
704 2960690422 2960687367 Bacteria 6535474
705 2960696259 2960693952 Bacteria 6749742
706 2961081720 2961077736 Bacteria 7079850
707 2961120286 2961114664 Bacteria 6680456
708 2961132205 2961127735 Bacteria 7196641
709 2961138637 2961136820 Bacteria 6775228
710 2961165103 2961163497 Bacteria 6901077
711 2961184175 2961183825 Bacteria 6688536
712 2963649592 2963644680 Bacteria 6530403
713 2964612041 2964607997 Bacteria 7101408
714 2964617562 2964615318 Bacteria 6809089
715 2964622872 2964621998 Bacteria 6834995
716 2964633662 2964628898 Bacteria 7083044
717 2964642060 2964636051 Bacteria 7091832
718 2964644401 2964643177 Bacteria 6820887
719 2964652982 2964649959 Bacteria 6675118
720 2964658192 2964656573 Bacteria 7100150
721 2964666095 2964663802 Bacteria 7019362
722 2964671134 2964670856 Bacteria 6851364
723 2964684723 2964678106 Bacteria 6792020
724 2964686166 2964685014 Bacteria 6839111
725 2964693592 2964691889 Bacteria 6802758
726 2964701935 2964698721 Bacteria 6765331
727 2964712205 2964705432 Bacteria 7114648
728 2964713579 2964712639 Bacteria 6695970
729 2964726587 2964719344 Bacteria 7286602
730 2965019927 2965018300 Bacteria 6883036
731 2965026224 2965025482 Bacteria 6532201
732 2965034295 2965032056 Bacteria 6887443
733 2965046955 2965040258 Bacteria 6855979
734 2965047959 2965047637 Bacteria 6623551
735 2965064678 2965062239 Bacteria 7412989
736 2965094493 2965089291 Bacteria 6866420
737 2965106383 2965102966 Bacteria 6800987
738 2965117264 2965110997 Bacteria 6693150
739 2967671459 2967664464 Bacteria 6948836
740 2967673757 2967671571 Bacteria 7021409
741 2967678803 2967678726 Bacteria 7264382
742 2967686302 2967686174 Bacteria 6678622
743 2967693124 2967693043 Bacteria 6804451
744 2967704298 2967699805 Bacteria 6854538
745 2967713990 2967706974 Bacteria 7186053
746 2967721386 2967714385 Bacteria 7000047
747 2967724737 2967721400 Bacteria 7073753
748 2967730679 2967728569 Bacteria 6641507
749 2967741019 2967735183 Bacteria 6827012
750 2967746961 2967742019 Bacteria 6794534
751 2967752227 2967748971 Bacteria 6733771
752 2967761069 2967755722 Bacteria 6814706
753 2967763699 2967762386 Bacteria 6923502
754 2967773178 2967769361 Bacteria 6587838
755 2967779390 2967775926 Bacteria 6738189
756 2968019440 2968016561 Bacteria 7022047
757 2968084754 2968083720 Bacteria 7351627
758 2968101644 2968097103 Bacteria 6107094
759 2968116753 2968110612 Bacteria 6814636
760 2968118501 2968117919 Bacteria 6536078
761 2968131834 2968128360 Bacteria 6270294
762 2968143599 2968138860 Bacteria 6605449
763 2968173504 2968171901 Bacteria 6894245
764 2970026721 2970019648 Bacteria 7072033
765 2970030434 2970026789 Bacteria 6785236
766 2970039199 2970033650 Bacteria 7118744
767 2970042979 2970040964 Bacteria 6731123
768 2970051615 2970047711 Bacteria 7088379
769 2970058724 2970054988 Bacteria 6611507
770 2970066989 2970061556 Bacteria 7099761
771 2970074899 2970068827 Bacteria 7123112
772 2970076486 2970076120 Bacteria 6697332
773 2970083379 2970082768 Bacteria 6183754
774 2970093526 2970088815 Bacteria 6933825
775 2970100183 2970095765 Bacteria 6936963
776 2970108444 2970102677 Bacteria 6812532
777 2970112265 2970109326 Bacteria 6863976
778 2970118088 2970116247 Bacteria 6501857
779 2970128292 2970122695 Bacteria 6625855
780 2970129397 2970129317 Bacteria 6806560
781 2970143414 2970136068 Bacteria 7207982
782 2970149030 2970143518 Bacteria 6446480
783 2970151301 2970149975 Bacteria 6779706
784 2970157152 2970156795 Bacteria 7168044
785 2970167382 2970164137 Bacteria 6861252
786 2970171483 2970170962 Bacteria 6876229
787 2970182616 2970177841 Bacteria 6768001
788 2970187466 2970184632 Bacteria 7054431
789 2970196292 2970191845 Bacteria 7032787
790 2970472761 2970469710 Bacteria 6969209
791 2970494753 2970489779 Bacteria 6517260
792 2970515856 2970510686 Bacteria 7006402
793 2970529562 2970524798 Bacteria 6840927
794 2970533346 2970532167 Bacteria 6553173
795 2970545386 2970540015 Bacteria 6977556
796 2970550622 2970547951 Bacteria 6931819
797 2970556593 2970554993 Bacteria 6814252
798 2970596368 2970593180 Bacteria 7073582
799 2970623651 2970619444 Bacteria 6986144
800 2970630865 2970627176 Bacteria 6680862
801 2977518583 2977516862 Bacteria 6940108
802 2977525989 2977523885 Bacteria 6960446
803 2977533305 2977530762 Bacteria 6951399
804 2977537868 2977537788 Bacteria 6929320
805 2977544818 2977544691 Bacteria 6875412
806 2977551865 2977551784 Bacteria 7125765
807 2977563077 2977558990 Bacteria 6863948
808 2977568195 2977565890 Bacteria 6901543
809 2977574833 2977572785 Bacteria 6763888
810 2977581615 2977579622 Bacteria 6772100
811 2977851249 2977843712 Bacteria 6753583
812 2977862213 2977858184 Bacteria 6215359
813 2977875009 2977872689 Bacteria 7270173
814 2977908116 2977907340 Bacteria 6577984
815 2977916485 2977915119 Bacteria 6829656
816 2977927628 2977922695 Bacteria 6956781
817 2977938644 2977935797 Bacteria 6252826
818 2977946700 2977942078 Bacteria 7570577
819 2977957068 2977950692 Bacteria 6893264
820 2977959899 2977957713 Bacteria 6877875
821 2977973200 2977971508 Bacteria 7472917
822 2977987676 2977986579 Bacteria 6581278
823 2979717613 2979710463 Bacteria 6785254
824 2979744506 2979742915 Bacteria 7301278
825 2979770872 2979764755 Bacteria 6610066
826 2979775108 2979772303 Bacteria 6618277
827 2979785729 2979779861 Bacteria 6219781
828 2979796255 2979793036 Bacteria 6808957
829 2987643517 2987636660 Bacteria 8088555
830 2987651588 2987645492 Bacteria 6117018
831 2987652214 2987652177 Bacteria 6969023
832 2987661111 2987659509 Bacteria 6966464
833 2987672707 2987666974 Bacteria 6509233
834 2987673799 2987673487 Bacteria 6884027
835 2989355155 2989349275 Bacteria 6349068
836 2989775376 2989771324 Bacteria 5605128
837 2996313146 2996310559 Bacteria 6357320
838 2996348587 2996341866 Bacteria 6643098
839 2996352120 2996348954 Bacteria 7239054
840 2996391993 2996386984 Bacteria 6978667
841 3000142029 3000135777 Bacteria 6891109
842 3003932410 3003930520 Bacteria 5667563
843 3004171098 3004167301 Bacteria 8330599
844 3004190161 3004188549 Bacteria 6952365
845 3004203113 3004195979 Bacteria 6776956
846 3004207062 3004203850 Bacteria 7307914
847 3004214466 3004211236 Bacteria 7417683
848 3004223569 3004218560 Bacteria 7421728
849 3004233004 3004232784 Bacteria 6662140
850 3004239994 3004239961 Bacteria 6892290
851 3004249146 3004248173 Bacteria 6563236
852 3004273382 3004268573 Bacteria 7043476
853 3004278818 3004275668 Bacteria 7114440
854 3004339227 3004334049 Bacteria 8449246
855 637079384 637000159 Bacteria 7596297
856 643824929 643692032 Bacteria 6891900
857 648737739 648276728 Bacteria 6968865
858 649874772 649633066 Bacteria 6690028
859 8002287981 8002285264 Bacteria 6717907
860 8003992740 8003992118 Bacteria 7266902
861 8004000069 8003999396 Bacteria 7063185
862 8004303442 8004300914 Bacteria 6132239
863 8004318593 8004312739 Bacteria 7444653
864 8004368148 8004361976 Bacteria 6858373
865 8004391613 8004387939 Bacteria 7049250
866 8004449705 8004445564 Bacteria 6322258
867 8004633795 8004633249 Bacteria 6723080
868 8004641376 8004640170 Bacteria 6723001
869 8004700007 8004695233 Bacteria 6731676
870 8004710702 8004703790 Bacteria 8006957
871 8004716982 8004714634 Bacteria 6776161
872 8004733157 8004727605 Bacteria 6643904
873 8005246850 8005246636 Bacteria 4933972
874 8049293761 8049293176 Bacteria 6128433
875 8054560086 8054558443 Bacteria 5204801
876 8054567726 8054563764 Bacteria 5592885
877 8055622867 8055617313 Bacteria 7548464
878 Ga0439449_0002061
879 JGI24740J21852_10009030
880 JGI25158J39367_1001337
881 JGI25159J45721_1000001
882 JGI25151J46595_10008750
883 JGI25151J46595_10025779
884 JGI25165J46597_1000016
885 rootH2_10339468
886 JGI25160J50197_1000002
887 Ga0055542_1004234
888 Ga0055529_1006934
889 Ga0055526_1001867
890 Ga0055524_1000777
891 Ga0055524_1024254
892 Ga0055530_10040496
893 Ga0055531_10031987
894 Ga0055543_1000057
895 Ga0065165_1000004
896 Ga0070658_10391926
897 Ga0070666_10095281
898 Ga0070668_100298989
899 Ga0070674_100184160
900 Ga0070667_100430374
901 Ga0070663_100110541
902 Ga0070663_100645646
903 Ga0070678_100832481
904 Ga0068853_100043464
905 Ga0070665_100034072
906 Ga0070665_100471005
907 Ga0068855_100162571
908 Ga0070664_100750651
909 Ga0068857_100104451
910 Ga0081455_10018339
911 Ga0081540_1023624
912 Ga0075365_10004422
913 Ga0075365_10012641
914 Ga0075363_100012543
915 Ga0075363_100213756
916 Ga0075362_10027138
917 Ga0075362_10028394
918 Ga0075367_10019586
919 Ga0075369_10119954
920 Ga0075370_10026164
921 Ga0075370_10077522
922 Ga0079104_1007485
923 Ga0079104_1014594
924 Ga0105240_10026413
925 Ga0105240_10281473
926 Ga0105237_10031482
927 Ga0105237_10077156
928 Ga0105237_10163975
929 Ga0105237_10294357
930 Ga0105238_10011809
931 Ga0105239_10044001
932 Ga0105239_10076181
933 Ga0105239_10150471
934 Ga0105239_10466871
935 Ga0157370_10607504
936 Ga0157369_10276630
937 Ga0171463_1001
938 Ga0157374_10564917
939 Ga0157378_10680137
940 Ga0157372_10668351
941 Ga0182008_10128964
942 Ga0183363_1045
943 Ga0214544_1000008
944 Ga0214542_1000010
945 Ga0214542_1015383
946 Ga0214543_1000003
947 Ga0214543_1000004
948 Ga0228711_1000001
949 Ga0228710_1000001
950 Ga0209436_100122
951 Ga0209563_105116
952 Ga0209646_1011896
953 Ga0209026_1000005
954 Ga0209148_1000056
955 Ga0209759_1000631
956 Ga0209233_1000068
957 Ga0209455_1000238
958 Ga0209130_1000008
959 Ga0209676_1002258
960 Ga0209025_1000100
961 Ga0209025_1000165
962 Ga0209564_1000104
963 Ga0209758_1005808
964 Ga0209050_1015813
965 Ga0209256_1000652
966 Ga0209256_1002322
967 Ga0207426_1000016
968 Ga0207680_10098509
969 Ga0207647_10053502
970 Ga0207645_10077952
971 Ga0207695_10333569
972 Ga0207695_10824141
973 Ga0207671_10012030
974 Ga0207671_10058466
975 Ga0207671_10178806
976 Ga0207657_10050734
977 Ga0207694_10051200
978 Ga0207694_10445342
979 Ga0207706_10174245
980 Ga0207669_10149290
981 Ga0207691_10293169
982 Ga0207668_10388562
983 Ga0207639_10069737
984 Ga0207678_10149256
985 Ga0207674_10098525
986 Ga0209281_1000164
987 Ga0209281_1000626
988 Ga0209282_1000007
989 Ga0268266_10293056
990 Ga0307515_10000420
991 Ga0307515_10039061
992 Ga0265330_10123466
993 Ga0265325_10039985
994 Ga0265325_10041422
995 Ga0265340_10001536
996 Ga0265340_10012513
997 Ga0265340_10071750
998 Ga0265339_10004396
999 Ga0265339_10089722
1000 Ga0265339_10130413
1001 Ga0265316_10028899
1002 Ga0307513_10004196
1003 Ga0307408_100024952
1004 Ga0265313_10001426
1005 Ga0265313_10012669
1006 Ga0265314_10032908
1007 Ga0265342_10003927
1008 Ga0265342_10018567
1009 Ga0307406_10085121
1010 Ga0307412_10144470
1011 Ga0315914_1000006
1012 Ga0307409_100337798
1013 Ga0307416_100107466
1014 Ga0307416_101015167
1015 Ga0315913_1000002
1016 Ga0315915_1000001
1017 Ga0316574_0520552
1018 Ga0373931_0166482
1019 Ga0373935_0285059
1020 Ga0316582_0070662
1021 Ga0316584_0079499
1022 Ga0395900_0084548
1023 Ga0395900_0338598
1024 Ga0395898_0063483
1025 Ga0395898_0339865
1026 Ga0395905_0101818
1027 Ga0436364_1041655
1028 Ga0395901_0037442
1029 Ga0395901_0041612
1030 Ga0439461_0068124
1031 Ga0439466_0092196
1032 Ga0439465_0044479
1033 Ga0439442_066542
1034 Ga0439432_081424
1035 Ga0439462_0031769
1036 Ga0450906_026455
1037 Ga0450910_005161
1038 Ga0439458_0093151
1039 Ga0450918_007376
1040 Ga0466972_0092202
1041 Ga0466972_0230596
1042 Ga0466965_0237206
1043 Ga0466960_0081836
1044 Ga0495638_0098581
1045 Ga0495585_0252728
1046 Ga0495606_0053804
1047 Ga0495632_0048643
1048 Ga0495643_0070648
1049 Ga0495668_0044581
1050 Ga0495625_0021781
1051 Ga0495588_0099043
1052 Ga0495687_020699
1053 Ga0495602_0249634
1054 Ga0495602_0443161
1055 Ga0495626_0056117
1056 Ga0496102_0831960
1057 Ga0496104_0396809
1058 Ga0496105_0063843
1059 Ga0496110_0196310
1060 Ga0496110_0407293
1061 Ga0496112_0015726
1062 Ga0496112_0260718
1063 Ga0496113_0221816
1064 Ga0496114_0200085
1065 Ga0496117_0002204
1066 Ga0496118_0046814
1067 Ga0496120_0052491
1068 Ga0496121_0153319
1069 Ga0496122_0004346
1070 Ga0496122_0076809
1071 Ga0496123_0000103
1072 Ga0496123_0026920
1073 Ga0496124_0005072
1074 Ga0496124_0122222
1075 Ga0496125_0000879
1076 Ga0496125_0039027
1077 Ga0496126_0001336
1078 Ga0496126_0012132
1079 Ga0496126_0092384
1080 Ga0501290_000163
1081 Ga0501031_0005610
1082 Ga0501031_0035334
1083 Ga0501031_0177612
1084 Ga0501032_0000082
1085 Ga0501032_0006363
1086 Ga0501032_0077742
1087 Ga0501032_0163195
1088 Ga0501032_0242560
1089 Ga0501032_0323449
1090 Ga0501032_0477858
1091 Ga0501033_0000070
1092 Ga0501033_0000500
1093 Ga0501033_0000503
1094 Ga0501033_0007653
1095 Ga0501033_0016653
1096 Ga0501033_0111103
1097 Ga0501033_0332300
1098 Ga0501034_0000087
1099 Ga0501034_0277704
1100 Ga0501034_0500559
1101 Ga0501034_0614244
1102 Ga0501034_0620168
1103 Ga0501036_0000073
1104 Ga0501036_0100265
1105 Ga0501036_0119383
1106 Ga0501036_0167658
1107 Ga0501036_0297094
1108 Ga0501036_0698783
1109 Ga0501037_0000014
1110 Ga0501037_0004549
1111 Ga0501037_0117480
1112 Ga0501037_0322388
1113 Ga0501037_0328514
1114 Ga0501037_0407722
1115 Ga0501037_0409883
1116 Ga0501038_0000023
1117 Ga0501038_0024807
1118 Ga0501038_0168640
1119 Ga0501039_0000044
1120 Ga0501039_0317168
1121 Ga0501039_0468183
1122 Ga0501043_0000022
1123 Ga0501043_0000088
1124 Ga0501043_0017381
1125 Ga0501043_0291265
1126 Ga0501043_0453175
1127 Ga0501046_0012919
1128 Ga0501046_0014815
1129 Ga0501046_0088424
1130 Ga0501047_0006539
1131 Ga0501047_0014062
1132 Ga0501047_0065071
1133 Ga0501047_0087503
1134 Ga0501047_0102861
1135 Ga0501047_0163561
1136 Ga0501047_0181467
1137 Ga0501047_0242905
1138 Ga0501047_0400807
1139 Ga0501047_0451074
1140 Ga0501047_0546877
1141 Ga0501067_0022364
1142 Ga0501068_0031056
1143 Ga0501068_0222000
1144 Ga0501069_0000284
1145 Ga0501069_0017700
1146 Ga0501070_0000103
1147 Ga0501070_0007102
1148 Ga0501070_0014430
1149 Ga0501070_0134743
1150 Ga0501070_0152142
1151 Ga0501070_0246332
1152 Ga0501070_0367885
1153 Ga0501071_0050853
1154 Ga0501073_0016951
1155 Ga0501073_0062094
1156 Ga0501073_0081812
1157 Ga0501073_0254797
1158 Ga0501073_0392706
1159 Ga0501074_0001426
1160 Ga0501074_0013544
1161 Ga0501074_0098204
1162 Ga0501074_0651818
1163 Ga0501202_018881
1164 Ga0501222_001521
1165 Ga0501223_001150
1166 Ga0501224_006556
1167 Ga0501079_0467541
1168 Ga0501080_0035831
1169 Ga0501080_0046275
1170 Ga0501080_0098650
1171 Ga0501080_0147726
1172 Ga0501080_0255827
1173 Ga0501080_0365547
1174 Ga0501083_0000374
1175 Ga0501280_000010
1176 Ga0501282_001568
1177 Ga0501035_0000047
1178 Ga0501035_0002644
1179 Ga0501035_0002789
1180 Ga0501035_0003617
1181 Ga0501035_0016993
1182 Ga0501035_0020300
1183 Ga0501035_0044652
1184 Ga0501035_0128449
1185 Ga0501035_0132124
1186 Ga0501035_0132746
1187 Ga0501044_0003500
1188 Ga0501044_0007915
1189 Ga0501044_0013751
1190 Ga0501044_0048111
1191 Ga0501044_0114660
1192 Ga0501044_0164871
1193 Ga0501044_0165646
1194 Ga0501044_0197805
1195 Ga0501044_0277499
1196 Ga0501044_0329332
1197 Ga0501044_0379739
1198 Ga0501044_0521416
1199 Ga0501045_0300157
1200 nmdc:mga03683_77172_c1
1201 nmdc:mga03n38_183648_c1
1202 nmdc:mga03n38_2998_c1
1203 nmdc:mga0yw44_1413_c1
1204 nmdc:mga0yw44_483546_c1
1205 nmdc:mga0yw44_7220_c1
1206 nmdc:mga06z11_18329_c1
1207 nmdc:mga06z11_218415_c1
1208 nmdc:mga06z11_30040_c1
1209 nmdc:mga06z11_7530_c1
1210 nmdc:mga04h51_105845_c1
1211 nmdc:mga0sz30_1456_c1
1212 Ga0500610_0037028
1213 Ga0495655_0029661
1214 Ga0500578_0096475
1215 Ga0500643_000356
1216 Ga0500595_049433
1217 Ga0500658_0150608
1218 Ga0500568_0000209
1219 Ga0500604_0015119
1220 Ga0500604_0117993
1221 Ga0500620_007680
1222 Ga0500624_036798
1223 Ga0500627_0072549
1224 Ga0500611_028533
1225 Ga0500609_012103
1226 Ga0501082_0064688
1227 2503203477
1228 2509107395
1229 2509115895
1230 2509373682
1231 2509374615
1232 2509397894
1233 2510304532
1234 2510316468
1235 2511500849
1236 2512532271
1237 2512929640
1238 2512964421
1239 2512972398
1240 2513585833
1241 2513603477
1242 2513608295
1243 2513619762
1244 2513882825
1245 2513906548
1246 2513985429
1247 2513999329
1248 2514004932
1249 2514036973
1250 2514416728
1251 2514591637
1252 2515607977
1253 2516208731
1254 2516892122
1255 2517568937
1256 2523466202
1257 2524450171
1258 2551681065
1259 2551684813
1260 2551695399
1261 2551702340
1262 2551714704
1263 2551721668
1264 2551724935
1265 2551724966
1266 2551733299
1267 2551746567
1268 2558863643
1269 2585165338
1270 2585266433
1271 2585387411
1272 2585394073
1273 2588515219
1274 2597815180
1275 2599939945
1276 2600191758
1277 2643774108
1278 2643774790
1279 2643793234
1280 2643807384
1281 2643838626
1282 2643989020
1283 2644046791
1284 2644069796
1285 2644109176
1286 2644132742
1287 2644151698
1288 2644152205
1289 2644202498
1290 2644206397
1291 2644297109
1292 2644311832
1293 2644330104
1294 2644380767
1295 2644414672
1296 2644448329
1297 2644479580
1298 2644493573
1299 2644500767
1300 2644543142
1301 2644617630
1302 2644650044
1303 2644655362
1304 2644673726
1305 2644689364
1306 2657682163
1307 2688600308
1308 2692316976
1309 2694631744
1310 2694639796
1311 2723577583
1312 2738945935
1313 2739306639
1314 2739347075
1315 2753358885
1316 2753462969
1317 2756673129
1318 2776912365
1319 2792584011
1320 2792622187
1321 2792628248
1322 2792638494
1323 2792750872
1324 2793283020
1325 2802717580
1326 2802723493
1327 2802731057
1328 2802736063
1329 2802743726
1330 2802750562
1331 2804751181
1332 2837652518
1333 2838076284
1334 2842525121
1335 2844005580
1336 2844015619
1337 2844163813
1338 2847417955
1339 2847671987
1340 2847688218
1341 2848992931
1342 2850080317
1343 2855832040
1344 2855840326
1345 2855878994
1346 2856318281
1347 2856324238
1348 2856328603
1349 2856338481
1350 2856345604
1351 2856353688
1352 2856364816
1353 2857354915
1354 2857369616
1355 2858800857
1356 2869165491
1357 2869173889
1358 2869241264
1359 2869242478
1360 2869256872
1361 2869261680
1362 2869264622
1363 2869277320
1364 2869281764
1365 2869289735
1366 2871431801
1367 2871443119
1368 2871445320
1369 2871455126
1370 2871465758
1371 2871468503
1372 2871488464
1373 2871497517
1374 2874108840
1375 2874113636
1376 2874122629
1377 2874127730
1378 2874132306
1379 2874140568
1380 2874155479
1381 2874162336
1382 2874166570
1383 2874175273
1384 2876366798
1385 2876376846
1386 2876378548
1387 2876390757
1388 2876398754
1389 2876400595
1390 2876408796
1391 2876420824
1392 2876426966
1393 2878037619
1394 2878742352
1395 2878748407
1396 2878761735
1397 2878768703
1398 2878778689
1399 2878788006
1400 2881153845
1401 2881157627
1402 2881162989
1403 2881853953
1404 2882635350
1405 2885311780
1406 2885322892
1407 2885340445
1408 2885350004
1409 2885350819
1410 2888341482
1411 2888348629
1412 2888350818
1413 2889013160
1414 2889021980
1415 2891376483
1416 2894776651
1417 2896386486
1418 2899806335
1419 2903452973
1420 2903506084
1421 2903514942
1422 2903524665
1423 2903531092
1424 2903542312
1425 2904665286
1426 2906312024
1427 2906323762
1428 2906331383
1429 2906360348
1430 2906364863
1431 2906377928
1432 2906383573
1433 2906388958
1434 2906395447
1435 2906402444
1436 2906408404
1437 2906418318
1438 2906435025
1439 2913297591
1440 2913310379
1441 2915984148
1442 2915990236
1443 2915997945
1444 2916002336
1445 2916008582
1446 2916020393
1447 2916023556
1448 2916034549
1449 2916035295
1450 2916043336
1451 2916051055
1452 2916057652
1453 2916067959
1454 2916073406
1455 2916080160
1456 2920763030
1457 2920823673
1458 2921207632
1459 2921212509
1460 2921243873
1461 2921245909
1462 2921250843
1463 2921261070
1464 2921269299
1465 2921283859
1466 2921294810
1467 2921301325
1468 2922137594
1469 2922153274
1470 2922159744
1471 2922178173
1472 2922182441
1473 2922193826
1474 2924146979
1475 2924155945
1476 2924160451
1477 2924169824
1478 2924178605
1479 2924180331
1480 2924191395
1481 2924196011
1482 2924204446
1483 2924207481
1484 2924217016
1485 2924228847
1486 2924231396
1487 2924718829
1488 2924728136
1489 2924740377
1490 2924742750
1491 2924752574
1492 2924761515
1493 2924764449
1494 2924780152
1495 2936999197
1496 2937003334
1497 2937010638
1498 2937016795
1499 2937028046
1500 2937029979
1501 2937038027
1502 2937044649
1503 2937052699
1504 2937061655
1505 2937066534
1506 2937072374
1507 2937083122
1508 2937089123
1509 2937097903
1510 2937103749
1511 2937107360
1512 2937119800
1513 2937120900
1514 2937130207
1515 2937818153
1516 2937829086
1517 2937842738
1518 2937846622
1519 2937850683
1520 2937868726
1521 2937873784
1522 2937882672
1523 2937892084
1524 2937973355
1525 2937988116
1526 2937996167
1527 2938015045
1528 2941500402
1529 2957380138
1530 2957385191
1531 2957389253
1532 2957397057
1533 2957402728
1534 2957415159
1535 2957417215
1536 2957423549
1537 2957436451
1538 2957439865
1539 2957449962
1540 2957453364
1541 2957457882
1542 2957466393
1543 2957475054
1544 2957483785
1545 2957490521
1546 2957495873
1547 2957499273
1548 2957507934
1549 2958037725
1550 2958047437
1551 2958066105
1552 2958074952
1553 2958089797
1554 2958097711
1555 2958107868
1556 2958113009
1557 2958116820
1558 2958130021
1559 2958134108
1560 2958142803
1561 2958146776
1562 2958163468
1563 2958166637
1564 2958178260
1565 2958183754
1566 2960587957
1567 2960595459
1568 2960600697
1569 2960604671
1570 2960613853
1571 2960617584
1572 2960626668
1573 2960633341
1574 2960642094
1575 2960649797
1576 2960656850
1577 2960662261
1578 2960668487
1579 2960677573
1580 2960685728
1581 2960690422
1582 2960696259
1583 2961081720
1584 2961120286
1585 2961132205
1586 2961138637
1587 2961165103
1588 2961184175
1589 2963649592
1590 2964612041
1591 2964617562
1592 2964622872
1593 2964633662
1594 2964642060
1595 2964644401
1596 2964652982
1597 2964658192
1598 2964666095
1599 2964671134
1600 2964684723
1601 2964686166
1602 2964693592
1603 2964701935
1604 2964712205
1605 2964713579
1606 2964726587
1607 2965019927
1608 2965026224
1609 2965034295
1610 2965046955
1611 2965047959
1612 2965064678
1613 2965094493
1614 2965106383
1615 2965117264
1616 2967671459
1617 2967673757
1618 2967678803
1619 2967686302
1620 2967693124
1621 2967704298
1622 2967713990
1623 2967721386
1624 2967724737
1625 2967730679
1626 2967741019
1627 2967746961
1628 2967752227
1629 2967761069
1630 2967763699
1631 2967773178
1632 2967779390
1633 2968019440
1634 2968084754
1635 2968101644
1636 2968116753
1637 2968118501
1638 2968131834
1639 2968143599
1640 2968173504
1641 2970026721
1642 2970030434
1643 2970039199
1644 2970042979
1645 2970051615
1646 2970058724
1647 2970066989
1648 2970074899
1649 2970076486
1650 2970083379
1651 2970093526
1652 2970100183
1653 2970108444
1654 2970112265
1655 2970118088
1656 2970128292
1657 2970129397
1658 2970143414
1659 2970149030
1660 2970151301
1661 2970157152
1662 2970167382
1663 2970171483
1664 2970182616
1665 2970187466
1666 2970196292
1667 2970472761
1668 2970494753
1669 2970515856
1670 2970529562
1671 2970533346
1672 2970545386
1673 2970550622
1674 2970556593
1675 2970596368
1676 2970623651
1677 2970630865
1678 2977518583
1679 2977525989
1680 2977533305
1681 2977537868
1682 2977544818
1683 2977551865
1684 2977563077
1685 2977568195
1686 2977574833
1687 2977581615
1688 2977851249
1689 2977862213
1690 2977875009
1691 2977908116
1692 2977916485
1693 2977927628
1694 2977938644
1695 2977946700
1696 2977957068
1697 2977959899
1698 2977973200
1699 2977987676
1700 2979717613
1701 2979744506
1702 2979770872
1703 2979775108
1704 2979785729
1705 2979796255
1706 2987643517
1707 2987651588
1708 2987652214
1709 2987661111
1710 2987672707
1711 2987673799
1712 2989355155
1713 2989775376
1714 2996313146
1715 2996348587
1716 2996352120
1717 2996391993
1718 3000142029
1719 3003932410
1720 3004171098
1721 3004190161
1722 3004203113
1723 3004207062
1724 3004214466
1725 3004223569
1726 3004233004
1727 3004239994
1728 3004249146
1729 3004273382
1730 3004278818
1731 3004339227
1732 637079384
1733 643824929
1734 648737739
1735 649874772
1736 8002287981
1737 8003992740
1738 8004000069
1739 8004303442
1740 8004318593
1741 8004368148
1742 8004391613
1743 8004449705
1744 8004633795
1745 8004641376
1746 8004700007
1747 8004710702
1748 8004716982
1749 8004733157
1750 8005246850
1751 8049293761
1752 8054560086
1753 8054567726
1754 8055622867

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

121

231

0.97

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

42

225

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2no4-assembly1.cif.gz_B crystal structure analysis of a dehalogenase 0.9785 3 215
2no5-assembly1.cif.gz_B crystal structure analysis of a dehalogenase with intermediate complex 0.9716 2 215
2no4-assembly1.cif.gz_B crystal structure analysis of a dehalogenase 0.952 3 215
3um9-assembly1.cif.gz_B crystal structure of the defluorinating l-2-haloacid dehalogenase bpro0530 0.9509 3 217
3umb-assembly1.cif.gz_A-2 crystal structure of the l-2-haloacid dehalogenase rsc1362 0.9501 1 218
ID Description Score Start End Superfamily
2no5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9869 92 215 3.40.50.1000
1zrmA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9583 3 217 3.40.50.1000
2no5B02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9382 17 89 1.10.150.240
1zrmA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9324 3 217 3.40.50.1000
2w43A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9245 92 217 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A531M6S1-F1-model_v4 (S)-2-haloacid dehalogenase (EC 3.8.1.2) (2-haloalkanoic acid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-2-haloacid dehalogenase) 0.9978 1 171 GO:0018784
AF-A0A434CLW1-F1-model_v4 (S)-2-haloacid dehalogenase (EC 3.8.1.2) (2-haloalkanoic acid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-2-haloacid dehalogenase) 0.9952 1 142 GO:0018784
AF-X5R813-F1-model_v4 (S)-2-haloacid dehalogenase (EC 3.8.1.2) (2-haloalkanoic acid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-2-haloacid dehalogenase) 0.995 1 218 GO:0018784
AF-A0A345ZV89-F1-model_v4 (S)-2-haloacid dehalogenase (EC 3.8.1.2) (2-haloalkanoic acid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-2-haloacid dehalogenase) 0.995 4 217 GO:0018784
AF-A0A7X1HG32-F1-model_v4 (S)-2-haloacid dehalogenase (EC 3.8.1.2) (2-haloalkanoic acid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-2-haloacid dehalogenase) 0.9944 3 217 GO:0018784

Map