F484427
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 878 | 281 | 876 | 309 |
Family's Representative Sequence
| Representative Sequence | 3300036401|Ga0373937_0075441|Ga0373937_0075441_1161_2168 |
| Length | 335 |
| Sequence | MAAVRVAVRPILPTRRESAMLELATISLLNGVVYGLLLFMLTSGLTLIFSMMGVLNFAHASIFMLGAYFSWQLSRWIGFWPALVVAPLLCGVAGAAIERYGLRHVHKRGHVAEILFTFGLAYVIEELVTMIWGRNAVANGVPRAIDFPLFHLFGSSFPAYKGLMMAISVAMFAFLYVALKRTRVGLVIRAALTHPQMVGALGHDVPRIFVLVFALGSALAGLAGVIGGFMWLTQPTLAHAVGPIVFVVVVLGGLGSLAGALIASMLIGILQTLAVAVDYSLLDLFRVAGVTIARSSPWYDLCSIRVATAAPIVPYLLLVLMLVVRPRGLLGTRDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 4 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 224 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 225 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 227 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 228 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 229 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 232 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 233 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 234 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 235 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 236 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 237 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 238 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 239 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 240 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 241 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 259 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 260 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 261 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 262 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 263 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 264 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 267 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 268 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 269 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.77 |
| Metatranscriptomes | 0 |
| Isolates | 0.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.59 |
| Nodule | 0 |
| Rhizoplane | 3.87 |
| Rhizosphere | 94.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10014625 | 3300002067 | Unclassified | 2456 |
| 2 | JGI24035J26624_1003066 | 3300002126 | Bacteria | 1562 |
| 3 | JGI24033J26618_1004127 | 3300002155 | Bacteria | 1557 |
| 4 | JGI25165J46597_1000824 | 3300003214 | Bacteria | 23238 |
| 5 | rootL2_10348385 | 3300003322 | Bacteria | 2491 |
| 6 | Ga0055532_1000297 | 3300003758 | Bacteria | 30678 |
| 7 | Ga0055532_1000435 | 3300003758 | Bacteria | 19731 |
| 8 | Ga0055527_1000236 | 3300003760 | Bacteria | 34738 |
| 9 | Ga0055535_1000503 | 3300003761 | Bacteria | 34738 |
| 10 | Ga0055542_1000521 | 3300003762 | Bacteria | 34738 |
| 11 | Ga0055529_1000510 | 3300003763 | Bacteria | 34738 |
| 12 | Ga0065712_10121336 | 3300005290 | Bacteria | 1666 |
| 13 | Ga0065715_10105456 | 3300005293 | Bacteria | 2891 |
| 14 | Ga0065715_10163288 | 3300005293 | Bacteria | 1609 |
| 15 | Ga0065707_10041460 | 3300005295 | Bacteria | 1297 |
| 16 | Ga0070658_10042562 | 3300005327 | Bacteria | 3668 |
| 17 | Ga0070658_10240915 | 3300005327 | Bacteria | 1533 |
| 18 | Ga0070658_10276831 | 3300005327 | Bacteria | 1428 |
| 19 | Ga0070676_10023491 | 3300005328 | Bacteria | 3466 |
| 20 | Ga0070676_10065363 | 3300005328 | Bacteria | 2171 |
| 21 | Ga0070683_100072461 | 3300005329 | Bacteria | 3215 |
| 22 | Ga0070683_100180217 | 3300005329 | Bacteria | 2005 |
| 23 | Ga0070690_100000937 | 3300005330 | Bacteria | 14894 |
| 24 | Ga0070690_100007555 | 3300005330 | Bacteria | 6223 |
| 25 | Ga0070690_100101313 | 3300005330 | Bacteria | 1910 |
| 26 | Ga0070690_100278225 | 3300005330 | Bacteria | 1193 |
| 27 | Ga0070670_100005195 | 3300005331 | Bacteria | 10960 |
| 28 | Ga0070670_100006021 | 3300005331 | Bacteria | 10254 |
| 29 | Ga0070670_100013131 | 3300005331 | Bacteria | 7095 |
| 30 | Ga0070670_100088410 | 3300005331 | Bacteria | 2663 |
| 31 | Ga0070670_100101790 | 3300005331 | Bacteria | 2473 |
| 32 | Ga0070677_10000311 | 3300005333 | Bacteria | 16974 |
| 33 | Ga0070677_10009260 | 3300005333 | Bacteria | 3335 |
| 34 | Ga0070677_10023257 | 3300005333 | Bacteria | 2293 |
| 35 | Ga0070677_10101402 | 3300005333 | Bacteria | 1270 |
| 36 | Ga0068869_100003339 | 3300005334 | Bacteria | 9801 |
| 37 | Ga0068869_100004702 | 3300005334 | Bacteria | 8519 |
| 38 | Ga0068869_100005299 | 3300005334 | Bacteria | 8104 |
| 39 | Ga0068869_100006404 | 3300005334 | Bacteria | 7465 |
| 40 | Ga0068869_100063480 | 3300005334 | Bacteria | 2714 |
| 41 | Ga0068869_100367124 | 3300005334 | Bacteria | 1177 |
| 42 | Ga0070666_10015499 | 3300005335 | Bacteria | 4863 |
| 43 | Ga0070666_10021926 | 3300005335 | Bacteria | 4143 |
| 44 | Ga0070666_10031845 | 3300005335 | Bacteria | 3482 |
| 45 | Ga0070680_100031635 | 3300005336 | Bacteria | 4255 |
| 46 | Ga0070680_100043480 | 3300005336 | Bacteria | 3649 |
| 47 | Ga0070680_100050144 | 3300005336 | Bacteria | 3404 |
| 48 | Ga0070682_100002642 | 3300005337 | Bacteria | 9902 |
| 49 | Ga0070682_100016272 | 3300005337 | Bacteria | 4323 |
| 50 | Ga0068868_100001088 | 3300005338 | Bacteria | 18600 |
| 51 | Ga0068868_100014606 | 3300005338 | Bacteria | 5792 |
| 52 | Ga0068868_100021157 | 3300005338 | Bacteria | 4898 |
| 53 | Ga0068868_100109971 | 3300005338 | Bacteria | 2239 |
| 54 | Ga0068868_100164832 | 3300005338 | Bacteria | 1832 |
| 55 | Ga0068868_100235349 | 3300005338 | Bacteria | 1537 |
| 56 | Ga0070660_100001240 | 3300005339 | Bacteria | 17325 |
| 57 | Ga0070660_100001443 | 3300005339 | Bacteria | 16236 |
| 58 | Ga0070660_100175395 | 3300005339 | Bacteria | 1733 |
| 59 | Ga0070689_100004319 | 3300005340 | Bacteria | 9594 |
| 60 | Ga0070689_100014876 | 3300005340 | Bacteria | 5662 |
| 61 | Ga0070689_100027007 | 3300005340 | Bacteria | 4326 |
| 62 | Ga0070689_100138058 | 3300005340 | Bacteria | 1959 |
| 63 | Ga0070689_100157011 | 3300005340 | Bacteria | 1837 |
| 64 | Ga0070689_100224098 | 3300005340 | Bacteria | 1543 |
| 65 | Ga0070691_10040765 | 3300005341 | Bacteria | 2195 |
| 66 | Ga0070687_100003610 | 3300005343 | Bacteria | 6037 |
| 67 | Ga0070687_100011438 | 3300005343 | Bacteria | 3882 |
| 68 | Ga0070687_100054981 | 3300005343 | Bacteria | 2076 |
| 69 | Ga0070687_100141042 | 3300005343 | Bacteria | 1404 |
| 70 | Ga0070661_100000422 | 3300005344 | Bacteria | 32487 |
| 71 | Ga0070661_100001121 | 3300005344 | Bacteria | 18811 |
| 72 | Ga0070661_100083999 | 3300005344 | Bacteria | 2352 |
| 73 | Ga0070661_100263411 | 3300005344 | Bacteria | 1333 |
| 74 | Ga0070661_100280508 | 3300005344 | Bacteria | 1292 |
| 75 | Ga0070661_100284007 | 3300005344 | Bacteria | 1284 |
| 76 | Ga0070692_10069497 | 3300005345 | Bacteria | 1873 |
| 77 | Ga0070692_10084663 | 3300005345 | Bacteria | 1714 |
| 78 | Ga0070668_100003855 | 3300005347 | Bacteria | 11068 |
| 79 | Ga0070668_100023182 | 3300005347 | Bacteria | 4693 |
| 80 | Ga0070668_100035230 | 3300005347 | Bacteria | 3816 |
| 81 | Ga0070668_100448542 | 3300005347 | Bacteria | 1109 |
| 82 | Ga0070669_100242731 | 3300005353 | Bacteria | 1432 |
| 83 | Ga0070669_100290210 | 3300005353 | Bacteria | 1313 |
| 84 | Ga0070675_100004306 | 3300005354 | Bacteria | 10851 |
| 85 | Ga0070675_100004789 | 3300005354 | Bacteria | 10319 |
| 86 | Ga0070675_100063250 | 3300005354 | Bacteria | 3059 |
| 87 | Ga0070675_100122702 | 3300005354 | Bacteria | 2208 |
| 88 | Ga0070675_100471622 | 3300005354 | Bacteria | 1128 |
| 89 | Ga0070671_100000758 | 3300005355 | Bacteria | 23124 |
| 90 | Ga0070671_100007181 | 3300005355 | Bacteria | 8905 |
| 91 | Ga0070671_100008280 | 3300005355 | Bacteria | 8323 |
| 92 | Ga0070671_100018968 | 3300005355 | Bacteria | 5593 |
| 93 | Ga0070671_100042621 | 3300005355 | Bacteria | 3773 |
| 94 | Ga0070671_100254550 | 3300005355 | Bacteria | 1492 |
| 95 | Ga0070671_100264882 | 3300005355 | Bacteria | 1461 |
| 96 | Ga0070674_100000539 | 3300005356 | Bacteria | 19016 |
| 97 | Ga0070674_100049758 | 3300005356 | Bacteria | 2883 |
| 98 | Ga0070674_100095624 | 3300005356 | Bacteria | 2154 |
| 99 | Ga0070673_100008416 | 3300005364 | Bacteria | 6859 |
| 100 | Ga0070673_100017502 | 3300005364 | Bacteria | 5099 |
| 101 | Ga0070673_100037562 | 3300005364 | Bacteria | 3691 |
| 102 | Ga0070673_100074239 | 3300005364 | Bacteria | 2740 |
| 103 | Ga0070673_100096181 | 3300005364 | Bacteria | 2430 |
| 104 | Ga0070673_100099891 | 3300005364 | Bacteria | 2388 |
| 105 | Ga0070673_100103085 | 3300005364 | Bacteria | 2353 |
| 106 | Ga0070688_100048802 | 3300005365 | Bacteria | 2632 |
| 107 | Ga0070688_100089398 | 3300005365 | Bacteria | 2010 |
| 108 | Ga0070688_100202702 | 3300005365 | Bacteria | 1389 |
| 109 | Ga0070688_100209997 | 3300005365 | Bacteria | 1366 |
| 110 | Ga0070659_100003747 | 3300005366 | Bacteria | 10844 |
| 111 | Ga0070659_100038438 | 3300005366 | Bacteria | 3733 |
| 112 | Ga0070659_100041362 | 3300005366 | Bacteria | 3603 |
| 113 | Ga0070659_100054906 | 3300005366 | Bacteria | 3138 |
| 114 | Ga0070659_100107228 | 3300005366 | Bacteria | 2252 |
| 115 | Ga0070667_100012929 | 3300005367 | Bacteria | 6900 |
| 116 | Ga0070667_100023042 | 3300005367 | Bacteria | 5165 |
| 117 | Ga0070667_100033086 | 3300005367 | Bacteria | 4317 |
| 118 | Ga0070667_100060942 | 3300005367 | Bacteria | 3194 |
| 119 | Ga0070703_10001200 | 3300005406 | Bacteria | 7955 |
| 120 | Ga0070709_10125456 | 3300005434 | Bacteria | 1746 |
| 121 | Ga0070714_100001293 | 3300005435 | Bacteria | 18094 |
| 122 | Ga0070714_100040851 | 3300005435 | Bacteria | 3911 |
| 123 | Ga0070714_100162116 | 3300005435 | Bacteria | 2024 |
| 124 | Ga0070713_100014185 | 3300005436 | Bacteria | 5905 |
| 125 | Ga0070713_100022094 | 3300005436 | Bacteria | 4910 |
| 126 | Ga0070713_100055080 | 3300005436 | Bacteria | 3303 |
| 127 | Ga0070710_10002850 | 3300005437 | Bacteria | 8241 |
| 128 | Ga0070710_10022141 | 3300005437 | Bacteria | 3321 |
| 129 | Ga0070710_10104267 | 3300005437 | Bacteria | 1694 |
| 130 | Ga0070701_10015307 | 3300005438 | Bacteria | 3539 |
| 131 | Ga0070701_10016294 | 3300005438 | Bacteria | 3452 |
| 132 | Ga0070701_10035616 | 3300005438 | Bacteria | 2502 |
| 133 | Ga0070711_100041397 | 3300005439 | Bacteria | 3111 |
| 134 | Ga0070711_100067958 | 3300005439 | Bacteria | 2502 |
| 135 | Ga0070711_100171819 | 3300005439 | Bacteria | 1653 |
| 136 | Ga0070705_100000841 | 3300005440 | Bacteria | 17205 |
| 137 | Ga0070705_100150597 | 3300005440 | Bacteria | 1543 |
| 138 | Ga0070700_100003801 | 3300005441 | Bacteria | 7820 |
| 139 | Ga0070700_100028121 | 3300005441 | Bacteria | 3341 |
| 140 | Ga0070694_100015658 | 3300005444 | Bacteria | 4766 |
| 141 | Ga0070694_100055888 | 3300005444 | Bacteria | 2679 |
| 142 | Ga0070708_100108699 | 3300005445 | Bacteria | 2547 |
| 143 | Ga0070708_100116248 | 3300005445 | Bacteria | 2463 |
| 144 | Ga0070708_100158925 | 3300005445 | Bacteria | 2105 |
| 145 | Ga0070663_100007113 | 3300005455 | Bacteria | 6790 |
| 146 | Ga0070663_100020597 | 3300005455 | Bacteria | 4367 |
| 147 | Ga0070678_100002006 | 3300005456 | Bacteria | 10996 |
| 148 | Ga0070678_100040346 | 3300005456 | Bacteria | 3303 |
| 149 | Ga0070678_100053751 | 3300005456 | Bacteria | 2931 |
| 150 | Ga0070678_100225153 | 3300005456 | Bacteria | 1561 |
| 151 | Ga0070678_100367848 | 3300005456 | Bacteria | 1241 |
| 152 | Ga0070662_100002572 | 3300005457 | Bacteria | 11179 |
| 153 | Ga0070662_100036711 | 3300005457 | Bacteria | 3469 |
| 154 | Ga0070662_100090000 | 3300005457 | Bacteria | 2302 |
| 155 | Ga0070662_100119865 | 3300005457 | Bacteria | 2015 |
| 156 | Ga0070662_100149138 | 3300005457 | Bacteria | 1819 |
| 157 | Ga0070662_100313734 | 3300005457 | Bacteria | 1277 |
| 158 | Ga0070681_10002769 | 3300005458 | Bacteria | 16183 |
| 159 | Ga0070681_10024351 | 3300005458 | Bacteria | 6094 |
| 160 | Ga0070681_10100713 | 3300005458 | Bacteria | 2835 |
| 161 | Ga0068867_100001532 | 3300005459 | Bacteria | 16033 |
| 162 | Ga0068867_100015021 | 3300005459 | Bacteria | 5489 |
| 163 | Ga0068867_100018604 | 3300005459 | Bacteria | 4939 |
| 164 | Ga0068867_100053179 | 3300005459 | Bacteria | 2990 |
| 165 | Ga0068867_100058920 | 3300005459 | Bacteria | 2845 |
| 166 | Ga0068867_100178831 | 3300005459 | Bacteria | 1685 |
| 167 | Ga0068867_100236897 | 3300005459 | Bacteria | 1478 |
| 168 | Ga0070685_10016964 | 3300005466 | Bacteria | 3889 |
| 169 | Ga0070685_10044044 | 3300005466 | Bacteria | 2554 |
| 170 | Ga0070706_100134617 | 3300005467 | Bacteria | 2307 |
| 171 | Ga0070706_100294372 | 3300005467 | Bacteria | 1515 |
| 172 | Ga0070706_100333506 | 3300005467 | Bacteria | 1414 |
| 173 | Ga0070707_100046638 | 3300005468 | Bacteria | 4147 |
| 174 | Ga0070707_100176497 | 3300005468 | Bacteria | 2082 |
| 175 | Ga0070707_100380338 | 3300005468 | Bacteria | 1371 |
| 176 | Ga0070698_100059491 | 3300005471 | Bacteria | 3858 |
| 177 | Ga0070698_100258627 | 3300005471 | Bacteria | 1673 |
| 178 | Ga0070698_100333361 | 3300005471 | Bacteria | 1448 |
| 179 | Ga0070699_100059121 | 3300005518 | Bacteria | 3322 |
| 180 | Ga0070699_100249199 | 3300005518 | Bacteria | 1586 |
| 181 | Ga0070699_100305986 | 3300005518 | Bacteria | 1426 |
| 182 | Ga0070679_100009803 | 3300005530 | Bacteria | 9062 |
| 183 | Ga0070679_100040872 | 3300005530 | Bacteria | 4614 |
| 184 | Ga0070679_100063431 | 3300005530 | Bacteria | 3683 |
| 185 | Ga0070679_100069494 | 3300005530 | Bacteria | 3512 |
| 186 | Ga0070684_100039393 | 3300005535 | Bacteria | 4064 |
| 187 | Ga0070684_100066710 | 3300005535 | Bacteria | 3159 |
| 188 | Ga0070684_100110230 | 3300005535 | Bacteria | 2467 |
| 189 | Ga0070697_100022910 | 3300005536 | Bacteria | 4965 |
| 190 | Ga0070697_100420400 | 3300005536 | Bacteria | 1161 |
| 191 | Ga0068853_100009263 | 3300005539 | Bacteria | 7939 |
| 192 | Ga0068853_100019343 | 3300005539 | Bacteria | 5645 |
| 193 | Ga0068853_100042613 | 3300005539 | Bacteria | 3882 |
| 194 | Ga0068853_100042935 | 3300005539 | Bacteria | 3868 |
| 195 | Ga0068853_100044043 | 3300005539 | Bacteria | 3819 |
| 196 | Ga0068853_100056864 | 3300005539 | Bacteria | 3374 |
| 197 | Ga0068853_100307940 | 3300005539 | Bacteria | 1466 |
| 198 | Ga0070672_100000794 | 3300005543 | Bacteria | 18801 |
| 199 | Ga0070672_100008039 | 3300005543 | Bacteria | 7205 |
| 200 | Ga0070672_100026312 | 3300005543 | Bacteria | 4327 |
| 201 | Ga0070672_100039344 | 3300005543 | Bacteria | 3622 |
| 202 | Ga0070672_100077268 | 3300005543 | Bacteria | 2662 |
| 203 | Ga0070672_100310338 | 3300005543 | Bacteria | 1339 |
| 204 | Ga0070686_100004773 | 3300005544 | Bacteria | 7479 |
| 205 | Ga0070686_100008579 | 3300005544 | Bacteria | 5726 |
| 206 | Ga0070686_100038894 | 3300005544 | Bacteria | 2960 |
| 207 | Ga0070695_100076489 | 3300005545 | Bacteria | 2204 |
| 208 | Ga0070696_100000636 | 3300005546 | Bacteria | 22379 |
| 209 | Ga0070696_100009059 | 3300005546 | Bacteria | 6665 |
| 210 | Ga0070696_100017547 | 3300005546 | Bacteria | 4832 |
| 211 | Ga0070696_100210699 | 3300005546 | Bacteria | 1454 |
| 212 | Ga0070693_100000180 | 3300005547 | Bacteria | 29107 |
| 213 | Ga0070693_100009441 | 3300005547 | Bacteria | 4851 |
| 214 | Ga0070693_100140078 | 3300005547 | Bacteria | 1521 |
| 215 | Ga0070665_100005242 | 3300005548 | Bacteria | 13407 |
| 216 | Ga0070665_100006820 | 3300005548 | Bacteria | 11615 |
| 217 | Ga0070665_100014818 | 3300005548 | Bacteria | 7825 |
| 218 | Ga0070665_100044628 | 3300005548 | Bacteria | 4452 |
| 219 | Ga0070665_100095265 | 3300005548 | Bacteria | 2981 |
| 220 | Ga0070665_100530845 | 3300005548 | Bacteria | 1189 |
| 221 | Ga0070704_100006749 | 3300005549 | Bacteria | 6793 |
| 222 | Ga0070704_100010310 | 3300005549 | Bacteria | 5683 |
| 223 | Ga0070704_100077775 | 3300005549 | Bacteria | 2431 |
| 224 | Ga0070704_100353553 | 3300005549 | Bacteria | 1241 |
| 225 | Ga0068855_100000437 | 3300005563 | Bacteria | 51661 |
| 226 | Ga0068855_100002451 | 3300005563 | Bacteria | 22926 |
| 227 | Ga0068855_100011225 | 3300005563 | Bacteria | 10819 |
| 228 | Ga0068855_100017036 | 3300005563 | Bacteria | 8741 |
| 229 | Ga0068855_100031328 | 3300005563 | Bacteria | 6350 |
| 230 | Ga0068855_100038423 | 3300005563 | Bacteria | 5688 |
| 231 | Ga0068855_100055606 | 3300005563 | Bacteria | 4647 |
| 232 | Ga0068855_100091052 | 3300005563 | Bacteria | 3519 |
| 233 | Ga0068855_100165197 | 3300005563 | Bacteria | 2510 |
| 234 | Ga0068855_100239399 | 3300005563 | Bacteria | 2029 |
| 235 | Ga0070664_100000120 | 3300005564 | Bacteria | 52284 |
| 236 | Ga0070664_100002391 | 3300005564 | Bacteria | 15069 |
| 237 | Ga0070664_100051354 | 3300005564 | Bacteria | 3491 |
| 238 | Ga0070664_100055187 | 3300005564 | Bacteria | 3372 |
| 239 | Ga0070664_100151814 | 3300005564 | Bacteria | 2045 |
| 240 | Ga0070664_100190723 | 3300005564 | Bacteria | 1826 |
| 241 | Ga0068857_100001876 | 3300005577 | Bacteria | 16915 |
| 242 | Ga0068857_100057642 | 3300005577 | Bacteria | 3448 |
| 243 | Ga0068857_100139430 | 3300005577 | Bacteria | 2191 |
| 244 | Ga0068857_100351296 | 3300005577 | Bacteria | 1365 |
| 245 | Ga0068854_100020976 | 3300005578 | Bacteria | 4427 |
| 246 | Ga0068854_100023947 | 3300005578 | Bacteria | 4174 |
| 247 | Ga0068854_100049293 | 3300005578 | Bacteria | 3007 |
| 248 | Ga0068856_100002007 | 3300005614 | Bacteria | 21229 |
| 249 | Ga0068856_100002048 | 3300005614 | Bacteria | 20920 |
| 250 | Ga0068856_100008813 | 3300005614 | Bacteria | 9818 |
| 251 | Ga0068856_100020667 | 3300005614 | Bacteria | 6396 |
| 252 | Ga0068856_100028863 | 3300005614 | Bacteria | 5421 |
| 253 | Ga0070702_100014533 | 3300005615 | Bacteria | 3994 |
| 254 | Ga0070702_100031689 | 3300005615 | Bacteria | 2895 |
| 255 | Ga0070702_100040731 | 3300005615 | Bacteria | 2601 |
| 256 | Ga0068852_100000703 | 3300005616 | Bacteria | 21859 |
| 257 | Ga0068852_100011026 | 3300005616 | Bacteria | 6783 |
| 258 | Ga0068852_100039515 | 3300005616 | Bacteria | 3972 |
| 259 | Ga0068859_100004536 | 3300005617 | Bacteria | 14160 |
| 260 | Ga0068859_100007313 | 3300005617 | Bacteria | 11197 |
| 261 | Ga0068859_100029580 | 3300005617 | Bacteria | 5497 |
| 262 | Ga0068859_100048377 | 3300005617 | Bacteria | 4272 |
| 263 | Ga0068859_100088067 | 3300005617 | Bacteria | 3154 |
| 264 | Ga0068864_100005836 | 3300005618 | Bacteria | 10097 |
| 265 | Ga0068864_100006991 | 3300005618 | Bacteria | 9258 |
| 266 | Ga0068864_100016447 | 3300005618 | Bacteria | 6157 |
| 267 | Ga0068864_100043351 | 3300005618 | Bacteria | 3853 |
| 268 | Ga0068864_100189124 | 3300005618 | Bacteria | 1886 |
| 269 | Ga0068864_100210914 | 3300005618 | Bacteria | 1788 |
| 270 | Ga0068866_10001149 | 3300005718 | Bacteria | 11628 |
| 271 | Ga0068866_10002335 | 3300005718 | Bacteria | 7861 |
| 272 | Ga0068866_10003843 | 3300005718 | Bacteria | 6164 |
| 273 | Ga0068861_100004384 | 3300005719 | Bacteria | 9461 |
| 274 | Ga0068861_100032353 | 3300005719 | Bacteria | 3849 |
| 275 | Ga0068861_100034695 | 3300005719 | Bacteria | 3732 |
| 276 | Ga0068851_10000609 | 3300005834 | Bacteria | 15417 |
| 277 | Ga0068851_10006762 | 3300005834 | Bacteria | 5247 |
| 278 | Ga0068851_10012908 | 3300005834 | Bacteria | 3946 |
| 279 | Ga0068870_10001373 | 3300005840 | Bacteria | 9825 |
| 280 | Ga0068870_10004702 | 3300005840 | Bacteria | 5900 |
| 281 | Ga0068870_10027578 | 3300005840 | Bacteria | 2842 |
| 282 | Ga0068870_10085455 | 3300005840 | Bacteria | 1754 |
| 283 | Ga0068863_100011115 | 3300005841 | Bacteria | 8730 |
| 284 | Ga0068863_100013417 | 3300005841 | Bacteria | 7900 |
| 285 | Ga0068863_100029339 | 3300005841 | Bacteria | 5250 |
| 286 | Ga0068863_100076016 | 3300005841 | Bacteria | 3177 |
| 287 | Ga0068863_100129012 | 3300005841 | Bacteria | 2413 |
| 288 | Ga0068863_100210752 | 3300005841 | Bacteria | 1871 |
| 289 | Ga0068863_100262279 | 3300005841 | Bacteria | 1671 |
| 290 | Ga0068858_100036666 | 3300005842 | Bacteria | 4546 |
| 291 | Ga0068858_100048524 | 3300005842 | Bacteria | 3933 |
| 292 | Ga0068858_100082984 | 3300005842 | Bacteria | 2980 |
| 293 | Ga0068858_100239620 | 3300005842 | Bacteria | 1721 |
| 294 | Ga0068860_100016867 | 3300005843 | Bacteria | 7119 |
| 295 | Ga0068860_100027659 | 3300005843 | Bacteria | 5460 |
| 296 | Ga0068860_100029411 | 3300005843 | Bacteria | 5285 |
| 297 | Ga0068860_100031977 | 3300005843 | Bacteria | 5059 |
| 298 | Ga0068860_100065162 | 3300005843 | Bacteria | 3460 |
| 299 | Ga0068860_100120014 | 3300005843 | Bacteria | 2517 |
| 300 | Ga0068860_100126195 | 3300005843 | Bacteria | 2453 |
| 301 | Ga0068860_100153186 | 3300005843 | Bacteria | 2221 |
| 302 | Ga0068862_100004037 | 3300005844 | Bacteria | 12439 |
| 303 | Ga0068862_100016175 | 3300005844 | Bacteria | 6205 |
| 304 | Ga0068862_100031535 | 3300005844 | Bacteria | 4474 |
| 305 | Ga0068862_100292420 | 3300005844 | Bacteria | 1496 |
| 306 | Ga0081539_10027135 | 3300005985 | Bacteria | 3635 |
| 307 | Ga0070715_10019149 | 3300006163 | Bacteria | 2620 |
| 308 | Ga0070712_100001779 | 3300006175 | Bacteria | 13187 |
| 309 | Ga0070712_100011777 | 3300006175 | Bacteria | 5558 |
| 310 | Ga0070712_100022474 | 3300006175 | Bacteria | 4156 |
| 311 | Ga0070712_100071133 | 3300006175 | Bacteria | 2488 |
| 312 | Ga0097621_100013839 | 3300006237 | Bacteria | 6023 |
| 313 | Ga0097621_100034872 | 3300006237 | Bacteria | 4016 |
| 314 | Ga0097621_100044504 | 3300006237 | Bacteria | 3581 |
| 315 | Ga0097621_100060211 | 3300006237 | Bacteria | 3112 |
| 316 | Ga0097621_100120280 | 3300006237 | Bacteria | 2226 |
| 317 | Ga0097621_100121174 | 3300006237 | Bacteria | 2218 |
| 318 | Ga0068871_100011567 | 3300006358 | Bacteria | 6474 |
| 319 | Ga0068871_100016596 | 3300006358 | Bacteria | 5551 |
| 320 | Ga0068871_100049457 | 3300006358 | Bacteria | 3398 |
| 321 | Ga0068871_100110073 | 3300006358 | Bacteria | 2316 |
| 322 | Ga0068871_100116362 | 3300006358 | Bacteria | 2254 |
| 323 | Ga0068871_100270422 | 3300006358 | Bacteria | 1484 |
| 324 | Ga0068871_100349976 | 3300006358 | Bacteria | 1307 |
| 325 | Ga0075428_100004567 | 3300006844 | Bacteria | 15310 |
| 326 | Ga0075428_100106351 | 3300006844 | Bacteria | 3059 |
| 327 | Ga0075433_10022361 | 3300006852 | Bacteria | 5307 |
| 328 | Ga0075433_10058418 | 3300006852 | Bacteria | 3373 |
| 329 | Ga0075434_100002519 | 3300006871 | Bacteria | 16153 |
| 330 | Ga0075434_100015608 | 3300006871 | Bacteria | 7290 |
| 331 | Ga0075434_100249837 | 3300006871 | Bacteria | 1793 |
| 332 | Ga0075434_100364973 | 3300006871 | Bacteria | 1465 |
| 333 | Ga0075434_100424418 | 3300006871 | Bacteria | 1351 |
| 334 | Ga0075429_100028612 | 3300006880 | Bacteria | 4838 |
| 335 | Ga0068865_100011339 | 3300006881 | Bacteria | 5574 |
| 336 | Ga0068865_100017767 | 3300006881 | Bacteria | 4579 |
| 337 | Ga0068865_100021963 | 3300006881 | Bacteria | 4155 |
| 338 | Ga0068865_100053793 | 3300006881 | Bacteria | 2794 |
| 339 | Ga0068865_100130247 | 3300006881 | Bacteria | 1884 |
| 340 | Ga0068865_100150519 | 3300006881 | Bacteria | 1765 |
| 341 | Ga0068865_100189958 | 3300006881 | Bacteria | 1588 |
| 342 | Ga0075436_100001322 | 3300006914 | Bacteria | 16848 |
| 343 | Ga0075436_100010939 | 3300006914 | Bacteria | 6228 |
| 344 | Ga0075436_100168139 | 3300006914 | Bacteria | 1548 |
| 345 | Ga0097620_100004536 | 3300006931 | Bacteria | 14160 |
| 346 | Ga0097620_100007313 | 3300006931 | Bacteria | 11197 |
| 347 | Ga0097620_100029578 | 3300006931 | Bacteria | 5497 |
| 348 | Ga0097620_100048376 | 3300006931 | Bacteria | 4272 |
| 349 | Ga0097620_100088067 | 3300006931 | Bacteria | 3154 |
| 350 | Ga0075435_100018903 | 3300007076 | Bacteria | 5251 |
| 351 | Ga0075435_100038871 | 3300007076 | Bacteria | 3795 |
| 352 | Ga0075435_100204901 | 3300007076 | Bacteria | 1672 |
| 353 | Ga0105251_10073050 | 3300009011 | Unclassified | 1594 |
| 354 | Ga0105240_10002531 | 3300009093 | Bacteria | 29323 |
| 355 | Ga0105240_10038120 | 3300009093 | Bacteria | 6169 |
| 356 | Ga0111539_10014739 | 3300009094 | Bacteria | 9751 |
| 357 | Ga0111539_10038744 | 3300009094 | Bacteria | 5751 |
| 358 | Ga0111539_10116285 | 3300009094 | Bacteria | 3136 |
| 359 | Ga0111539_10271849 | 3300009094 | Bacteria | 1972 |
| 360 | Ga0111539_10346546 | 3300009094 | Bacteria | 1729 |
| 361 | Ga0105245_10017020 | 3300009098 | Bacteria | 6347 |
| 362 | Ga0105245_10020497 | 3300009098 | Bacteria | 5798 |
| 363 | Ga0105245_10034327 | 3300009098 | Bacteria | 4499 |
| 364 | Ga0105245_10074575 | 3300009098 | Bacteria | 3088 |
| 365 | Ga0105247_10068880 | 3300009101 | Bacteria | 2206 |
| 366 | Ga0105243_10021090 | 3300009148 | Bacteria | 4944 |
| 367 | Ga0105243_10133898 | 3300009148 | Bacteria | 2106 |
| 368 | Ga0105243_10343951 | 3300009148 | Bacteria | 1367 |
| 369 | Ga0105243_10358331 | 3300009148 | Bacteria | 1342 |
| 370 | Ga0105241_10005305 | 3300009174 | Bacteria | 9518 |
| 371 | Ga0105241_10139815 | 3300009174 | Bacteria | 1970 |
| 372 | Ga0105241_10247765 | 3300009174 | Bacteria | 1509 |
| 373 | Ga0105241_10508716 | 3300009174 | Bacteria | 1075 |
| 374 | Ga0105242_10014757 | 3300009176 | Bacteria | 6051 |
| 375 | Ga0105242_10046189 | 3300009176 | Bacteria | 3532 |
| 376 | Ga0105242_10158523 | 3300009176 | Bacteria | 1979 |
| 377 | Ga0105242_10218900 | 3300009176 | Bacteria | 1700 |
| 378 | Ga0105248_10002744 | 3300009177 | Bacteria | 19558 |
| 379 | Ga0105248_10008149 | 3300009177 | Bacteria | 11507 |
| 380 | Ga0105248_10044391 | 3300009177 | Bacteria | 4985 |
| 381 | Ga0105248_10045076 | 3300009177 | Bacteria | 4945 |
| 382 | Ga0105248_10087294 | 3300009177 | Bacteria | 3510 |
| 383 | Ga0105248_10161419 | 3300009177 | Bacteria | 2528 |
| 384 | Ga0105248_10328763 | 3300009177 | Bacteria | 1722 |
| 385 | Ga0105248_10511322 | 3300009177 | Bacteria | 1354 |
| 386 | Ga0105237_10101611 | 3300009545 | Bacteria | 2867 |
| 387 | Ga0105237_10126959 | 3300009545 | Bacteria | 2545 |
| 388 | Ga0105237_10289506 | 3300009545 | Bacteria | 1641 |
| 389 | Ga0105238_10000484 | 3300009551 | Bacteria | 41852 |
| 390 | Ga0105238_10000708 | 3300009551 | Bacteria | 34846 |
| 391 | Ga0105238_10017077 | 3300009551 | Bacteria | 7366 |
| 392 | Ga0105238_10039196 | 3300009551 | Bacteria | 4805 |
| 393 | Ga0105249_10015859 | 3300009553 | Bacteria | 6677 |
| 394 | Ga0105249_10449875 | 3300009553 | Bacteria | 1326 |
| 395 | Ga0105239_10101660 | 3300010375 | Bacteria | 3180 |
| 396 | Ga0105239_10280862 | 3300010375 | Bacteria | 1874 |
| 397 | Ga0105246_10100724 | 3300011119 | Bacteria | 2102 |
| 398 | Ga0157373_10000142 | 3300013100 | Bacteria | 57494 |
| 399 | Ga0157373_10000439 | 3300013100 | Bacteria | 33045 |
| 400 | Ga0157373_10032232 | 3300013100 | Bacteria | 3773 |
| 401 | Ga0157371_10000549 | 3300013102 | Bacteria | 44661 |
| 402 | Ga0157371_10053519 | 3300013102 | Bacteria | 2866 |
| 403 | Ga0157371_10214661 | 3300013102 | Bacteria | 1381 |
| 404 | Ga0157370_10003069 | 3300013104 | Bacteria | 19795 |
| 405 | Ga0157370_10011154 | 3300013104 | Bacteria | 9419 |
| 406 | Ga0157370_10100007 | 3300013104 | Bacteria | 2717 |
| 407 | Ga0157370_10182023 | 3300013104 | Bacteria | 1952 |
| 408 | Ga0157369_10001662 | 3300013105 | Bacteria | 27112 |
| 409 | Ga0157369_10006377 | 3300013105 | Bacteria | 13684 |
| 410 | Ga0157369_10028998 | 3300013105 | Bacteria | 6119 |
| 411 | Ga0157369_10029718 | 3300013105 | Bacteria | 6036 |
| 412 | Ga0157369_10045116 | 3300013105 | Bacteria | 4796 |
| 413 | Ga0157369_10057558 | 3300013105 | Bacteria | 4194 |
| 414 | Ga0157369_10058838 | 3300013105 | Bacteria | 4145 |
| 415 | Ga0157369_10060917 | 3300013105 | Bacteria | 4069 |
| 416 | Ga0157369_10084262 | 3300013105 | Bacteria | 3398 |
| 417 | Ga0157369_10426383 | 3300013105 | Bacteria | 1375 |
| 418 | Ga0157374_10046348 | 3300013296 | Bacteria | 4026 |
| 419 | Ga0157374_10054076 | 3300013296 | Bacteria | 3744 |
| 420 | Ga0157374_10126874 | 3300013296 | Bacteria | 2467 |
| 421 | Ga0157378_10018814 | 3300013297 | Bacteria | 6072 |
| 422 | Ga0157378_10019026 | 3300013297 | Bacteria | 6035 |
| 423 | Ga0157378_10026831 | 3300013297 | Bacteria | 5079 |
| 424 | Ga0157378_10047198 | 3300013297 | Bacteria | 3828 |
| 425 | Ga0157378_10111197 | 3300013297 | Bacteria | 2512 |
| 426 | Ga0157378_10547524 | 3300013297 | Bacteria | 1162 |
| 427 | Ga0163162_10042407 | 3300013306 | Bacteria | 4554 |
| 428 | Ga0163162_10045176 | 3300013306 | Bacteria | 4413 |
| 429 | Ga0163162_10052417 | 3300013306 | Bacteria | 4097 |
| 430 | Ga0163162_10068889 | 3300013306 | Bacteria | 3590 |
| 431 | Ga0163162_10257476 | 3300013306 | Bacteria | 1877 |
| 432 | Ga0157372_10002118 | 3300013307 | Bacteria | 21583 |
| 433 | Ga0157372_10002963 | 3300013307 | Bacteria | 18296 |
| 434 | Ga0157372_10003796 | 3300013307 | Bacteria | 16219 |
| 435 | Ga0157372_10009842 | 3300013307 | Bacteria | 10171 |
| 436 | Ga0157372_10010340 | 3300013307 | Bacteria | 9916 |
| 437 | Ga0157372_10024655 | 3300013307 | Bacteria | 6538 |
| 438 | Ga0157372_10048759 | 3300013307 | Bacteria | 4708 |
| 439 | Ga0157372_10093600 | 3300013307 | Bacteria | 3420 |
| 440 | Ga0157372_10328567 | 3300013307 | Bacteria | 1780 |
| 441 | Ga0157372_10663931 | 3300013307 | Bacteria | 1214 |
| 442 | Ga0157375_10008096 | 3300013308 | Bacteria | 9196 |
| 443 | Ga0157375_10028562 | 3300013308 | Bacteria | 5231 |
| 444 | Ga0157375_10060084 | 3300013308 | Bacteria | 3768 |
| 445 | Ga0157375_10171735 | 3300013308 | Bacteria | 2316 |
| 446 | Ga0157375_10270773 | 3300013308 | Bacteria | 1860 |
| 447 | Ga0163163_10032631 | 3300014325 | Bacteria | 5031 |
| 448 | Ga0163163_10051112 | 3300014325 | Bacteria | 4074 |
| 449 | Ga0157380_10038030 | 3300014326 | Bacteria | 3734 |
| 450 | Ga0157380_10048709 | 3300014326 | Bacteria | 3339 |
| 451 | Ga0157380_10177112 | 3300014326 | Bacteria | 1870 |
| 452 | Ga0157380_10360782 | 3300014326 | Bacteria | 1363 |
| 453 | Ga0182008_10049535 | 3300014497 | Bacteria | 2085 |
| 454 | Ga0157377_10008365 | 3300014745 | Bacteria | 5044 |
| 455 | Ga0157377_10135560 | 3300014745 | Bacteria | 1508 |
| 456 | Ga0157379_10007045 | 3300014968 | Bacteria | 9716 |
| 457 | Ga0157379_10039514 | 3300014968 | Bacteria | 4209 |
| 458 | Ga0157379_10366795 | 3300014968 | Bacteria | 1320 |
| 459 | Ga0157376_10009267 | 3300014969 | Bacteria | 7146 |
| 460 | Ga0157376_10024405 | 3300014969 | Bacteria | 4746 |
| 461 | Ga0157376_10056995 | 3300014969 | Bacteria | 3267 |
| 462 | Ga0157376_10097230 | 3300014969 | Bacteria | 2564 |
| 463 | Ga0157376_10172143 | 3300014969 | Bacteria | 1973 |
| 464 | Ga0157376_10205247 | 3300014969 | Bacteria | 1816 |
| 465 | Ga0157376_10574276 | 3300014969 | Bacteria | 1119 |
| 466 | Ga0163161_10011199 | 3300017792 | Bacteria | 6213 |
| 467 | Ga0163161_10102395 | 3300017792 | Bacteria | 2132 |
| 468 | Ga0163161_10103349 | 3300017792 | Bacteria | 2123 |
| 469 | Ga0163161_10277412 | 3300017792 | Bacteria | 1314 |
| 470 | Ga0209672_100021 | 3300025228 | Bacteria | 428473 |
| 471 | Ga0209147_100025 | 3300025229 | Bacteria | 428473 |
| 472 | Ga0207427_101253 | 3300025231 | Bacteria | 9734 |
| 473 | Ga0209258_100037 | 3300025242 | Bacteria | 428473 |
| 474 | Ga0209148_1000049 | 3300025254 | Bacteria | 428473 |
| 475 | Ga0209233_1000091 | 3300025261 | Bacteria | 309402 |
| 476 | Ga0207666_1007935 | 3300025271 | Bacteria | 1409 |
| 477 | Ga0209455_1000041 | 3300025272 | Bacteria | 428473 |
| 478 | Ga0207697_10000771 | 3300025315 | Bacteria | 18159 |
| 479 | Ga0207697_10022755 | 3300025315 | Bacteria | 2566 |
| 480 | Ga0207656_10037973 | 3300025321 | Bacteria | 2029 |
| 481 | Ga0207656_10061372 | 3300025321 | Bacteria | 1650 |
| 482 | Ga0207656_10116215 | 3300025321 | Bacteria | 1241 |
| 483 | Ga0207653_10003878 | 3300025885 | Bacteria | 4701 |
| 484 | Ga0207653_10023147 | 3300025885 | Bacteria | 1977 |
| 485 | Ga0207682_10000061 | 3300025893 | Bacteria | 46850 |
| 486 | Ga0207682_10001382 | 3300025893 | Bacteria | 11198 |
| 487 | Ga0207692_10002535 | 3300025898 | Bacteria | 7012 |
| 488 | Ga0207692_10003513 | 3300025898 | Bacteria | 6132 |
| 489 | Ga0207642_10002972 | 3300025899 | Bacteria | 5305 |
| 490 | Ga0207642_10003792 | 3300025899 | Bacteria | 4815 |
| 491 | Ga0207642_10034580 | 3300025899 | Bacteria | 2150 |
| 492 | Ga0207710_10012018 | 3300025900 | Bacteria | 3640 |
| 493 | Ga0207688_10000524 | 3300025901 | Bacteria | 18570 |
| 494 | Ga0207688_10044878 | 3300025901 | Bacteria | 2464 |
| 495 | Ga0207680_10020342 | 3300025903 | Bacteria | 3569 |
| 496 | Ga0207680_10024123 | 3300025903 | Bacteria | 3333 |
| 497 | Ga0207680_10044079 | 3300025903 | Bacteria | 2621 |
| 498 | Ga0207680_10047484 | 3300025903 | Bacteria | 2544 |
| 499 | Ga0207680_10062397 | 3300025903 | Bacteria | 2277 |
| 500 | Ga0207647_10001055 | 3300025904 | Bacteria | 21220 |
| 501 | Ga0207685_10044182 | 3300025905 | Bacteria | 1683 |
| 502 | Ga0207699_10043946 | 3300025906 | Bacteria | 2599 |
| 503 | Ga0207699_10269112 | 3300025906 | Bacteria | 1180 |
| 504 | Ga0207645_10000143 | 3300025907 | Bacteria | 55663 |
| 505 | Ga0207645_10003306 | 3300025907 | Bacteria | 12299 |
| 506 | Ga0207645_10052410 | 3300025907 | Bacteria | 2607 |
| 507 | Ga0207645_10055232 | 3300025907 | Bacteria | 2535 |
| 508 | Ga0207643_10000189 | 3300025908 | Bacteria | 42432 |
| 509 | Ga0207643_10000632 | 3300025908 | Bacteria | 22134 |
| 510 | Ga0207643_10019153 | 3300025908 | Bacteria | 3750 |
| 511 | Ga0207643_10022641 | 3300025908 | Bacteria | 3461 |
| 512 | Ga0207705_10015818 | 3300025909 | Bacteria | 5418 |
| 513 | Ga0207705_10052673 | 3300025909 | Bacteria | 2931 |
| 514 | Ga0207705_10143446 | 3300025909 | Bacteria | 1785 |
| 515 | Ga0207684_10065825 | 3300025910 | Bacteria | 3077 |
| 516 | Ga0207654_10041807 | 3300025911 | Bacteria | 2590 |
| 517 | Ga0207654_10044322 | 3300025911 | Bacteria | 2526 |
| 518 | Ga0207654_10143878 | 3300025911 | Bacteria | 1524 |
| 519 | Ga0207707_10000305 | 3300025912 | Bacteria | 51662 |
| 520 | Ga0207707_10014131 | 3300025912 | Bacteria | 6957 |
| 521 | Ga0207707_10020405 | 3300025912 | Bacteria | 5787 |
| 522 | Ga0207707_10189322 | 3300025912 | Bacteria | 1795 |
| 523 | Ga0207695_10074702 | 3300025913 | Bacteria | 3451 |
| 524 | Ga0207695_10088402 | 3300025913 | Bacteria | 3119 |
| 525 | Ga0207695_10092785 | 3300025913 | Bacteria | 3029 |
| 526 | Ga0207695_10223022 | 3300025913 | Bacteria | 1792 |
| 527 | Ga0207695_10362570 | 3300025913 | Bacteria | 1336 |
| 528 | Ga0207671_10039603 | 3300025914 | Bacteria | 3489 |
| 529 | Ga0207693_10000605 | 3300025915 | Bacteria | 32124 |
| 530 | Ga0207693_10011952 | 3300025915 | Bacteria | 7019 |
| 531 | Ga0207663_10008229 | 3300025916 | Bacteria | 5443 |
| 532 | Ga0207660_10001522 | 3300025917 | Bacteria | 15576 |
| 533 | Ga0207660_10031002 | 3300025917 | Bacteria | 3679 |
| 534 | Ga0207660_10052593 | 3300025917 | Bacteria | 2900 |
| 535 | Ga0207662_10000111 | 3300025918 | Bacteria | 38905 |
| 536 | Ga0207662_10008136 | 3300025918 | Bacteria | 5733 |
| 537 | Ga0207662_10016468 | 3300025918 | Bacteria | 4172 |
| 538 | Ga0207662_10144512 | 3300025918 | Bacteria | 1509 |
| 539 | Ga0207657_10000236 | 3300025919 | Bacteria | 58234 |
| 540 | Ga0207657_10000341 | 3300025919 | Bacteria | 49504 |
| 541 | Ga0207657_10001274 | 3300025919 | Bacteria | 26860 |
| 542 | Ga0207657_10136772 | 3300025919 | Bacteria | 2004 |
| 543 | Ga0207649_10003765 | 3300025920 | Bacteria | 8274 |
| 544 | Ga0207649_10007510 | 3300025920 | Bacteria | 5925 |
| 545 | Ga0207649_10033132 | 3300025920 | Bacteria | 3085 |
| 546 | Ga0207649_10117584 | 3300025920 | Bacteria | 1787 |
| 547 | Ga0207652_10000572 | 3300025921 | Bacteria | 37038 |
| 548 | Ga0207652_10073713 | 3300025921 | Bacteria | 2971 |
| 549 | Ga0207652_10078209 | 3300025921 | Bacteria | 2888 |
| 550 | Ga0207652_10089964 | 3300025921 | Bacteria | 2696 |
| 551 | Ga0207652_10337729 | 3300025921 | Bacteria | 1360 |
| 552 | Ga0207652_10438853 | 3300025921 | Bacteria | 1177 |
| 553 | Ga0207646_10037621 | 3300025922 | Bacteria | 4362 |
| 554 | Ga0207681_10041390 | 3300025923 | Bacteria | 3071 |
| 555 | Ga0207681_10124618 | 3300025923 | Bacteria | 1895 |
| 556 | Ga0207681_10142951 | 3300025923 | Bacteria | 1784 |
| 557 | Ga0207681_10190078 | 3300025923 | Bacteria | 1570 |
| 558 | Ga0207681_10320574 | 3300025923 | Bacteria | 1232 |
| 559 | Ga0207694_10002559 | 3300025924 | Bacteria | 14754 |
| 560 | Ga0207694_10016977 | 3300025924 | Bacteria | 5498 |
| 561 | Ga0207694_10067079 | 3300025924 | Bacteria | 2800 |
| 562 | Ga0207650_10006656 | 3300025925 | Bacteria | 7882 |
| 563 | Ga0207650_10021348 | 3300025925 | Bacteria | 4575 |
| 564 | Ga0207650_10032547 | 3300025925 | Bacteria | 3771 |
| 565 | Ga0207650_10052022 | 3300025925 | Bacteria | 3033 |
| 566 | Ga0207650_10125870 | 3300025925 | Bacteria | 2000 |
| 567 | Ga0207650_10182762 | 3300025925 | Bacteria | 1672 |
| 568 | Ga0207650_10215442 | 3300025925 | Bacteria | 1544 |
| 569 | Ga0207659_10001702 | 3300025926 | Bacteria | 13047 |
| 570 | Ga0207659_10001717 | 3300025926 | Bacteria | 13001 |
| 571 | Ga0207659_10048407 | 3300025926 | Bacteria | 3011 |
| 572 | Ga0207659_10101516 | 3300025926 | Bacteria | 2170 |
| 573 | Ga0207659_10162659 | 3300025926 | Bacteria | 1754 |
| 574 | Ga0207659_10281472 | 3300025926 | Bacteria | 1360 |
| 575 | Ga0207687_10009538 | 3300025927 | Bacteria | 6349 |
| 576 | Ga0207687_10012063 | 3300025927 | Bacteria | 5652 |
| 577 | Ga0207687_10332628 | 3300025927 | Bacteria | 1233 |
| 578 | Ga0207700_10003435 | 3300025928 | Bacteria | 9209 |
| 579 | Ga0207700_10024869 | 3300025928 | Bacteria | 4150 |
| 580 | Ga0207700_10039165 | 3300025928 | Bacteria | 3447 |
| 581 | Ga0207700_10055501 | 3300025928 | Bacteria | 2978 |
| 582 | Ga0207700_10201327 | 3300025928 | Bacteria | 1678 |
| 583 | Ga0207664_10003607 | 3300025929 | Bacteria | 10358 |
| 584 | Ga0207664_10003667 | 3300025929 | Bacteria | 10289 |
| 585 | Ga0207664_10190681 | 3300025929 | Bacteria | 1764 |
| 586 | Ga0207664_10204825 | 3300025929 | Bacteria | 1705 |
| 587 | Ga0207664_10397816 | 3300025929 | Bacteria | 1225 |
| 588 | Ga0207644_10003631 | 3300025931 | Bacteria | 10006 |
| 589 | Ga0207644_10004584 | 3300025931 | Bacteria | 8987 |
| 590 | Ga0207644_10006445 | 3300025931 | Bacteria | 7649 |
| 591 | Ga0207644_10016308 | 3300025931 | Bacteria | 4998 |
| 592 | Ga0207644_10050891 | 3300025931 | Bacteria | 2971 |
| 593 | Ga0207644_10078561 | 3300025931 | Bacteria | 2432 |
| 594 | Ga0207644_10106862 | 3300025931 | Bacteria | 2110 |
| 595 | Ga0207644_10282982 | 3300025931 | Bacteria | 1332 |
| 596 | Ga0207690_10002016 | 3300025932 | Bacteria | 12445 |
| 597 | Ga0207690_10004905 | 3300025932 | Bacteria | 7894 |
| 598 | Ga0207690_10030443 | 3300025932 | Bacteria | 3443 |
| 599 | Ga0207690_10295821 | 3300025932 | Bacteria | 1265 |
| 600 | Ga0207690_10325146 | 3300025932 | Bacteria | 1210 |
| 601 | Ga0207706_10000037 | 3300025933 | Bacteria | 132826 |
| 602 | Ga0207706_10002271 | 3300025933 | Bacteria | 18768 |
| 603 | Ga0207706_10002346 | 3300025933 | Bacteria | 18486 |
| 604 | Ga0207706_10045007 | 3300025933 | Bacteria | 3910 |
| 605 | Ga0207706_10221465 | 3300025933 | Bacteria | 1657 |
| 606 | Ga0207706_10237589 | 3300025933 | Bacteria | 1593 |
| 607 | Ga0207686_10000645 | 3300025934 | Bacteria | 21468 |
| 608 | Ga0207686_10017623 | 3300025934 | Bacteria | 4028 |
| 609 | Ga0207709_10080601 | 3300025935 | Bacteria | 2097 |
| 610 | Ga0207709_10224111 | 3300025935 | Bacteria | 1358 |
| 611 | Ga0207670_10060956 | 3300025936 | Bacteria | 2572 |
| 612 | Ga0207669_10008113 | 3300025937 | Bacteria | 4911 |
| 613 | Ga0207669_10017690 | 3300025937 | Bacteria | 3663 |
| 614 | Ga0207669_10073018 | 3300025937 | Bacteria | 2163 |
| 615 | Ga0207704_10007762 | 3300025938 | Bacteria | 5089 |
| 616 | Ga0207704_10028961 | 3300025938 | Bacteria | 3081 |
| 617 | Ga0207704_10070616 | 3300025938 | Bacteria | 2212 |
| 618 | Ga0207704_10107114 | 3300025938 | Bacteria | 1879 |
| 619 | Ga0207704_10123080 | 3300025938 | Bacteria | 1780 |
| 620 | Ga0207665_10015015 | 3300025939 | Bacteria | 5087 |
| 621 | Ga0207665_10100732 | 3300025939 | Bacteria | 2016 |
| 622 | Ga0207691_10000016 | 3300025940 | Bacteria | 141024 |
| 623 | Ga0207691_10005729 | 3300025940 | Bacteria | 12011 |
| 624 | Ga0207691_10017461 | 3300025940 | Bacteria | 6804 |
| 625 | Ga0207691_10042719 | 3300025940 | Bacteria | 4178 |
| 626 | Ga0207691_10125321 | 3300025940 | Bacteria | 2273 |
| 627 | Ga0207691_10128007 | 3300025940 | Bacteria | 2245 |
| 628 | Ga0207691_10165735 | 3300025940 | Bacteria | 1937 |
| 629 | Ga0207691_10233853 | 3300025940 | Bacteria | 1591 |
| 630 | Ga0207691_10268575 | 3300025940 | Bacteria | 1469 |
| 631 | Ga0207711_10009671 | 3300025941 | Bacteria | 8033 |
| 632 | Ga0207711_10017357 | 3300025941 | Bacteria | 5979 |
| 633 | Ga0207711_10023334 | 3300025941 | Bacteria | 5178 |
| 634 | Ga0207711_10125413 | 3300025941 | Bacteria | 2296 |
| 635 | Ga0207711_10356136 | 3300025941 | Bacteria | 1355 |
| 636 | Ga0207711_10425171 | 3300025941 | Bacteria | 1236 |
| 637 | Ga0207689_10000870 | 3300025942 | Bacteria | 29137 |
| 638 | Ga0207689_10004636 | 3300025942 | Bacteria | 12438 |
| 639 | Ga0207689_10056631 | 3300025942 | Bacteria | 3226 |
| 640 | Ga0207689_10158417 | 3300025942 | Bacteria | 1866 |
| 641 | Ga0207679_10001850 | 3300025945 | Bacteria | 13151 |
| 642 | Ga0207679_10003252 | 3300025945 | Bacteria | 10037 |
| 643 | Ga0207679_10016532 | 3300025945 | Bacteria | 4903 |
| 644 | Ga0207679_10091393 | 3300025945 | Bacteria | 2356 |
| 645 | Ga0207667_10008179 | 3300025949 | Bacteria | 12444 |
| 646 | Ga0207667_10013261 | 3300025949 | Bacteria | 9445 |
| 647 | Ga0207667_10016005 | 3300025949 | Bacteria | 8491 |
| 648 | Ga0207667_10023196 | 3300025949 | Bacteria | 6834 |
| 649 | Ga0207667_10049453 | 3300025949 | Bacteria | 4440 |
| 650 | Ga0207667_10131664 | 3300025949 | Bacteria | 2576 |
| 651 | Ga0207667_10207472 | 3300025949 | Bacteria | 2009 |
| 652 | Ga0207667_10252738 | 3300025949 | Bacteria | 1803 |
| 653 | Ga0207651_10011174 | 3300025960 | Bacteria | 5013 |
| 654 | Ga0207651_10018254 | 3300025960 | Bacteria | 4168 |
| 655 | Ga0207651_10052906 | 3300025960 | Bacteria | 2771 |
| 656 | Ga0207651_10066847 | 3300025960 | Bacteria | 2527 |
| 657 | Ga0207651_10072307 | 3300025960 | Bacteria | 2448 |
| 658 | Ga0207651_10076859 | 3300025960 | Bacteria | 2388 |
| 659 | Ga0207712_10215548 | 3300025961 | Bacteria | 1532 |
| 660 | Ga0207668_10043134 | 3300025972 | Bacteria | 3059 |
| 661 | Ga0207668_10052977 | 3300025972 | Bacteria | 2810 |
| 662 | Ga0207668_10054958 | 3300025972 | Bacteria | 2765 |
| 663 | Ga0207668_10176463 | 3300025972 | Bacteria | 1681 |
| 664 | Ga0207640_10046566 | 3300025981 | Bacteria | 2791 |
| 665 | Ga0207640_10172372 | 3300025981 | Bacteria | 1614 |
| 666 | Ga0207640_10286805 | 3300025981 | Bacteria | 1296 |
| 667 | Ga0207658_10001061 | 3300025986 | Bacteria | 22224 |
| 668 | Ga0207658_10016693 | 3300025986 | Bacteria | 5053 |
| 669 | Ga0207658_10016917 | 3300025986 | Bacteria | 5019 |
| 670 | Ga0207658_10035560 | 3300025986 | Bacteria | 3568 |
| 671 | Ga0207658_10036349 | 3300025986 | Bacteria | 3530 |
| 672 | Ga0207658_10052140 | 3300025986 | Bacteria | 3018 |
| 673 | Ga0207658_10355730 | 3300025986 | Bacteria | 1276 |
| 674 | Ga0207677_10000384 | 3300026023 | Bacteria | 30510 |
| 675 | Ga0207677_10002748 | 3300026023 | Bacteria | 9283 |
| 676 | Ga0207677_10057180 | 3300026023 | Bacteria | 2677 |
| 677 | Ga0207677_10101504 | 3300026023 | Bacteria | 2118 |
| 678 | Ga0207677_10101837 | 3300026023 | Bacteria | 2116 |
| 679 | Ga0207677_10103963 | 3300026023 | Bacteria | 2098 |
| 680 | Ga0207677_10188900 | 3300026023 | Bacteria | 1628 |
| 681 | Ga0207677_10416425 | 3300026023 | Bacteria | 1143 |
| 682 | Ga0207703_10000559 | 3300026035 | Bacteria | 38247 |
| 683 | Ga0207703_10006066 | 3300026035 | Bacteria | 9665 |
| 684 | Ga0207703_10059324 | 3300026035 | Bacteria | 3125 |
| 685 | Ga0207703_10112800 | 3300026035 | Bacteria | 2323 |
| 686 | Ga0207703_10195956 | 3300026035 | Bacteria | 1792 |
| 687 | Ga0207639_10006119 | 3300026041 | Bacteria | 8167 |
| 688 | Ga0207639_10010013 | 3300026041 | Bacteria | 6554 |
| 689 | Ga0207639_10021047 | 3300026041 | Bacteria | 4679 |
| 690 | Ga0207639_10041646 | 3300026041 | Bacteria | 3438 |
| 691 | Ga0207639_10224921 | 3300026041 | Bacteria | 1623 |
| 692 | Ga0207639_10291402 | 3300026041 | Bacteria | 1439 |
| 693 | Ga0207639_10455095 | 3300026041 | Bacteria | 1162 |
| 694 | Ga0207678_10001044 | 3300026067 | Bacteria | 25314 |
| 695 | Ga0207678_10109464 | 3300026067 | Bacteria | 2356 |
| 696 | Ga0207708_10002020 | 3300026075 | Bacteria | 14954 |
| 697 | Ga0207708_10002481 | 3300026075 | Bacteria | 13573 |
| 698 | Ga0207702_10001008 | 3300026078 | Bacteria | 28905 |
| 699 | Ga0207702_10002619 | 3300026078 | Bacteria | 16908 |
| 700 | Ga0207702_10002815 | 3300026078 | Bacteria | 16274 |
| 701 | Ga0207702_10003232 | 3300026078 | Bacteria | 15057 |
| 702 | Ga0207702_10005727 | 3300026078 | Bacteria | 10828 |
| 703 | Ga0207702_10011001 | 3300026078 | Bacteria | 7548 |
| 704 | Ga0207702_10103108 | 3300026078 | Bacteria | 2523 |
| 705 | Ga0207702_10139585 | 3300026078 | Bacteria | 2191 |
| 706 | Ga0207641_10005288 | 3300026088 | Bacteria | 11030 |
| 707 | Ga0207641_10011902 | 3300026088 | Bacteria | 7137 |
| 708 | Ga0207641_10026296 | 3300026088 | Bacteria | 4802 |
| 709 | Ga0207641_10032429 | 3300026088 | Bacteria | 4337 |
| 710 | Ga0207641_10040931 | 3300026088 | Bacteria | 3882 |
| 711 | Ga0207641_10189247 | 3300026088 | Bacteria | 1890 |
| 712 | Ga0207641_10365618 | 3300026088 | Bacteria | 1378 |
| 713 | Ga0207648_10001798 | 3300026089 | Bacteria | 23490 |
| 714 | Ga0207648_10007158 | 3300026089 | Bacteria | 10998 |
| 715 | Ga0207648_10010994 | 3300026089 | Bacteria | 8546 |
| 716 | Ga0207648_10014010 | 3300026089 | Bacteria | 7429 |
| 717 | Ga0207648_10018464 | 3300026089 | Bacteria | 6313 |
| 718 | Ga0207648_10020027 | 3300026089 | Bacteria | 6035 |
| 719 | Ga0207648_10151795 | 3300026089 | Bacteria | 2044 |
| 720 | Ga0207676_10000680 | 3300026095 | Bacteria | 27065 |
| 721 | Ga0207676_10007971 | 3300026095 | Bacteria | 7529 |
| 722 | Ga0207676_10011804 | 3300026095 | Bacteria | 6250 |
| 723 | Ga0207676_10079615 | 3300026095 | Bacteria | 2657 |
| 724 | Ga0207676_10106271 | 3300026095 | Bacteria | 2338 |
| 725 | Ga0207676_10183509 | 3300026095 | Bacteria | 1834 |
| 726 | Ga0207674_10000040 | 3300026116 | Bacteria | 130571 |
| 727 | Ga0207674_10000170 | 3300026116 | Bacteria | 78770 |
| 728 | Ga0207674_10011703 | 3300026116 | Bacteria | 9848 |
| 729 | Ga0207674_10041640 | 3300026116 | Bacteria | 4748 |
| 730 | Ga0207674_10409236 | 3300026116 | Bacteria | 1311 |
| 731 | Ga0207675_100005496 | 3300026118 | Bacteria | 12131 |
| 732 | Ga0207675_100008544 | 3300026118 | Bacteria | 9630 |
| 733 | Ga0207675_100011565 | 3300026118 | Bacteria | 8252 |
| 734 | Ga0207675_100017185 | 3300026118 | Bacteria | 6756 |
| 735 | Ga0207675_100019790 | 3300026118 | Bacteria | 6282 |
| 736 | Ga0207675_100036156 | 3300026118 | Bacteria | 4606 |
| 737 | Ga0207683_10000322 | 3300026121 | Bacteria | 43758 |
| 738 | Ga0207683_10000509 | 3300026121 | Bacteria | 35855 |
| 739 | Ga0207683_10003454 | 3300026121 | Bacteria | 13782 |
| 740 | Ga0207683_10005325 | 3300026121 | Bacteria | 11035 |
| 741 | Ga0207683_10025973 | 3300026121 | Bacteria | 5056 |
| 742 | Ga0207683_10046212 | 3300026121 | Bacteria | 3809 |
| 743 | Ga0207683_10119581 | 3300026121 | Bacteria | 2364 |
| 744 | Ga0207683_10173692 | 3300026121 | Bacteria | 1952 |
| 745 | Ga0207698_10000642 | 3300026142 | Bacteria | 20202 |
| 746 | Ga0207698_10003296 | 3300026142 | Bacteria | 9706 |
| 747 | Ga0207698_10010650 | 3300026142 | Bacteria | 5926 |
| 748 | Ga0207698_10034612 | 3300026142 | Bacteria | 3684 |
| 749 | Ga0207698_10135576 | 3300026142 | Bacteria | 2112 |
| 750 | Ga0207698_10380427 | 3300026142 | Bacteria | 1343 |
| 751 | Ga0207698_10384677 | 3300026142 | Bacteria | 1336 |
| 752 | Ga0207428_10003126 | 3300027907 | Bacteria | 16236 |
| 753 | Ga0207428_10079983 | 3300027907 | Bacteria | 2554 |
| 754 | Ga0268266_10022455 | 3300028379 | Bacteria | 5376 |
| 755 | Ga0268266_10134616 | 3300028379 | Bacteria | 2212 |
| 756 | Ga0268266_10580730 | 3300028379 | Bacteria | 1075 |
| 757 | Ga0268265_10004602 | 3300028380 | Bacteria | 9534 |
| 758 | Ga0268265_10020997 | 3300028380 | Bacteria | 4566 |
| 759 | Ga0268265_10021151 | 3300028380 | Bacteria | 4552 |
| 760 | Ga0268265_10038320 | 3300028380 | Bacteria | 3525 |
| 761 | Ga0268264_10004968 | 3300028381 | Bacteria | 11267 |
| 762 | Ga0268264_10008834 | 3300028381 | Bacteria | 8351 |
| 763 | Ga0268264_10018827 | 3300028381 | Bacteria | 5646 |
| 764 | Ga0268264_10021400 | 3300028381 | Bacteria | 5281 |
| 765 | Ga0268264_10048059 | 3300028381 | Bacteria | 3548 |
| 766 | Ga0268264_10156033 | 3300028381 | Bacteria | 2051 |
| 767 | Ga0268264_10230150 | 3300028381 | Bacteria | 1711 |
| 768 | Ga0265314_10053352 | 3300031711 | Bacteria | 2804 |
| 769 | Ga0307411_10367748 | 3300032005 | Bacteria | 1178 |
| 770 | Ga0373934_0010053 | 3300035086 | Bacteria | 3551 |
| 771 | Ga0373940_0011064 | 3300035088 | Bacteria | 2136 |
| 772 | Ga0373923_0020985 | 3300035111 | Bacteria | 2545 |
| 773 | Ga0373953_0004854 | 3300035117 | Bacteria | 4321 |
| 774 | Ga0373954_0002489 | 3300035118 | Bacteria | 7729 |
| 775 | Ga0373956_0087017 | 3300035119 | Bacteria | 1438 |
| 776 | Ga0373943_0008311 | 3300035170 | Bacteria | 4658 |
| 777 | Ga0373946_0046071 | 3300035171 | Bacteria | 1806 |
| 778 | Ga0373942_0026979 | 3300035207 | Bacteria | 1491 |
| 779 | Ga0373962_0031480 | 3300035242 | Bacteria | 1455 |
| 780 | Ga0373924_0092415 | 3300035410 | Bacteria | 1296 |
| 781 | Ga0373931_0007359 | 3300035691 | Bacteria | 5183 |
| 782 | Ga0373931_0142592 | 3300035691 | Bacteria | 1389 |
| 783 | Ga0373927_0015750 | 3300035695 | Bacteria | 4991 |
| 784 | Ga0373927_0079068 | 3300035695 | Bacteria | 2130 |
| 785 | Ga0373933_0112349 | 3300035724 | Bacteria | 1700 |
| 786 | Ga0373947_0083805 | 3300035725 | Bacteria | 1977 |
| 787 | Ga0373937_0008460 | 3300036401 | Bacteria | 8943 |
| 788 | Ga0373937_0036536 | 3300036401 | Bacteria | 4477 |
| 789 | Ga0373937_0064536 | 3300036401 | Bacteria | 3368 |
| 790 | Ga0373937_0075441 | 3300036401 | Bacteria | 3113 |
| 791 | Ga0373937_0227554 | 3300036401 | Bacteria | 1756 |
| 792 | Ga0373937_0407894 | 3300036401 | Bacteria | 1289 |
| 793 | Ga0373925_0017777 | 3300037068 | Bacteria | 5159 |
| 794 | Ga0373925_0132538 | 3300037068 | Bacteria | 1944 |
| 795 | Ga0395900_0016897 | 3300037418 | Bacteria | 7449 |
| 796 | Ga0395905_0049773 | 3300037471 | Bacteria | 3928 |
| 797 | Ga0436364_1025804 | 3300037853 | Bacteria | 2644 |
| 798 | Ga0439465_0062802 | 3300041413 | Bacteria | 1233 |
| 799 | Ga0439462_0036859 | 3300042015 | Bacteria | 1302 |
| 800 | Ga0439459_0001956 | 3300042438 | Bacteria | 3129 |
| 801 | Ga0451577_0003232 | 3300042876 | Bacteria | 18320 |
| 802 | Ga0451577_0064526 | 3300042876 | Bacteria | 3265 |
| 803 | Ga0451577_0150408 | 3300042876 | Bacteria | 2095 |
| 804 | Ga0451577_0220672 | 3300042876 | Bacteria | 1714 |
| 805 | Ga0466963_0228293 | 3300044694 | Bacteria | 1304 |
| 806 | Ga0453684_0055553 | 3300044712 | Bacteria | 5147 |
| 807 | Ga0453684_0236026 | 3300044712 | Bacteria | 2108 |
| 808 | Ga0451576_0067687 | 3300045051 | Bacteria | 3717 |
| 809 | Ga0451576_0139213 | 3300045051 | Bacteria | 2531 |
| 810 | Ga0495580_0224142 | 3300046472 | Bacteria | 1291 |
| 811 | Ga0495662_0165348 | 3300046476 | Bacteria | 1090 |
| 812 | Ga0495584_0000168 | 3300046491 | Bacteria | 46140 |
| 813 | Ga0495628_0230400 | 3300046516 | Bacteria | 1389 |
| 814 | Ga0495663_0022905 | 3300046525 | Bacteria | 1807 |
| 815 | Ga0495587_0064135 | 3300046536 | Bacteria | 2147 |
| 816 | Ga0495621_0006382 | 3300046539 | Bacteria | 3440 |
| 817 | Ga0495667_0137195 | 3300046559 | Bacteria | 1577 |
| 818 | Ga0495635_0266289 | 3300046663 | Bacteria | 1153 |
| 819 | Ga0495623_0115052 | 3300046679 | Bacteria | 1626 |
| 820 | Ga0495658_0130767 | 3300046683 | Bacteria | 1528 |
| 821 | Ga0495624_0010270 | 3300046690 | Bacteria | 6452 |
| 822 | Ga0495674_0001621 | 3300047319 | Bacteria | 22068 |
| 823 | Ga0495676_0105426 | 3300047321 | Bacteria | 2078 |
| 824 | Ga0495675_0214724 | 3300047444 | Bacteria | 1166 |
| 825 | Ga0496100_0017773 | 3300048903 | Bacteria | 4206 |
| 826 | Ga0496100_0410807 | 3300048903 | Bacteria | 1032 |
| 827 | Ga0496101_0023863 | 3300048904 | Bacteria | 4229 |
| 828 | Ga0496101_0029580 | 3300048904 | Bacteria | 3832 |
| 829 | Ga0496101_0122600 | 3300048904 | Bacteria | 1966 |
| 830 | Ga0496102_0028471 | 3300048905 | Bacteria | 4991 |
| 831 | Ga0496102_0109639 | 3300048905 | Bacteria | 2572 |
| 832 | Ga0496102_0297109 | 3300048905 | Bacteria | 1522 |
| 833 | Ga0496103_0060607 | 3300048906 | Bacteria | 2352 |
| 834 | Ga0496104_0020829 | 3300048907 | Bacteria | 6013 |
| 835 | Ga0496104_0023610 | 3300048907 | Bacteria | 5655 |
| 836 | Ga0496104_0040428 | 3300048907 | Bacteria | 4370 |
| 837 | Ga0496105_0006517 | 3300048908 | Bacteria | 8979 |
| 838 | Ga0496105_0173639 | 3300048908 | Bacteria | 1766 |
| 839 | Ga0496106_0000737 | 3300048909 | Bacteria | 23592 |
| 840 | Ga0496107_0066533 | 3300048910 | Bacteria | 2613 |
| 841 | Ga0496107_0093812 | 3300048910 | Bacteria | 2195 |
| 842 | Ga0496108_0029794 | 3300048911 | Bacteria | 4522 |
| 843 | Ga0496108_0152100 | 3300048911 | Bacteria | 1997 |
| 844 | Ga0496108_0193261 | 3300048911 | Bacteria | 1764 |
| 845 | Ga0496108_0373306 | 3300048911 | Bacteria | 1245 |
| 846 | Ga0496109_0069000 | 3300048912 | Bacteria | 3241 |
| 847 | Ga0496109_0094111 | 3300048912 | Bacteria | 2773 |
| 848 | Ga0496109_0154337 | 3300048912 | Bacteria | 2150 |
| 849 | Ga0496109_0417777 | 3300048912 | Bacteria | 1267 |
| 850 | Ga0496110_0136992 | 3300048913 | Bacteria | 2213 |
| 851 | Ga0496110_0517000 | 3300048913 | Bacteria | 1086 |
| 852 | Ga0496112_0006527 | 3300048915 | Bacteria | 10257 |
| 853 | Ga0496112_0008103 | 3300048915 | Bacteria | 9383 |
| 854 | Ga0496112_0032832 | 3300048915 | Bacteria | 5040 |
| 855 | Ga0496112_0460646 | 3300048915 | Bacteria | 1209 |
| 856 | Ga0496114_0108693 | 3300048917 | Bacteria | 2374 |
| 857 | Ga0496114_0314532 | 3300048917 | Bacteria | 1383 |
| 858 | Ga0501046_0390742 | 3300049580 | Bacteria | 1006 |
| 859 | Ga0501072_0474825 | 3300049588 | Bacteria | 990 |
| 860 | Ga0501077_0096920 | 3300049593 | Bacteria | 1869 |
| 861 | Ga0501079_0082468 | 3300049741 | Bacteria | 2487 |
| 862 | nmdc:mga05p37_150411_c1 | 3300050507 | Bacteria | 2848 |
| 863 | nmdc:mga09592_35135_c1 | 3300050508 | Bacteria | 4194 |
| 864 | nmdc:mga08y16_624414_c1 | 3300050511 | Bacteria | 1084 |
| 865 | nmdc:mga0n895_19318_c1 | 3300050512 | Bacteria | 6332 |
| 866 | nmdc:mga0n895_325456_c1 | 3300050512 | Bacteria | 1557 |
| 867 | nmdc:mga0n895_394822_c1 | 3300050512 | Bacteria | 1399 |
| 868 | nmdc:mga0n895_6915_c1 | 3300050512 | Bacteria | 9692 |
| 869 | nmdc:mga0rr50_18244_c1 | 3300050513 | Bacteria | 4708 |
| 870 | nmdc:mga0rr50_6395_c1 | 3300050513 | Bacteria | 7166 |
| 871 | nmdc:mga0rr50_64843_c1 | 3300050513 | Bacteria | 2765 |
| 872 | nmdc:mga08x19_14568_c1 | 3300050514 | Bacteria | 4770 |
| 873 | nmdc:mga08x19_5662_c1 | 3300050514 | Bacteria | 7384 |
| 874 | nmdc:mga0a205_13241_c1 | 3300050515 | Bacteria | 7670 |
| 875 | nmdc:mga0a205_9042_c1 | 3300050515 | Bacteria | 9083 |
| 876 | Ga0501084_0038988 | 3300054114 | Bacteria | 3974 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014326 | Ga0157380_10360782 | Ga0157380_103607822 | 225 |
| 2 | 3300005518 | Ga0070699_100059121 | Ga0070699_1000591213 | 250 |
| 3 | 3300005536 | Ga0070697_100022910 | Ga0070697_1000229103 | 250 |
| 4 | 3300049741 | Ga0501079_0082468 | Ga0501079_0082468_64_1014 | 255 |
| 5 | 3300036401 | Ga0373937_0407894 | Ga0373937_0407894_403_1260 | 259 |
| 6 | 3300035207 | Ga0373942_0026979 | Ga0373942_0026979_97_984 | 262 |
| 7 | 3300037068 | Ga0373925_0017777 | Ga0373925_0017777_18_887 | 263 |
| 8 | 3300036401 | Ga0373937_0036536 | Ga0373937_0036536_2843_3793 | 264 |
| 9 | 3300005549 | Ga0070704_100353553 | Ga0070704_1003535531 | 266 |
| 10 | 3300009177 | Ga0105248_10008149 | Ga0105248_1000814911 | 269 |
| 11 | 3300014968 | Ga0157379_10007045 | Ga0157379_100070458 | 269 |
| 12 | 3300005344 | Ga0070661_100263411 | Ga0070661_1002634112 | 271 |
| 13 | 3300005458 | Ga0070681_10002769 | Ga0070681_100027698 | 271 |
| 14 | 3300005530 | Ga0070679_100069494 | Ga0070679_1000694943 | 271 |
| 15 | 3300005564 | Ga0070664_100190723 | Ga0070664_1001907232 | 271 |
| 16 | 3300005614 | Ga0068856_100008813 | Ga0068856_1000088138 | 271 |
| 17 | 3300009174 | Ga0105241_10247765 | Ga0105241_102477652 | 271 |
| 18 | 3300013104 | Ga0157370_10100007 | Ga0157370_101000072 | 271 |
| 19 | 3300013105 | Ga0157369_10058838 | Ga0157369_100588383 | 271 |
| 20 | 3300013307 | Ga0157372_10002118 | Ga0157372_1000211820 | 271 |
| 21 | 3300025921 | Ga0207652_10073713 | Ga0207652_100737131 | 271 |
| 22 | 3300025945 | Ga0207679_10091393 | Ga0207679_100913932 | 271 |
| 23 | 3300026078 | Ga0207702_10002619 | Ga0207702_100026198 | 271 |
| 24 | 3300005295 | Ga0065707_10041460 | Ga0065707_100414601 | 272 |
| 25 | 3300005331 | Ga0070670_100088410 | Ga0070670_1000884102 | 272 |
| 26 | 3300005334 | Ga0068869_100006404 | Ga0068869_1000064044 | 272 |
| 27 | 3300005336 | Ga0070680_100031635 | Ga0070680_1000316352 | 272 |
| 28 | 3300005337 | Ga0070682_100016272 | Ga0070682_1000162722 | 272 |
| 29 | 3300005340 | Ga0070689_100004319 | Ga0070689_1000043199 | 272 |
| 30 | 3300005343 | Ga0070687_100003610 | Ga0070687_1000036106 | 272 |
| 31 | 3300005345 | Ga0070692_10069497 | Ga0070692_100694972 | 272 |
| 32 | 3300005354 | Ga0070675_100004789 | Ga0070675_1000047892 | 272 |
| 33 | 3300005355 | Ga0070671_100264882 | Ga0070671_1002648822 | 272 |
| 34 | 3300005365 | Ga0070688_100202702 | Ga0070688_1002027021 | 272 |
| 35 | 3300005434 | Ga0070709_10125456 | Ga0070709_101254562 | 272 |
| 36 | 3300005438 | Ga0070701_10015307 | Ga0070701_100153072 | 272 |
| 37 | 3300005441 | Ga0070700_100003801 | Ga0070700_1000038012 | 272 |
| 38 | 3300005444 | Ga0070694_100015658 | Ga0070694_1000156586 | 272 |
| 39 | 3300005445 | Ga0070708_100116248 | Ga0070708_1001162482 | 272 |
| 40 | 3300005459 | Ga0068867_100015021 | Ga0068867_1000150215 | 272 |
| 41 | 3300005530 | Ga0070679_100040872 | Ga0070679_1000408725 | 272 |
| 42 | 3300005539 | Ga0068853_100042935 | Ga0068853_1000429352 | 272 |
| 43 | 3300005543 | Ga0070672_100026312 | Ga0070672_1000263123 | 272 |
| 44 | 3300005544 | Ga0070686_100004773 | Ga0070686_1000047734 | 272 |
| 45 | 3300005546 | Ga0070696_100009059 | Ga0070696_1000090595 | 272 |
| 46 | 3300005547 | Ga0070693_100009441 | Ga0070693_1000094414 | 272 |
| 47 | 3300005549 | Ga0070704_100006749 | Ga0070704_1000067492 | 272 |
| 48 | 3300005563 | Ga0068855_100017036 | Ga0068855_1000170365 | 272 |
| 49 | 3300005563 | Ga0068855_100031328 | Ga0068855_1000313289 | 272 |
| 50 | 3300005578 | Ga0068854_100023947 | Ga0068854_1000239472 | 272 |
| 51 | 3300005617 | Ga0068859_100029580 | Ga0068859_1000295804 | 272 |
| 52 | 3300005718 | Ga0068866_10001149 | Ga0068866_100011495 | 272 |
| 53 | 3300005719 | Ga0068861_100004384 | Ga0068861_1000043849 | 272 |
| 54 | 3300005719 | Ga0068861_100034695 | Ga0068861_1000346954 | 272 |
| 55 | 3300005841 | Ga0068863_100262279 | Ga0068863_1002622792 | 272 |
| 56 | 3300005843 | Ga0068860_100153186 | Ga0068860_1001531862 | 272 |
| 57 | 3300005844 | Ga0068862_100016175 | Ga0068862_1000161752 | 272 |
| 58 | 3300006175 | Ga0070712_100022474 | Ga0070712_1000224744 | 272 |
| 59 | 3300006844 | Ga0075428_100004567 | Ga0075428_10000456715 | 272 |
| 60 | 3300006852 | Ga0075433_10058418 | Ga0075433_100584182 | 272 |
| 61 | 3300006871 | Ga0075434_100015608 | Ga0075434_1000156086 | 272 |
| 62 | 3300006880 | Ga0075429_100028612 | Ga0075429_1000286122 | 272 |
| 63 | 3300006881 | Ga0068865_100011339 | Ga0068865_1000113393 | 272 |
| 64 | 3300006914 | Ga0075436_100010939 | Ga0075436_1000109396 | 272 |
| 65 | 3300006931 | Ga0097620_100029578 | Ga0097620_1000295784 | 272 |
| 66 | 3300009094 | Ga0111539_10014739 | Ga0111539_100147399 | 272 |
| 67 | 3300009094 | Ga0111539_10271849 | Ga0111539_102718492 | 272 |
| 68 | 3300009098 | Ga0105245_10017020 | Ga0105245_100170206 | 272 |
| 69 | 3300009148 | Ga0105243_10021090 | Ga0105243_100210902 | 272 |
| 70 | 3300009177 | Ga0105248_10161419 | Ga0105248_101614192 | 272 |
| 71 | 3300009553 | Ga0105249_10449875 | Ga0105249_104498752 | 272 |
| 72 | 3300010375 | Ga0105239_10101660 | Ga0105239_101016602 | 272 |
| 73 | 3300013105 | Ga0157369_10029718 | Ga0157369_100297185 | 272 |
| 74 | 3300013297 | Ga0157378_10019026 | Ga0157378_100190266 | 272 |
| 75 | 3300013306 | Ga0163162_10052417 | Ga0163162_100524173 | 272 |
| 76 | 3300013308 | Ga0157375_10028562 | Ga0157375_100285621 | 272 |
| 77 | 3300014326 | Ga0157380_10038030 | Ga0157380_100380302 | 272 |
| 78 | 3300014745 | Ga0157377_10135560 | Ga0157377_101355602 | 272 |
| 79 | 3300014968 | Ga0157379_10366795 | Ga0157379_103667952 | 272 |
| 80 | 3300014969 | Ga0157376_10024405 | Ga0157376_100244058 | 272 |
| 81 | 3300014969 | Ga0157376_10574276 | Ga0157376_105742762 | 272 |
| 82 | 3300025885 | Ga0207653_10023147 | Ga0207653_100231472 | 272 |
| 83 | 3300025899 | Ga0207642_10002972 | Ga0207642_100029722 | 272 |
| 84 | 3300025901 | Ga0207688_10044878 | Ga0207688_100448782 | 272 |
| 85 | 3300025908 | Ga0207643_10022641 | Ga0207643_100226412 | 272 |
| 86 | 3300025917 | Ga0207660_10031002 | Ga0207660_100310022 | 272 |
| 87 | 3300025918 | Ga0207662_10000111 | Ga0207662_100001115 | 272 |
| 88 | 3300025921 | Ga0207652_10089964 | Ga0207652_100899642 | 272 |
| 89 | 3300025926 | Ga0207659_10048407 | Ga0207659_100484071 | 272 |
| 90 | 3300025929 | Ga0207664_10397816 | Ga0207664_103978161 | 272 |
| 91 | 3300025931 | Ga0207644_10050891 | Ga0207644_100508912 | 272 |
| 92 | 3300025932 | Ga0207690_10325146 | Ga0207690_103251461 | 272 |
| 93 | 3300025935 | Ga0207709_10080601 | Ga0207709_100806012 | 272 |
| 94 | 3300025938 | Ga0207704_10070616 | Ga0207704_100706162 | 272 |
| 95 | 3300025940 | Ga0207691_10005729 | Ga0207691_100057293 | 272 |
| 96 | 3300025949 | Ga0207667_10023196 | Ga0207667_100231964 | 272 |
| 97 | 3300025961 | Ga0207712_10215548 | Ga0207712_102155482 | 272 |
| 98 | 3300025981 | Ga0207640_10046566 | Ga0207640_100465662 | 272 |
| 99 | 3300026023 | Ga0207677_10101837 | Ga0207677_101018372 | 272 |
| 100 | 3300026075 | Ga0207708_10002481 | Ga0207708_1000248112 | 272 |
| 101 | 3300026078 | Ga0207702_10011001 | Ga0207702_100110015 | 272 |
| 102 | 3300026078 | Ga0207702_10139585 | Ga0207702_101395852 | 272 |
| 103 | 3300026089 | Ga0207648_10001798 | Ga0207648_1000179811 | 272 |
| 104 | 3300026118 | Ga0207675_100005496 | Ga0207675_1000054965 | 272 |
| 105 | 3300027907 | Ga0207428_10003126 | Ga0207428_100031264 | 272 |
| 106 | 3300028380 | Ga0268265_10004602 | Ga0268265_100046024 | 272 |
| 107 | 3300028381 | Ga0268264_10018827 | Ga0268264_100188273 | 272 |
| 108 | 3300028381 | Ga0268264_10021400 | Ga0268264_100214004 | 272 |
| 109 | 3300036401 | Ga0373937_0064536 | Ga0373937_0064536_1281_2231 | 272 |
| 110 | 3300045051 | Ga0451576_0067687 | Ga0451576_0067687_1334_2221 | 272 |
| 111 | 3300045051 | Ga0451576_0139213 | Ga0451576_0139213_1378_2265 | 272 |
| 112 | 3300046683 | Ga0495658_0130767 | Ga0495658_0130767_286_1236 | 272 |
| 113 | 3300050507 | nmdc:mga05p37_150411_c1 | nmdc:mga05p37_150411_c1_196_1083 | 272 |
| 114 | 3300050508 | nmdc:mga09592_35135_c1 | nmdc:mga09592_35135_c1_3240_4127 | 272 |
| 115 | 3300050512 | nmdc:mga0n895_325456_c1 | nmdc:mga0n895_325456_c1_101_988 | 272 |
| 116 | 3300050513 | nmdc:mga0rr50_6395_c1 | nmdc:mga0rr50_6395_c1_6208_7095 | 272 |
| 117 | 3300050514 | nmdc:mga08x19_5662_c1 | nmdc:mga08x19_5662_c1_6299_7186 | 272 |
| 118 | 3300050515 | nmdc:mga0a205_13241_c1 | nmdc:mga0a205_13241_c1_2449_3336 | 272 |
| 119 | 3300025271 | Ga0207666_1007935 | Ga0207666_10079353 | 273 |
| 120 | 3300048903 | Ga0496100_0017773 | Ga0496100_0017773_1812_2762 | 273 |
| 121 | 3300002126 | JGI24035J26624_1003066 | JGI24035J26624_10030661 | 274 |
| 122 | 3300002155 | JGI24033J26618_1004127 | JGI24033J26618_10041272 | 274 |
| 123 | 3300005290 | Ga0065712_10121336 | Ga0065712_101213362 | 274 |
| 124 | 3300005328 | Ga0070676_10065363 | Ga0070676_100653632 | 274 |
| 125 | 3300005329 | Ga0070683_100072461 | Ga0070683_1000724612 | 274 |
| 126 | 3300005330 | Ga0070690_100007555 | Ga0070690_1000075556 | 274 |
| 127 | 3300005331 | Ga0070670_100101790 | Ga0070670_1001017902 | 274 |
| 128 | 3300005333 | Ga0070677_10009260 | Ga0070677_100092603 | 274 |
| 129 | 3300005334 | Ga0068869_100004702 | Ga0068869_1000047027 | 274 |
| 130 | 3300005338 | Ga0068868_100164832 | Ga0068868_1001648321 | 274 |
| 131 | 3300005340 | Ga0070689_100014876 | Ga0070689_1000148764 | 274 |
| 132 | 3300005341 | Ga0070691_10040765 | Ga0070691_100407652 | 274 |
| 133 | 3300005343 | Ga0070687_100011438 | Ga0070687_1000114382 | 274 |
| 134 | 3300005344 | Ga0070661_100083999 | Ga0070661_1000839992 | 274 |
| 135 | 3300005345 | Ga0070692_10084663 | Ga0070692_100846631 | 274 |
| 136 | 3300005347 | Ga0070668_100035230 | Ga0070668_1000352303 | 274 |
| 137 | 3300005354 | Ga0070675_100122702 | Ga0070675_1001227022 | 274 |
| 138 | 3300005364 | Ga0070673_100103085 | Ga0070673_1001030852 | 274 |
| 139 | 3300005365 | Ga0070688_100089398 | Ga0070688_1000893982 | 274 |
| 140 | 3300005366 | Ga0070659_100054906 | Ga0070659_1000549062 | 274 |
| 141 | 3300005438 | Ga0070701_10016294 | Ga0070701_100162942 | 274 |
| 142 | 3300005441 | Ga0070700_100028121 | Ga0070700_1000281212 | 274 |
| 143 | 3300005455 | Ga0070663_100020597 | Ga0070663_1000205972 | 274 |
| 144 | 3300005457 | Ga0070662_100036711 | Ga0070662_1000367112 | 274 |
| 145 | 3300005466 | Ga0070685_10044044 | Ga0070685_100440442 | 274 |
| 146 | 3300005539 | Ga0068853_100044043 | Ga0068853_1000440432 | 274 |
| 147 | 3300005544 | Ga0070686_100008579 | Ga0070686_1000085795 | 274 |
| 148 | 3300005548 | Ga0070665_100095265 | Ga0070665_1000952652 | 274 |
| 149 | 3300005563 | Ga0068855_100165197 | Ga0068855_1001651972 | 274 |
| 150 | 3300005564 | Ga0070664_100051354 | Ga0070664_1000513542 | 274 |
| 151 | 3300005577 | Ga0068857_100139430 | Ga0068857_1001394303 | 274 |
| 152 | 3300005578 | Ga0068854_100049293 | Ga0068854_1000492932 | 274 |
| 153 | 3300005615 | Ga0070702_100031689 | Ga0070702_1000316892 | 274 |
| 154 | 3300005718 | Ga0068866_10002335 | Ga0068866_100023356 | 274 |
| 155 | 3300005834 | Ga0068851_10012908 | Ga0068851_100129082 | 274 |
| 156 | 3300005840 | Ga0068870_10027578 | Ga0068870_100275783 | 274 |
| 157 | 3300005844 | Ga0068862_100292420 | Ga0068862_1002924203 | 274 |
| 158 | 3300006358 | Ga0068871_100110073 | Ga0068871_1001100733 | 274 |
| 159 | 3300006881 | Ga0068865_100021963 | Ga0068865_1000219633 | 274 |
| 160 | 3300009094 | Ga0111539_10038744 | Ga0111539_100387448 | 274 |
| 161 | 3300009148 | Ga0105243_10133898 | Ga0105243_101338983 | 274 |
| 162 | 3300009174 | Ga0105241_10508716 | Ga0105241_105087161 | 274 |
| 163 | 3300009176 | Ga0105242_10014757 | Ga0105242_100147574 | 274 |
| 164 | 3300009553 | Ga0105249_10015859 | Ga0105249_100158593 | 274 |
| 165 | 3300010375 | Ga0105239_10280862 | Ga0105239_102808623 | 274 |
| 166 | 3300011119 | Ga0105246_10100724 | Ga0105246_101007242 | 274 |
| 167 | 3300013297 | Ga0157378_10047198 | Ga0157378_100471982 | 274 |
| 168 | 3300014325 | Ga0163163_10051112 | Ga0163163_100511122 | 274 |
| 169 | 3300014326 | Ga0157380_10048709 | Ga0157380_100487093 | 274 |
| 170 | 3300014745 | Ga0157377_10008365 | Ga0157377_100083652 | 274 |
| 171 | 3300017792 | Ga0163161_10102395 | Ga0163161_101023952 | 274 |
| 172 | 3300025315 | Ga0207697_10000771 | Ga0207697_1000077112 | 274 |
| 173 | 3300025321 | Ga0207656_10037973 | Ga0207656_100379732 | 274 |
| 174 | 3300025893 | Ga0207682_10001382 | Ga0207682_100013824 | 274 |
| 175 | 3300025899 | Ga0207642_10003792 | Ga0207642_100037924 | 274 |
| 176 | 3300025901 | Ga0207688_10000524 | Ga0207688_100005246 | 274 |
| 177 | 3300025903 | Ga0207680_10020342 | Ga0207680_100203422 | 274 |
| 178 | 3300025907 | Ga0207645_10003306 | Ga0207645_100033063 | 274 |
| 179 | 3300025908 | Ga0207643_10000632 | Ga0207643_1000063212 | 274 |
| 180 | 3300025918 | Ga0207662_10016468 | Ga0207662_100164683 | 274 |
| 181 | 3300025923 | Ga0207681_10041390 | Ga0207681_100413904 | 274 |
| 182 | 3300025925 | Ga0207650_10021348 | Ga0207650_100213485 | 274 |
| 183 | 3300025926 | Ga0207659_10001717 | Ga0207659_100017172 | 274 |
| 184 | 3300025931 | Ga0207644_10078561 | Ga0207644_100785612 | 274 |
| 185 | 3300025933 | Ga0207706_10002346 | Ga0207706_1000234612 | 274 |
| 186 | 3300025935 | Ga0207709_10224111 | Ga0207709_102241113 | 274 |
| 187 | 3300025940 | Ga0207691_10017461 | Ga0207691_100174614 | 274 |
| 188 | 3300025942 | Ga0207689_10158417 | Ga0207689_101584172 | 274 |
| 189 | 3300025986 | Ga0207658_10036349 | Ga0207658_100363492 | 274 |
| 190 | 3300026035 | Ga0207703_10059324 | Ga0207703_100593242 | 274 |
| 191 | 3300026075 | Ga0207708_10002020 | Ga0207708_100020206 | 274 |
| 192 | 3300026089 | Ga0207648_10014010 | Ga0207648_100140106 | 274 |
| 193 | 3300026116 | Ga0207674_10041640 | Ga0207674_100416402 | 274 |
| 194 | 3300026118 | Ga0207675_100011565 | Ga0207675_1000115654 | 274 |
| 195 | 3300026121 | Ga0207683_10005325 | Ga0207683_100053254 | 274 |
| 196 | 3300026142 | Ga0207698_10034612 | Ga0207698_100346122 | 274 |
| 197 | 3300027907 | Ga0207428_10079983 | Ga0207428_100799833 | 274 |
| 198 | 3300028380 | Ga0268265_10038320 | Ga0268265_100383204 | 274 |
| 199 | 3300028381 | Ga0268264_10156033 | Ga0268264_101560332 | 274 |
| 200 | 3300035410 | Ga0373924_0092415 | Ga0373924_0092415_308_1258 | 274 |
| 201 | 3300048904 | Ga0496101_0122600 | Ga0496101_0122600_73_1023 | 274 |
| 202 | 3300048905 | Ga0496102_0297109 | Ga0496102_0297109_455_1405 | 274 |
| 203 | 3300048907 | Ga0496104_0023610 | Ga0496104_0023610_1357_2307 | 274 |
| 204 | 3300048908 | Ga0496105_0173639 | Ga0496105_0173639_443_1393 | 274 |
| 205 | 3300048910 | Ga0496107_0093812 | Ga0496107_0093812_686_1636 | 274 |
| 206 | 3300048911 | Ga0496108_0029794 | Ga0496108_0029794_109_1059 | 274 |
| 207 | 3300048912 | Ga0496109_0154337 | Ga0496109_0154337_1019_1969 | 274 |
| 208 | 3300048917 | Ga0496114_0108693 | Ga0496114_0108693_1268_2218 | 274 |
| 209 | 3300005327 | Ga0070658_10240915 | Ga0070658_102409152 | 275 |
| 210 | 3300005344 | Ga0070661_100001121 | Ga0070661_1000011215 | 275 |
| 211 | 3300005366 | Ga0070659_100038438 | Ga0070659_1000384382 | 275 |
| 212 | 3300005458 | Ga0070681_10100713 | Ga0070681_101007132 | 275 |
| 213 | 3300005530 | Ga0070679_100009803 | Ga0070679_1000098032 | 275 |
| 214 | 3300005535 | Ga0070684_100039393 | Ga0070684_1000393932 | 275 |
| 215 | 3300005563 | Ga0068855_100011225 | Ga0068855_1000112259 | 275 |
| 216 | 3300005564 | Ga0070664_100002391 | Ga0070664_10000239110 | 275 |
| 217 | 3300005577 | Ga0068857_100001876 | Ga0068857_1000018762 | 275 |
| 218 | 3300005578 | Ga0068854_100020976 | Ga0068854_1000209765 | 275 |
| 219 | 3300005614 | Ga0068856_100002048 | Ga0068856_1000020484 | 275 |
| 220 | 3300005616 | Ga0068852_100011026 | Ga0068852_1000110264 | 275 |
| 221 | 3300006844 | Ga0075428_100106351 | Ga0075428_1001063512 | 275 |
| 222 | 3300009093 | Ga0105240_10002531 | Ga0105240_1000253120 | 275 |
| 223 | 3300009545 | Ga0105237_10126959 | Ga0105237_101269592 | 275 |
| 224 | 3300009551 | Ga0105238_10000484 | Ga0105238_1000048434 | 275 |
| 225 | 3300013100 | Ga0157373_10032232 | Ga0157373_100322323 | 275 |
| 226 | 3300013102 | Ga0157371_10053519 | Ga0157371_100535193 | 275 |
| 227 | 3300013104 | Ga0157370_10003069 | Ga0157370_1000306916 | 275 |
| 228 | 3300013105 | Ga0157369_10006377 | Ga0157369_1000637713 | 275 |
| 229 | 3300013307 | Ga0157372_10010340 | Ga0157372_100103402 | 275 |
| 230 | 3300014497 | Ga0182008_10049535 | Ga0182008_100495352 | 275 |
| 231 | 3300025909 | Ga0207705_10052673 | Ga0207705_100526733 | 275 |
| 232 | 3300025911 | Ga0207654_10041807 | Ga0207654_100418072 | 275 |
| 233 | 3300025912 | Ga0207707_10014131 | Ga0207707_100141312 | 275 |
| 234 | 3300025913 | Ga0207695_10088402 | Ga0207695_100884022 | 275 |
| 235 | 3300025914 | Ga0207671_10039603 | Ga0207671_100396033 | 275 |
| 236 | 3300025919 | Ga0207657_10136772 | Ga0207657_101367722 | 275 |
| 237 | 3300025920 | Ga0207649_10007510 | Ga0207649_100075104 | 275 |
| 238 | 3300025924 | Ga0207694_10002559 | Ga0207694_100025595 | 275 |
| 239 | 3300025929 | Ga0207664_10003607 | Ga0207664_100036072 | 275 |
| 240 | 3300025932 | Ga0207690_10030443 | Ga0207690_100304432 | 275 |
| 241 | 3300025945 | Ga0207679_10016532 | Ga0207679_100165324 | 275 |
| 242 | 3300025949 | Ga0207667_10131664 | Ga0207667_101316642 | 275 |
| 243 | 3300026041 | Ga0207639_10224921 | Ga0207639_102249212 | 275 |
| 244 | 3300026078 | Ga0207702_10003232 | Ga0207702_100032325 | 275 |
| 245 | 3300026116 | Ga0207674_10000040 | Ga0207674_1000004013 | 275 |
| 246 | 3300026142 | Ga0207698_10135576 | Ga0207698_101355762 | 275 |
| 247 | 3300005327 | Ga0070658_10042562 | Ga0070658_100425623 | 276 |
| 248 | 3300025909 | Ga0207705_10015818 | Ga0207705_100158183 | 276 |
| 249 | 3300025940 | Ga0207691_10233853 | Ga0207691_102338532 | 276 |
| 250 | 3300032005 | Ga0307411_10367748 | Ga0307411_103677482 | 277 |
| 251 | 3300005364 | Ga0070673_100074239 | Ga0070673_1000742392 | 279 |
| 252 | 3300025920 | Ga0207649_10003765 | Ga0207649_100037656 | 279 |
| 253 | 3300025960 | Ga0207651_10011174 | Ga0207651_100111744 | 279 |
| 254 | 3300005293 | Ga0065715_10163288 | Ga0065715_101632881 | 280 |
| 255 | 3300005328 | Ga0070676_10023491 | Ga0070676_100234912 | 280 |
| 256 | 3300005339 | Ga0070660_100001443 | Ga0070660_1000014439 | 280 |
| 257 | 3300005353 | Ga0070669_100290210 | Ga0070669_1002902102 | 280 |
| 258 | 3300005354 | Ga0070675_100471622 | Ga0070675_1004716221 | 280 |
| 259 | 3300005355 | Ga0070671_100000758 | Ga0070671_1000007583 | 280 |
| 260 | 3300005355 | Ga0070671_100254550 | Ga0070671_1002545502 | 280 |
| 261 | 3300005366 | Ga0070659_100003747 | Ga0070659_1000037472 | 280 |
| 262 | 3300005456 | Ga0070678_100053751 | Ga0070678_1000537512 | 280 |
| 263 | 3300005457 | Ga0070662_100002572 | Ga0070662_10000257211 | 280 |
| 264 | 3300005539 | Ga0068853_100056864 | Ga0068853_1000568643 | 280 |
| 265 | 3300005543 | Ga0070672_100077268 | Ga0070672_1000772682 | 280 |
| 266 | 3300005563 | Ga0068855_100002451 | Ga0068855_10000245115 | 280 |
| 267 | 3300005564 | Ga0070664_100000120 | Ga0070664_10000012021 | 280 |
| 268 | 3300005614 | Ga0068856_100002007 | Ga0068856_10000200715 | 280 |
| 269 | 3300005616 | Ga0068852_100039515 | Ga0068852_1000395153 | 280 |
| 270 | 3300006871 | Ga0075434_100424418 | Ga0075434_1004244181 | 280 |
| 271 | 3300013100 | Ga0157373_10000142 | Ga0157373_1000014215 | 280 |
| 272 | 3300013102 | Ga0157371_10000549 | Ga0157371_1000054945 | 280 |
| 273 | 3300013105 | Ga0157369_10045116 | Ga0157369_100451163 | 280 |
| 274 | 3300013307 | Ga0157372_10024655 | Ga0157372_100246552 | 280 |
| 275 | 3300025907 | Ga0207645_10052410 | Ga0207645_100524102 | 280 |
| 276 | 3300025917 | Ga0207660_10052593 | Ga0207660_100525931 | 280 |
| 277 | 3300025919 | Ga0207657_10000341 | Ga0207657_1000034115 | 280 |
| 278 | 3300025921 | Ga0207652_10438853 | Ga0207652_104388532 | 280 |
| 279 | 3300025923 | Ga0207681_10190078 | Ga0207681_101900782 | 280 |
| 280 | 3300025926 | Ga0207659_10101516 | Ga0207659_101015161 | 280 |
| 281 | 3300025931 | Ga0207644_10106862 | Ga0207644_101068622 | 280 |
| 282 | 3300025932 | Ga0207690_10002016 | Ga0207690_100020162 | 280 |
| 283 | 3300025933 | Ga0207706_10000037 | Ga0207706_10000037121 | 280 |
| 284 | 3300025937 | Ga0207669_10073018 | Ga0207669_100730181 | 280 |
| 285 | 3300025945 | Ga0207679_10001850 | Ga0207679_100018508 | 280 |
| 286 | 3300025949 | Ga0207667_10013261 | Ga0207667_100132615 | 280 |
| 287 | 3300026041 | Ga0207639_10006119 | Ga0207639_100061194 | 280 |
| 288 | 3300026078 | Ga0207702_10002815 | Ga0207702_100028159 | 280 |
| 289 | 3300026116 | Ga0207674_10409236 | Ga0207674_104092362 | 280 |
| 290 | 3300041413 | Ga0439465_0062802 | Ga0439465_0062802_79_1005 | 280 |
| 291 | 3300048904 | Ga0496101_0023863 | Ga0496101_0023863_2949_3899 | 280 |
| 292 | 3300048905 | Ga0496102_0109639 | Ga0496102_0109639_971_1921 | 280 |
| 293 | 3300048909 | Ga0496106_0000737 | Ga0496106_0000737_22195_23145 | 280 |
| 294 | 3300048913 | Ga0496110_0136992 | Ga0496110_0136992_425_1375 | 280 |
| 295 | 3300005356 | Ga0070674_100095624 | Ga0070674_1000956242 | 282 |
| 296 | 3300005459 | Ga0068867_100053179 | Ga0068867_1000531793 | 282 |
| 297 | 3300005843 | Ga0068860_100126195 | Ga0068860_1001261952 | 282 |
| 298 | 3300007076 | Ga0075435_100204901 | Ga0075435_1002049011 | 282 |
| 299 | 3300017792 | Ga0163161_10011199 | Ga0163161_100111993 | 282 |
| 300 | 3300025934 | Ga0207686_10017623 | Ga0207686_100176235 | 282 |
| 301 | 3300025938 | Ga0207704_10107114 | Ga0207704_101071142 | 282 |
| 302 | 3300026089 | Ga0207648_10010994 | Ga0207648_100109947 | 282 |
| 303 | 3300026121 | Ga0207683_10025973 | Ga0207683_100259734 | 282 |
| 304 | 3300044712 | Ga0453684_0236026 | Ga0453684_0236026_184_1101 | 282 |
| 305 | 3300025940 | Ga0207691_10125321 | Ga0207691_101253211 | 283 |
| 306 | 3300025972 | Ga0207668_10043134 | Ga0207668_100431342 | 283 |
| 307 | 3300005331 | Ga0070670_100005195 | Ga0070670_1000051954 | 284 |
| 308 | 3300005334 | Ga0068869_100003339 | Ga0068869_10000333910 | 284 |
| 309 | 3300005340 | Ga0070689_100157011 | Ga0070689_1001570112 | 284 |
| 310 | 3300005347 | Ga0070668_100023182 | Ga0070668_1000231822 | 284 |
| 311 | 3300005364 | Ga0070673_100008416 | Ga0070673_1000084162 | 284 |
| 312 | 3300005367 | Ga0070667_100023042 | Ga0070667_1000230422 | 284 |
| 313 | 3300005459 | Ga0068867_100018604 | Ga0068867_1000186042 | 284 |
| 314 | 3300005548 | Ga0070665_100530845 | Ga0070665_1005308452 | 284 |
| 315 | 3300005563 | Ga0068855_100239399 | Ga0068855_1002393992 | 284 |
| 316 | 3300005577 | Ga0068857_100057642 | Ga0068857_1000576422 | 284 |
| 317 | 3300005617 | Ga0068859_100004536 | Ga0068859_1000045364 | 284 |
| 318 | 3300005618 | Ga0068864_100043351 | Ga0068864_1000433514 | 284 |
| 319 | 3300005719 | Ga0068861_100032353 | Ga0068861_1000323534 | 284 |
| 320 | 3300005840 | Ga0068870_10085455 | Ga0068870_100854552 | 284 |
| 321 | 3300005841 | Ga0068863_100029339 | Ga0068863_1000293393 | 284 |
| 322 | 3300005842 | Ga0068858_100048524 | Ga0068858_1000485243 | 284 |
| 323 | 3300005843 | Ga0068860_100016867 | Ga0068860_1000168678 | 284 |
| 324 | 3300005844 | Ga0068862_100031535 | Ga0068862_1000315352 | 284 |
| 325 | 3300006881 | Ga0068865_100150519 | Ga0068865_1001505192 | 284 |
| 326 | 3300006931 | Ga0097620_100004536 | Ga0097620_1000045364 | 284 |
| 327 | 3300009094 | Ga0111539_10346546 | Ga0111539_103465462 | 284 |
| 328 | 3300009101 | Ga0105247_10068880 | Ga0105247_100688802 | 284 |
| 329 | 3300009545 | Ga0105237_10289506 | Ga0105237_102895062 | 284 |
| 330 | 3300013308 | Ga0157375_10171735 | Ga0157375_101717352 | 284 |
| 331 | 3300014326 | Ga0157380_10177112 | Ga0157380_101771122 | 284 |
| 332 | 3300025923 | Ga0207681_10142951 | Ga0207681_101429512 | 284 |
| 333 | 3300025925 | Ga0207650_10032547 | Ga0207650_100325472 | 284 |
| 334 | 3300025926 | Ga0207659_10162659 | Ga0207659_101626592 | 284 |
| 335 | 3300025938 | Ga0207704_10123080 | Ga0207704_101230801 | 284 |
| 336 | 3300025941 | Ga0207711_10023334 | Ga0207711_100233345 | 284 |
| 337 | 3300025942 | Ga0207689_10004636 | Ga0207689_1000463610 | 284 |
| 338 | 3300025960 | Ga0207651_10066847 | Ga0207651_100668472 | 284 |
| 339 | 3300025972 | Ga0207668_10052977 | Ga0207668_100529772 | 284 |
| 340 | 3300025972 | Ga0207668_10054958 | Ga0207668_100549582 | 284 |
| 341 | 3300025986 | Ga0207658_10016693 | Ga0207658_100166932 | 284 |
| 342 | 3300026035 | Ga0207703_10000559 | Ga0207703_1000055927 | 284 |
| 343 | 3300026088 | Ga0207641_10040931 | Ga0207641_100409313 | 284 |
| 344 | 3300026089 | Ga0207648_10020027 | Ga0207648_100200276 | 284 |
| 345 | 3300026095 | Ga0207676_10106271 | Ga0207676_101062712 | 284 |
| 346 | 3300026116 | Ga0207674_10011703 | Ga0207674_100117033 | 284 |
| 347 | 3300026118 | Ga0207675_100017185 | Ga0207675_1000171856 | 284 |
| 348 | 3300026121 | Ga0207683_10119581 | Ga0207683_101195812 | 284 |
| 349 | 3300028379 | Ga0268266_10580730 | Ga0268266_105807301 | 284 |
| 350 | 3300028380 | Ga0268265_10020997 | Ga0268265_100209973 | 284 |
| 351 | 3300028381 | Ga0268264_10004968 | Ga0268264_100049686 | 284 |
| 352 | 3300048905 | Ga0496102_0028471 | Ga0496102_0028471_2839_3786 | 284 |
| 353 | 3300048906 | Ga0496103_0060607 | Ga0496103_0060607_960_1907 | 284 |
| 354 | 3300048911 | Ga0496108_0193261 | Ga0496108_0193261_55_1002 | 284 |
| 355 | 3300048912 | Ga0496109_0069000 | Ga0496109_0069000_155_1102 | 284 |
| 356 | 3300050511 | nmdc:mga08y16_624414_c1 | nmdc:mga08y16_624414_c1_42_989 | 284 |
| 357 | 3300042015 | Ga0439462_0036859 | Ga0439462_0036859_20_967 | 287 |
| 358 | 3300049588 | Ga0501072_0474825 | Ga0501072_0474825_24_974 | 287 |
| 359 | 3300049593 | Ga0501077_0096920 | Ga0501077_0096920_29_979 | 287 |
| 360 | 3300042876 | Ga0451577_0003232 | Ga0451577_0003232_10885_11838 | 288 |
| 361 | 3300005293 | Ga0065715_10105456 | Ga0065715_101054563 | 289 |
| 362 | 3300005327 | Ga0070658_10276831 | Ga0070658_102768312 | 289 |
| 363 | 3300005329 | Ga0070683_100180217 | Ga0070683_1001802172 | 289 |
| 364 | 3300005330 | Ga0070690_100000937 | Ga0070690_1000009373 | 289 |
| 365 | 3300005330 | Ga0070690_100101313 | Ga0070690_1001013132 | 289 |
| 366 | 3300005330 | Ga0070690_100278225 | Ga0070690_1002782252 | 289 |
| 367 | 3300005331 | Ga0070670_100006021 | Ga0070670_10000602114 | 289 |
| 368 | 3300005331 | Ga0070670_100013131 | Ga0070670_1000131313 | 289 |
| 369 | 3300005333 | Ga0070677_10000311 | Ga0070677_1000031114 | 289 |
| 370 | 3300005333 | Ga0070677_10023257 | Ga0070677_100232572 | 289 |
| 371 | 3300005333 | Ga0070677_10101402 | Ga0070677_101014021 | 289 |
| 372 | 3300005334 | Ga0068869_100005299 | Ga0068869_1000052997 | 289 |
| 373 | 3300005334 | Ga0068869_100063480 | Ga0068869_1000634802 | 289 |
| 374 | 3300005334 | Ga0068869_100367124 | Ga0068869_1003671241 | 289 |
| 375 | 3300005335 | Ga0070666_10015499 | Ga0070666_100154995 | 289 |
| 376 | 3300005335 | Ga0070666_10021926 | Ga0070666_100219263 | 289 |
| 377 | 3300005335 | Ga0070666_10031845 | Ga0070666_100318452 | 289 |
| 378 | 3300005336 | Ga0070680_100043480 | Ga0070680_1000434802 | 289 |
| 379 | 3300005336 | Ga0070680_100050144 | Ga0070680_1000501443 | 289 |
| 380 | 3300005337 | Ga0070682_100002642 | Ga0070682_1000026423 | 289 |
| 381 | 3300005338 | Ga0068868_100001088 | Ga0068868_10000108814 | 289 |
| 382 | 3300005338 | Ga0068868_100014606 | Ga0068868_1000146063 | 289 |
| 383 | 3300005338 | Ga0068868_100021157 | Ga0068868_1000211574 | 289 |
| 384 | 3300005338 | Ga0068868_100109971 | Ga0068868_1001099712 | 289 |
| 385 | 3300005338 | Ga0068868_100235349 | Ga0068868_1002353492 | 289 |
| 386 | 3300005339 | Ga0070660_100001240 | Ga0070660_10000124016 | 289 |
| 387 | 3300005339 | Ga0070660_100175395 | Ga0070660_1001753952 | 289 |
| 388 | 3300005340 | Ga0070689_100027007 | Ga0070689_1000270072 | 289 |
| 389 | 3300005340 | Ga0070689_100138058 | Ga0070689_1001380581 | 289 |
| 390 | 3300005340 | Ga0070689_100224098 | Ga0070689_1002240982 | 289 |
| 391 | 3300005343 | Ga0070687_100054981 | Ga0070687_1000549812 | 289 |
| 392 | 3300005343 | Ga0070687_100141042 | Ga0070687_1001410421 | 289 |
| 393 | 3300005344 | Ga0070661_100000422 | Ga0070661_10000042233 | 289 |
| 394 | 3300005344 | Ga0070661_100280508 | Ga0070661_1002805081 | 289 |
| 395 | 3300005344 | Ga0070661_100284007 | Ga0070661_1002840072 | 289 |
| 396 | 3300005347 | Ga0070668_100003855 | Ga0070668_1000038555 | 289 |
| 397 | 3300005347 | Ga0070668_100448542 | Ga0070668_1004485422 | 289 |
| 398 | 3300005353 | Ga0070669_100242731 | Ga0070669_1002427312 | 289 |
| 399 | 3300005354 | Ga0070675_100004306 | Ga0070675_1000043068 | 289 |
| 400 | 3300005354 | Ga0070675_100063250 | Ga0070675_1000632502 | 289 |
| 401 | 3300005355 | Ga0070671_100007181 | Ga0070671_1000071813 | 289 |
| 402 | 3300005355 | Ga0070671_100008280 | Ga0070671_1000082802 | 289 |
| 403 | 3300005355 | Ga0070671_100018968 | Ga0070671_1000189685 | 289 |
| 404 | 3300005355 | Ga0070671_100042621 | Ga0070671_1000426212 | 289 |
| 405 | 3300005356 | Ga0070674_100000539 | Ga0070674_10000053911 | 289 |
| 406 | 3300005356 | Ga0070674_100049758 | Ga0070674_1000497582 | 289 |
| 407 | 3300005364 | Ga0070673_100017502 | Ga0070673_1000175022 | 289 |
| 408 | 3300005364 | Ga0070673_100037562 | Ga0070673_1000375622 | 289 |
| 409 | 3300005364 | Ga0070673_100096181 | Ga0070673_1000961812 | 289 |
| 410 | 3300005364 | Ga0070673_100099891 | Ga0070673_1000998912 | 289 |
| 411 | 3300005365 | Ga0070688_100048802 | Ga0070688_1000488022 | 289 |
| 412 | 3300005365 | Ga0070688_100209997 | Ga0070688_1002099972 | 289 |
| 413 | 3300005366 | Ga0070659_100041362 | Ga0070659_1000413623 | 289 |
| 414 | 3300005366 | Ga0070659_100107228 | Ga0070659_1001072282 | 289 |
| 415 | 3300005367 | Ga0070667_100012929 | Ga0070667_1000129293 | 289 |
| 416 | 3300005367 | Ga0070667_100033086 | Ga0070667_1000330865 | 289 |
| 417 | 3300005367 | Ga0070667_100060942 | Ga0070667_1000609422 | 289 |
| 418 | 3300005406 | Ga0070703_10001200 | Ga0070703_100012002 | 289 |
| 419 | 3300005435 | Ga0070714_100001293 | Ga0070714_10000129317 | 289 |
| 420 | 3300005435 | Ga0070714_100040851 | Ga0070714_1000408512 | 289 |
| 421 | 3300005435 | Ga0070714_100162116 | Ga0070714_1001621162 | 289 |
| 422 | 3300005436 | Ga0070713_100014185 | Ga0070713_1000141854 | 289 |
| 423 | 3300005436 | Ga0070713_100022094 | Ga0070713_1000220944 | 289 |
| 424 | 3300005436 | Ga0070713_100055080 | Ga0070713_1000550803 | 289 |
| 425 | 3300005437 | Ga0070710_10002850 | Ga0070710_100028506 | 289 |
| 426 | 3300005437 | Ga0070710_10022141 | Ga0070710_100221412 | 289 |
| 427 | 3300005437 | Ga0070710_10104267 | Ga0070710_101042671 | 289 |
| 428 | 3300005438 | Ga0070701_10035616 | Ga0070701_100356162 | 289 |
| 429 | 3300005439 | Ga0070711_100041397 | Ga0070711_1000413972 | 289 |
| 430 | 3300005439 | Ga0070711_100067958 | Ga0070711_1000679582 | 289 |
| 431 | 3300005439 | Ga0070711_100171819 | Ga0070711_1001718192 | 289 |
| 432 | 3300005440 | Ga0070705_100000841 | Ga0070705_10000084112 | 289 |
| 433 | 3300005440 | Ga0070705_100150597 | Ga0070705_1001505972 | 289 |
| 434 | 3300005444 | Ga0070694_100055888 | Ga0070694_1000558882 | 289 |
| 435 | 3300005445 | Ga0070708_100108699 | Ga0070708_1001086992 | 289 |
| 436 | 3300005445 | Ga0070708_100158925 | Ga0070708_1001589252 | 289 |
| 437 | 3300005455 | Ga0070663_100007113 | Ga0070663_1000071136 | 289 |
| 438 | 3300005456 | Ga0070678_100002006 | Ga0070678_1000020067 | 289 |
| 439 | 3300005456 | Ga0070678_100040346 | Ga0070678_1000403461 | 289 |
| 440 | 3300005456 | Ga0070678_100225153 | Ga0070678_1002251532 | 289 |
| 441 | 3300005456 | Ga0070678_100367848 | Ga0070678_1003678482 | 289 |
| 442 | 3300005457 | Ga0070662_100090000 | Ga0070662_1000900002 | 289 |
| 443 | 3300005457 | Ga0070662_100119865 | Ga0070662_1001198652 | 289 |
| 444 | 3300005457 | Ga0070662_100149138 | Ga0070662_1001491382 | 289 |
| 445 | 3300005457 | Ga0070662_100313734 | Ga0070662_1003137342 | 289 |
| 446 | 3300005458 | Ga0070681_10024351 | Ga0070681_100243515 | 289 |
| 447 | 3300005459 | Ga0068867_100001532 | Ga0068867_10000153210 | 289 |
| 448 | 3300005459 | Ga0068867_100058920 | Ga0068867_1000589202 | 289 |
| 449 | 3300005459 | Ga0068867_100178831 | Ga0068867_1001788312 | 289 |
| 450 | 3300005459 | Ga0068867_100236897 | Ga0068867_1002368971 | 289 |
| 451 | 3300005466 | Ga0070685_10016964 | Ga0070685_100169643 | 289 |
| 452 | 3300005467 | Ga0070706_100134617 | Ga0070706_1001346172 | 289 |
| 453 | 3300005467 | Ga0070706_100294372 | Ga0070706_1002943722 | 289 |
| 454 | 3300005467 | Ga0070706_100333506 | Ga0070706_1003335062 | 289 |
| 455 | 3300005468 | Ga0070707_100046638 | Ga0070707_1000466383 | 289 |
| 456 | 3300005468 | Ga0070707_100176497 | Ga0070707_1001764972 | 289 |
| 457 | 3300005468 | Ga0070707_100380338 | Ga0070707_1003803382 | 289 |
| 458 | 3300005471 | Ga0070698_100059491 | Ga0070698_1000594912 | 289 |
| 459 | 3300005471 | Ga0070698_100258627 | Ga0070698_1002586272 | 289 |
| 460 | 3300005471 | Ga0070698_100333361 | Ga0070698_1003333612 | 289 |
| 461 | 3300005518 | Ga0070699_100249199 | Ga0070699_1002491992 | 289 |
| 462 | 3300005518 | Ga0070699_100305986 | Ga0070699_1003059862 | 289 |
| 463 | 3300005530 | Ga0070679_100063431 | Ga0070679_1000634312 | 289 |
| 464 | 3300005535 | Ga0070684_100066710 | Ga0070684_1000667103 | 289 |
| 465 | 3300005535 | Ga0070684_100110230 | Ga0070684_1001102302 | 289 |
| 466 | 3300005536 | Ga0070697_100420400 | Ga0070697_1004204001 | 289 |
| 467 | 3300005539 | Ga0068853_100009263 | Ga0068853_1000092637 | 289 |
| 468 | 3300005539 | Ga0068853_100019343 | Ga0068853_1000193433 | 289 |
| 469 | 3300005539 | Ga0068853_100042613 | Ga0068853_1000426133 | 289 |
| 470 | 3300005539 | Ga0068853_100307940 | Ga0068853_1003079402 | 289 |
| 471 | 3300005543 | Ga0070672_100000794 | Ga0070672_10000079410 | 289 |
| 472 | 3300005543 | Ga0070672_100008039 | Ga0070672_1000080396 | 289 |
| 473 | 3300005543 | Ga0070672_100039344 | Ga0070672_1000393442 | 289 |
| 474 | 3300005543 | Ga0070672_100310338 | Ga0070672_1003103382 | 289 |
| 475 | 3300005544 | Ga0070686_100038894 | Ga0070686_1000388941 | 289 |
| 476 | 3300005545 | Ga0070695_100076489 | Ga0070695_1000764892 | 289 |
| 477 | 3300005546 | Ga0070696_100000636 | Ga0070696_1000006369 | 289 |
| 478 | 3300005546 | Ga0070696_100017547 | Ga0070696_1000175471 | 289 |
| 479 | 3300005546 | Ga0070696_100210699 | Ga0070696_1002106992 | 289 |
| 480 | 3300005547 | Ga0070693_100000180 | Ga0070693_10000018026 | 289 |
| 481 | 3300005547 | Ga0070693_100140078 | Ga0070693_1001400782 | 289 |
| 482 | 3300005548 | Ga0070665_100005242 | Ga0070665_1000052425 | 289 |
| 483 | 3300005548 | Ga0070665_100006820 | Ga0070665_1000068205 | 289 |
| 484 | 3300005548 | Ga0070665_100014818 | Ga0070665_1000148184 | 289 |
| 485 | 3300005548 | Ga0070665_100044628 | Ga0070665_1000446282 | 289 |
| 486 | 3300005549 | Ga0070704_100010310 | Ga0070704_1000103102 | 289 |
| 487 | 3300005549 | Ga0070704_100077775 | Ga0070704_1000777752 | 289 |
| 488 | 3300005563 | Ga0068855_100000437 | Ga0068855_10000043736 | 289 |
| 489 | 3300005563 | Ga0068855_100038423 | Ga0068855_1000384232 | 289 |
| 490 | 3300005563 | Ga0068855_100055606 | Ga0068855_1000556063 | 289 |
| 491 | 3300005563 | Ga0068855_100091052 | Ga0068855_1000910522 | 289 |
| 492 | 3300005564 | Ga0070664_100055187 | Ga0070664_1000551873 | 289 |
| 493 | 3300005564 | Ga0070664_100151814 | Ga0070664_1001518142 | 289 |
| 494 | 3300005577 | Ga0068857_100351296 | Ga0068857_1003512962 | 289 |
| 495 | 3300005614 | Ga0068856_100020667 | Ga0068856_1000206674 | 289 |
| 496 | 3300005614 | Ga0068856_100028863 | Ga0068856_1000288637 | 289 |
| 497 | 3300005615 | Ga0070702_100014533 | Ga0070702_1000145332 | 289 |
| 498 | 3300005615 | Ga0070702_100040731 | Ga0070702_1000407312 | 289 |
| 499 | 3300005616 | Ga0068852_100000703 | Ga0068852_10000070311 | 289 |
| 500 | 3300005617 | Ga0068859_100007313 | Ga0068859_1000073137 | 289 |
| 501 | 3300005617 | Ga0068859_100048377 | Ga0068859_1000483772 | 289 |
| 502 | 3300005617 | Ga0068859_100088067 | Ga0068859_1000880672 | 289 |
| 503 | 3300005618 | Ga0068864_100005836 | Ga0068864_1000058367 | 289 |
| 504 | 3300005618 | Ga0068864_100006991 | Ga0068864_1000069915 | 289 |
| 505 | 3300005618 | Ga0068864_100016447 | Ga0068864_1000164473 | 289 |
| 506 | 3300005618 | Ga0068864_100189124 | Ga0068864_1001891241 | 289 |
| 507 | 3300005618 | Ga0068864_100210914 | Ga0068864_1002109142 | 289 |
| 508 | 3300005718 | Ga0068866_10003843 | Ga0068866_100038436 | 289 |
| 509 | 3300005834 | Ga0068851_10000609 | Ga0068851_100006098 | 289 |
| 510 | 3300005834 | Ga0068851_10006762 | Ga0068851_100067622 | 289 |
| 511 | 3300005840 | Ga0068870_10001373 | Ga0068870_100013732 | 289 |
| 512 | 3300005840 | Ga0068870_10004702 | Ga0068870_100047022 | 289 |
| 513 | 3300005841 | Ga0068863_100011115 | Ga0068863_1000111154 | 289 |
| 514 | 3300005841 | Ga0068863_100013417 | Ga0068863_1000134176 | 289 |
| 515 | 3300005841 | Ga0068863_100076016 | Ga0068863_1000760162 | 289 |
| 516 | 3300005841 | Ga0068863_100129012 | Ga0068863_1001290122 | 289 |
| 517 | 3300005841 | Ga0068863_100210752 | Ga0068863_1002107522 | 289 |
| 518 | 3300005842 | Ga0068858_100036666 | Ga0068858_1000366663 | 289 |
| 519 | 3300005842 | Ga0068858_100082984 | Ga0068858_1000829842 | 289 |
| 520 | 3300005842 | Ga0068858_100239620 | Ga0068858_1002396202 | 289 |
| 521 | 3300005843 | Ga0068860_100027659 | Ga0068860_1000276592 | 289 |
| 522 | 3300005843 | Ga0068860_100029411 | Ga0068860_1000294112 | 289 |
| 523 | 3300005843 | Ga0068860_100031977 | Ga0068860_1000319776 | 289 |
| 524 | 3300005843 | Ga0068860_100065162 | Ga0068860_1000651623 | 289 |
| 525 | 3300005843 | Ga0068860_100120014 | Ga0068860_1001200142 | 289 |
| 526 | 3300005844 | Ga0068862_100004037 | Ga0068862_1000040372 | 289 |
| 527 | 3300005985 | Ga0081539_10027135 | Ga0081539_100271353 | 289 |
| 528 | 3300006163 | Ga0070715_10019149 | Ga0070715_100191491 | 289 |
| 529 | 3300006175 | Ga0070712_100001779 | Ga0070712_1000017795 | 289 |
| 530 | 3300006175 | Ga0070712_100011777 | Ga0070712_1000117774 | 289 |
| 531 | 3300006175 | Ga0070712_100071133 | Ga0070712_1000711332 | 289 |
| 532 | 3300006237 | Ga0097621_100013839 | Ga0097621_1000138395 | 289 |
| 533 | 3300006237 | Ga0097621_100034872 | Ga0097621_1000348724 | 289 |
| 534 | 3300006237 | Ga0097621_100044504 | Ga0097621_1000445043 | 289 |
| 535 | 3300006237 | Ga0097621_100060211 | Ga0097621_1000602113 | 289 |
| 536 | 3300006237 | Ga0097621_100120280 | Ga0097621_1001202802 | 289 |
| 537 | 3300006237 | Ga0097621_100121174 | Ga0097621_1001211741 | 289 |
| 538 | 3300006358 | Ga0068871_100011567 | Ga0068871_1000115673 | 289 |
| 539 | 3300006358 | Ga0068871_100016596 | Ga0068871_1000165962 | 289 |
| 540 | 3300006358 | Ga0068871_100049457 | Ga0068871_1000494572 | 289 |
| 541 | 3300006358 | Ga0068871_100116362 | Ga0068871_1001163622 | 289 |
| 542 | 3300006358 | Ga0068871_100270422 | Ga0068871_1002704222 | 289 |
| 543 | 3300006358 | Ga0068871_100349976 | Ga0068871_1003499761 | 289 |
| 544 | 3300006852 | Ga0075433_10022361 | Ga0075433_100223613 | 289 |
| 545 | 3300006871 | Ga0075434_100002519 | Ga0075434_1000025194 | 289 |
| 546 | 3300006871 | Ga0075434_100249837 | Ga0075434_1002498372 | 289 |
| 547 | 3300006871 | Ga0075434_100364973 | Ga0075434_1003649732 | 289 |
| 548 | 3300006881 | Ga0068865_100017767 | Ga0068865_1000177672 | 289 |
| 549 | 3300006881 | Ga0068865_100053793 | Ga0068865_1000537932 | 289 |
| 550 | 3300006881 | Ga0068865_100130247 | Ga0068865_1001302471 | 289 |
| 551 | 3300006881 | Ga0068865_100189958 | Ga0068865_1001899582 | 289 |
| 552 | 3300006914 | Ga0075436_100001322 | Ga0075436_10000132210 | 289 |
| 553 | 3300006914 | Ga0075436_100168139 | Ga0075436_1001681392 | 289 |
| 554 | 3300006931 | Ga0097620_100007313 | Ga0097620_1000073135 | 289 |
| 555 | 3300006931 | Ga0097620_100048376 | Ga0097620_1000483762 | 289 |
| 556 | 3300006931 | Ga0097620_100088067 | Ga0097620_1000880672 | 289 |
| 557 | 3300007076 | Ga0075435_100018903 | Ga0075435_1000189034 | 289 |
| 558 | 3300007076 | Ga0075435_100038871 | Ga0075435_1000388712 | 289 |
| 559 | 3300009093 | Ga0105240_10038120 | Ga0105240_100381204 | 289 |
| 560 | 3300009094 | Ga0111539_10116285 | Ga0111539_101162853 | 289 |
| 561 | 3300009098 | Ga0105245_10020497 | Ga0105245_100204974 | 289 |
| 562 | 3300009098 | Ga0105245_10034327 | Ga0105245_100343272 | 289 |
| 563 | 3300009098 | Ga0105245_10074575 | Ga0105245_100745752 | 289 |
| 564 | 3300009148 | Ga0105243_10343951 | Ga0105243_103439512 | 289 |
| 565 | 3300009148 | Ga0105243_10358331 | Ga0105243_103583312 | 289 |
| 566 | 3300009174 | Ga0105241_10005305 | Ga0105241_100053055 | 289 |
| 567 | 3300009174 | Ga0105241_10139815 | Ga0105241_101398152 | 289 |
| 568 | 3300009176 | Ga0105242_10046189 | Ga0105242_100461894 | 289 |
| 569 | 3300009176 | Ga0105242_10158523 | Ga0105242_101585231 | 289 |
| 570 | 3300009176 | Ga0105242_10218900 | Ga0105242_102189001 | 289 |
| 571 | 3300009177 | Ga0105248_10002744 | Ga0105248_100027445 | 289 |
| 572 | 3300009177 | Ga0105248_10044391 | Ga0105248_100443913 | 289 |
| 573 | 3300009177 | Ga0105248_10045076 | Ga0105248_100450763 | 289 |
| 574 | 3300009177 | Ga0105248_10087294 | Ga0105248_100872942 | 289 |
| 575 | 3300009177 | Ga0105248_10328763 | Ga0105248_103287632 | 289 |
| 576 | 3300009177 | Ga0105248_10511322 | Ga0105248_105113222 | 289 |
| 577 | 3300009545 | Ga0105237_10101611 | Ga0105237_101016112 | 289 |
| 578 | 3300009551 | Ga0105238_10000708 | Ga0105238_1000070816 | 289 |
| 579 | 3300009551 | Ga0105238_10017077 | Ga0105238_100170772 | 289 |
| 580 | 3300009551 | Ga0105238_10039196 | Ga0105238_100391962 | 289 |
| 581 | 3300013100 | Ga0157373_10000439 | Ga0157373_1000043926 | 289 |
| 582 | 3300013102 | Ga0157371_10214661 | Ga0157371_102146611 | 289 |
| 583 | 3300013104 | Ga0157370_10011154 | Ga0157370_100111545 | 289 |
| 584 | 3300013104 | Ga0157370_10182023 | Ga0157370_101820232 | 289 |
| 585 | 3300013105 | Ga0157369_10001662 | Ga0157369_1000166221 | 289 |
| 586 | 3300013105 | Ga0157369_10028998 | Ga0157369_100289985 | 289 |
| 587 | 3300013105 | Ga0157369_10057558 | Ga0157369_100575583 | 289 |
| 588 | 3300013105 | Ga0157369_10084262 | Ga0157369_100842622 | 289 |
| 589 | 3300013105 | Ga0157369_10426383 | Ga0157369_104263832 | 289 |
| 590 | 3300013296 | Ga0157374_10046348 | Ga0157374_100463481 | 289 |
| 591 | 3300013296 | Ga0157374_10054076 | Ga0157374_100540762 | 289 |
| 592 | 3300013296 | Ga0157374_10126874 | Ga0157374_101268742 | 289 |
| 593 | 3300013297 | Ga0157378_10018814 | Ga0157378_100188145 | 289 |
| 594 | 3300013297 | Ga0157378_10026831 | Ga0157378_100268313 | 289 |
| 595 | 3300013297 | Ga0157378_10111197 | Ga0157378_101111972 | 289 |
| 596 | 3300013297 | Ga0157378_10547524 | Ga0157378_105475241 | 289 |
| 597 | 3300013306 | Ga0163162_10042407 | Ga0163162_100424072 | 289 |
| 598 | 3300013306 | Ga0163162_10045176 | Ga0163162_100451762 | 289 |
| 599 | 3300013306 | Ga0163162_10068889 | Ga0163162_100688893 | 289 |
| 600 | 3300013306 | Ga0163162_10257476 | Ga0163162_102574762 | 289 |
| 601 | 3300013307 | Ga0157372_10002963 | Ga0157372_1000296316 | 289 |
| 602 | 3300013307 | Ga0157372_10003796 | Ga0157372_100037966 | 289 |
| 603 | 3300013307 | Ga0157372_10009842 | Ga0157372_100098422 | 289 |
| 604 | 3300013307 | Ga0157372_10048759 | Ga0157372_100487595 | 289 |
| 605 | 3300013307 | Ga0157372_10093600 | Ga0157372_100936003 | 289 |
| 606 | 3300013307 | Ga0157372_10328567 | Ga0157372_103285672 | 289 |
| 607 | 3300013307 | Ga0157372_10663931 | Ga0157372_106639311 | 289 |
| 608 | 3300013308 | Ga0157375_10008096 | Ga0157375_100080964 | 289 |
| 609 | 3300013308 | Ga0157375_10060084 | Ga0157375_100600843 | 289 |
| 610 | 3300013308 | Ga0157375_10270773 | Ga0157375_102707731 | 289 |
| 611 | 3300014325 | Ga0163163_10032631 | Ga0163163_100326314 | 289 |
| 612 | 3300014968 | Ga0157379_10039514 | Ga0157379_100395143 | 289 |
| 613 | 3300014969 | Ga0157376_10009267 | Ga0157376_100092676 | 289 |
| 614 | 3300014969 | Ga0157376_10056995 | Ga0157376_100569953 | 289 |
| 615 | 3300014969 | Ga0157376_10097230 | Ga0157376_100972302 | 289 |
| 616 | 3300014969 | Ga0157376_10172143 | Ga0157376_101721431 | 289 |
| 617 | 3300014969 | Ga0157376_10205247 | Ga0157376_102052472 | 289 |
| 618 | 3300017792 | Ga0163161_10103349 | Ga0163161_101033492 | 289 |
| 619 | 3300017792 | Ga0163161_10277412 | Ga0163161_102774121 | 289 |
| 620 | 3300025315 | Ga0207697_10022755 | Ga0207697_100227553 | 289 |
| 621 | 3300025321 | Ga0207656_10061372 | Ga0207656_100613722 | 289 |
| 622 | 3300025321 | Ga0207656_10116215 | Ga0207656_101162151 | 289 |
| 623 | 3300025885 | Ga0207653_10003878 | Ga0207653_100038785 | 289 |
| 624 | 3300025893 | Ga0207682_10000061 | Ga0207682_100000618 | 289 |
| 625 | 3300025898 | Ga0207692_10002535 | Ga0207692_100025354 | 289 |
| 626 | 3300025898 | Ga0207692_10003513 | Ga0207692_100035132 | 289 |
| 627 | 3300025899 | Ga0207642_10034580 | Ga0207642_100345802 | 289 |
| 628 | 3300025900 | Ga0207710_10012018 | Ga0207710_100120183 | 289 |
| 629 | 3300025903 | Ga0207680_10024123 | Ga0207680_100241232 | 289 |
| 630 | 3300025903 | Ga0207680_10044079 | Ga0207680_100440792 | 289 |
| 631 | 3300025903 | Ga0207680_10047484 | Ga0207680_100474842 | 289 |
| 632 | 3300025903 | Ga0207680_10062397 | Ga0207680_100623972 | 289 |
| 633 | 3300025905 | Ga0207685_10044182 | Ga0207685_100441822 | 289 |
| 634 | 3300025906 | Ga0207699_10043946 | Ga0207699_100439462 | 289 |
| 635 | 3300025906 | Ga0207699_10269112 | Ga0207699_102691121 | 289 |
| 636 | 3300025907 | Ga0207645_10000143 | Ga0207645_1000014344 | 289 |
| 637 | 3300025907 | Ga0207645_10055232 | Ga0207645_100552322 | 289 |
| 638 | 3300025908 | Ga0207643_10000189 | Ga0207643_1000018932 | 289 |
| 639 | 3300025908 | Ga0207643_10019153 | Ga0207643_100191532 | 289 |
| 640 | 3300025909 | Ga0207705_10143446 | Ga0207705_101434462 | 289 |
| 641 | 3300025910 | Ga0207684_10065825 | Ga0207684_100658253 | 289 |
| 642 | 3300025911 | Ga0207654_10044322 | Ga0207654_100443222 | 289 |
| 643 | 3300025911 | Ga0207654_10143878 | Ga0207654_101438782 | 289 |
| 644 | 3300025912 | Ga0207707_10000305 | Ga0207707_1000030533 | 289 |
| 645 | 3300025912 | Ga0207707_10020405 | Ga0207707_100204054 | 289 |
| 646 | 3300025912 | Ga0207707_10189322 | Ga0207707_101893222 | 289 |
| 647 | 3300025913 | Ga0207695_10074702 | Ga0207695_100747023 | 289 |
| 648 | 3300025913 | Ga0207695_10092785 | Ga0207695_100927853 | 289 |
| 649 | 3300025913 | Ga0207695_10223022 | Ga0207695_102230221 | 289 |
| 650 | 3300025913 | Ga0207695_10362570 | Ga0207695_103625702 | 289 |
| 651 | 3300025915 | Ga0207693_10000605 | Ga0207693_100006053 | 289 |
| 652 | 3300025915 | Ga0207693_10011952 | Ga0207693_100119523 | 289 |
| 653 | 3300025916 | Ga0207663_10008229 | Ga0207663_100082292 | 289 |
| 654 | 3300025917 | Ga0207660_10001522 | Ga0207660_1000152216 | 289 |
| 655 | 3300025918 | Ga0207662_10008136 | Ga0207662_100081363 | 289 |
| 656 | 3300025918 | Ga0207662_10144512 | Ga0207662_101445122 | 289 |
| 657 | 3300025919 | Ga0207657_10000236 | Ga0207657_1000023623 | 289 |
| 658 | 3300025919 | Ga0207657_10001274 | Ga0207657_1000127418 | 289 |
| 659 | 3300025920 | Ga0207649_10033132 | Ga0207649_100331322 | 289 |
| 660 | 3300025920 | Ga0207649_10117584 | Ga0207649_101175842 | 289 |
| 661 | 3300025921 | Ga0207652_10000572 | Ga0207652_1000057212 | 289 |
| 662 | 3300025921 | Ga0207652_10078209 | Ga0207652_100782092 | 289 |
| 663 | 3300025921 | Ga0207652_10337729 | Ga0207652_103377292 | 289 |
| 664 | 3300025922 | Ga0207646_10037621 | Ga0207646_100376213 | 289 |
| 665 | 3300025923 | Ga0207681_10124618 | Ga0207681_101246182 | 289 |
| 666 | 3300025923 | Ga0207681_10320574 | Ga0207681_103205742 | 289 |
| 667 | 3300025924 | Ga0207694_10016977 | Ga0207694_100169774 | 289 |
| 668 | 3300025924 | Ga0207694_10067079 | Ga0207694_100670792 | 289 |
| 669 | 3300025925 | Ga0207650_10006656 | Ga0207650_100066563 | 289 |
| 670 | 3300025925 | Ga0207650_10052022 | Ga0207650_100520222 | 289 |
| 671 | 3300025925 | Ga0207650_10125870 | Ga0207650_101258702 | 289 |
| 672 | 3300025925 | Ga0207650_10182762 | Ga0207650_101827622 | 289 |
| 673 | 3300025925 | Ga0207650_10215442 | Ga0207650_102154422 | 289 |
| 674 | 3300025926 | Ga0207659_10001702 | Ga0207659_1000170210 | 289 |
| 675 | 3300025926 | Ga0207659_10281472 | Ga0207659_102814722 | 289 |
| 676 | 3300025927 | Ga0207687_10009538 | Ga0207687_100095386 | 289 |
| 677 | 3300025927 | Ga0207687_10012063 | Ga0207687_100120634 | 289 |
| 678 | 3300025927 | Ga0207687_10332628 | Ga0207687_103326281 | 289 |
| 679 | 3300025928 | Ga0207700_10003435 | Ga0207700_100034354 | 289 |
| 680 | 3300025928 | Ga0207700_10024869 | Ga0207700_100248693 | 289 |
| 681 | 3300025928 | Ga0207700_10039165 | Ga0207700_100391652 | 289 |
| 682 | 3300025928 | Ga0207700_10055501 | Ga0207700_100555012 | 289 |
| 683 | 3300025928 | Ga0207700_10201327 | Ga0207700_102013272 | 289 |
| 684 | 3300025929 | Ga0207664_10003667 | Ga0207664_100036674 | 289 |
| 685 | 3300025929 | Ga0207664_10190681 | Ga0207664_101906812 | 289 |
| 686 | 3300025929 | Ga0207664_10204825 | Ga0207664_102048252 | 289 |
| 687 | 3300025931 | Ga0207644_10003631 | Ga0207644_100036313 | 289 |
| 688 | 3300025931 | Ga0207644_10004584 | Ga0207644_100045843 | 289 |
| 689 | 3300025931 | Ga0207644_10006445 | Ga0207644_100064453 | 289 |
| 690 | 3300025931 | Ga0207644_10016308 | Ga0207644_100163084 | 289 |
| 691 | 3300025931 | Ga0207644_10282982 | Ga0207644_102829822 | 289 |
| 692 | 3300025932 | Ga0207690_10004905 | Ga0207690_100049052 | 289 |
| 693 | 3300025932 | Ga0207690_10295821 | Ga0207690_102958211 | 289 |
| 694 | 3300025933 | Ga0207706_10002271 | Ga0207706_1000227112 | 289 |
| 695 | 3300025933 | Ga0207706_10045007 | Ga0207706_100450072 | 289 |
| 696 | 3300025933 | Ga0207706_10221465 | Ga0207706_102214652 | 289 |
| 697 | 3300025933 | Ga0207706_10237589 | Ga0207706_102375892 | 289 |
| 698 | 3300025934 | Ga0207686_10000645 | Ga0207686_100006456 | 289 |
| 699 | 3300025936 | Ga0207670_10060956 | Ga0207670_100609563 | 289 |
| 700 | 3300025937 | Ga0207669_10008113 | Ga0207669_100081135 | 289 |
| 701 | 3300025937 | Ga0207669_10017690 | Ga0207669_100176903 | 289 |
| 702 | 3300025938 | Ga0207704_10007762 | Ga0207704_100077623 | 289 |
| 703 | 3300025938 | Ga0207704_10028961 | Ga0207704_100289612 | 289 |
| 704 | 3300025939 | Ga0207665_10015015 | Ga0207665_100150153 | 289 |
| 705 | 3300025939 | Ga0207665_10100732 | Ga0207665_101007322 | 289 |
| 706 | 3300025940 | Ga0207691_10000016 | Ga0207691_10000016112 | 289 |
| 707 | 3300025940 | Ga0207691_10042719 | Ga0207691_100427195 | 289 |
| 708 | 3300025940 | Ga0207691_10128007 | Ga0207691_101280072 | 289 |
| 709 | 3300025940 | Ga0207691_10165735 | Ga0207691_101657352 | 289 |
| 710 | 3300025940 | Ga0207691_10268575 | Ga0207691_102685752 | 289 |
| 711 | 3300025941 | Ga0207711_10009671 | Ga0207711_100096717 | 289 |
| 712 | 3300025941 | Ga0207711_10017357 | Ga0207711_100173575 | 289 |
| 713 | 3300025941 | Ga0207711_10125413 | Ga0207711_101254132 | 289 |
| 714 | 3300025941 | Ga0207711_10356136 | Ga0207711_103561362 | 289 |
| 715 | 3300025941 | Ga0207711_10425171 | Ga0207711_104251711 | 289 |
| 716 | 3300025942 | Ga0207689_10000870 | Ga0207689_1000087012 | 289 |
| 717 | 3300025942 | Ga0207689_10056631 | Ga0207689_100566313 | 289 |
| 718 | 3300025945 | Ga0207679_10003252 | Ga0207679_100032525 | 289 |
| 719 | 3300025949 | Ga0207667_10008179 | Ga0207667_100081799 | 289 |
| 720 | 3300025949 | Ga0207667_10016005 | Ga0207667_100160054 | 289 |
| 721 | 3300025949 | Ga0207667_10049453 | Ga0207667_100494533 | 289 |
| 722 | 3300025949 | Ga0207667_10207472 | Ga0207667_102074722 | 289 |
| 723 | 3300025949 | Ga0207667_10252738 | Ga0207667_102527382 | 289 |
| 724 | 3300025960 | Ga0207651_10018254 | Ga0207651_100182543 | 289 |
| 725 | 3300025960 | Ga0207651_10052906 | Ga0207651_100529062 | 289 |
| 726 | 3300025960 | Ga0207651_10072307 | Ga0207651_100723072 | 289 |
| 727 | 3300025960 | Ga0207651_10076859 | Ga0207651_100768592 | 289 |
| 728 | 3300025972 | Ga0207668_10176463 | Ga0207668_101764632 | 289 |
| 729 | 3300025981 | Ga0207640_10172372 | Ga0207640_101723721 | 289 |
| 730 | 3300025981 | Ga0207640_10286805 | Ga0207640_102868051 | 289 |
| 731 | 3300025986 | Ga0207658_10001061 | Ga0207658_100010616 | 289 |
| 732 | 3300025986 | Ga0207658_10016917 | Ga0207658_100169175 | 289 |
| 733 | 3300025986 | Ga0207658_10035560 | Ga0207658_100355603 | 289 |
| 734 | 3300025986 | Ga0207658_10052140 | Ga0207658_100521402 | 289 |
| 735 | 3300025986 | Ga0207658_10355730 | Ga0207658_103557302 | 289 |
| 736 | 3300026023 | Ga0207677_10000384 | Ga0207677_100003847 | 289 |
| 737 | 3300026023 | Ga0207677_10002748 | Ga0207677_100027482 | 289 |
| 738 | 3300026023 | Ga0207677_10057180 | Ga0207677_100571802 | 289 |
| 739 | 3300026023 | Ga0207677_10101504 | Ga0207677_101015042 | 289 |
| 740 | 3300026023 | Ga0207677_10103963 | Ga0207677_101039631 | 289 |
| 741 | 3300026023 | Ga0207677_10188900 | Ga0207677_101889002 | 289 |
| 742 | 3300026023 | Ga0207677_10416425 | Ga0207677_104164251 | 289 |
| 743 | 3300026035 | Ga0207703_10006066 | Ga0207703_100060667 | 289 |
| 744 | 3300026035 | Ga0207703_10112800 | Ga0207703_101128002 | 289 |
| 745 | 3300026035 | Ga0207703_10195956 | Ga0207703_101959562 | 289 |
| 746 | 3300026041 | Ga0207639_10010013 | Ga0207639_100100135 | 289 |
| 747 | 3300026041 | Ga0207639_10021047 | Ga0207639_100210472 | 289 |
| 748 | 3300026041 | Ga0207639_10041646 | Ga0207639_100416462 | 289 |
| 749 | 3300026041 | Ga0207639_10291402 | Ga0207639_102914021 | 289 |
| 750 | 3300026041 | Ga0207639_10455095 | Ga0207639_104550951 | 289 |
| 751 | 3300026067 | Ga0207678_10001044 | Ga0207678_100010449 | 289 |
| 752 | 3300026067 | Ga0207678_10109464 | Ga0207678_101094642 | 289 |
| 753 | 3300026078 | Ga0207702_10001008 | Ga0207702_1000100815 | 289 |
| 754 | 3300026078 | Ga0207702_10005727 | Ga0207702_100057272 | 289 |
| 755 | 3300026078 | Ga0207702_10103108 | Ga0207702_101031082 | 289 |
| 756 | 3300026088 | Ga0207641_10005288 | Ga0207641_100052883 | 289 |
| 757 | 3300026088 | Ga0207641_10011902 | Ga0207641_100119024 | 289 |
| 758 | 3300026088 | Ga0207641_10026296 | Ga0207641_100262962 | 289 |
| 759 | 3300026088 | Ga0207641_10032429 | Ga0207641_100324292 | 289 |
| 760 | 3300026088 | Ga0207641_10189247 | Ga0207641_101892472 | 289 |
| 761 | 3300026088 | Ga0207641_10365618 | Ga0207641_103656182 | 289 |
| 762 | 3300026089 | Ga0207648_10007158 | Ga0207648_100071585 | 289 |
| 763 | 3300026089 | Ga0207648_10018464 | Ga0207648_100184642 | 289 |
| 764 | 3300026089 | Ga0207648_10151795 | Ga0207648_101517952 | 289 |
| 765 | 3300026095 | Ga0207676_10000680 | Ga0207676_1000068015 | 289 |
| 766 | 3300026095 | Ga0207676_10007971 | Ga0207676_100079713 | 289 |
| 767 | 3300026095 | Ga0207676_10011804 | Ga0207676_100118044 | 289 |
| 768 | 3300026095 | Ga0207676_10079615 | Ga0207676_100796152 | 289 |
| 769 | 3300026095 | Ga0207676_10183509 | Ga0207676_101835092 | 289 |
| 770 | 3300026116 | Ga0207674_10000170 | Ga0207674_1000017047 | 289 |
| 771 | 3300026118 | Ga0207675_100008544 | Ga0207675_10000854412 | 289 |
| 772 | 3300026118 | Ga0207675_100019790 | Ga0207675_1000197904 | 289 |
| 773 | 3300026118 | Ga0207675_100036156 | Ga0207675_1000361562 | 289 |
| 774 | 3300026121 | Ga0207683_10000322 | Ga0207683_1000032242 | 289 |
| 775 | 3300026121 | Ga0207683_10000509 | Ga0207683_1000050913 | 289 |
| 776 | 3300026121 | Ga0207683_10003454 | Ga0207683_100034546 | 289 |
| 777 | 3300026121 | Ga0207683_10046212 | Ga0207683_100462122 | 289 |
| 778 | 3300026121 | Ga0207683_10173692 | Ga0207683_101736922 | 289 |
| 779 | 3300026142 | Ga0207698_10000642 | Ga0207698_1000064217 | 289 |
| 780 | 3300026142 | Ga0207698_10003296 | Ga0207698_100032968 | 289 |
| 781 | 3300026142 | Ga0207698_10010650 | Ga0207698_100106505 | 289 |
| 782 | 3300026142 | Ga0207698_10380427 | Ga0207698_103804272 | 289 |
| 783 | 3300026142 | Ga0207698_10384677 | Ga0207698_103846772 | 289 |
| 784 | 3300028379 | Ga0268266_10022455 | Ga0268266_100224553 | 289 |
| 785 | 3300028379 | Ga0268266_10134616 | Ga0268266_101346162 | 289 |
| 786 | 3300028380 | Ga0268265_10021151 | Ga0268265_100211516 | 289 |
| 787 | 3300028381 | Ga0268264_10008834 | Ga0268264_100088342 | 289 |
| 788 | 3300028381 | Ga0268264_10048059 | Ga0268264_100480592 | 289 |
| 789 | 3300028381 | Ga0268264_10230150 | Ga0268264_102301502 | 289 |
| 790 | 3300031711 | Ga0265314_10053352 | Ga0265314_100533522 | 289 |
| 791 | 3300035086 | Ga0373934_0010053 | Ga0373934_0010053_666_1616 | 289 |
| 792 | 3300035088 | Ga0373940_0011064 | Ga0373940_0011064_625_1572 | 289 |
| 793 | 3300035111 | Ga0373923_0020985 | Ga0373923_0020985_761_1711 | 289 |
| 794 | 3300035117 | Ga0373953_0004854 | Ga0373953_0004854_3297_4247 | 289 |
| 795 | 3300035118 | Ga0373954_0002489 | Ga0373954_0002489_308_1258 | 289 |
| 796 | 3300035119 | Ga0373956_0087017 | Ga0373956_0087017_351_1301 | 289 |
| 797 | 3300035170 | Ga0373943_0008311 | Ga0373943_0008311_1530_2480 | 289 |
| 798 | 3300035171 | Ga0373946_0046071 | Ga0373946_0046071_339_1289 | 289 |
| 799 | 3300035242 | Ga0373962_0031480 | Ga0373962_0031480_27_974 | 289 |
| 800 | 3300035691 | Ga0373931_0007359 | Ga0373931_0007359_2950_3897 | 289 |
| 801 | 3300035691 | Ga0373931_0142592 | Ga0373931_0142592_363_1310 | 289 |
| 802 | 3300035695 | Ga0373927_0015750 | Ga0373927_0015750_3466_4416 | 289 |
| 803 | 3300035695 | Ga0373927_0079068 | Ga0373927_0079068_82_1032 | 289 |
| 804 | 3300035724 | Ga0373933_0112349 | Ga0373933_0112349_72_1022 | 289 |
| 805 | 3300035725 | Ga0373947_0083805 | Ga0373947_0083805_69_1019 | 289 |
| 806 | 3300036401 | Ga0373937_0008460 | Ga0373937_0008460_626_1576 | 289 |
| 807 | 3300036401 | Ga0373937_0075441 | Ga0373937_0075441_1161_2168 | 289 |
| 808 | 3300036401 | Ga0373937_0227554 | Ga0373937_0227554_225_1175 | 289 |
| 809 | 3300037068 | Ga0373925_0132538 | Ga0373925_0132538_904_1854 | 289 |
| 810 | 3300037418 | Ga0395900_0016897 | Ga0395900_0016897_6368_7318 | 289 |
| 811 | 3300037471 | Ga0395905_0049773 | Ga0395905_0049773_805_1755 | 289 |
| 812 | 3300037853 | Ga0436364_1025804 | Ga0436364_1025804_1580_2512 | 289 |
| 813 | 3300042438 | Ga0439459_0001956 | Ga0439459_0001956_1790_2737 | 289 |
| 814 | 3300042876 | Ga0451577_0064526 | Ga0451577_0064526_20_967 | 289 |
| 815 | 3300042876 | Ga0451577_0150408 | Ga0451577_0150408_232_1170 | 289 |
| 816 | 3300042876 | Ga0451577_0220672 | Ga0451577_0220672_483_1433 | 289 |
| 817 | 3300044694 | Ga0466963_0228293 | Ga0466963_0228293_25_972 | 289 |
| 818 | 3300044712 | Ga0453684_0055553 | Ga0453684_0055553_262_1209 | 289 |
| 819 | 3300046472 | Ga0495580_0224142 | Ga0495580_0224142_311_1261 | 289 |
| 820 | 3300046476 | Ga0495662_0165348 | Ga0495662_0165348_110_1060 | 289 |
| 821 | 3300046491 | Ga0495584_0000168 | Ga0495584_0000168_11089_12033 | 289 |
| 822 | 3300046516 | Ga0495628_0230400 | Ga0495628_0230400_103_1053 | 289 |
| 823 | 3300046525 | Ga0495663_0022905 | Ga0495663_0022905_619_1566 | 289 |
| 824 | 3300046536 | Ga0495587_0064135 | Ga0495587_0064135_1039_1989 | 289 |
| 825 | 3300046539 | Ga0495621_0006382 | Ga0495621_0006382_2332_3282 | 289 |
| 826 | 3300046559 | Ga0495667_0137195 | Ga0495667_0137195_405_1352 | 289 |
| 827 | 3300046663 | Ga0495635_0266289 | Ga0495635_0266289_122_1072 | 289 |
| 828 | 3300046679 | Ga0495623_0115052 | Ga0495623_0115052_617_1567 | 289 |
| 829 | 3300047444 | Ga0495675_0214724 | Ga0495675_0214724_118_1068 | 289 |
| 830 | 3300048903 | Ga0496100_0410807 | Ga0496100_0410807_20_970 | 289 |
| 831 | 3300048904 | Ga0496101_0029580 | Ga0496101_0029580_1164_2114 | 289 |
| 832 | 3300048907 | Ga0496104_0020829 | Ga0496104_0020829_3424_4371 | 289 |
| 833 | 3300048907 | Ga0496104_0040428 | Ga0496104_0040428_2170_3120 | 289 |
| 834 | 3300048908 | Ga0496105_0006517 | Ga0496105_0006517_7757_8707 | 289 |
| 835 | 3300048910 | Ga0496107_0066533 | Ga0496107_0066533_924_1874 | 289 |
| 836 | 3300048911 | Ga0496108_0152100 | Ga0496108_0152100_783_1733 | 289 |
| 837 | 3300048911 | Ga0496108_0373306 | Ga0496108_0373306_116_1066 | 289 |
| 838 | 3300048912 | Ga0496109_0094111 | Ga0496109_0094111_638_1588 | 289 |
| 839 | 3300048912 | Ga0496109_0417777 | Ga0496109_0417777_111_1058 | 289 |
| 840 | 3300048913 | Ga0496110_0517000 | Ga0496110_0517000_24_971 | 289 |
| 841 | 3300048915 | Ga0496112_0006527 | Ga0496112_0006527_5295_6245 | 289 |
| 842 | 3300048915 | Ga0496112_0008103 | Ga0496112_0008103_14_964 | 289 |
| 843 | 3300048915 | Ga0496112_0032832 | Ga0496112_0032832_2603_3550 | 289 |
| 844 | 3300048915 | Ga0496112_0460646 | Ga0496112_0460646_122_1072 | 289 |
| 845 | 3300048917 | Ga0496114_0314532 | Ga0496114_0314532_353_1303 | 289 |
| 846 | 3300049580 | Ga0501046_0390742 | Ga0501046_0390742_26_976 | 289 |
| 847 | 3300050512 | nmdc:mga0n895_19318_c1 | nmdc:mga0n895_19318_c1_1623_2570 | 289 |
| 848 | 3300050512 | nmdc:mga0n895_394822_c1 | nmdc:mga0n895_394822_c1_390_1337 | 289 |
| 849 | 3300050512 | nmdc:mga0n895_6915_c1 | nmdc:mga0n895_6915_c1_2406_3353 | 289 |
| 850 | 3300050513 | nmdc:mga0rr50_18244_c1 | nmdc:mga0rr50_18244_c1_1987_2934 | 289 |
| 851 | 3300050513 | nmdc:mga0rr50_64843_c1 | nmdc:mga0rr50_64843_c1_1325_2272 | 289 |
| 852 | 3300050514 | nmdc:mga08x19_14568_c1 | nmdc:mga08x19_14568_c1_284_1231 | 289 |
| 853 | 3300050515 | nmdc:mga0a205_9042_c1 | nmdc:mga0a205_9042_c1_5802_6749 | 289 |
| 854 | 3300054114 | Ga0501084_0038988 | Ga0501084_0038988_2234_3184 | 289 |
| 855 | iso_pu_bacteria | 2904483920 | 2904489910 | 292 |
| 856 | iso_pu_bacteria | 641736151 | 642425821 | 292 |
| 857 | 3300002067 | JGI24735J21928_10014625 | JGI24735J21928_100146252 | 296 |
| 858 | 3300003214 | JGI25165J46597_1000824 | JGI25165J46597_10008247 | 296 |
| 859 | 3300003322 | rootL2_10348385 | rootL2_103483852 | 296 |
| 860 | 3300003758 | Ga0055532_1000297 | Ga0055532_100029712 | 296 |
| 861 | 3300003758 | Ga0055532_1000435 | Ga0055532_10004354 | 296 |
| 862 | 3300003760 | Ga0055527_1000236 | Ga0055527_100023616 | 296 |
| 863 | 3300003761 | Ga0055535_1000503 | Ga0055535_100050316 | 296 |
| 864 | 3300003762 | Ga0055542_1000521 | Ga0055542_100052116 | 296 |
| 865 | 3300003763 | Ga0055529_1000510 | Ga0055529_100051016 | 296 |
| 866 | 3300009011 | Ga0105251_10073050 | Ga0105251_100730502 | 296 |
| 867 | 3300013105 | Ga0157369_10060917 | Ga0157369_100609172 | 296 |
| 868 | 3300025228 | Ga0209672_100021 | Ga0209672_10002115 | 296 |
| 869 | 3300025229 | Ga0209147_100025 | Ga0209147_10002515 | 296 |
| 870 | 3300025231 | Ga0207427_101253 | Ga0207427_1012537 | 296 |
| 871 | 3300025242 | Ga0209258_100037 | Ga0209258_10003715 | 296 |
| 872 | 3300025254 | Ga0209148_1000049 | Ga0209148_100004915 | 296 |
| 873 | 3300025261 | Ga0209233_1000091 | Ga0209233_100009115 | 296 |
| 874 | 3300025272 | Ga0209455_1000041 | Ga0209455_100004115 | 296 |
| 875 | 3300025904 | Ga0207647_10001055 | Ga0207647_1000105515 | 296 |
| 876 | 3300046690 | Ga0495624_0010270 | Ga0495624_0010270_5382_6329 | 296 |
| 877 | 3300047319 | Ga0495674_0001621 | Ga0495674_0001621_2939_3886 | 296 |
| 878 | 3300047321 | Ga0495676_0105426 | Ga0495676_0105426_53_1000 | 296 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dbl-assembly2.cif.gz_F | crystal structure of e159q mutant of btucdf | 0.5045 | 14 | 288 |
| 7kyp-assembly4.cif.gz_N | psabc from streptococcus pneumoniae in complex with fab | 0.4637 | 10 | 282 |
| 4dbl-assembly2.cif.gz_F | crystal structure of e159q mutant of btucdf | 0.463 | 14 | 288 |
| 4dbl-assembly1.cif.gz_B | crystal structure of e159q mutant of btucdf | 0.4608 | 14 | 288 |
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.4564 | 7 | 288 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AEX7_11_292_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.777 | 8 | 283 | 1.10.3470.10 |
| af_P0AEX7_11_292_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7591 | 8 | 283 | 1.10.3470.10 |
| af_Q58665_14_295_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7193 | 8 | 285 | 1.10.3470.10 |
| af_Q58665_14_295_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7077 | 8 | 285 | 1.10.3470.10 |
| af_P37772_34_305_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.6951 | 9 | 286 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4P7CXW1-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9151 | 1 | 296 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A4P7CXW1-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9121 | 1 | 296 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A7V8JST9-F1-model_v4 | High-affinity branched-chain amino acid transport system permease protein LivH | 0.9054 | 1 | 213 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A436D355-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9042 | 1 | 235 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A3D1J3F0-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9023 | 1 | 220 |
GO:0005886
GO:0006865 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar