F484427

General Info

Members Datasets Scaffolds Average Seq Length
878 281 876 309

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0075441|Ga0373937_0075441_1161_2168
Length 335
Sequence MAAVRVAVRPILPTRRESAMLELATISLLNGVVYGLLLFMLTSGLTLIFSMMGVLNFAHASIFMLGAYFSWQLSRWIGFWPALVVAPLLCGVAGAAIERYGLRHVHKRGHVAEILFTFGLAYVIEELVTMIWGRNAVANGVPRAIDFPLFHLFGSSFPAYKGLMMAISVAMFAFLYVALKRTRVGLVIRAALTHPQMVGALGHDVPRIFVLVFALGSALAGLAGVIGGFMWLTQPTLAHAVGPIVFVVVVLGGLGSLAGALIASMLIGILQTLAVAVDYSLLDLFRVAGVTIARSSPWYDLCSIRVATAAPIVPYLLLVLMLVVRPRGLLGTRDA

Samples

Sample ID Description Type Environment
1 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
8 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
91 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
139 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
215 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
216 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
218 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
219 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
220 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
221 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
222 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
223 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
224 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
227 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
228 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
232 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
233 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
234 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
235 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
236 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
237 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
242 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
243 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
246 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
247 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
251 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
252 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
271 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.59
Nodule 0
Rhizoplane 3.87
Rhizosphere 94.19
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10014625 3300002067 Unclassified 2456
2 JGI24035J26624_1003066 3300002126 Bacteria 1562
3 JGI24033J26618_1004127 3300002155 Bacteria 1557
4 JGI25165J46597_1000824 3300003214 Bacteria 23238
5 rootL2_10348385 3300003322 Bacteria 2491
6 Ga0055532_1000297 3300003758 Bacteria 30678
7 Ga0055532_1000435 3300003758 Bacteria 19731
8 Ga0055527_1000236 3300003760 Bacteria 34738
9 Ga0055535_1000503 3300003761 Bacteria 34738
10 Ga0055542_1000521 3300003762 Bacteria 34738
11 Ga0055529_1000510 3300003763 Bacteria 34738
12 Ga0065712_10121336 3300005290 Bacteria 1666
13 Ga0065715_10105456 3300005293 Bacteria 2891
14 Ga0065715_10163288 3300005293 Bacteria 1609
15 Ga0065707_10041460 3300005295 Bacteria 1297
16 Ga0070658_10042562 3300005327 Bacteria 3668
17 Ga0070658_10240915 3300005327 Bacteria 1533
18 Ga0070658_10276831 3300005327 Bacteria 1428
19 Ga0070676_10023491 3300005328 Bacteria 3466
20 Ga0070676_10065363 3300005328 Bacteria 2171
21 Ga0070683_100072461 3300005329 Bacteria 3215
22 Ga0070683_100180217 3300005329 Bacteria 2005
23 Ga0070690_100000937 3300005330 Bacteria 14894
24 Ga0070690_100007555 3300005330 Bacteria 6223
25 Ga0070690_100101313 3300005330 Bacteria 1910
26 Ga0070690_100278225 3300005330 Bacteria 1193
27 Ga0070670_100005195 3300005331 Bacteria 10960
28 Ga0070670_100006021 3300005331 Bacteria 10254
29 Ga0070670_100013131 3300005331 Bacteria 7095
30 Ga0070670_100088410 3300005331 Bacteria 2663
31 Ga0070670_100101790 3300005331 Bacteria 2473
32 Ga0070677_10000311 3300005333 Bacteria 16974
33 Ga0070677_10009260 3300005333 Bacteria 3335
34 Ga0070677_10023257 3300005333 Bacteria 2293
35 Ga0070677_10101402 3300005333 Bacteria 1270
36 Ga0068869_100003339 3300005334 Bacteria 9801
37 Ga0068869_100004702 3300005334 Bacteria 8519
38 Ga0068869_100005299 3300005334 Bacteria 8104
39 Ga0068869_100006404 3300005334 Bacteria 7465
40 Ga0068869_100063480 3300005334 Bacteria 2714
41 Ga0068869_100367124 3300005334 Bacteria 1177
42 Ga0070666_10015499 3300005335 Bacteria 4863
43 Ga0070666_10021926 3300005335 Bacteria 4143
44 Ga0070666_10031845 3300005335 Bacteria 3482
45 Ga0070680_100031635 3300005336 Bacteria 4255
46 Ga0070680_100043480 3300005336 Bacteria 3649
47 Ga0070680_100050144 3300005336 Bacteria 3404
48 Ga0070682_100002642 3300005337 Bacteria 9902
49 Ga0070682_100016272 3300005337 Bacteria 4323
50 Ga0068868_100001088 3300005338 Bacteria 18600
51 Ga0068868_100014606 3300005338 Bacteria 5792
52 Ga0068868_100021157 3300005338 Bacteria 4898
53 Ga0068868_100109971 3300005338 Bacteria 2239
54 Ga0068868_100164832 3300005338 Bacteria 1832
55 Ga0068868_100235349 3300005338 Bacteria 1537
56 Ga0070660_100001240 3300005339 Bacteria 17325
57 Ga0070660_100001443 3300005339 Bacteria 16236
58 Ga0070660_100175395 3300005339 Bacteria 1733
59 Ga0070689_100004319 3300005340 Bacteria 9594
60 Ga0070689_100014876 3300005340 Bacteria 5662
61 Ga0070689_100027007 3300005340 Bacteria 4326
62 Ga0070689_100138058 3300005340 Bacteria 1959
63 Ga0070689_100157011 3300005340 Bacteria 1837
64 Ga0070689_100224098 3300005340 Bacteria 1543
65 Ga0070691_10040765 3300005341 Bacteria 2195
66 Ga0070687_100003610 3300005343 Bacteria 6037
67 Ga0070687_100011438 3300005343 Bacteria 3882
68 Ga0070687_100054981 3300005343 Bacteria 2076
69 Ga0070687_100141042 3300005343 Bacteria 1404
70 Ga0070661_100000422 3300005344 Bacteria 32487
71 Ga0070661_100001121 3300005344 Bacteria 18811
72 Ga0070661_100083999 3300005344 Bacteria 2352
73 Ga0070661_100263411 3300005344 Bacteria 1333
74 Ga0070661_100280508 3300005344 Bacteria 1292
75 Ga0070661_100284007 3300005344 Bacteria 1284
76 Ga0070692_10069497 3300005345 Bacteria 1873
77 Ga0070692_10084663 3300005345 Bacteria 1714
78 Ga0070668_100003855 3300005347 Bacteria 11068
79 Ga0070668_100023182 3300005347 Bacteria 4693
80 Ga0070668_100035230 3300005347 Bacteria 3816
81 Ga0070668_100448542 3300005347 Bacteria 1109
82 Ga0070669_100242731 3300005353 Bacteria 1432
83 Ga0070669_100290210 3300005353 Bacteria 1313
84 Ga0070675_100004306 3300005354 Bacteria 10851
85 Ga0070675_100004789 3300005354 Bacteria 10319
86 Ga0070675_100063250 3300005354 Bacteria 3059
87 Ga0070675_100122702 3300005354 Bacteria 2208
88 Ga0070675_100471622 3300005354 Bacteria 1128
89 Ga0070671_100000758 3300005355 Bacteria 23124
90 Ga0070671_100007181 3300005355 Bacteria 8905
91 Ga0070671_100008280 3300005355 Bacteria 8323
92 Ga0070671_100018968 3300005355 Bacteria 5593
93 Ga0070671_100042621 3300005355 Bacteria 3773
94 Ga0070671_100254550 3300005355 Bacteria 1492
95 Ga0070671_100264882 3300005355 Bacteria 1461
96 Ga0070674_100000539 3300005356 Bacteria 19016
97 Ga0070674_100049758 3300005356 Bacteria 2883
98 Ga0070674_100095624 3300005356 Bacteria 2154
99 Ga0070673_100008416 3300005364 Bacteria 6859
100 Ga0070673_100017502 3300005364 Bacteria 5099
101 Ga0070673_100037562 3300005364 Bacteria 3691
102 Ga0070673_100074239 3300005364 Bacteria 2740
103 Ga0070673_100096181 3300005364 Bacteria 2430
104 Ga0070673_100099891 3300005364 Bacteria 2388
105 Ga0070673_100103085 3300005364 Bacteria 2353
106 Ga0070688_100048802 3300005365 Bacteria 2632
107 Ga0070688_100089398 3300005365 Bacteria 2010
108 Ga0070688_100202702 3300005365 Bacteria 1389
109 Ga0070688_100209997 3300005365 Bacteria 1366
110 Ga0070659_100003747 3300005366 Bacteria 10844
111 Ga0070659_100038438 3300005366 Bacteria 3733
112 Ga0070659_100041362 3300005366 Bacteria 3603
113 Ga0070659_100054906 3300005366 Bacteria 3138
114 Ga0070659_100107228 3300005366 Bacteria 2252
115 Ga0070667_100012929 3300005367 Bacteria 6900
116 Ga0070667_100023042 3300005367 Bacteria 5165
117 Ga0070667_100033086 3300005367 Bacteria 4317
118 Ga0070667_100060942 3300005367 Bacteria 3194
119 Ga0070703_10001200 3300005406 Bacteria 7955
120 Ga0070709_10125456 3300005434 Bacteria 1746
121 Ga0070714_100001293 3300005435 Bacteria 18094
122 Ga0070714_100040851 3300005435 Bacteria 3911
123 Ga0070714_100162116 3300005435 Bacteria 2024
124 Ga0070713_100014185 3300005436 Bacteria 5905
125 Ga0070713_100022094 3300005436 Bacteria 4910
126 Ga0070713_100055080 3300005436 Bacteria 3303
127 Ga0070710_10002850 3300005437 Bacteria 8241
128 Ga0070710_10022141 3300005437 Bacteria 3321
129 Ga0070710_10104267 3300005437 Bacteria 1694
130 Ga0070701_10015307 3300005438 Bacteria 3539
131 Ga0070701_10016294 3300005438 Bacteria 3452
132 Ga0070701_10035616 3300005438 Bacteria 2502
133 Ga0070711_100041397 3300005439 Bacteria 3111
134 Ga0070711_100067958 3300005439 Bacteria 2502
135 Ga0070711_100171819 3300005439 Bacteria 1653
136 Ga0070705_100000841 3300005440 Bacteria 17205
137 Ga0070705_100150597 3300005440 Bacteria 1543
138 Ga0070700_100003801 3300005441 Bacteria 7820
139 Ga0070700_100028121 3300005441 Bacteria 3341
140 Ga0070694_100015658 3300005444 Bacteria 4766
141 Ga0070694_100055888 3300005444 Bacteria 2679
142 Ga0070708_100108699 3300005445 Bacteria 2547
143 Ga0070708_100116248 3300005445 Bacteria 2463
144 Ga0070708_100158925 3300005445 Bacteria 2105
145 Ga0070663_100007113 3300005455 Bacteria 6790
146 Ga0070663_100020597 3300005455 Bacteria 4367
147 Ga0070678_100002006 3300005456 Bacteria 10996
148 Ga0070678_100040346 3300005456 Bacteria 3303
149 Ga0070678_100053751 3300005456 Bacteria 2931
150 Ga0070678_100225153 3300005456 Bacteria 1561
151 Ga0070678_100367848 3300005456 Bacteria 1241
152 Ga0070662_100002572 3300005457 Bacteria 11179
153 Ga0070662_100036711 3300005457 Bacteria 3469
154 Ga0070662_100090000 3300005457 Bacteria 2302
155 Ga0070662_100119865 3300005457 Bacteria 2015
156 Ga0070662_100149138 3300005457 Bacteria 1819
157 Ga0070662_100313734 3300005457 Bacteria 1277
158 Ga0070681_10002769 3300005458 Bacteria 16183
159 Ga0070681_10024351 3300005458 Bacteria 6094
160 Ga0070681_10100713 3300005458 Bacteria 2835
161 Ga0068867_100001532 3300005459 Bacteria 16033
162 Ga0068867_100015021 3300005459 Bacteria 5489
163 Ga0068867_100018604 3300005459 Bacteria 4939
164 Ga0068867_100053179 3300005459 Bacteria 2990
165 Ga0068867_100058920 3300005459 Bacteria 2845
166 Ga0068867_100178831 3300005459 Bacteria 1685
167 Ga0068867_100236897 3300005459 Bacteria 1478
168 Ga0070685_10016964 3300005466 Bacteria 3889
169 Ga0070685_10044044 3300005466 Bacteria 2554
170 Ga0070706_100134617 3300005467 Bacteria 2307
171 Ga0070706_100294372 3300005467 Bacteria 1515
172 Ga0070706_100333506 3300005467 Bacteria 1414
173 Ga0070707_100046638 3300005468 Bacteria 4147
174 Ga0070707_100176497 3300005468 Bacteria 2082
175 Ga0070707_100380338 3300005468 Bacteria 1371
176 Ga0070698_100059491 3300005471 Bacteria 3858
177 Ga0070698_100258627 3300005471 Bacteria 1673
178 Ga0070698_100333361 3300005471 Bacteria 1448
179 Ga0070699_100059121 3300005518 Bacteria 3322
180 Ga0070699_100249199 3300005518 Bacteria 1586
181 Ga0070699_100305986 3300005518 Bacteria 1426
182 Ga0070679_100009803 3300005530 Bacteria 9062
183 Ga0070679_100040872 3300005530 Bacteria 4614
184 Ga0070679_100063431 3300005530 Bacteria 3683
185 Ga0070679_100069494 3300005530 Bacteria 3512
186 Ga0070684_100039393 3300005535 Bacteria 4064
187 Ga0070684_100066710 3300005535 Bacteria 3159
188 Ga0070684_100110230 3300005535 Bacteria 2467
189 Ga0070697_100022910 3300005536 Bacteria 4965
190 Ga0070697_100420400 3300005536 Bacteria 1161
191 Ga0068853_100009263 3300005539 Bacteria 7939
192 Ga0068853_100019343 3300005539 Bacteria 5645
193 Ga0068853_100042613 3300005539 Bacteria 3882
194 Ga0068853_100042935 3300005539 Bacteria 3868
195 Ga0068853_100044043 3300005539 Bacteria 3819
196 Ga0068853_100056864 3300005539 Bacteria 3374
197 Ga0068853_100307940 3300005539 Bacteria 1466
198 Ga0070672_100000794 3300005543 Bacteria 18801
199 Ga0070672_100008039 3300005543 Bacteria 7205
200 Ga0070672_100026312 3300005543 Bacteria 4327
201 Ga0070672_100039344 3300005543 Bacteria 3622
202 Ga0070672_100077268 3300005543 Bacteria 2662
203 Ga0070672_100310338 3300005543 Bacteria 1339
204 Ga0070686_100004773 3300005544 Bacteria 7479
205 Ga0070686_100008579 3300005544 Bacteria 5726
206 Ga0070686_100038894 3300005544 Bacteria 2960
207 Ga0070695_100076489 3300005545 Bacteria 2204
208 Ga0070696_100000636 3300005546 Bacteria 22379
209 Ga0070696_100009059 3300005546 Bacteria 6665
210 Ga0070696_100017547 3300005546 Bacteria 4832
211 Ga0070696_100210699 3300005546 Bacteria 1454
212 Ga0070693_100000180 3300005547 Bacteria 29107
213 Ga0070693_100009441 3300005547 Bacteria 4851
214 Ga0070693_100140078 3300005547 Bacteria 1521
215 Ga0070665_100005242 3300005548 Bacteria 13407
216 Ga0070665_100006820 3300005548 Bacteria 11615
217 Ga0070665_100014818 3300005548 Bacteria 7825
218 Ga0070665_100044628 3300005548 Bacteria 4452
219 Ga0070665_100095265 3300005548 Bacteria 2981
220 Ga0070665_100530845 3300005548 Bacteria 1189
221 Ga0070704_100006749 3300005549 Bacteria 6793
222 Ga0070704_100010310 3300005549 Bacteria 5683
223 Ga0070704_100077775 3300005549 Bacteria 2431
224 Ga0070704_100353553 3300005549 Bacteria 1241
225 Ga0068855_100000437 3300005563 Bacteria 51661
226 Ga0068855_100002451 3300005563 Bacteria 22926
227 Ga0068855_100011225 3300005563 Bacteria 10819
228 Ga0068855_100017036 3300005563 Bacteria 8741
229 Ga0068855_100031328 3300005563 Bacteria 6350
230 Ga0068855_100038423 3300005563 Bacteria 5688
231 Ga0068855_100055606 3300005563 Bacteria 4647
232 Ga0068855_100091052 3300005563 Bacteria 3519
233 Ga0068855_100165197 3300005563 Bacteria 2510
234 Ga0068855_100239399 3300005563 Bacteria 2029
235 Ga0070664_100000120 3300005564 Bacteria 52284
236 Ga0070664_100002391 3300005564 Bacteria 15069
237 Ga0070664_100051354 3300005564 Bacteria 3491
238 Ga0070664_100055187 3300005564 Bacteria 3372
239 Ga0070664_100151814 3300005564 Bacteria 2045
240 Ga0070664_100190723 3300005564 Bacteria 1826
241 Ga0068857_100001876 3300005577 Bacteria 16915
242 Ga0068857_100057642 3300005577 Bacteria 3448
243 Ga0068857_100139430 3300005577 Bacteria 2191
244 Ga0068857_100351296 3300005577 Bacteria 1365
245 Ga0068854_100020976 3300005578 Bacteria 4427
246 Ga0068854_100023947 3300005578 Bacteria 4174
247 Ga0068854_100049293 3300005578 Bacteria 3007
248 Ga0068856_100002007 3300005614 Bacteria 21229
249 Ga0068856_100002048 3300005614 Bacteria 20920
250 Ga0068856_100008813 3300005614 Bacteria 9818
251 Ga0068856_100020667 3300005614 Bacteria 6396
252 Ga0068856_100028863 3300005614 Bacteria 5421
253 Ga0070702_100014533 3300005615 Bacteria 3994
254 Ga0070702_100031689 3300005615 Bacteria 2895
255 Ga0070702_100040731 3300005615 Bacteria 2601
256 Ga0068852_100000703 3300005616 Bacteria 21859
257 Ga0068852_100011026 3300005616 Bacteria 6783
258 Ga0068852_100039515 3300005616 Bacteria 3972
259 Ga0068859_100004536 3300005617 Bacteria 14160
260 Ga0068859_100007313 3300005617 Bacteria 11197
261 Ga0068859_100029580 3300005617 Bacteria 5497
262 Ga0068859_100048377 3300005617 Bacteria 4272
263 Ga0068859_100088067 3300005617 Bacteria 3154
264 Ga0068864_100005836 3300005618 Bacteria 10097
265 Ga0068864_100006991 3300005618 Bacteria 9258
266 Ga0068864_100016447 3300005618 Bacteria 6157
267 Ga0068864_100043351 3300005618 Bacteria 3853
268 Ga0068864_100189124 3300005618 Bacteria 1886
269 Ga0068864_100210914 3300005618 Bacteria 1788
270 Ga0068866_10001149 3300005718 Bacteria 11628
271 Ga0068866_10002335 3300005718 Bacteria 7861
272 Ga0068866_10003843 3300005718 Bacteria 6164
273 Ga0068861_100004384 3300005719 Bacteria 9461
274 Ga0068861_100032353 3300005719 Bacteria 3849
275 Ga0068861_100034695 3300005719 Bacteria 3732
276 Ga0068851_10000609 3300005834 Bacteria 15417
277 Ga0068851_10006762 3300005834 Bacteria 5247
278 Ga0068851_10012908 3300005834 Bacteria 3946
279 Ga0068870_10001373 3300005840 Bacteria 9825
280 Ga0068870_10004702 3300005840 Bacteria 5900
281 Ga0068870_10027578 3300005840 Bacteria 2842
282 Ga0068870_10085455 3300005840 Bacteria 1754
283 Ga0068863_100011115 3300005841 Bacteria 8730
284 Ga0068863_100013417 3300005841 Bacteria 7900
285 Ga0068863_100029339 3300005841 Bacteria 5250
286 Ga0068863_100076016 3300005841 Bacteria 3177
287 Ga0068863_100129012 3300005841 Bacteria 2413
288 Ga0068863_100210752 3300005841 Bacteria 1871
289 Ga0068863_100262279 3300005841 Bacteria 1671
290 Ga0068858_100036666 3300005842 Bacteria 4546
291 Ga0068858_100048524 3300005842 Bacteria 3933
292 Ga0068858_100082984 3300005842 Bacteria 2980
293 Ga0068858_100239620 3300005842 Bacteria 1721
294 Ga0068860_100016867 3300005843 Bacteria 7119
295 Ga0068860_100027659 3300005843 Bacteria 5460
296 Ga0068860_100029411 3300005843 Bacteria 5285
297 Ga0068860_100031977 3300005843 Bacteria 5059
298 Ga0068860_100065162 3300005843 Bacteria 3460
299 Ga0068860_100120014 3300005843 Bacteria 2517
300 Ga0068860_100126195 3300005843 Bacteria 2453
301 Ga0068860_100153186 3300005843 Bacteria 2221
302 Ga0068862_100004037 3300005844 Bacteria 12439
303 Ga0068862_100016175 3300005844 Bacteria 6205
304 Ga0068862_100031535 3300005844 Bacteria 4474
305 Ga0068862_100292420 3300005844 Bacteria 1496
306 Ga0081539_10027135 3300005985 Bacteria 3635
307 Ga0070715_10019149 3300006163 Bacteria 2620
308 Ga0070712_100001779 3300006175 Bacteria 13187
309 Ga0070712_100011777 3300006175 Bacteria 5558
310 Ga0070712_100022474 3300006175 Bacteria 4156
311 Ga0070712_100071133 3300006175 Bacteria 2488
312 Ga0097621_100013839 3300006237 Bacteria 6023
313 Ga0097621_100034872 3300006237 Bacteria 4016
314 Ga0097621_100044504 3300006237 Bacteria 3581
315 Ga0097621_100060211 3300006237 Bacteria 3112
316 Ga0097621_100120280 3300006237 Bacteria 2226
317 Ga0097621_100121174 3300006237 Bacteria 2218
318 Ga0068871_100011567 3300006358 Bacteria 6474
319 Ga0068871_100016596 3300006358 Bacteria 5551
320 Ga0068871_100049457 3300006358 Bacteria 3398
321 Ga0068871_100110073 3300006358 Bacteria 2316
322 Ga0068871_100116362 3300006358 Bacteria 2254
323 Ga0068871_100270422 3300006358 Bacteria 1484
324 Ga0068871_100349976 3300006358 Bacteria 1307
325 Ga0075428_100004567 3300006844 Bacteria 15310
326 Ga0075428_100106351 3300006844 Bacteria 3059
327 Ga0075433_10022361 3300006852 Bacteria 5307
328 Ga0075433_10058418 3300006852 Bacteria 3373
329 Ga0075434_100002519 3300006871 Bacteria 16153
330 Ga0075434_100015608 3300006871 Bacteria 7290
331 Ga0075434_100249837 3300006871 Bacteria 1793
332 Ga0075434_100364973 3300006871 Bacteria 1465
333 Ga0075434_100424418 3300006871 Bacteria 1351
334 Ga0075429_100028612 3300006880 Bacteria 4838
335 Ga0068865_100011339 3300006881 Bacteria 5574
336 Ga0068865_100017767 3300006881 Bacteria 4579
337 Ga0068865_100021963 3300006881 Bacteria 4155
338 Ga0068865_100053793 3300006881 Bacteria 2794
339 Ga0068865_100130247 3300006881 Bacteria 1884
340 Ga0068865_100150519 3300006881 Bacteria 1765
341 Ga0068865_100189958 3300006881 Bacteria 1588
342 Ga0075436_100001322 3300006914 Bacteria 16848
343 Ga0075436_100010939 3300006914 Bacteria 6228
344 Ga0075436_100168139 3300006914 Bacteria 1548
345 Ga0097620_100004536 3300006931 Bacteria 14160
346 Ga0097620_100007313 3300006931 Bacteria 11197
347 Ga0097620_100029578 3300006931 Bacteria 5497
348 Ga0097620_100048376 3300006931 Bacteria 4272
349 Ga0097620_100088067 3300006931 Bacteria 3154
350 Ga0075435_100018903 3300007076 Bacteria 5251
351 Ga0075435_100038871 3300007076 Bacteria 3795
352 Ga0075435_100204901 3300007076 Bacteria 1672
353 Ga0105251_10073050 3300009011 Unclassified 1594
354 Ga0105240_10002531 3300009093 Bacteria 29323
355 Ga0105240_10038120 3300009093 Bacteria 6169
356 Ga0111539_10014739 3300009094 Bacteria 9751
357 Ga0111539_10038744 3300009094 Bacteria 5751
358 Ga0111539_10116285 3300009094 Bacteria 3136
359 Ga0111539_10271849 3300009094 Bacteria 1972
360 Ga0111539_10346546 3300009094 Bacteria 1729
361 Ga0105245_10017020 3300009098 Bacteria 6347
362 Ga0105245_10020497 3300009098 Bacteria 5798
363 Ga0105245_10034327 3300009098 Bacteria 4499
364 Ga0105245_10074575 3300009098 Bacteria 3088
365 Ga0105247_10068880 3300009101 Bacteria 2206
366 Ga0105243_10021090 3300009148 Bacteria 4944
367 Ga0105243_10133898 3300009148 Bacteria 2106
368 Ga0105243_10343951 3300009148 Bacteria 1367
369 Ga0105243_10358331 3300009148 Bacteria 1342
370 Ga0105241_10005305 3300009174 Bacteria 9518
371 Ga0105241_10139815 3300009174 Bacteria 1970
372 Ga0105241_10247765 3300009174 Bacteria 1509
373 Ga0105241_10508716 3300009174 Bacteria 1075
374 Ga0105242_10014757 3300009176 Bacteria 6051
375 Ga0105242_10046189 3300009176 Bacteria 3532
376 Ga0105242_10158523 3300009176 Bacteria 1979
377 Ga0105242_10218900 3300009176 Bacteria 1700
378 Ga0105248_10002744 3300009177 Bacteria 19558
379 Ga0105248_10008149 3300009177 Bacteria 11507
380 Ga0105248_10044391 3300009177 Bacteria 4985
381 Ga0105248_10045076 3300009177 Bacteria 4945
382 Ga0105248_10087294 3300009177 Bacteria 3510
383 Ga0105248_10161419 3300009177 Bacteria 2528
384 Ga0105248_10328763 3300009177 Bacteria 1722
385 Ga0105248_10511322 3300009177 Bacteria 1354
386 Ga0105237_10101611 3300009545 Bacteria 2867
387 Ga0105237_10126959 3300009545 Bacteria 2545
388 Ga0105237_10289506 3300009545 Bacteria 1641
389 Ga0105238_10000484 3300009551 Bacteria 41852
390 Ga0105238_10000708 3300009551 Bacteria 34846
391 Ga0105238_10017077 3300009551 Bacteria 7366
392 Ga0105238_10039196 3300009551 Bacteria 4805
393 Ga0105249_10015859 3300009553 Bacteria 6677
394 Ga0105249_10449875 3300009553 Bacteria 1326
395 Ga0105239_10101660 3300010375 Bacteria 3180
396 Ga0105239_10280862 3300010375 Bacteria 1874
397 Ga0105246_10100724 3300011119 Bacteria 2102
398 Ga0157373_10000142 3300013100 Bacteria 57494
399 Ga0157373_10000439 3300013100 Bacteria 33045
400 Ga0157373_10032232 3300013100 Bacteria 3773
401 Ga0157371_10000549 3300013102 Bacteria 44661
402 Ga0157371_10053519 3300013102 Bacteria 2866
403 Ga0157371_10214661 3300013102 Bacteria 1381
404 Ga0157370_10003069 3300013104 Bacteria 19795
405 Ga0157370_10011154 3300013104 Bacteria 9419
406 Ga0157370_10100007 3300013104 Bacteria 2717
407 Ga0157370_10182023 3300013104 Bacteria 1952
408 Ga0157369_10001662 3300013105 Bacteria 27112
409 Ga0157369_10006377 3300013105 Bacteria 13684
410 Ga0157369_10028998 3300013105 Bacteria 6119
411 Ga0157369_10029718 3300013105 Bacteria 6036
412 Ga0157369_10045116 3300013105 Bacteria 4796
413 Ga0157369_10057558 3300013105 Bacteria 4194
414 Ga0157369_10058838 3300013105 Bacteria 4145
415 Ga0157369_10060917 3300013105 Bacteria 4069
416 Ga0157369_10084262 3300013105 Bacteria 3398
417 Ga0157369_10426383 3300013105 Bacteria 1375
418 Ga0157374_10046348 3300013296 Bacteria 4026
419 Ga0157374_10054076 3300013296 Bacteria 3744
420 Ga0157374_10126874 3300013296 Bacteria 2467
421 Ga0157378_10018814 3300013297 Bacteria 6072
422 Ga0157378_10019026 3300013297 Bacteria 6035
423 Ga0157378_10026831 3300013297 Bacteria 5079
424 Ga0157378_10047198 3300013297 Bacteria 3828
425 Ga0157378_10111197 3300013297 Bacteria 2512
426 Ga0157378_10547524 3300013297 Bacteria 1162
427 Ga0163162_10042407 3300013306 Bacteria 4554
428 Ga0163162_10045176 3300013306 Bacteria 4413
429 Ga0163162_10052417 3300013306 Bacteria 4097
430 Ga0163162_10068889 3300013306 Bacteria 3590
431 Ga0163162_10257476 3300013306 Bacteria 1877
432 Ga0157372_10002118 3300013307 Bacteria 21583
433 Ga0157372_10002963 3300013307 Bacteria 18296
434 Ga0157372_10003796 3300013307 Bacteria 16219
435 Ga0157372_10009842 3300013307 Bacteria 10171
436 Ga0157372_10010340 3300013307 Bacteria 9916
437 Ga0157372_10024655 3300013307 Bacteria 6538
438 Ga0157372_10048759 3300013307 Bacteria 4708
439 Ga0157372_10093600 3300013307 Bacteria 3420
440 Ga0157372_10328567 3300013307 Bacteria 1780
441 Ga0157372_10663931 3300013307 Bacteria 1214
442 Ga0157375_10008096 3300013308 Bacteria 9196
443 Ga0157375_10028562 3300013308 Bacteria 5231
444 Ga0157375_10060084 3300013308 Bacteria 3768
445 Ga0157375_10171735 3300013308 Bacteria 2316
446 Ga0157375_10270773 3300013308 Bacteria 1860
447 Ga0163163_10032631 3300014325 Bacteria 5031
448 Ga0163163_10051112 3300014325 Bacteria 4074
449 Ga0157380_10038030 3300014326 Bacteria 3734
450 Ga0157380_10048709 3300014326 Bacteria 3339
451 Ga0157380_10177112 3300014326 Bacteria 1870
452 Ga0157380_10360782 3300014326 Bacteria 1363
453 Ga0182008_10049535 3300014497 Bacteria 2085
454 Ga0157377_10008365 3300014745 Bacteria 5044
455 Ga0157377_10135560 3300014745 Bacteria 1508
456 Ga0157379_10007045 3300014968 Bacteria 9716
457 Ga0157379_10039514 3300014968 Bacteria 4209
458 Ga0157379_10366795 3300014968 Bacteria 1320
459 Ga0157376_10009267 3300014969 Bacteria 7146
460 Ga0157376_10024405 3300014969 Bacteria 4746
461 Ga0157376_10056995 3300014969 Bacteria 3267
462 Ga0157376_10097230 3300014969 Bacteria 2564
463 Ga0157376_10172143 3300014969 Bacteria 1973
464 Ga0157376_10205247 3300014969 Bacteria 1816
465 Ga0157376_10574276 3300014969 Bacteria 1119
466 Ga0163161_10011199 3300017792 Bacteria 6213
467 Ga0163161_10102395 3300017792 Bacteria 2132
468 Ga0163161_10103349 3300017792 Bacteria 2123
469 Ga0163161_10277412 3300017792 Bacteria 1314
470 Ga0209672_100021 3300025228 Bacteria 428473
471 Ga0209147_100025 3300025229 Bacteria 428473
472 Ga0207427_101253 3300025231 Bacteria 9734
473 Ga0209258_100037 3300025242 Bacteria 428473
474 Ga0209148_1000049 3300025254 Bacteria 428473
475 Ga0209233_1000091 3300025261 Bacteria 309402
476 Ga0207666_1007935 3300025271 Bacteria 1409
477 Ga0209455_1000041 3300025272 Bacteria 428473
478 Ga0207697_10000771 3300025315 Bacteria 18159
479 Ga0207697_10022755 3300025315 Bacteria 2566
480 Ga0207656_10037973 3300025321 Bacteria 2029
481 Ga0207656_10061372 3300025321 Bacteria 1650
482 Ga0207656_10116215 3300025321 Bacteria 1241
483 Ga0207653_10003878 3300025885 Bacteria 4701
484 Ga0207653_10023147 3300025885 Bacteria 1977
485 Ga0207682_10000061 3300025893 Bacteria 46850
486 Ga0207682_10001382 3300025893 Bacteria 11198
487 Ga0207692_10002535 3300025898 Bacteria 7012
488 Ga0207692_10003513 3300025898 Bacteria 6132
489 Ga0207642_10002972 3300025899 Bacteria 5305
490 Ga0207642_10003792 3300025899 Bacteria 4815
491 Ga0207642_10034580 3300025899 Bacteria 2150
492 Ga0207710_10012018 3300025900 Bacteria 3640
493 Ga0207688_10000524 3300025901 Bacteria 18570
494 Ga0207688_10044878 3300025901 Bacteria 2464
495 Ga0207680_10020342 3300025903 Bacteria 3569
496 Ga0207680_10024123 3300025903 Bacteria 3333
497 Ga0207680_10044079 3300025903 Bacteria 2621
498 Ga0207680_10047484 3300025903 Bacteria 2544
499 Ga0207680_10062397 3300025903 Bacteria 2277
500 Ga0207647_10001055 3300025904 Bacteria 21220
501 Ga0207685_10044182 3300025905 Bacteria 1683
502 Ga0207699_10043946 3300025906 Bacteria 2599
503 Ga0207699_10269112 3300025906 Bacteria 1180
504 Ga0207645_10000143 3300025907 Bacteria 55663
505 Ga0207645_10003306 3300025907 Bacteria 12299
506 Ga0207645_10052410 3300025907 Bacteria 2607
507 Ga0207645_10055232 3300025907 Bacteria 2535
508 Ga0207643_10000189 3300025908 Bacteria 42432
509 Ga0207643_10000632 3300025908 Bacteria 22134
510 Ga0207643_10019153 3300025908 Bacteria 3750
511 Ga0207643_10022641 3300025908 Bacteria 3461
512 Ga0207705_10015818 3300025909 Bacteria 5418
513 Ga0207705_10052673 3300025909 Bacteria 2931
514 Ga0207705_10143446 3300025909 Bacteria 1785
515 Ga0207684_10065825 3300025910 Bacteria 3077
516 Ga0207654_10041807 3300025911 Bacteria 2590
517 Ga0207654_10044322 3300025911 Bacteria 2526
518 Ga0207654_10143878 3300025911 Bacteria 1524
519 Ga0207707_10000305 3300025912 Bacteria 51662
520 Ga0207707_10014131 3300025912 Bacteria 6957
521 Ga0207707_10020405 3300025912 Bacteria 5787
522 Ga0207707_10189322 3300025912 Bacteria 1795
523 Ga0207695_10074702 3300025913 Bacteria 3451
524 Ga0207695_10088402 3300025913 Bacteria 3119
525 Ga0207695_10092785 3300025913 Bacteria 3029
526 Ga0207695_10223022 3300025913 Bacteria 1792
527 Ga0207695_10362570 3300025913 Bacteria 1336
528 Ga0207671_10039603 3300025914 Bacteria 3489
529 Ga0207693_10000605 3300025915 Bacteria 32124
530 Ga0207693_10011952 3300025915 Bacteria 7019
531 Ga0207663_10008229 3300025916 Bacteria 5443
532 Ga0207660_10001522 3300025917 Bacteria 15576
533 Ga0207660_10031002 3300025917 Bacteria 3679
534 Ga0207660_10052593 3300025917 Bacteria 2900
535 Ga0207662_10000111 3300025918 Bacteria 38905
536 Ga0207662_10008136 3300025918 Bacteria 5733
537 Ga0207662_10016468 3300025918 Bacteria 4172
538 Ga0207662_10144512 3300025918 Bacteria 1509
539 Ga0207657_10000236 3300025919 Bacteria 58234
540 Ga0207657_10000341 3300025919 Bacteria 49504
541 Ga0207657_10001274 3300025919 Bacteria 26860
542 Ga0207657_10136772 3300025919 Bacteria 2004
543 Ga0207649_10003765 3300025920 Bacteria 8274
544 Ga0207649_10007510 3300025920 Bacteria 5925
545 Ga0207649_10033132 3300025920 Bacteria 3085
546 Ga0207649_10117584 3300025920 Bacteria 1787
547 Ga0207652_10000572 3300025921 Bacteria 37038
548 Ga0207652_10073713 3300025921 Bacteria 2971
549 Ga0207652_10078209 3300025921 Bacteria 2888
550 Ga0207652_10089964 3300025921 Bacteria 2696
551 Ga0207652_10337729 3300025921 Bacteria 1360
552 Ga0207652_10438853 3300025921 Bacteria 1177
553 Ga0207646_10037621 3300025922 Bacteria 4362
554 Ga0207681_10041390 3300025923 Bacteria 3071
555 Ga0207681_10124618 3300025923 Bacteria 1895
556 Ga0207681_10142951 3300025923 Bacteria 1784
557 Ga0207681_10190078 3300025923 Bacteria 1570
558 Ga0207681_10320574 3300025923 Bacteria 1232
559 Ga0207694_10002559 3300025924 Bacteria 14754
560 Ga0207694_10016977 3300025924 Bacteria 5498
561 Ga0207694_10067079 3300025924 Bacteria 2800
562 Ga0207650_10006656 3300025925 Bacteria 7882
563 Ga0207650_10021348 3300025925 Bacteria 4575
564 Ga0207650_10032547 3300025925 Bacteria 3771
565 Ga0207650_10052022 3300025925 Bacteria 3033
566 Ga0207650_10125870 3300025925 Bacteria 2000
567 Ga0207650_10182762 3300025925 Bacteria 1672
568 Ga0207650_10215442 3300025925 Bacteria 1544
569 Ga0207659_10001702 3300025926 Bacteria 13047
570 Ga0207659_10001717 3300025926 Bacteria 13001
571 Ga0207659_10048407 3300025926 Bacteria 3011
572 Ga0207659_10101516 3300025926 Bacteria 2170
573 Ga0207659_10162659 3300025926 Bacteria 1754
574 Ga0207659_10281472 3300025926 Bacteria 1360
575 Ga0207687_10009538 3300025927 Bacteria 6349
576 Ga0207687_10012063 3300025927 Bacteria 5652
577 Ga0207687_10332628 3300025927 Bacteria 1233
578 Ga0207700_10003435 3300025928 Bacteria 9209
579 Ga0207700_10024869 3300025928 Bacteria 4150
580 Ga0207700_10039165 3300025928 Bacteria 3447
581 Ga0207700_10055501 3300025928 Bacteria 2978
582 Ga0207700_10201327 3300025928 Bacteria 1678
583 Ga0207664_10003607 3300025929 Bacteria 10358
584 Ga0207664_10003667 3300025929 Bacteria 10289
585 Ga0207664_10190681 3300025929 Bacteria 1764
586 Ga0207664_10204825 3300025929 Bacteria 1705
587 Ga0207664_10397816 3300025929 Bacteria 1225
588 Ga0207644_10003631 3300025931 Bacteria 10006
589 Ga0207644_10004584 3300025931 Bacteria 8987
590 Ga0207644_10006445 3300025931 Bacteria 7649
591 Ga0207644_10016308 3300025931 Bacteria 4998
592 Ga0207644_10050891 3300025931 Bacteria 2971
593 Ga0207644_10078561 3300025931 Bacteria 2432
594 Ga0207644_10106862 3300025931 Bacteria 2110
595 Ga0207644_10282982 3300025931 Bacteria 1332
596 Ga0207690_10002016 3300025932 Bacteria 12445
597 Ga0207690_10004905 3300025932 Bacteria 7894
598 Ga0207690_10030443 3300025932 Bacteria 3443
599 Ga0207690_10295821 3300025932 Bacteria 1265
600 Ga0207690_10325146 3300025932 Bacteria 1210
601 Ga0207706_10000037 3300025933 Bacteria 132826
602 Ga0207706_10002271 3300025933 Bacteria 18768
603 Ga0207706_10002346 3300025933 Bacteria 18486
604 Ga0207706_10045007 3300025933 Bacteria 3910
605 Ga0207706_10221465 3300025933 Bacteria 1657
606 Ga0207706_10237589 3300025933 Bacteria 1593
607 Ga0207686_10000645 3300025934 Bacteria 21468
608 Ga0207686_10017623 3300025934 Bacteria 4028
609 Ga0207709_10080601 3300025935 Bacteria 2097
610 Ga0207709_10224111 3300025935 Bacteria 1358
611 Ga0207670_10060956 3300025936 Bacteria 2572
612 Ga0207669_10008113 3300025937 Bacteria 4911
613 Ga0207669_10017690 3300025937 Bacteria 3663
614 Ga0207669_10073018 3300025937 Bacteria 2163
615 Ga0207704_10007762 3300025938 Bacteria 5089
616 Ga0207704_10028961 3300025938 Bacteria 3081
617 Ga0207704_10070616 3300025938 Bacteria 2212
618 Ga0207704_10107114 3300025938 Bacteria 1879
619 Ga0207704_10123080 3300025938 Bacteria 1780
620 Ga0207665_10015015 3300025939 Bacteria 5087
621 Ga0207665_10100732 3300025939 Bacteria 2016
622 Ga0207691_10000016 3300025940 Bacteria 141024
623 Ga0207691_10005729 3300025940 Bacteria 12011
624 Ga0207691_10017461 3300025940 Bacteria 6804
625 Ga0207691_10042719 3300025940 Bacteria 4178
626 Ga0207691_10125321 3300025940 Bacteria 2273
627 Ga0207691_10128007 3300025940 Bacteria 2245
628 Ga0207691_10165735 3300025940 Bacteria 1937
629 Ga0207691_10233853 3300025940 Bacteria 1591
630 Ga0207691_10268575 3300025940 Bacteria 1469
631 Ga0207711_10009671 3300025941 Bacteria 8033
632 Ga0207711_10017357 3300025941 Bacteria 5979
633 Ga0207711_10023334 3300025941 Bacteria 5178
634 Ga0207711_10125413 3300025941 Bacteria 2296
635 Ga0207711_10356136 3300025941 Bacteria 1355
636 Ga0207711_10425171 3300025941 Bacteria 1236
637 Ga0207689_10000870 3300025942 Bacteria 29137
638 Ga0207689_10004636 3300025942 Bacteria 12438
639 Ga0207689_10056631 3300025942 Bacteria 3226
640 Ga0207689_10158417 3300025942 Bacteria 1866
641 Ga0207679_10001850 3300025945 Bacteria 13151
642 Ga0207679_10003252 3300025945 Bacteria 10037
643 Ga0207679_10016532 3300025945 Bacteria 4903
644 Ga0207679_10091393 3300025945 Bacteria 2356
645 Ga0207667_10008179 3300025949 Bacteria 12444
646 Ga0207667_10013261 3300025949 Bacteria 9445
647 Ga0207667_10016005 3300025949 Bacteria 8491
648 Ga0207667_10023196 3300025949 Bacteria 6834
649 Ga0207667_10049453 3300025949 Bacteria 4440
650 Ga0207667_10131664 3300025949 Bacteria 2576
651 Ga0207667_10207472 3300025949 Bacteria 2009
652 Ga0207667_10252738 3300025949 Bacteria 1803
653 Ga0207651_10011174 3300025960 Bacteria 5013
654 Ga0207651_10018254 3300025960 Bacteria 4168
655 Ga0207651_10052906 3300025960 Bacteria 2771
656 Ga0207651_10066847 3300025960 Bacteria 2527
657 Ga0207651_10072307 3300025960 Bacteria 2448
658 Ga0207651_10076859 3300025960 Bacteria 2388
659 Ga0207712_10215548 3300025961 Bacteria 1532
660 Ga0207668_10043134 3300025972 Bacteria 3059
661 Ga0207668_10052977 3300025972 Bacteria 2810
662 Ga0207668_10054958 3300025972 Bacteria 2765
663 Ga0207668_10176463 3300025972 Bacteria 1681
664 Ga0207640_10046566 3300025981 Bacteria 2791
665 Ga0207640_10172372 3300025981 Bacteria 1614
666 Ga0207640_10286805 3300025981 Bacteria 1296
667 Ga0207658_10001061 3300025986 Bacteria 22224
668 Ga0207658_10016693 3300025986 Bacteria 5053
669 Ga0207658_10016917 3300025986 Bacteria 5019
670 Ga0207658_10035560 3300025986 Bacteria 3568
671 Ga0207658_10036349 3300025986 Bacteria 3530
672 Ga0207658_10052140 3300025986 Bacteria 3018
673 Ga0207658_10355730 3300025986 Bacteria 1276
674 Ga0207677_10000384 3300026023 Bacteria 30510
675 Ga0207677_10002748 3300026023 Bacteria 9283
676 Ga0207677_10057180 3300026023 Bacteria 2677
677 Ga0207677_10101504 3300026023 Bacteria 2118
678 Ga0207677_10101837 3300026023 Bacteria 2116
679 Ga0207677_10103963 3300026023 Bacteria 2098
680 Ga0207677_10188900 3300026023 Bacteria 1628
681 Ga0207677_10416425 3300026023 Bacteria 1143
682 Ga0207703_10000559 3300026035 Bacteria 38247
683 Ga0207703_10006066 3300026035 Bacteria 9665
684 Ga0207703_10059324 3300026035 Bacteria 3125
685 Ga0207703_10112800 3300026035 Bacteria 2323
686 Ga0207703_10195956 3300026035 Bacteria 1792
687 Ga0207639_10006119 3300026041 Bacteria 8167
688 Ga0207639_10010013 3300026041 Bacteria 6554
689 Ga0207639_10021047 3300026041 Bacteria 4679
690 Ga0207639_10041646 3300026041 Bacteria 3438
691 Ga0207639_10224921 3300026041 Bacteria 1623
692 Ga0207639_10291402 3300026041 Bacteria 1439
693 Ga0207639_10455095 3300026041 Bacteria 1162
694 Ga0207678_10001044 3300026067 Bacteria 25314
695 Ga0207678_10109464 3300026067 Bacteria 2356
696 Ga0207708_10002020 3300026075 Bacteria 14954
697 Ga0207708_10002481 3300026075 Bacteria 13573
698 Ga0207702_10001008 3300026078 Bacteria 28905
699 Ga0207702_10002619 3300026078 Bacteria 16908
700 Ga0207702_10002815 3300026078 Bacteria 16274
701 Ga0207702_10003232 3300026078 Bacteria 15057
702 Ga0207702_10005727 3300026078 Bacteria 10828
703 Ga0207702_10011001 3300026078 Bacteria 7548
704 Ga0207702_10103108 3300026078 Bacteria 2523
705 Ga0207702_10139585 3300026078 Bacteria 2191
706 Ga0207641_10005288 3300026088 Bacteria 11030
707 Ga0207641_10011902 3300026088 Bacteria 7137
708 Ga0207641_10026296 3300026088 Bacteria 4802
709 Ga0207641_10032429 3300026088 Bacteria 4337
710 Ga0207641_10040931 3300026088 Bacteria 3882
711 Ga0207641_10189247 3300026088 Bacteria 1890
712 Ga0207641_10365618 3300026088 Bacteria 1378
713 Ga0207648_10001798 3300026089 Bacteria 23490
714 Ga0207648_10007158 3300026089 Bacteria 10998
715 Ga0207648_10010994 3300026089 Bacteria 8546
716 Ga0207648_10014010 3300026089 Bacteria 7429
717 Ga0207648_10018464 3300026089 Bacteria 6313
718 Ga0207648_10020027 3300026089 Bacteria 6035
719 Ga0207648_10151795 3300026089 Bacteria 2044
720 Ga0207676_10000680 3300026095 Bacteria 27065
721 Ga0207676_10007971 3300026095 Bacteria 7529
722 Ga0207676_10011804 3300026095 Bacteria 6250
723 Ga0207676_10079615 3300026095 Bacteria 2657
724 Ga0207676_10106271 3300026095 Bacteria 2338
725 Ga0207676_10183509 3300026095 Bacteria 1834
726 Ga0207674_10000040 3300026116 Bacteria 130571
727 Ga0207674_10000170 3300026116 Bacteria 78770
728 Ga0207674_10011703 3300026116 Bacteria 9848
729 Ga0207674_10041640 3300026116 Bacteria 4748
730 Ga0207674_10409236 3300026116 Bacteria 1311
731 Ga0207675_100005496 3300026118 Bacteria 12131
732 Ga0207675_100008544 3300026118 Bacteria 9630
733 Ga0207675_100011565 3300026118 Bacteria 8252
734 Ga0207675_100017185 3300026118 Bacteria 6756
735 Ga0207675_100019790 3300026118 Bacteria 6282
736 Ga0207675_100036156 3300026118 Bacteria 4606
737 Ga0207683_10000322 3300026121 Bacteria 43758
738 Ga0207683_10000509 3300026121 Bacteria 35855
739 Ga0207683_10003454 3300026121 Bacteria 13782
740 Ga0207683_10005325 3300026121 Bacteria 11035
741 Ga0207683_10025973 3300026121 Bacteria 5056
742 Ga0207683_10046212 3300026121 Bacteria 3809
743 Ga0207683_10119581 3300026121 Bacteria 2364
744 Ga0207683_10173692 3300026121 Bacteria 1952
745 Ga0207698_10000642 3300026142 Bacteria 20202
746 Ga0207698_10003296 3300026142 Bacteria 9706
747 Ga0207698_10010650 3300026142 Bacteria 5926
748 Ga0207698_10034612 3300026142 Bacteria 3684
749 Ga0207698_10135576 3300026142 Bacteria 2112
750 Ga0207698_10380427 3300026142 Bacteria 1343
751 Ga0207698_10384677 3300026142 Bacteria 1336
752 Ga0207428_10003126 3300027907 Bacteria 16236
753 Ga0207428_10079983 3300027907 Bacteria 2554
754 Ga0268266_10022455 3300028379 Bacteria 5376
755 Ga0268266_10134616 3300028379 Bacteria 2212
756 Ga0268266_10580730 3300028379 Bacteria 1075
757 Ga0268265_10004602 3300028380 Bacteria 9534
758 Ga0268265_10020997 3300028380 Bacteria 4566
759 Ga0268265_10021151 3300028380 Bacteria 4552
760 Ga0268265_10038320 3300028380 Bacteria 3525
761 Ga0268264_10004968 3300028381 Bacteria 11267
762 Ga0268264_10008834 3300028381 Bacteria 8351
763 Ga0268264_10018827 3300028381 Bacteria 5646
764 Ga0268264_10021400 3300028381 Bacteria 5281
765 Ga0268264_10048059 3300028381 Bacteria 3548
766 Ga0268264_10156033 3300028381 Bacteria 2051
767 Ga0268264_10230150 3300028381 Bacteria 1711
768 Ga0265314_10053352 3300031711 Bacteria 2804
769 Ga0307411_10367748 3300032005 Bacteria 1178
770 Ga0373934_0010053 3300035086 Bacteria 3551
771 Ga0373940_0011064 3300035088 Bacteria 2136
772 Ga0373923_0020985 3300035111 Bacteria 2545
773 Ga0373953_0004854 3300035117 Bacteria 4321
774 Ga0373954_0002489 3300035118 Bacteria 7729
775 Ga0373956_0087017 3300035119 Bacteria 1438
776 Ga0373943_0008311 3300035170 Bacteria 4658
777 Ga0373946_0046071 3300035171 Bacteria 1806
778 Ga0373942_0026979 3300035207 Bacteria 1491
779 Ga0373962_0031480 3300035242 Bacteria 1455
780 Ga0373924_0092415 3300035410 Bacteria 1296
781 Ga0373931_0007359 3300035691 Bacteria 5183
782 Ga0373931_0142592 3300035691 Bacteria 1389
783 Ga0373927_0015750 3300035695 Bacteria 4991
784 Ga0373927_0079068 3300035695 Bacteria 2130
785 Ga0373933_0112349 3300035724 Bacteria 1700
786 Ga0373947_0083805 3300035725 Bacteria 1977
787 Ga0373937_0008460 3300036401 Bacteria 8943
788 Ga0373937_0036536 3300036401 Bacteria 4477
789 Ga0373937_0064536 3300036401 Bacteria 3368
790 Ga0373937_0075441 3300036401 Bacteria 3113
791 Ga0373937_0227554 3300036401 Bacteria 1756
792 Ga0373937_0407894 3300036401 Bacteria 1289
793 Ga0373925_0017777 3300037068 Bacteria 5159
794 Ga0373925_0132538 3300037068 Bacteria 1944
795 Ga0395900_0016897 3300037418 Bacteria 7449
796 Ga0395905_0049773 3300037471 Bacteria 3928
797 Ga0436364_1025804 3300037853 Bacteria 2644
798 Ga0439465_0062802 3300041413 Bacteria 1233
799 Ga0439462_0036859 3300042015 Bacteria 1302
800 Ga0439459_0001956 3300042438 Bacteria 3129
801 Ga0451577_0003232 3300042876 Bacteria 18320
802 Ga0451577_0064526 3300042876 Bacteria 3265
803 Ga0451577_0150408 3300042876 Bacteria 2095
804 Ga0451577_0220672 3300042876 Bacteria 1714
805 Ga0466963_0228293 3300044694 Bacteria 1304
806 Ga0453684_0055553 3300044712 Bacteria 5147
807 Ga0453684_0236026 3300044712 Bacteria 2108
808 Ga0451576_0067687 3300045051 Bacteria 3717
809 Ga0451576_0139213 3300045051 Bacteria 2531
810 Ga0495580_0224142 3300046472 Bacteria 1291
811 Ga0495662_0165348 3300046476 Bacteria 1090
812 Ga0495584_0000168 3300046491 Bacteria 46140
813 Ga0495628_0230400 3300046516 Bacteria 1389
814 Ga0495663_0022905 3300046525 Bacteria 1807
815 Ga0495587_0064135 3300046536 Bacteria 2147
816 Ga0495621_0006382 3300046539 Bacteria 3440
817 Ga0495667_0137195 3300046559 Bacteria 1577
818 Ga0495635_0266289 3300046663 Bacteria 1153
819 Ga0495623_0115052 3300046679 Bacteria 1626
820 Ga0495658_0130767 3300046683 Bacteria 1528
821 Ga0495624_0010270 3300046690 Bacteria 6452
822 Ga0495674_0001621 3300047319 Bacteria 22068
823 Ga0495676_0105426 3300047321 Bacteria 2078
824 Ga0495675_0214724 3300047444 Bacteria 1166
825 Ga0496100_0017773 3300048903 Bacteria 4206
826 Ga0496100_0410807 3300048903 Bacteria 1032
827 Ga0496101_0023863 3300048904 Bacteria 4229
828 Ga0496101_0029580 3300048904 Bacteria 3832
829 Ga0496101_0122600 3300048904 Bacteria 1966
830 Ga0496102_0028471 3300048905 Bacteria 4991
831 Ga0496102_0109639 3300048905 Bacteria 2572
832 Ga0496102_0297109 3300048905 Bacteria 1522
833 Ga0496103_0060607 3300048906 Bacteria 2352
834 Ga0496104_0020829 3300048907 Bacteria 6013
835 Ga0496104_0023610 3300048907 Bacteria 5655
836 Ga0496104_0040428 3300048907 Bacteria 4370
837 Ga0496105_0006517 3300048908 Bacteria 8979
838 Ga0496105_0173639 3300048908 Bacteria 1766
839 Ga0496106_0000737 3300048909 Bacteria 23592
840 Ga0496107_0066533 3300048910 Bacteria 2613
841 Ga0496107_0093812 3300048910 Bacteria 2195
842 Ga0496108_0029794 3300048911 Bacteria 4522
843 Ga0496108_0152100 3300048911 Bacteria 1997
844 Ga0496108_0193261 3300048911 Bacteria 1764
845 Ga0496108_0373306 3300048911 Bacteria 1245
846 Ga0496109_0069000 3300048912 Bacteria 3241
847 Ga0496109_0094111 3300048912 Bacteria 2773
848 Ga0496109_0154337 3300048912 Bacteria 2150
849 Ga0496109_0417777 3300048912 Bacteria 1267
850 Ga0496110_0136992 3300048913 Bacteria 2213
851 Ga0496110_0517000 3300048913 Bacteria 1086
852 Ga0496112_0006527 3300048915 Bacteria 10257
853 Ga0496112_0008103 3300048915 Bacteria 9383
854 Ga0496112_0032832 3300048915 Bacteria 5040
855 Ga0496112_0460646 3300048915 Bacteria 1209
856 Ga0496114_0108693 3300048917 Bacteria 2374
857 Ga0496114_0314532 3300048917 Bacteria 1383
858 Ga0501046_0390742 3300049580 Bacteria 1006
859 Ga0501072_0474825 3300049588 Bacteria 990
860 Ga0501077_0096920 3300049593 Bacteria 1869
861 Ga0501079_0082468 3300049741 Bacteria 2487
862 nmdc:mga05p37_150411_c1 3300050507 Bacteria 2848
863 nmdc:mga09592_35135_c1 3300050508 Bacteria 4194
864 nmdc:mga08y16_624414_c1 3300050511 Bacteria 1084
865 nmdc:mga0n895_19318_c1 3300050512 Bacteria 6332
866 nmdc:mga0n895_325456_c1 3300050512 Bacteria 1557
867 nmdc:mga0n895_394822_c1 3300050512 Bacteria 1399
868 nmdc:mga0n895_6915_c1 3300050512 Bacteria 9692
869 nmdc:mga0rr50_18244_c1 3300050513 Bacteria 4708
870 nmdc:mga0rr50_6395_c1 3300050513 Bacteria 7166
871 nmdc:mga0rr50_64843_c1 3300050513 Bacteria 2765
872 nmdc:mga08x19_14568_c1 3300050514 Bacteria 4770
873 nmdc:mga08x19_5662_c1 3300050514 Bacteria 7384
874 nmdc:mga0a205_13241_c1 3300050515 Bacteria 7670
875 nmdc:mga0a205_9042_c1 3300050515 Bacteria 9083
876 Ga0501084_0038988 3300054114 Bacteria 3974

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014326 Ga0157380_10360782 Ga0157380_103607822 225
2 3300005518 Ga0070699_100059121 Ga0070699_1000591213 250
3 3300005536 Ga0070697_100022910 Ga0070697_1000229103 250
4 3300049741 Ga0501079_0082468 Ga0501079_0082468_64_1014 255
5 3300036401 Ga0373937_0407894 Ga0373937_0407894_403_1260 259
6 3300035207 Ga0373942_0026979 Ga0373942_0026979_97_984 262
7 3300037068 Ga0373925_0017777 Ga0373925_0017777_18_887 263
8 3300036401 Ga0373937_0036536 Ga0373937_0036536_2843_3793 264
9 3300005549 Ga0070704_100353553 Ga0070704_1003535531 266
10 3300009177 Ga0105248_10008149 Ga0105248_1000814911 269
11 3300014968 Ga0157379_10007045 Ga0157379_100070458 269
12 3300005344 Ga0070661_100263411 Ga0070661_1002634112 271
13 3300005458 Ga0070681_10002769 Ga0070681_100027698 271
14 3300005530 Ga0070679_100069494 Ga0070679_1000694943 271
15 3300005564 Ga0070664_100190723 Ga0070664_1001907232 271
16 3300005614 Ga0068856_100008813 Ga0068856_1000088138 271
17 3300009174 Ga0105241_10247765 Ga0105241_102477652 271
18 3300013104 Ga0157370_10100007 Ga0157370_101000072 271
19 3300013105 Ga0157369_10058838 Ga0157369_100588383 271
20 3300013307 Ga0157372_10002118 Ga0157372_1000211820 271
21 3300025921 Ga0207652_10073713 Ga0207652_100737131 271
22 3300025945 Ga0207679_10091393 Ga0207679_100913932 271
23 3300026078 Ga0207702_10002619 Ga0207702_100026198 271
24 3300005295 Ga0065707_10041460 Ga0065707_100414601 272
25 3300005331 Ga0070670_100088410 Ga0070670_1000884102 272
26 3300005334 Ga0068869_100006404 Ga0068869_1000064044 272
27 3300005336 Ga0070680_100031635 Ga0070680_1000316352 272
28 3300005337 Ga0070682_100016272 Ga0070682_1000162722 272
29 3300005340 Ga0070689_100004319 Ga0070689_1000043199 272
30 3300005343 Ga0070687_100003610 Ga0070687_1000036106 272
31 3300005345 Ga0070692_10069497 Ga0070692_100694972 272
32 3300005354 Ga0070675_100004789 Ga0070675_1000047892 272
33 3300005355 Ga0070671_100264882 Ga0070671_1002648822 272
34 3300005365 Ga0070688_100202702 Ga0070688_1002027021 272
35 3300005434 Ga0070709_10125456 Ga0070709_101254562 272
36 3300005438 Ga0070701_10015307 Ga0070701_100153072 272
37 3300005441 Ga0070700_100003801 Ga0070700_1000038012 272
38 3300005444 Ga0070694_100015658 Ga0070694_1000156586 272
39 3300005445 Ga0070708_100116248 Ga0070708_1001162482 272
40 3300005459 Ga0068867_100015021 Ga0068867_1000150215 272
41 3300005530 Ga0070679_100040872 Ga0070679_1000408725 272
42 3300005539 Ga0068853_100042935 Ga0068853_1000429352 272
43 3300005543 Ga0070672_100026312 Ga0070672_1000263123 272
44 3300005544 Ga0070686_100004773 Ga0070686_1000047734 272
45 3300005546 Ga0070696_100009059 Ga0070696_1000090595 272
46 3300005547 Ga0070693_100009441 Ga0070693_1000094414 272
47 3300005549 Ga0070704_100006749 Ga0070704_1000067492 272
48 3300005563 Ga0068855_100017036 Ga0068855_1000170365 272
49 3300005563 Ga0068855_100031328 Ga0068855_1000313289 272
50 3300005578 Ga0068854_100023947 Ga0068854_1000239472 272
51 3300005617 Ga0068859_100029580 Ga0068859_1000295804 272
52 3300005718 Ga0068866_10001149 Ga0068866_100011495 272
53 3300005719 Ga0068861_100004384 Ga0068861_1000043849 272
54 3300005719 Ga0068861_100034695 Ga0068861_1000346954 272
55 3300005841 Ga0068863_100262279 Ga0068863_1002622792 272
56 3300005843 Ga0068860_100153186 Ga0068860_1001531862 272
57 3300005844 Ga0068862_100016175 Ga0068862_1000161752 272
58 3300006175 Ga0070712_100022474 Ga0070712_1000224744 272
59 3300006844 Ga0075428_100004567 Ga0075428_10000456715 272
60 3300006852 Ga0075433_10058418 Ga0075433_100584182 272
61 3300006871 Ga0075434_100015608 Ga0075434_1000156086 272
62 3300006880 Ga0075429_100028612 Ga0075429_1000286122 272
63 3300006881 Ga0068865_100011339 Ga0068865_1000113393 272
64 3300006914 Ga0075436_100010939 Ga0075436_1000109396 272
65 3300006931 Ga0097620_100029578 Ga0097620_1000295784 272
66 3300009094 Ga0111539_10014739 Ga0111539_100147399 272
67 3300009094 Ga0111539_10271849 Ga0111539_102718492 272
68 3300009098 Ga0105245_10017020 Ga0105245_100170206 272
69 3300009148 Ga0105243_10021090 Ga0105243_100210902 272
70 3300009177 Ga0105248_10161419 Ga0105248_101614192 272
71 3300009553 Ga0105249_10449875 Ga0105249_104498752 272
72 3300010375 Ga0105239_10101660 Ga0105239_101016602 272
73 3300013105 Ga0157369_10029718 Ga0157369_100297185 272
74 3300013297 Ga0157378_10019026 Ga0157378_100190266 272
75 3300013306 Ga0163162_10052417 Ga0163162_100524173 272
76 3300013308 Ga0157375_10028562 Ga0157375_100285621 272
77 3300014326 Ga0157380_10038030 Ga0157380_100380302 272
78 3300014745 Ga0157377_10135560 Ga0157377_101355602 272
79 3300014968 Ga0157379_10366795 Ga0157379_103667952 272
80 3300014969 Ga0157376_10024405 Ga0157376_100244058 272
81 3300014969 Ga0157376_10574276 Ga0157376_105742762 272
82 3300025885 Ga0207653_10023147 Ga0207653_100231472 272
83 3300025899 Ga0207642_10002972 Ga0207642_100029722 272
84 3300025901 Ga0207688_10044878 Ga0207688_100448782 272
85 3300025908 Ga0207643_10022641 Ga0207643_100226412 272
86 3300025917 Ga0207660_10031002 Ga0207660_100310022 272
87 3300025918 Ga0207662_10000111 Ga0207662_100001115 272
88 3300025921 Ga0207652_10089964 Ga0207652_100899642 272
89 3300025926 Ga0207659_10048407 Ga0207659_100484071 272
90 3300025929 Ga0207664_10397816 Ga0207664_103978161 272
91 3300025931 Ga0207644_10050891 Ga0207644_100508912 272
92 3300025932 Ga0207690_10325146 Ga0207690_103251461 272
93 3300025935 Ga0207709_10080601 Ga0207709_100806012 272
94 3300025938 Ga0207704_10070616 Ga0207704_100706162 272
95 3300025940 Ga0207691_10005729 Ga0207691_100057293 272
96 3300025949 Ga0207667_10023196 Ga0207667_100231964 272
97 3300025961 Ga0207712_10215548 Ga0207712_102155482 272
98 3300025981 Ga0207640_10046566 Ga0207640_100465662 272
99 3300026023 Ga0207677_10101837 Ga0207677_101018372 272
100 3300026075 Ga0207708_10002481 Ga0207708_1000248112 272
101 3300026078 Ga0207702_10011001 Ga0207702_100110015 272
102 3300026078 Ga0207702_10139585 Ga0207702_101395852 272
103 3300026089 Ga0207648_10001798 Ga0207648_1000179811 272
104 3300026118 Ga0207675_100005496 Ga0207675_1000054965 272
105 3300027907 Ga0207428_10003126 Ga0207428_100031264 272
106 3300028380 Ga0268265_10004602 Ga0268265_100046024 272
107 3300028381 Ga0268264_10018827 Ga0268264_100188273 272
108 3300028381 Ga0268264_10021400 Ga0268264_100214004 272
109 3300036401 Ga0373937_0064536 Ga0373937_0064536_1281_2231 272
110 3300045051 Ga0451576_0067687 Ga0451576_0067687_1334_2221 272
111 3300045051 Ga0451576_0139213 Ga0451576_0139213_1378_2265 272
112 3300046683 Ga0495658_0130767 Ga0495658_0130767_286_1236 272
113 3300050507 nmdc:mga05p37_150411_c1 nmdc:mga05p37_150411_c1_196_1083 272
114 3300050508 nmdc:mga09592_35135_c1 nmdc:mga09592_35135_c1_3240_4127 272
115 3300050512 nmdc:mga0n895_325456_c1 nmdc:mga0n895_325456_c1_101_988 272
116 3300050513 nmdc:mga0rr50_6395_c1 nmdc:mga0rr50_6395_c1_6208_7095 272
117 3300050514 nmdc:mga08x19_5662_c1 nmdc:mga08x19_5662_c1_6299_7186 272
118 3300050515 nmdc:mga0a205_13241_c1 nmdc:mga0a205_13241_c1_2449_3336 272
119 3300025271 Ga0207666_1007935 Ga0207666_10079353 273
120 3300048903 Ga0496100_0017773 Ga0496100_0017773_1812_2762 273
121 3300002126 JGI24035J26624_1003066 JGI24035J26624_10030661 274
122 3300002155 JGI24033J26618_1004127 JGI24033J26618_10041272 274
123 3300005290 Ga0065712_10121336 Ga0065712_101213362 274
124 3300005328 Ga0070676_10065363 Ga0070676_100653632 274
125 3300005329 Ga0070683_100072461 Ga0070683_1000724612 274
126 3300005330 Ga0070690_100007555 Ga0070690_1000075556 274
127 3300005331 Ga0070670_100101790 Ga0070670_1001017902 274
128 3300005333 Ga0070677_10009260 Ga0070677_100092603 274
129 3300005334 Ga0068869_100004702 Ga0068869_1000047027 274
130 3300005338 Ga0068868_100164832 Ga0068868_1001648321 274
131 3300005340 Ga0070689_100014876 Ga0070689_1000148764 274
132 3300005341 Ga0070691_10040765 Ga0070691_100407652 274
133 3300005343 Ga0070687_100011438 Ga0070687_1000114382 274
134 3300005344 Ga0070661_100083999 Ga0070661_1000839992 274
135 3300005345 Ga0070692_10084663 Ga0070692_100846631 274
136 3300005347 Ga0070668_100035230 Ga0070668_1000352303 274
137 3300005354 Ga0070675_100122702 Ga0070675_1001227022 274
138 3300005364 Ga0070673_100103085 Ga0070673_1001030852 274
139 3300005365 Ga0070688_100089398 Ga0070688_1000893982 274
140 3300005366 Ga0070659_100054906 Ga0070659_1000549062 274
141 3300005438 Ga0070701_10016294 Ga0070701_100162942 274
142 3300005441 Ga0070700_100028121 Ga0070700_1000281212 274
143 3300005455 Ga0070663_100020597 Ga0070663_1000205972 274
144 3300005457 Ga0070662_100036711 Ga0070662_1000367112 274
145 3300005466 Ga0070685_10044044 Ga0070685_100440442 274
146 3300005539 Ga0068853_100044043 Ga0068853_1000440432 274
147 3300005544 Ga0070686_100008579 Ga0070686_1000085795 274
148 3300005548 Ga0070665_100095265 Ga0070665_1000952652 274
149 3300005563 Ga0068855_100165197 Ga0068855_1001651972 274
150 3300005564 Ga0070664_100051354 Ga0070664_1000513542 274
151 3300005577 Ga0068857_100139430 Ga0068857_1001394303 274
152 3300005578 Ga0068854_100049293 Ga0068854_1000492932 274
153 3300005615 Ga0070702_100031689 Ga0070702_1000316892 274
154 3300005718 Ga0068866_10002335 Ga0068866_100023356 274
155 3300005834 Ga0068851_10012908 Ga0068851_100129082 274
156 3300005840 Ga0068870_10027578 Ga0068870_100275783 274
157 3300005844 Ga0068862_100292420 Ga0068862_1002924203 274
158 3300006358 Ga0068871_100110073 Ga0068871_1001100733 274
159 3300006881 Ga0068865_100021963 Ga0068865_1000219633 274
160 3300009094 Ga0111539_10038744 Ga0111539_100387448 274
161 3300009148 Ga0105243_10133898 Ga0105243_101338983 274
162 3300009174 Ga0105241_10508716 Ga0105241_105087161 274
163 3300009176 Ga0105242_10014757 Ga0105242_100147574 274
164 3300009553 Ga0105249_10015859 Ga0105249_100158593 274
165 3300010375 Ga0105239_10280862 Ga0105239_102808623 274
166 3300011119 Ga0105246_10100724 Ga0105246_101007242 274
167 3300013297 Ga0157378_10047198 Ga0157378_100471982 274
168 3300014325 Ga0163163_10051112 Ga0163163_100511122 274
169 3300014326 Ga0157380_10048709 Ga0157380_100487093 274
170 3300014745 Ga0157377_10008365 Ga0157377_100083652 274
171 3300017792 Ga0163161_10102395 Ga0163161_101023952 274
172 3300025315 Ga0207697_10000771 Ga0207697_1000077112 274
173 3300025321 Ga0207656_10037973 Ga0207656_100379732 274
174 3300025893 Ga0207682_10001382 Ga0207682_100013824 274
175 3300025899 Ga0207642_10003792 Ga0207642_100037924 274
176 3300025901 Ga0207688_10000524 Ga0207688_100005246 274
177 3300025903 Ga0207680_10020342 Ga0207680_100203422 274
178 3300025907 Ga0207645_10003306 Ga0207645_100033063 274
179 3300025908 Ga0207643_10000632 Ga0207643_1000063212 274
180 3300025918 Ga0207662_10016468 Ga0207662_100164683 274
181 3300025923 Ga0207681_10041390 Ga0207681_100413904 274
182 3300025925 Ga0207650_10021348 Ga0207650_100213485 274
183 3300025926 Ga0207659_10001717 Ga0207659_100017172 274
184 3300025931 Ga0207644_10078561 Ga0207644_100785612 274
185 3300025933 Ga0207706_10002346 Ga0207706_1000234612 274
186 3300025935 Ga0207709_10224111 Ga0207709_102241113 274
187 3300025940 Ga0207691_10017461 Ga0207691_100174614 274
188 3300025942 Ga0207689_10158417 Ga0207689_101584172 274
189 3300025986 Ga0207658_10036349 Ga0207658_100363492 274
190 3300026035 Ga0207703_10059324 Ga0207703_100593242 274
191 3300026075 Ga0207708_10002020 Ga0207708_100020206 274
192 3300026089 Ga0207648_10014010 Ga0207648_100140106 274
193 3300026116 Ga0207674_10041640 Ga0207674_100416402 274
194 3300026118 Ga0207675_100011565 Ga0207675_1000115654 274
195 3300026121 Ga0207683_10005325 Ga0207683_100053254 274
196 3300026142 Ga0207698_10034612 Ga0207698_100346122 274
197 3300027907 Ga0207428_10079983 Ga0207428_100799833 274
198 3300028380 Ga0268265_10038320 Ga0268265_100383204 274
199 3300028381 Ga0268264_10156033 Ga0268264_101560332 274
200 3300035410 Ga0373924_0092415 Ga0373924_0092415_308_1258 274
201 3300048904 Ga0496101_0122600 Ga0496101_0122600_73_1023 274
202 3300048905 Ga0496102_0297109 Ga0496102_0297109_455_1405 274
203 3300048907 Ga0496104_0023610 Ga0496104_0023610_1357_2307 274
204 3300048908 Ga0496105_0173639 Ga0496105_0173639_443_1393 274
205 3300048910 Ga0496107_0093812 Ga0496107_0093812_686_1636 274
206 3300048911 Ga0496108_0029794 Ga0496108_0029794_109_1059 274
207 3300048912 Ga0496109_0154337 Ga0496109_0154337_1019_1969 274
208 3300048917 Ga0496114_0108693 Ga0496114_0108693_1268_2218 274
209 3300005327 Ga0070658_10240915 Ga0070658_102409152 275
210 3300005344 Ga0070661_100001121 Ga0070661_1000011215 275
211 3300005366 Ga0070659_100038438 Ga0070659_1000384382 275
212 3300005458 Ga0070681_10100713 Ga0070681_101007132 275
213 3300005530 Ga0070679_100009803 Ga0070679_1000098032 275
214 3300005535 Ga0070684_100039393 Ga0070684_1000393932 275
215 3300005563 Ga0068855_100011225 Ga0068855_1000112259 275
216 3300005564 Ga0070664_100002391 Ga0070664_10000239110 275
217 3300005577 Ga0068857_100001876 Ga0068857_1000018762 275
218 3300005578 Ga0068854_100020976 Ga0068854_1000209765 275
219 3300005614 Ga0068856_100002048 Ga0068856_1000020484 275
220 3300005616 Ga0068852_100011026 Ga0068852_1000110264 275
221 3300006844 Ga0075428_100106351 Ga0075428_1001063512 275
222 3300009093 Ga0105240_10002531 Ga0105240_1000253120 275
223 3300009545 Ga0105237_10126959 Ga0105237_101269592 275
224 3300009551 Ga0105238_10000484 Ga0105238_1000048434 275
225 3300013100 Ga0157373_10032232 Ga0157373_100322323 275
226 3300013102 Ga0157371_10053519 Ga0157371_100535193 275
227 3300013104 Ga0157370_10003069 Ga0157370_1000306916 275
228 3300013105 Ga0157369_10006377 Ga0157369_1000637713 275
229 3300013307 Ga0157372_10010340 Ga0157372_100103402 275
230 3300014497 Ga0182008_10049535 Ga0182008_100495352 275
231 3300025909 Ga0207705_10052673 Ga0207705_100526733 275
232 3300025911 Ga0207654_10041807 Ga0207654_100418072 275
233 3300025912 Ga0207707_10014131 Ga0207707_100141312 275
234 3300025913 Ga0207695_10088402 Ga0207695_100884022 275
235 3300025914 Ga0207671_10039603 Ga0207671_100396033 275
236 3300025919 Ga0207657_10136772 Ga0207657_101367722 275
237 3300025920 Ga0207649_10007510 Ga0207649_100075104 275
238 3300025924 Ga0207694_10002559 Ga0207694_100025595 275
239 3300025929 Ga0207664_10003607 Ga0207664_100036072 275
240 3300025932 Ga0207690_10030443 Ga0207690_100304432 275
241 3300025945 Ga0207679_10016532 Ga0207679_100165324 275
242 3300025949 Ga0207667_10131664 Ga0207667_101316642 275
243 3300026041 Ga0207639_10224921 Ga0207639_102249212 275
244 3300026078 Ga0207702_10003232 Ga0207702_100032325 275
245 3300026116 Ga0207674_10000040 Ga0207674_1000004013 275
246 3300026142 Ga0207698_10135576 Ga0207698_101355762 275
247 3300005327 Ga0070658_10042562 Ga0070658_100425623 276
248 3300025909 Ga0207705_10015818 Ga0207705_100158183 276
249 3300025940 Ga0207691_10233853 Ga0207691_102338532 276
250 3300032005 Ga0307411_10367748 Ga0307411_103677482 277
251 3300005364 Ga0070673_100074239 Ga0070673_1000742392 279
252 3300025920 Ga0207649_10003765 Ga0207649_100037656 279
253 3300025960 Ga0207651_10011174 Ga0207651_100111744 279
254 3300005293 Ga0065715_10163288 Ga0065715_101632881 280
255 3300005328 Ga0070676_10023491 Ga0070676_100234912 280
256 3300005339 Ga0070660_100001443 Ga0070660_1000014439 280
257 3300005353 Ga0070669_100290210 Ga0070669_1002902102 280
258 3300005354 Ga0070675_100471622 Ga0070675_1004716221 280
259 3300005355 Ga0070671_100000758 Ga0070671_1000007583 280
260 3300005355 Ga0070671_100254550 Ga0070671_1002545502 280
261 3300005366 Ga0070659_100003747 Ga0070659_1000037472 280
262 3300005456 Ga0070678_100053751 Ga0070678_1000537512 280
263 3300005457 Ga0070662_100002572 Ga0070662_10000257211 280
264 3300005539 Ga0068853_100056864 Ga0068853_1000568643 280
265 3300005543 Ga0070672_100077268 Ga0070672_1000772682 280
266 3300005563 Ga0068855_100002451 Ga0068855_10000245115 280
267 3300005564 Ga0070664_100000120 Ga0070664_10000012021 280
268 3300005614 Ga0068856_100002007 Ga0068856_10000200715 280
269 3300005616 Ga0068852_100039515 Ga0068852_1000395153 280
270 3300006871 Ga0075434_100424418 Ga0075434_1004244181 280
271 3300013100 Ga0157373_10000142 Ga0157373_1000014215 280
272 3300013102 Ga0157371_10000549 Ga0157371_1000054945 280
273 3300013105 Ga0157369_10045116 Ga0157369_100451163 280
274 3300013307 Ga0157372_10024655 Ga0157372_100246552 280
275 3300025907 Ga0207645_10052410 Ga0207645_100524102 280
276 3300025917 Ga0207660_10052593 Ga0207660_100525931 280
277 3300025919 Ga0207657_10000341 Ga0207657_1000034115 280
278 3300025921 Ga0207652_10438853 Ga0207652_104388532 280
279 3300025923 Ga0207681_10190078 Ga0207681_101900782 280
280 3300025926 Ga0207659_10101516 Ga0207659_101015161 280
281 3300025931 Ga0207644_10106862 Ga0207644_101068622 280
282 3300025932 Ga0207690_10002016 Ga0207690_100020162 280
283 3300025933 Ga0207706_10000037 Ga0207706_10000037121 280
284 3300025937 Ga0207669_10073018 Ga0207669_100730181 280
285 3300025945 Ga0207679_10001850 Ga0207679_100018508 280
286 3300025949 Ga0207667_10013261 Ga0207667_100132615 280
287 3300026041 Ga0207639_10006119 Ga0207639_100061194 280
288 3300026078 Ga0207702_10002815 Ga0207702_100028159 280
289 3300026116 Ga0207674_10409236 Ga0207674_104092362 280
290 3300041413 Ga0439465_0062802 Ga0439465_0062802_79_1005 280
291 3300048904 Ga0496101_0023863 Ga0496101_0023863_2949_3899 280
292 3300048905 Ga0496102_0109639 Ga0496102_0109639_971_1921 280
293 3300048909 Ga0496106_0000737 Ga0496106_0000737_22195_23145 280
294 3300048913 Ga0496110_0136992 Ga0496110_0136992_425_1375 280
295 3300005356 Ga0070674_100095624 Ga0070674_1000956242 282
296 3300005459 Ga0068867_100053179 Ga0068867_1000531793 282
297 3300005843 Ga0068860_100126195 Ga0068860_1001261952 282
298 3300007076 Ga0075435_100204901 Ga0075435_1002049011 282
299 3300017792 Ga0163161_10011199 Ga0163161_100111993 282
300 3300025934 Ga0207686_10017623 Ga0207686_100176235 282
301 3300025938 Ga0207704_10107114 Ga0207704_101071142 282
302 3300026089 Ga0207648_10010994 Ga0207648_100109947 282
303 3300026121 Ga0207683_10025973 Ga0207683_100259734 282
304 3300044712 Ga0453684_0236026 Ga0453684_0236026_184_1101 282
305 3300025940 Ga0207691_10125321 Ga0207691_101253211 283
306 3300025972 Ga0207668_10043134 Ga0207668_100431342 283
307 3300005331 Ga0070670_100005195 Ga0070670_1000051954 284
308 3300005334 Ga0068869_100003339 Ga0068869_10000333910 284
309 3300005340 Ga0070689_100157011 Ga0070689_1001570112 284
310 3300005347 Ga0070668_100023182 Ga0070668_1000231822 284
311 3300005364 Ga0070673_100008416 Ga0070673_1000084162 284
312 3300005367 Ga0070667_100023042 Ga0070667_1000230422 284
313 3300005459 Ga0068867_100018604 Ga0068867_1000186042 284
314 3300005548 Ga0070665_100530845 Ga0070665_1005308452 284
315 3300005563 Ga0068855_100239399 Ga0068855_1002393992 284
316 3300005577 Ga0068857_100057642 Ga0068857_1000576422 284
317 3300005617 Ga0068859_100004536 Ga0068859_1000045364 284
318 3300005618 Ga0068864_100043351 Ga0068864_1000433514 284
319 3300005719 Ga0068861_100032353 Ga0068861_1000323534 284
320 3300005840 Ga0068870_10085455 Ga0068870_100854552 284
321 3300005841 Ga0068863_100029339 Ga0068863_1000293393 284
322 3300005842 Ga0068858_100048524 Ga0068858_1000485243 284
323 3300005843 Ga0068860_100016867 Ga0068860_1000168678 284
324 3300005844 Ga0068862_100031535 Ga0068862_1000315352 284
325 3300006881 Ga0068865_100150519 Ga0068865_1001505192 284
326 3300006931 Ga0097620_100004536 Ga0097620_1000045364 284
327 3300009094 Ga0111539_10346546 Ga0111539_103465462 284
328 3300009101 Ga0105247_10068880 Ga0105247_100688802 284
329 3300009545 Ga0105237_10289506 Ga0105237_102895062 284
330 3300013308 Ga0157375_10171735 Ga0157375_101717352 284
331 3300014326 Ga0157380_10177112 Ga0157380_101771122 284
332 3300025923 Ga0207681_10142951 Ga0207681_101429512 284
333 3300025925 Ga0207650_10032547 Ga0207650_100325472 284
334 3300025926 Ga0207659_10162659 Ga0207659_101626592 284
335 3300025938 Ga0207704_10123080 Ga0207704_101230801 284
336 3300025941 Ga0207711_10023334 Ga0207711_100233345 284
337 3300025942 Ga0207689_10004636 Ga0207689_1000463610 284
338 3300025960 Ga0207651_10066847 Ga0207651_100668472 284
339 3300025972 Ga0207668_10052977 Ga0207668_100529772 284
340 3300025972 Ga0207668_10054958 Ga0207668_100549582 284
341 3300025986 Ga0207658_10016693 Ga0207658_100166932 284
342 3300026035 Ga0207703_10000559 Ga0207703_1000055927 284
343 3300026088 Ga0207641_10040931 Ga0207641_100409313 284
344 3300026089 Ga0207648_10020027 Ga0207648_100200276 284
345 3300026095 Ga0207676_10106271 Ga0207676_101062712 284
346 3300026116 Ga0207674_10011703 Ga0207674_100117033 284
347 3300026118 Ga0207675_100017185 Ga0207675_1000171856 284
348 3300026121 Ga0207683_10119581 Ga0207683_101195812 284
349 3300028379 Ga0268266_10580730 Ga0268266_105807301 284
350 3300028380 Ga0268265_10020997 Ga0268265_100209973 284
351 3300028381 Ga0268264_10004968 Ga0268264_100049686 284
352 3300048905 Ga0496102_0028471 Ga0496102_0028471_2839_3786 284
353 3300048906 Ga0496103_0060607 Ga0496103_0060607_960_1907 284
354 3300048911 Ga0496108_0193261 Ga0496108_0193261_55_1002 284
355 3300048912 Ga0496109_0069000 Ga0496109_0069000_155_1102 284
356 3300050511 nmdc:mga08y16_624414_c1 nmdc:mga08y16_624414_c1_42_989 284
357 3300042015 Ga0439462_0036859 Ga0439462_0036859_20_967 287
358 3300049588 Ga0501072_0474825 Ga0501072_0474825_24_974 287
359 3300049593 Ga0501077_0096920 Ga0501077_0096920_29_979 287
360 3300042876 Ga0451577_0003232 Ga0451577_0003232_10885_11838 288
361 3300005293 Ga0065715_10105456 Ga0065715_101054563 289
362 3300005327 Ga0070658_10276831 Ga0070658_102768312 289
363 3300005329 Ga0070683_100180217 Ga0070683_1001802172 289
364 3300005330 Ga0070690_100000937 Ga0070690_1000009373 289
365 3300005330 Ga0070690_100101313 Ga0070690_1001013132 289
366 3300005330 Ga0070690_100278225 Ga0070690_1002782252 289
367 3300005331 Ga0070670_100006021 Ga0070670_10000602114 289
368 3300005331 Ga0070670_100013131 Ga0070670_1000131313 289
369 3300005333 Ga0070677_10000311 Ga0070677_1000031114 289
370 3300005333 Ga0070677_10023257 Ga0070677_100232572 289
371 3300005333 Ga0070677_10101402 Ga0070677_101014021 289
372 3300005334 Ga0068869_100005299 Ga0068869_1000052997 289
373 3300005334 Ga0068869_100063480 Ga0068869_1000634802 289
374 3300005334 Ga0068869_100367124 Ga0068869_1003671241 289
375 3300005335 Ga0070666_10015499 Ga0070666_100154995 289
376 3300005335 Ga0070666_10021926 Ga0070666_100219263 289
377 3300005335 Ga0070666_10031845 Ga0070666_100318452 289
378 3300005336 Ga0070680_100043480 Ga0070680_1000434802 289
379 3300005336 Ga0070680_100050144 Ga0070680_1000501443 289
380 3300005337 Ga0070682_100002642 Ga0070682_1000026423 289
381 3300005338 Ga0068868_100001088 Ga0068868_10000108814 289
382 3300005338 Ga0068868_100014606 Ga0068868_1000146063 289
383 3300005338 Ga0068868_100021157 Ga0068868_1000211574 289
384 3300005338 Ga0068868_100109971 Ga0068868_1001099712 289
385 3300005338 Ga0068868_100235349 Ga0068868_1002353492 289
386 3300005339 Ga0070660_100001240 Ga0070660_10000124016 289
387 3300005339 Ga0070660_100175395 Ga0070660_1001753952 289
388 3300005340 Ga0070689_100027007 Ga0070689_1000270072 289
389 3300005340 Ga0070689_100138058 Ga0070689_1001380581 289
390 3300005340 Ga0070689_100224098 Ga0070689_1002240982 289
391 3300005343 Ga0070687_100054981 Ga0070687_1000549812 289
392 3300005343 Ga0070687_100141042 Ga0070687_1001410421 289
393 3300005344 Ga0070661_100000422 Ga0070661_10000042233 289
394 3300005344 Ga0070661_100280508 Ga0070661_1002805081 289
395 3300005344 Ga0070661_100284007 Ga0070661_1002840072 289
396 3300005347 Ga0070668_100003855 Ga0070668_1000038555 289
397 3300005347 Ga0070668_100448542 Ga0070668_1004485422 289
398 3300005353 Ga0070669_100242731 Ga0070669_1002427312 289
399 3300005354 Ga0070675_100004306 Ga0070675_1000043068 289
400 3300005354 Ga0070675_100063250 Ga0070675_1000632502 289
401 3300005355 Ga0070671_100007181 Ga0070671_1000071813 289
402 3300005355 Ga0070671_100008280 Ga0070671_1000082802 289
403 3300005355 Ga0070671_100018968 Ga0070671_1000189685 289
404 3300005355 Ga0070671_100042621 Ga0070671_1000426212 289
405 3300005356 Ga0070674_100000539 Ga0070674_10000053911 289
406 3300005356 Ga0070674_100049758 Ga0070674_1000497582 289
407 3300005364 Ga0070673_100017502 Ga0070673_1000175022 289
408 3300005364 Ga0070673_100037562 Ga0070673_1000375622 289
409 3300005364 Ga0070673_100096181 Ga0070673_1000961812 289
410 3300005364 Ga0070673_100099891 Ga0070673_1000998912 289
411 3300005365 Ga0070688_100048802 Ga0070688_1000488022 289
412 3300005365 Ga0070688_100209997 Ga0070688_1002099972 289
413 3300005366 Ga0070659_100041362 Ga0070659_1000413623 289
414 3300005366 Ga0070659_100107228 Ga0070659_1001072282 289
415 3300005367 Ga0070667_100012929 Ga0070667_1000129293 289
416 3300005367 Ga0070667_100033086 Ga0070667_1000330865 289
417 3300005367 Ga0070667_100060942 Ga0070667_1000609422 289
418 3300005406 Ga0070703_10001200 Ga0070703_100012002 289
419 3300005435 Ga0070714_100001293 Ga0070714_10000129317 289
420 3300005435 Ga0070714_100040851 Ga0070714_1000408512 289
421 3300005435 Ga0070714_100162116 Ga0070714_1001621162 289
422 3300005436 Ga0070713_100014185 Ga0070713_1000141854 289
423 3300005436 Ga0070713_100022094 Ga0070713_1000220944 289
424 3300005436 Ga0070713_100055080 Ga0070713_1000550803 289
425 3300005437 Ga0070710_10002850 Ga0070710_100028506 289
426 3300005437 Ga0070710_10022141 Ga0070710_100221412 289
427 3300005437 Ga0070710_10104267 Ga0070710_101042671 289
428 3300005438 Ga0070701_10035616 Ga0070701_100356162 289
429 3300005439 Ga0070711_100041397 Ga0070711_1000413972 289
430 3300005439 Ga0070711_100067958 Ga0070711_1000679582 289
431 3300005439 Ga0070711_100171819 Ga0070711_1001718192 289
432 3300005440 Ga0070705_100000841 Ga0070705_10000084112 289
433 3300005440 Ga0070705_100150597 Ga0070705_1001505972 289
434 3300005444 Ga0070694_100055888 Ga0070694_1000558882 289
435 3300005445 Ga0070708_100108699 Ga0070708_1001086992 289
436 3300005445 Ga0070708_100158925 Ga0070708_1001589252 289
437 3300005455 Ga0070663_100007113 Ga0070663_1000071136 289
438 3300005456 Ga0070678_100002006 Ga0070678_1000020067 289
439 3300005456 Ga0070678_100040346 Ga0070678_1000403461 289
440 3300005456 Ga0070678_100225153 Ga0070678_1002251532 289
441 3300005456 Ga0070678_100367848 Ga0070678_1003678482 289
442 3300005457 Ga0070662_100090000 Ga0070662_1000900002 289
443 3300005457 Ga0070662_100119865 Ga0070662_1001198652 289
444 3300005457 Ga0070662_100149138 Ga0070662_1001491382 289
445 3300005457 Ga0070662_100313734 Ga0070662_1003137342 289
446 3300005458 Ga0070681_10024351 Ga0070681_100243515 289
447 3300005459 Ga0068867_100001532 Ga0068867_10000153210 289
448 3300005459 Ga0068867_100058920 Ga0068867_1000589202 289
449 3300005459 Ga0068867_100178831 Ga0068867_1001788312 289
450 3300005459 Ga0068867_100236897 Ga0068867_1002368971 289
451 3300005466 Ga0070685_10016964 Ga0070685_100169643 289
452 3300005467 Ga0070706_100134617 Ga0070706_1001346172 289
453 3300005467 Ga0070706_100294372 Ga0070706_1002943722 289
454 3300005467 Ga0070706_100333506 Ga0070706_1003335062 289
455 3300005468 Ga0070707_100046638 Ga0070707_1000466383 289
456 3300005468 Ga0070707_100176497 Ga0070707_1001764972 289
457 3300005468 Ga0070707_100380338 Ga0070707_1003803382 289
458 3300005471 Ga0070698_100059491 Ga0070698_1000594912 289
459 3300005471 Ga0070698_100258627 Ga0070698_1002586272 289
460 3300005471 Ga0070698_100333361 Ga0070698_1003333612 289
461 3300005518 Ga0070699_100249199 Ga0070699_1002491992 289
462 3300005518 Ga0070699_100305986 Ga0070699_1003059862 289
463 3300005530 Ga0070679_100063431 Ga0070679_1000634312 289
464 3300005535 Ga0070684_100066710 Ga0070684_1000667103 289
465 3300005535 Ga0070684_100110230 Ga0070684_1001102302 289
466 3300005536 Ga0070697_100420400 Ga0070697_1004204001 289
467 3300005539 Ga0068853_100009263 Ga0068853_1000092637 289
468 3300005539 Ga0068853_100019343 Ga0068853_1000193433 289
469 3300005539 Ga0068853_100042613 Ga0068853_1000426133 289
470 3300005539 Ga0068853_100307940 Ga0068853_1003079402 289
471 3300005543 Ga0070672_100000794 Ga0070672_10000079410 289
472 3300005543 Ga0070672_100008039 Ga0070672_1000080396 289
473 3300005543 Ga0070672_100039344 Ga0070672_1000393442 289
474 3300005543 Ga0070672_100310338 Ga0070672_1003103382 289
475 3300005544 Ga0070686_100038894 Ga0070686_1000388941 289
476 3300005545 Ga0070695_100076489 Ga0070695_1000764892 289
477 3300005546 Ga0070696_100000636 Ga0070696_1000006369 289
478 3300005546 Ga0070696_100017547 Ga0070696_1000175471 289
479 3300005546 Ga0070696_100210699 Ga0070696_1002106992 289
480 3300005547 Ga0070693_100000180 Ga0070693_10000018026 289
481 3300005547 Ga0070693_100140078 Ga0070693_1001400782 289
482 3300005548 Ga0070665_100005242 Ga0070665_1000052425 289
483 3300005548 Ga0070665_100006820 Ga0070665_1000068205 289
484 3300005548 Ga0070665_100014818 Ga0070665_1000148184 289
485 3300005548 Ga0070665_100044628 Ga0070665_1000446282 289
486 3300005549 Ga0070704_100010310 Ga0070704_1000103102 289
487 3300005549 Ga0070704_100077775 Ga0070704_1000777752 289
488 3300005563 Ga0068855_100000437 Ga0068855_10000043736 289
489 3300005563 Ga0068855_100038423 Ga0068855_1000384232 289
490 3300005563 Ga0068855_100055606 Ga0068855_1000556063 289
491 3300005563 Ga0068855_100091052 Ga0068855_1000910522 289
492 3300005564 Ga0070664_100055187 Ga0070664_1000551873 289
493 3300005564 Ga0070664_100151814 Ga0070664_1001518142 289
494 3300005577 Ga0068857_100351296 Ga0068857_1003512962 289
495 3300005614 Ga0068856_100020667 Ga0068856_1000206674 289
496 3300005614 Ga0068856_100028863 Ga0068856_1000288637 289
497 3300005615 Ga0070702_100014533 Ga0070702_1000145332 289
498 3300005615 Ga0070702_100040731 Ga0070702_1000407312 289
499 3300005616 Ga0068852_100000703 Ga0068852_10000070311 289
500 3300005617 Ga0068859_100007313 Ga0068859_1000073137 289
501 3300005617 Ga0068859_100048377 Ga0068859_1000483772 289
502 3300005617 Ga0068859_100088067 Ga0068859_1000880672 289
503 3300005618 Ga0068864_100005836 Ga0068864_1000058367 289
504 3300005618 Ga0068864_100006991 Ga0068864_1000069915 289
505 3300005618 Ga0068864_100016447 Ga0068864_1000164473 289
506 3300005618 Ga0068864_100189124 Ga0068864_1001891241 289
507 3300005618 Ga0068864_100210914 Ga0068864_1002109142 289
508 3300005718 Ga0068866_10003843 Ga0068866_100038436 289
509 3300005834 Ga0068851_10000609 Ga0068851_100006098 289
510 3300005834 Ga0068851_10006762 Ga0068851_100067622 289
511 3300005840 Ga0068870_10001373 Ga0068870_100013732 289
512 3300005840 Ga0068870_10004702 Ga0068870_100047022 289
513 3300005841 Ga0068863_100011115 Ga0068863_1000111154 289
514 3300005841 Ga0068863_100013417 Ga0068863_1000134176 289
515 3300005841 Ga0068863_100076016 Ga0068863_1000760162 289
516 3300005841 Ga0068863_100129012 Ga0068863_1001290122 289
517 3300005841 Ga0068863_100210752 Ga0068863_1002107522 289
518 3300005842 Ga0068858_100036666 Ga0068858_1000366663 289
519 3300005842 Ga0068858_100082984 Ga0068858_1000829842 289
520 3300005842 Ga0068858_100239620 Ga0068858_1002396202 289
521 3300005843 Ga0068860_100027659 Ga0068860_1000276592 289
522 3300005843 Ga0068860_100029411 Ga0068860_1000294112 289
523 3300005843 Ga0068860_100031977 Ga0068860_1000319776 289
524 3300005843 Ga0068860_100065162 Ga0068860_1000651623 289
525 3300005843 Ga0068860_100120014 Ga0068860_1001200142 289
526 3300005844 Ga0068862_100004037 Ga0068862_1000040372 289
527 3300005985 Ga0081539_10027135 Ga0081539_100271353 289
528 3300006163 Ga0070715_10019149 Ga0070715_100191491 289
529 3300006175 Ga0070712_100001779 Ga0070712_1000017795 289
530 3300006175 Ga0070712_100011777 Ga0070712_1000117774 289
531 3300006175 Ga0070712_100071133 Ga0070712_1000711332 289
532 3300006237 Ga0097621_100013839 Ga0097621_1000138395 289
533 3300006237 Ga0097621_100034872 Ga0097621_1000348724 289
534 3300006237 Ga0097621_100044504 Ga0097621_1000445043 289
535 3300006237 Ga0097621_100060211 Ga0097621_1000602113 289
536 3300006237 Ga0097621_100120280 Ga0097621_1001202802 289
537 3300006237 Ga0097621_100121174 Ga0097621_1001211741 289
538 3300006358 Ga0068871_100011567 Ga0068871_1000115673 289
539 3300006358 Ga0068871_100016596 Ga0068871_1000165962 289
540 3300006358 Ga0068871_100049457 Ga0068871_1000494572 289
541 3300006358 Ga0068871_100116362 Ga0068871_1001163622 289
542 3300006358 Ga0068871_100270422 Ga0068871_1002704222 289
543 3300006358 Ga0068871_100349976 Ga0068871_1003499761 289
544 3300006852 Ga0075433_10022361 Ga0075433_100223613 289
545 3300006871 Ga0075434_100002519 Ga0075434_1000025194 289
546 3300006871 Ga0075434_100249837 Ga0075434_1002498372 289
547 3300006871 Ga0075434_100364973 Ga0075434_1003649732 289
548 3300006881 Ga0068865_100017767 Ga0068865_1000177672 289
549 3300006881 Ga0068865_100053793 Ga0068865_1000537932 289
550 3300006881 Ga0068865_100130247 Ga0068865_1001302471 289
551 3300006881 Ga0068865_100189958 Ga0068865_1001899582 289
552 3300006914 Ga0075436_100001322 Ga0075436_10000132210 289
553 3300006914 Ga0075436_100168139 Ga0075436_1001681392 289
554 3300006931 Ga0097620_100007313 Ga0097620_1000073135 289
555 3300006931 Ga0097620_100048376 Ga0097620_1000483762 289
556 3300006931 Ga0097620_100088067 Ga0097620_1000880672 289
557 3300007076 Ga0075435_100018903 Ga0075435_1000189034 289
558 3300007076 Ga0075435_100038871 Ga0075435_1000388712 289
559 3300009093 Ga0105240_10038120 Ga0105240_100381204 289
560 3300009094 Ga0111539_10116285 Ga0111539_101162853 289
561 3300009098 Ga0105245_10020497 Ga0105245_100204974 289
562 3300009098 Ga0105245_10034327 Ga0105245_100343272 289
563 3300009098 Ga0105245_10074575 Ga0105245_100745752 289
564 3300009148 Ga0105243_10343951 Ga0105243_103439512 289
565 3300009148 Ga0105243_10358331 Ga0105243_103583312 289
566 3300009174 Ga0105241_10005305 Ga0105241_100053055 289
567 3300009174 Ga0105241_10139815 Ga0105241_101398152 289
568 3300009176 Ga0105242_10046189 Ga0105242_100461894 289
569 3300009176 Ga0105242_10158523 Ga0105242_101585231 289
570 3300009176 Ga0105242_10218900 Ga0105242_102189001 289
571 3300009177 Ga0105248_10002744 Ga0105248_100027445 289
572 3300009177 Ga0105248_10044391 Ga0105248_100443913 289
573 3300009177 Ga0105248_10045076 Ga0105248_100450763 289
574 3300009177 Ga0105248_10087294 Ga0105248_100872942 289
575 3300009177 Ga0105248_10328763 Ga0105248_103287632 289
576 3300009177 Ga0105248_10511322 Ga0105248_105113222 289
577 3300009545 Ga0105237_10101611 Ga0105237_101016112 289
578 3300009551 Ga0105238_10000708 Ga0105238_1000070816 289
579 3300009551 Ga0105238_10017077 Ga0105238_100170772 289
580 3300009551 Ga0105238_10039196 Ga0105238_100391962 289
581 3300013100 Ga0157373_10000439 Ga0157373_1000043926 289
582 3300013102 Ga0157371_10214661 Ga0157371_102146611 289
583 3300013104 Ga0157370_10011154 Ga0157370_100111545 289
584 3300013104 Ga0157370_10182023 Ga0157370_101820232 289
585 3300013105 Ga0157369_10001662 Ga0157369_1000166221 289
586 3300013105 Ga0157369_10028998 Ga0157369_100289985 289
587 3300013105 Ga0157369_10057558 Ga0157369_100575583 289
588 3300013105 Ga0157369_10084262 Ga0157369_100842622 289
589 3300013105 Ga0157369_10426383 Ga0157369_104263832 289
590 3300013296 Ga0157374_10046348 Ga0157374_100463481 289
591 3300013296 Ga0157374_10054076 Ga0157374_100540762 289
592 3300013296 Ga0157374_10126874 Ga0157374_101268742 289
593 3300013297 Ga0157378_10018814 Ga0157378_100188145 289
594 3300013297 Ga0157378_10026831 Ga0157378_100268313 289
595 3300013297 Ga0157378_10111197 Ga0157378_101111972 289
596 3300013297 Ga0157378_10547524 Ga0157378_105475241 289
597 3300013306 Ga0163162_10042407 Ga0163162_100424072 289
598 3300013306 Ga0163162_10045176 Ga0163162_100451762 289
599 3300013306 Ga0163162_10068889 Ga0163162_100688893 289
600 3300013306 Ga0163162_10257476 Ga0163162_102574762 289
601 3300013307 Ga0157372_10002963 Ga0157372_1000296316 289
602 3300013307 Ga0157372_10003796 Ga0157372_100037966 289
603 3300013307 Ga0157372_10009842 Ga0157372_100098422 289
604 3300013307 Ga0157372_10048759 Ga0157372_100487595 289
605 3300013307 Ga0157372_10093600 Ga0157372_100936003 289
606 3300013307 Ga0157372_10328567 Ga0157372_103285672 289
607 3300013307 Ga0157372_10663931 Ga0157372_106639311 289
608 3300013308 Ga0157375_10008096 Ga0157375_100080964 289
609 3300013308 Ga0157375_10060084 Ga0157375_100600843 289
610 3300013308 Ga0157375_10270773 Ga0157375_102707731 289
611 3300014325 Ga0163163_10032631 Ga0163163_100326314 289
612 3300014968 Ga0157379_10039514 Ga0157379_100395143 289
613 3300014969 Ga0157376_10009267 Ga0157376_100092676 289
614 3300014969 Ga0157376_10056995 Ga0157376_100569953 289
615 3300014969 Ga0157376_10097230 Ga0157376_100972302 289
616 3300014969 Ga0157376_10172143 Ga0157376_101721431 289
617 3300014969 Ga0157376_10205247 Ga0157376_102052472 289
618 3300017792 Ga0163161_10103349 Ga0163161_101033492 289
619 3300017792 Ga0163161_10277412 Ga0163161_102774121 289
620 3300025315 Ga0207697_10022755 Ga0207697_100227553 289
621 3300025321 Ga0207656_10061372 Ga0207656_100613722 289
622 3300025321 Ga0207656_10116215 Ga0207656_101162151 289
623 3300025885 Ga0207653_10003878 Ga0207653_100038785 289
624 3300025893 Ga0207682_10000061 Ga0207682_100000618 289
625 3300025898 Ga0207692_10002535 Ga0207692_100025354 289
626 3300025898 Ga0207692_10003513 Ga0207692_100035132 289
627 3300025899 Ga0207642_10034580 Ga0207642_100345802 289
628 3300025900 Ga0207710_10012018 Ga0207710_100120183 289
629 3300025903 Ga0207680_10024123 Ga0207680_100241232 289
630 3300025903 Ga0207680_10044079 Ga0207680_100440792 289
631 3300025903 Ga0207680_10047484 Ga0207680_100474842 289
632 3300025903 Ga0207680_10062397 Ga0207680_100623972 289
633 3300025905 Ga0207685_10044182 Ga0207685_100441822 289
634 3300025906 Ga0207699_10043946 Ga0207699_100439462 289
635 3300025906 Ga0207699_10269112 Ga0207699_102691121 289
636 3300025907 Ga0207645_10000143 Ga0207645_1000014344 289
637 3300025907 Ga0207645_10055232 Ga0207645_100552322 289
638 3300025908 Ga0207643_10000189 Ga0207643_1000018932 289
639 3300025908 Ga0207643_10019153 Ga0207643_100191532 289
640 3300025909 Ga0207705_10143446 Ga0207705_101434462 289
641 3300025910 Ga0207684_10065825 Ga0207684_100658253 289
642 3300025911 Ga0207654_10044322 Ga0207654_100443222 289
643 3300025911 Ga0207654_10143878 Ga0207654_101438782 289
644 3300025912 Ga0207707_10000305 Ga0207707_1000030533 289
645 3300025912 Ga0207707_10020405 Ga0207707_100204054 289
646 3300025912 Ga0207707_10189322 Ga0207707_101893222 289
647 3300025913 Ga0207695_10074702 Ga0207695_100747023 289
648 3300025913 Ga0207695_10092785 Ga0207695_100927853 289
649 3300025913 Ga0207695_10223022 Ga0207695_102230221 289
650 3300025913 Ga0207695_10362570 Ga0207695_103625702 289
651 3300025915 Ga0207693_10000605 Ga0207693_100006053 289
652 3300025915 Ga0207693_10011952 Ga0207693_100119523 289
653 3300025916 Ga0207663_10008229 Ga0207663_100082292 289
654 3300025917 Ga0207660_10001522 Ga0207660_1000152216 289
655 3300025918 Ga0207662_10008136 Ga0207662_100081363 289
656 3300025918 Ga0207662_10144512 Ga0207662_101445122 289
657 3300025919 Ga0207657_10000236 Ga0207657_1000023623 289
658 3300025919 Ga0207657_10001274 Ga0207657_1000127418 289
659 3300025920 Ga0207649_10033132 Ga0207649_100331322 289
660 3300025920 Ga0207649_10117584 Ga0207649_101175842 289
661 3300025921 Ga0207652_10000572 Ga0207652_1000057212 289
662 3300025921 Ga0207652_10078209 Ga0207652_100782092 289
663 3300025921 Ga0207652_10337729 Ga0207652_103377292 289
664 3300025922 Ga0207646_10037621 Ga0207646_100376213 289
665 3300025923 Ga0207681_10124618 Ga0207681_101246182 289
666 3300025923 Ga0207681_10320574 Ga0207681_103205742 289
667 3300025924 Ga0207694_10016977 Ga0207694_100169774 289
668 3300025924 Ga0207694_10067079 Ga0207694_100670792 289
669 3300025925 Ga0207650_10006656 Ga0207650_100066563 289
670 3300025925 Ga0207650_10052022 Ga0207650_100520222 289
671 3300025925 Ga0207650_10125870 Ga0207650_101258702 289
672 3300025925 Ga0207650_10182762 Ga0207650_101827622 289
673 3300025925 Ga0207650_10215442 Ga0207650_102154422 289
674 3300025926 Ga0207659_10001702 Ga0207659_1000170210 289
675 3300025926 Ga0207659_10281472 Ga0207659_102814722 289
676 3300025927 Ga0207687_10009538 Ga0207687_100095386 289
677 3300025927 Ga0207687_10012063 Ga0207687_100120634 289
678 3300025927 Ga0207687_10332628 Ga0207687_103326281 289
679 3300025928 Ga0207700_10003435 Ga0207700_100034354 289
680 3300025928 Ga0207700_10024869 Ga0207700_100248693 289
681 3300025928 Ga0207700_10039165 Ga0207700_100391652 289
682 3300025928 Ga0207700_10055501 Ga0207700_100555012 289
683 3300025928 Ga0207700_10201327 Ga0207700_102013272 289
684 3300025929 Ga0207664_10003667 Ga0207664_100036674 289
685 3300025929 Ga0207664_10190681 Ga0207664_101906812 289
686 3300025929 Ga0207664_10204825 Ga0207664_102048252 289
687 3300025931 Ga0207644_10003631 Ga0207644_100036313 289
688 3300025931 Ga0207644_10004584 Ga0207644_100045843 289
689 3300025931 Ga0207644_10006445 Ga0207644_100064453 289
690 3300025931 Ga0207644_10016308 Ga0207644_100163084 289
691 3300025931 Ga0207644_10282982 Ga0207644_102829822 289
692 3300025932 Ga0207690_10004905 Ga0207690_100049052 289
693 3300025932 Ga0207690_10295821 Ga0207690_102958211 289
694 3300025933 Ga0207706_10002271 Ga0207706_1000227112 289
695 3300025933 Ga0207706_10045007 Ga0207706_100450072 289
696 3300025933 Ga0207706_10221465 Ga0207706_102214652 289
697 3300025933 Ga0207706_10237589 Ga0207706_102375892 289
698 3300025934 Ga0207686_10000645 Ga0207686_100006456 289
699 3300025936 Ga0207670_10060956 Ga0207670_100609563 289
700 3300025937 Ga0207669_10008113 Ga0207669_100081135 289
701 3300025937 Ga0207669_10017690 Ga0207669_100176903 289
702 3300025938 Ga0207704_10007762 Ga0207704_100077623 289
703 3300025938 Ga0207704_10028961 Ga0207704_100289612 289
704 3300025939 Ga0207665_10015015 Ga0207665_100150153 289
705 3300025939 Ga0207665_10100732 Ga0207665_101007322 289
706 3300025940 Ga0207691_10000016 Ga0207691_10000016112 289
707 3300025940 Ga0207691_10042719 Ga0207691_100427195 289
708 3300025940 Ga0207691_10128007 Ga0207691_101280072 289
709 3300025940 Ga0207691_10165735 Ga0207691_101657352 289
710 3300025940 Ga0207691_10268575 Ga0207691_102685752 289
711 3300025941 Ga0207711_10009671 Ga0207711_100096717 289
712 3300025941 Ga0207711_10017357 Ga0207711_100173575 289
713 3300025941 Ga0207711_10125413 Ga0207711_101254132 289
714 3300025941 Ga0207711_10356136 Ga0207711_103561362 289
715 3300025941 Ga0207711_10425171 Ga0207711_104251711 289
716 3300025942 Ga0207689_10000870 Ga0207689_1000087012 289
717 3300025942 Ga0207689_10056631 Ga0207689_100566313 289
718 3300025945 Ga0207679_10003252 Ga0207679_100032525 289
719 3300025949 Ga0207667_10008179 Ga0207667_100081799 289
720 3300025949 Ga0207667_10016005 Ga0207667_100160054 289
721 3300025949 Ga0207667_10049453 Ga0207667_100494533 289
722 3300025949 Ga0207667_10207472 Ga0207667_102074722 289
723 3300025949 Ga0207667_10252738 Ga0207667_102527382 289
724 3300025960 Ga0207651_10018254 Ga0207651_100182543 289
725 3300025960 Ga0207651_10052906 Ga0207651_100529062 289
726 3300025960 Ga0207651_10072307 Ga0207651_100723072 289
727 3300025960 Ga0207651_10076859 Ga0207651_100768592 289
728 3300025972 Ga0207668_10176463 Ga0207668_101764632 289
729 3300025981 Ga0207640_10172372 Ga0207640_101723721 289
730 3300025981 Ga0207640_10286805 Ga0207640_102868051 289
731 3300025986 Ga0207658_10001061 Ga0207658_100010616 289
732 3300025986 Ga0207658_10016917 Ga0207658_100169175 289
733 3300025986 Ga0207658_10035560 Ga0207658_100355603 289
734 3300025986 Ga0207658_10052140 Ga0207658_100521402 289
735 3300025986 Ga0207658_10355730 Ga0207658_103557302 289
736 3300026023 Ga0207677_10000384 Ga0207677_100003847 289
737 3300026023 Ga0207677_10002748 Ga0207677_100027482 289
738 3300026023 Ga0207677_10057180 Ga0207677_100571802 289
739 3300026023 Ga0207677_10101504 Ga0207677_101015042 289
740 3300026023 Ga0207677_10103963 Ga0207677_101039631 289
741 3300026023 Ga0207677_10188900 Ga0207677_101889002 289
742 3300026023 Ga0207677_10416425 Ga0207677_104164251 289
743 3300026035 Ga0207703_10006066 Ga0207703_100060667 289
744 3300026035 Ga0207703_10112800 Ga0207703_101128002 289
745 3300026035 Ga0207703_10195956 Ga0207703_101959562 289
746 3300026041 Ga0207639_10010013 Ga0207639_100100135 289
747 3300026041 Ga0207639_10021047 Ga0207639_100210472 289
748 3300026041 Ga0207639_10041646 Ga0207639_100416462 289
749 3300026041 Ga0207639_10291402 Ga0207639_102914021 289
750 3300026041 Ga0207639_10455095 Ga0207639_104550951 289
751 3300026067 Ga0207678_10001044 Ga0207678_100010449 289
752 3300026067 Ga0207678_10109464 Ga0207678_101094642 289
753 3300026078 Ga0207702_10001008 Ga0207702_1000100815 289
754 3300026078 Ga0207702_10005727 Ga0207702_100057272 289
755 3300026078 Ga0207702_10103108 Ga0207702_101031082 289
756 3300026088 Ga0207641_10005288 Ga0207641_100052883 289
757 3300026088 Ga0207641_10011902 Ga0207641_100119024 289
758 3300026088 Ga0207641_10026296 Ga0207641_100262962 289
759 3300026088 Ga0207641_10032429 Ga0207641_100324292 289
760 3300026088 Ga0207641_10189247 Ga0207641_101892472 289
761 3300026088 Ga0207641_10365618 Ga0207641_103656182 289
762 3300026089 Ga0207648_10007158 Ga0207648_100071585 289
763 3300026089 Ga0207648_10018464 Ga0207648_100184642 289
764 3300026089 Ga0207648_10151795 Ga0207648_101517952 289
765 3300026095 Ga0207676_10000680 Ga0207676_1000068015 289
766 3300026095 Ga0207676_10007971 Ga0207676_100079713 289
767 3300026095 Ga0207676_10011804 Ga0207676_100118044 289
768 3300026095 Ga0207676_10079615 Ga0207676_100796152 289
769 3300026095 Ga0207676_10183509 Ga0207676_101835092 289
770 3300026116 Ga0207674_10000170 Ga0207674_1000017047 289
771 3300026118 Ga0207675_100008544 Ga0207675_10000854412 289
772 3300026118 Ga0207675_100019790 Ga0207675_1000197904 289
773 3300026118 Ga0207675_100036156 Ga0207675_1000361562 289
774 3300026121 Ga0207683_10000322 Ga0207683_1000032242 289
775 3300026121 Ga0207683_10000509 Ga0207683_1000050913 289
776 3300026121 Ga0207683_10003454 Ga0207683_100034546 289
777 3300026121 Ga0207683_10046212 Ga0207683_100462122 289
778 3300026121 Ga0207683_10173692 Ga0207683_101736922 289
779 3300026142 Ga0207698_10000642 Ga0207698_1000064217 289
780 3300026142 Ga0207698_10003296 Ga0207698_100032968 289
781 3300026142 Ga0207698_10010650 Ga0207698_100106505 289
782 3300026142 Ga0207698_10380427 Ga0207698_103804272 289
783 3300026142 Ga0207698_10384677 Ga0207698_103846772 289
784 3300028379 Ga0268266_10022455 Ga0268266_100224553 289
785 3300028379 Ga0268266_10134616 Ga0268266_101346162 289
786 3300028380 Ga0268265_10021151 Ga0268265_100211516 289
787 3300028381 Ga0268264_10008834 Ga0268264_100088342 289
788 3300028381 Ga0268264_10048059 Ga0268264_100480592 289
789 3300028381 Ga0268264_10230150 Ga0268264_102301502 289
790 3300031711 Ga0265314_10053352 Ga0265314_100533522 289
791 3300035086 Ga0373934_0010053 Ga0373934_0010053_666_1616 289
792 3300035088 Ga0373940_0011064 Ga0373940_0011064_625_1572 289
793 3300035111 Ga0373923_0020985 Ga0373923_0020985_761_1711 289
794 3300035117 Ga0373953_0004854 Ga0373953_0004854_3297_4247 289
795 3300035118 Ga0373954_0002489 Ga0373954_0002489_308_1258 289
796 3300035119 Ga0373956_0087017 Ga0373956_0087017_351_1301 289
797 3300035170 Ga0373943_0008311 Ga0373943_0008311_1530_2480 289
798 3300035171 Ga0373946_0046071 Ga0373946_0046071_339_1289 289
799 3300035242 Ga0373962_0031480 Ga0373962_0031480_27_974 289
800 3300035691 Ga0373931_0007359 Ga0373931_0007359_2950_3897 289
801 3300035691 Ga0373931_0142592 Ga0373931_0142592_363_1310 289
802 3300035695 Ga0373927_0015750 Ga0373927_0015750_3466_4416 289
803 3300035695 Ga0373927_0079068 Ga0373927_0079068_82_1032 289
804 3300035724 Ga0373933_0112349 Ga0373933_0112349_72_1022 289
805 3300035725 Ga0373947_0083805 Ga0373947_0083805_69_1019 289
806 3300036401 Ga0373937_0008460 Ga0373937_0008460_626_1576 289
807 3300036401 Ga0373937_0075441 Ga0373937_0075441_1161_2168 289
808 3300036401 Ga0373937_0227554 Ga0373937_0227554_225_1175 289
809 3300037068 Ga0373925_0132538 Ga0373925_0132538_904_1854 289
810 3300037418 Ga0395900_0016897 Ga0395900_0016897_6368_7318 289
811 3300037471 Ga0395905_0049773 Ga0395905_0049773_805_1755 289
812 3300037853 Ga0436364_1025804 Ga0436364_1025804_1580_2512 289
813 3300042438 Ga0439459_0001956 Ga0439459_0001956_1790_2737 289
814 3300042876 Ga0451577_0064526 Ga0451577_0064526_20_967 289
815 3300042876 Ga0451577_0150408 Ga0451577_0150408_232_1170 289
816 3300042876 Ga0451577_0220672 Ga0451577_0220672_483_1433 289
817 3300044694 Ga0466963_0228293 Ga0466963_0228293_25_972 289
818 3300044712 Ga0453684_0055553 Ga0453684_0055553_262_1209 289
819 3300046472 Ga0495580_0224142 Ga0495580_0224142_311_1261 289
820 3300046476 Ga0495662_0165348 Ga0495662_0165348_110_1060 289
821 3300046491 Ga0495584_0000168 Ga0495584_0000168_11089_12033 289
822 3300046516 Ga0495628_0230400 Ga0495628_0230400_103_1053 289
823 3300046525 Ga0495663_0022905 Ga0495663_0022905_619_1566 289
824 3300046536 Ga0495587_0064135 Ga0495587_0064135_1039_1989 289
825 3300046539 Ga0495621_0006382 Ga0495621_0006382_2332_3282 289
826 3300046559 Ga0495667_0137195 Ga0495667_0137195_405_1352 289
827 3300046663 Ga0495635_0266289 Ga0495635_0266289_122_1072 289
828 3300046679 Ga0495623_0115052 Ga0495623_0115052_617_1567 289
829 3300047444 Ga0495675_0214724 Ga0495675_0214724_118_1068 289
830 3300048903 Ga0496100_0410807 Ga0496100_0410807_20_970 289
831 3300048904 Ga0496101_0029580 Ga0496101_0029580_1164_2114 289
832 3300048907 Ga0496104_0020829 Ga0496104_0020829_3424_4371 289
833 3300048907 Ga0496104_0040428 Ga0496104_0040428_2170_3120 289
834 3300048908 Ga0496105_0006517 Ga0496105_0006517_7757_8707 289
835 3300048910 Ga0496107_0066533 Ga0496107_0066533_924_1874 289
836 3300048911 Ga0496108_0152100 Ga0496108_0152100_783_1733 289
837 3300048911 Ga0496108_0373306 Ga0496108_0373306_116_1066 289
838 3300048912 Ga0496109_0094111 Ga0496109_0094111_638_1588 289
839 3300048912 Ga0496109_0417777 Ga0496109_0417777_111_1058 289
840 3300048913 Ga0496110_0517000 Ga0496110_0517000_24_971 289
841 3300048915 Ga0496112_0006527 Ga0496112_0006527_5295_6245 289
842 3300048915 Ga0496112_0008103 Ga0496112_0008103_14_964 289
843 3300048915 Ga0496112_0032832 Ga0496112_0032832_2603_3550 289
844 3300048915 Ga0496112_0460646 Ga0496112_0460646_122_1072 289
845 3300048917 Ga0496114_0314532 Ga0496114_0314532_353_1303 289
846 3300049580 Ga0501046_0390742 Ga0501046_0390742_26_976 289
847 3300050512 nmdc:mga0n895_19318_c1 nmdc:mga0n895_19318_c1_1623_2570 289
848 3300050512 nmdc:mga0n895_394822_c1 nmdc:mga0n895_394822_c1_390_1337 289
849 3300050512 nmdc:mga0n895_6915_c1 nmdc:mga0n895_6915_c1_2406_3353 289
850 3300050513 nmdc:mga0rr50_18244_c1 nmdc:mga0rr50_18244_c1_1987_2934 289
851 3300050513 nmdc:mga0rr50_64843_c1 nmdc:mga0rr50_64843_c1_1325_2272 289
852 3300050514 nmdc:mga08x19_14568_c1 nmdc:mga08x19_14568_c1_284_1231 289
853 3300050515 nmdc:mga0a205_9042_c1 nmdc:mga0a205_9042_c1_5802_6749 289
854 3300054114 Ga0501084_0038988 Ga0501084_0038988_2234_3184 289
855 iso_pu_bacteria 2904483920 2904489910 292
856 iso_pu_bacteria 641736151 642425821 292
857 3300002067 JGI24735J21928_10014625 JGI24735J21928_100146252 296
858 3300003214 JGI25165J46597_1000824 JGI25165J46597_10008247 296
859 3300003322 rootL2_10348385 rootL2_103483852 296
860 3300003758 Ga0055532_1000297 Ga0055532_100029712 296
861 3300003758 Ga0055532_1000435 Ga0055532_10004354 296
862 3300003760 Ga0055527_1000236 Ga0055527_100023616 296
863 3300003761 Ga0055535_1000503 Ga0055535_100050316 296
864 3300003762 Ga0055542_1000521 Ga0055542_100052116 296
865 3300003763 Ga0055529_1000510 Ga0055529_100051016 296
866 3300009011 Ga0105251_10073050 Ga0105251_100730502 296
867 3300013105 Ga0157369_10060917 Ga0157369_100609172 296
868 3300025228 Ga0209672_100021 Ga0209672_10002115 296
869 3300025229 Ga0209147_100025 Ga0209147_10002515 296
870 3300025231 Ga0207427_101253 Ga0207427_1012537 296
871 3300025242 Ga0209258_100037 Ga0209258_10003715 296
872 3300025254 Ga0209148_1000049 Ga0209148_100004915 296
873 3300025261 Ga0209233_1000091 Ga0209233_100009115 296
874 3300025272 Ga0209455_1000041 Ga0209455_100004115 296
875 3300025904 Ga0207647_10001055 Ga0207647_1000105515 296
876 3300046690 Ga0495624_0010270 Ga0495624_0010270_5382_6329 296
877 3300047319 Ga0495674_0001621 Ga0495674_0001621_2939_3886 296
878 3300047321 Ga0495676_0105426 Ga0495676_0105426_53_1000 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

27

323

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dbl-assembly2.cif.gz_F crystal structure of e159q mutant of btucdf 0.5045 14 288
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.4637 10 282
4dbl-assembly2.cif.gz_F crystal structure of e159q mutant of btucdf 0.463 14 288
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.4608 14 288
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.4564 7 288
ID Description Score Start End Superfamily
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.777 8 283 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7591 8 283 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7193 8 285 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7077 8 285 1.10.3470.10
af_P37772_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6951 9 286 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A4P7CXW1-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9151 1 296 GO:0005886
GO:0006865
GO:0022857
AF-A0A4P7CXW1-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9121 1 296 GO:0005886
GO:0006865
GO:0022857
AF-A0A7V8JST9-F1-model_v4 High-affinity branched-chain amino acid transport system permease protein LivH 0.9054 1 213 GO:0005886
GO:0006865
GO:0022857
AF-A0A436D355-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9042 1 235 GO:0005886
GO:0006865
GO:0022857
AF-A0A3D1J3F0-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9023 1 220 GO:0005886
GO:0006865
GO:0022857

Feature Viewer

pLDDT pTM Quality
84.34 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map