F484430

General Info

Members Datasets Scaffolds Average Seq Length
878 352 848 432

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0000577|Ga0466957_0000577_10390_11703
Length 423
Sequence MFENLTDRLESAFKQIKGEGRITELNIAATVKDIRRALVDADVNYKIAKEFTDKVKDQALGHKVLNAVSPGQLMVKIVKDELAELMGGSESELNAKGSPAVILIAGLQGSGKTTFSAKLANFLKAKRLSPLLVAADIYRPAAIDQLKVLGEQIQVDVYSEPENKNAVEIASNAIKDARSKNKNVVIIDTAGRLAIDEAMMTEVANVKAAVNPQEILFVVDSMTGQDAVNTAKAFNDRLDFTGVVLTKLDGDTRGGAALSIKYTVQKPIKFVSSGEKLDTLDVFYPERMAQRILGMGDITTLVEKAQAQFDEEQARKLEKKIRKNQFNFEDFKQQLEQIKKMGNIKDLLGMIPGVGKAIKDIDISDDAFKGIEAMINSMTPLERTDPDVIDQRRKLRIAKGAGKDIGEVNAFLKQFDGRMGMKR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
5 2738541278 Niastella sp. CF465 Isolate Unclassified
6 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
7 2818991444 Filimonas endophytica 3197 Isolate Unclassified
8 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
9 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
10 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
11 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
12 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
13 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
14 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
15 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
16 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
17 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
18 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
19 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
20 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
21 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
22 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
23 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
24 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
25 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
26 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
27 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
28 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
29 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
30 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
31 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
32 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
33 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
34 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
35 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
36 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
37 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
38 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
39 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
40 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
41 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
42 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
43 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
44 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
45 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
46 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
47 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
48 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
49 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
50 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
51 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
52 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
53 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
54 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
55 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
56 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
57 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
58 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
59 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
60 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
61 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
62 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
63 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
64 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
65 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
66 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
67 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
68 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
69 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
70 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
71 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
72 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
73 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
74 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
75 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
76 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
77 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
78 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
79 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
80 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
81 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
82 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
83 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
84 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
85 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
86 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
87 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
88 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
89 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
90 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
104 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
105 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
106 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
107 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
108 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
112 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
113 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
114 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
115 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
116 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
122 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
124 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
125 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
133 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
136 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
142 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
143 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
144 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
147 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
148 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
149 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
150 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
151 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
152 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
153 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
155 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
156 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
158 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
160 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
162 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
164 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
218 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
219 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
220 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
221 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
222 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
223 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
224 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
225 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
226 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
227 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
228 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
229 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
230 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
231 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
232 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
233 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
236 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
237 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
238 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
247 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
248 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
249 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
250 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
251 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
252 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
253 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
254 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
255 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
256 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
257 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
258 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
259 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
260 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
261 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
262 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
263 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
264 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
265 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
266 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
267 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
268 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
269 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
270 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
271 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
272 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
273 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
274 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
275 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
276 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
279 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
280 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
281 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
282 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
283 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
284 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
285 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
286 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
287 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
288 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
289 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
290 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
291 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
292 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
293 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
294 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
295 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
296 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
299 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
300 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
301 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
302 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
303 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
304 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
305 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
316 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
317 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
318 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
319 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
320 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
321 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
324 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
325 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
326 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
329 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
333 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
334 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
335 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
336 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
337 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
338 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
339 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
340 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
341 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
342 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
343 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
344 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
345 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
346 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
347 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
348 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
349 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
350 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
351 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
352 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.58
Metatranscriptomes 0
Isolates 3.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.52
Nodule 0
Rhizoplane 0.34
Rhizosphere 85.65
Stem 0
Stem Tuber 0
Unclassified 6.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1663050 2162886007 Bacteria 482194
2 SwRhRL2b_contig_3910478 2162886007 Bacteria 17291
3 JGI24739J22299_10000776 3300001989 Bacteria 11640
4 JGI24737J22298_10000150 3300001990 Bacteria 21826
5 JGI24735J21928_10000024 3300002067 Bacteria 95227
6 JGI25162J39368_1001130 3300002737 Bacteria 16055
7 JGI25154J39366_1000021 3300002738 Bacteria 221559
8 JGI25164J39214_1001844 3300002772 Bacteria 4004
9 JGI25165J46597_1001512 3300003214 Bacteria 11767
10 JGI25153J46596_10003171 3300003215 Bacteria 9266
11 rootH1_10035980 3300003316 Bacteria 1495
12 rootH2_10002788 3300003320 Bacteria 40387
13 rootH2_10039222 3300003320 Bacteria 5002
14 rootL2_10053828 3300003322 Bacteria 4732
15 rootL2_10212212 3300003322 Bacteria 1691
16 rootH1_10007236 3300003323 Bacteria 15279
17 rootH1_10038130 3300003323 Bacteria 3880
18 JGI25160J50197_1014100 3300003354 Bacteria 2689
19 Ga0055535_1001800 3300003761 Bacteria 9378
20 Ga0055542_1005835 3300003762 Bacteria 2708
21 Ga0055526_1032839 3300003771 Bacteria 1455
22 Ga0055528_1004767 3300003790 Bacteria 6457
23 Ga0055530_10003144 3300003791 Bacteria 9736
24 Ga0055531_10000015 3300003794 Bacteria 182104
25 Ga0055531_10019966 3300003794 Bacteria 2677
26 Ga0065165_1000109 3300005262 Bacteria 137370
27 Ga0065165_1008080 3300005262 Bacteria 5020
28 Ga0065714_10003604 3300005288 Bacteria 18449
29 Ga0065714_10069509 3300005288 Bacteria 4197
30 Ga0065704_10000317 3300005289 Bacteria 33898
31 Ga0065704_10070140 3300005289 Bacteria 482257
32 Ga0065704_10074432 3300005289 Bacteria 6274
33 Ga0065704_10079977 3300005289 Bacteria 4012
34 Ga0065712_10000661 3300005290 Bacteria 11127
35 Ga0065712_10003409 3300005290 Bacteria 3754
36 Ga0065712_10017029 3300005290 Bacteria 3119
37 Ga0065707_10007629 3300005295 Bacteria 4435
38 Ga0065707_10142526 3300005295 Bacteria 1754
39 Ga0070658_10019663 3300005327 Bacteria 5407
40 Ga0070658_10084047 3300005327 Bacteria 2617
41 Ga0070658_10139003 3300005327 Bacteria 2028
42 Ga0070658_10170445 3300005327 Bacteria 1828
43 Ga0070676_10018602 3300005328 Bacteria 3852
44 Ga0070683_100000468 3300005329 Bacteria 28362
45 Ga0070683_100002836 3300005329 Bacteria 13876
46 Ga0070683_100007919 3300005329 Bacteria 9009
47 Ga0070683_100099234 3300005329 Bacteria 2741
48 Ga0070683_100119074 3300005329 Bacteria 2494
49 Ga0070670_100005343 3300005331 Bacteria 10833
50 Ga0070670_100019418 3300005331 Bacteria 5832
51 Ga0070670_100123883 3300005331 Bacteria 2230
52 Ga0070670_100138870 3300005331 Bacteria 2101
53 Ga0070670_100184203 3300005331 Bacteria 1813
54 Ga0070670_100185747 3300005331 Unclassified 1805
55 Ga0070677_10018936 3300005333 Unclassified 2487
56 Ga0068869_100003551 3300005334 Bacteria 9566
57 Ga0068869_100009768 3300005334 Bacteria 6232
58 Ga0068869_100017086 3300005334 Bacteria 4909
59 Ga0068869_100044144 3300005334 Bacteria 3205
60 Ga0070666_10000038 3300005335 Bacteria 115799
61 Ga0070666_10004991 3300005335 Bacteria 8117
62 Ga0070666_10017523 3300005335 Bacteria 4592
63 Ga0070680_100000107 3300005336 Bacteria 48364
64 Ga0070680_100004673 3300005336 Bacteria 10298
65 Ga0070680_100059656 3300005336 Bacteria 3122
66 Ga0070680_100062464 3300005336 Bacteria 3050
67 Ga0070680_100086978 3300005336 Bacteria 2584
68 Ga0070682_100000129 3300005337 Bacteria 64098
69 Ga0070682_100004790 3300005337 Bacteria 7518
70 Ga0070682_100079749 3300005337 Bacteria 2115
71 Ga0068868_100052245 3300005338 Bacteria 3218
72 Ga0068868_100077038 3300005338 Bacteria 2667
73 Ga0068868_100088249 3300005338 Bacteria 2496
74 Ga0070660_100017754 3300005339 Bacteria 5190
75 Ga0070660_100095883 3300005339 Bacteria 2345
76 Ga0070689_100067418 3300005340 Bacteria 2790
77 Ga0070689_100166102 3300005340 Bacteria 1786
78 Ga0070691_10001904 3300005341 Bacteria 9149
79 Ga0070687_100052398 3300005343 Bacteria 2118
80 Ga0070661_100000179 3300005344 Bacteria 52306
81 Ga0070661_100003133 3300005344 Bacteria 11376
82 Ga0070668_100113087 3300005347 Bacteria 2162
83 Ga0070669_100004014 3300005353 Bacteria 10642
84 Ga0070669_100052457 3300005353 Bacteria 2984
85 Ga0070675_100004112 3300005354 Bacteria 11049
86 Ga0070675_100020576 3300005354 Bacteria 5264
87 Ga0070675_100049081 3300005354 Bacteria 3463
88 Ga0070671_100114425 3300005355 Bacteria 2268
89 Ga0070673_100008952 3300005364 Bacteria 6693
90 Ga0070673_100223552 3300005364 Bacteria 1630
91 Ga0070688_100045498 3300005365 Bacteria 2712
92 Ga0070688_100052769 3300005365 Bacteria 2541
93 Ga0070659_100000644 3300005366 Bacteria 25506
94 Ga0070659_100031741 3300005366 Bacteria 4093
95 Ga0070659_100057148 3300005366 Bacteria 3076
96 Ga0070659_100129852 3300005366 Bacteria 2046
97 Ga0070667_100002640 3300005367 Bacteria 15524
98 Ga0070667_100017912 3300005367 Bacteria 5871
99 Ga0070667_100037416 3300005367 Bacteria 4068
100 Ga0070663_100076544 3300005455 Bacteria 2447
101 Ga0070678_100014866 3300005456 Bacteria 4927
102 Ga0070678_100099416 3300005456 Bacteria 2251
103 Ga0070662_100036667 3300005457 Bacteria 3471
104 Ga0070681_10008323 3300005458 Bacteria 10161
105 Ga0070681_10018750 3300005458 Bacteria 6925
106 Ga0070681_10079621 3300005458 Bacteria 3233
107 Ga0068867_100011635 3300005459 Bacteria 6212
108 Ga0068867_100022600 3300005459 Bacteria 4496
109 Ga0068867_100026385 3300005459 Bacteria 4171
110 Ga0068867_100033978 3300005459 Bacteria 3696
111 Ga0068867_100049645 3300005459 Bacteria 3090
112 Ga0068867_100146902 3300005459 Bacteria 1849
113 Ga0068867_100175174 3300005459 Bacteria 1702
114 Ga0070685_10014741 3300005466 Bacteria 4145
115 Ga0070698_100000267 3300005471 Bacteria 52849
116 Ga0070698_100056165 3300005471 Bacteria 3990
117 Ga0070679_100000158 3300005530 Bacteria 54895
118 Ga0070679_100004315 3300005530 Bacteria 13126
119 Ga0070679_100004867 3300005530 Bacteria 12395
120 Ga0070679_100027513 3300005530 Bacteria 5597
121 Ga0070679_100056287 3300005530 Bacteria 3918
122 Ga0070679_100056404 3300005530 Bacteria 3914
123 Ga0070679_100107718 3300005530 Bacteria 2772
124 Ga0070679_100270164 3300005530 Bacteria 1654
125 Ga0070684_100002591 3300005535 Bacteria 13355
126 Ga0070684_100015367 3300005535 Bacteria 6233
127 Ga0070684_100054702 3300005535 Bacteria 3477
128 Ga0068853_100005569 3300005539 Bacteria 9886
129 Ga0068853_100006052 3300005539 Bacteria 9572
130 Ga0068853_100006293 3300005539 Bacteria 9416
131 Ga0068853_100012384 3300005539 Bacteria 6939
132 Ga0068853_100031729 3300005539 Bacteria 4469
133 Ga0068853_100042310 3300005539 Bacteria 3895
134 Ga0068853_100177983 3300005539 Bacteria 1928
135 Ga0068853_100188671 3300005539 Bacteria 1872
136 Ga0068853_100205012 3300005539 Bacteria 1796
137 Ga0070672_100035517 3300005543 Bacteria 3789
138 Ga0070672_100066688 3300005543 Bacteria 2850
139 Ga0070686_100032749 3300005544 Bacteria 3189
140 Ga0070686_100045558 3300005544 Bacteria 2763
141 Ga0070693_100001913 3300005547 Bacteria 9522
142 Ga0070665_100000094 3300005548 Bacteria 171072
143 Ga0070665_100061303 3300005548 Bacteria 3770
144 Ga0070665_100307857 3300005548 Bacteria 1588
145 Ga0068855_100000145 3300005563 Bacteria 91452
146 Ga0068855_100000489 3300005563 Bacteria 48884
147 Ga0068855_100001620 3300005563 Bacteria 28236
148 Ga0068855_100017041 3300005563 Bacteria 8739
149 Ga0068855_100100872 3300005563 Bacteria 3323
150 Ga0068855_100106589 3300005563 Bacteria 3221
151 Ga0068855_100107195 3300005563 Bacteria 3210
152 Ga0068855_100152798 3300005563 Bacteria 2624
153 Ga0068855_100155294 3300005563 Bacteria 2600
154 Ga0068855_100255295 3300005563 Bacteria 1954
155 Ga0070664_100000140 3300005564 Bacteria 49126
156 Ga0070664_100020306 3300005564 Bacteria 5469
157 Ga0070664_100025386 3300005564 Bacteria 4911
158 Ga0070664_100076654 3300005564 Bacteria 2873
159 Ga0070664_100167278 3300005564 Bacteria 1949
160 Ga0068857_100005598 3300005577 Bacteria 10734
161 Ga0068857_100014523 3300005577 Bacteria 6869
162 Ga0068857_100023904 3300005577 Bacteria 5379
163 Ga0068857_100317976 3300005577 Bacteria 1437
164 Ga0068854_100007508 3300005578 Bacteria 6967
165 Ga0068854_100013446 3300005578 Bacteria 5374
166 Ga0068854_100051058 3300005578 Bacteria 2962
167 Ga0068854_100072252 3300005578 Bacteria 2526
168 Ga0068856_100036347 3300005614 Bacteria 4830
169 Ga0068856_100045155 3300005614 Bacteria 4337
170 Ga0068856_100046347 3300005614 Bacteria 4282
171 Ga0068856_100151090 3300005614 Bacteria 2331
172 Ga0070702_100007104 3300005615 Bacteria 5345
173 Ga0068852_100001659 3300005616 Bacteria 15178
174 Ga0068852_100013323 3300005616 Bacteria 6291
175 Ga0068852_100049177 3300005616 Bacteria 3606
176 Ga0068852_100071704 3300005616 Bacteria 3043
177 Ga0068859_100000007 3300005617 Bacteria 390070
178 Ga0068859_100005587 3300005617 Bacteria 12808
179 Ga0068859_100005939 3300005617 Bacteria 12395
180 Ga0068859_100006487 3300005617 Bacteria 11875
181 Ga0068859_100007298 3300005617 Bacteria 11213
182 Ga0068859_100031009 3300005617 Bacteria 5366
183 Ga0068859_100074642 3300005617 Bacteria 3430
184 Ga0068859_100076094 3300005617 Bacteria 3397
185 Ga0068859_100165504 3300005617 Bacteria 2291
186 Ga0068859_100339039 3300005617 Bacteria 1597
187 Ga0068864_100000685 3300005618 Bacteria 28427
188 Ga0068864_100019755 3300005618 Bacteria 5634
189 Ga0068864_100061903 3300005618 Bacteria 3242
190 Ga0068866_10037107 3300005718 Bacteria 2392
191 Ga0068861_100019358 3300005719 Bacteria 4862
192 Ga0068861_100061537 3300005719 Bacteria 2881
193 Ga0068861_100065954 3300005719 Bacteria 2790
194 Ga0068861_100179625 3300005719 Bacteria 1760
195 Ga0068851_10011250 3300005834 Bacteria 4194
196 Ga0068851_10014891 3300005834 Bacteria 3699
197 Ga0068863_100018440 3300005841 Bacteria 6679
198 Ga0068863_100029101 3300005841 Bacteria 5274
199 Ga0068863_100073091 3300005841 Bacteria 3244
200 Ga0068858_100003163 3300005842 Bacteria 16480
201 Ga0068858_100041888 3300005842 Bacteria 4245
202 Ga0068858_100082551 3300005842 Bacteria 2988
203 Ga0068860_100001511 3300005843 Bacteria 25059
204 Ga0068860_100003681 3300005843 Bacteria 15776
205 Ga0068860_100007061 3300005843 Bacteria 11243
206 Ga0068860_100012160 3300005843 Bacteria 8479
207 Ga0068860_100014136 3300005843 Bacteria 7829
208 Ga0068860_100015699 3300005843 Bacteria 7395
209 Ga0068860_100065329 3300005843 Bacteria 3455
210 Ga0068860_100094546 3300005843 Bacteria 2849
211 Ga0068860_100248020 3300005843 Unclassified 1733
212 Ga0068862_100085605 3300005844 Bacteria 2739
213 Ga0068862_100096577 3300005844 Unclassified 2579
214 Ga0068862_100126300 3300005844 Bacteria 2258
215 Ga0081539_10076014 3300005985 Bacteria 1781
216 Ga0075366_10004374 3300006195 Bacteria 7580
217 Ga0075366_10009009 3300006195 Bacteria 5566
218 Ga0097621_100003509 3300006237 Bacteria 10830
219 Ga0097621_100053413 3300006237 Bacteria 3294
220 Ga0097621_100054450 3300006237 Bacteria 3263
221 Ga0097621_100060893 3300006237 Bacteria 3095
222 Ga0097621_100077188 3300006237 Bacteria 2765
223 Ga0097621_100084224 3300006237 Bacteria 2650
224 Ga0075370_10064390 3300006353 Bacteria 2091
225 Ga0068871_100003013 3300006358 Bacteria 11561
226 Ga0068871_100005842 3300006358 Bacteria 8651
227 Ga0068871_100113868 3300006358 Bacteria 2278
228 Ga0068871_100174091 3300006358 Bacteria 1846
229 Ga0075428_100003257 3300006844 Bacteria 17776
230 Ga0075428_100019714 3300006844 Bacteria 7463
231 Ga0075428_100216185 3300006844 Bacteria 2071
232 Ga0075434_100052957 3300006871 Bacteria 4033
233 Ga0075429_100015711 3300006880 Bacteria 6559
234 Ga0068865_100002580 3300006881 Bacteria 10756
235 Ga0068865_100059325 3300006881 Bacteria 2675
236 Ga0068865_100088202 3300006881 Bacteria 2244
237 Ga0068865_100108219 3300006881 Unclassified 2046
238 Ga0097620_100000007 3300006931 Bacteria 390070
239 Ga0097620_100005586 3300006931 Bacteria 12808
240 Ga0097620_100005939 3300006931 Bacteria 12395
241 Ga0097620_100006487 3300006931 Bacteria 11875
242 Ga0097620_100007298 3300006931 Bacteria 11213
243 Ga0097620_100031009 3300006931 Bacteria 5366
244 Ga0097620_100074639 3300006931 Bacteria 3430
245 Ga0097620_100076089 3300006931 Bacteria 3397
246 Ga0097620_100165510 3300006931 Bacteria 2291
247 Ga0097620_100339031 3300006931 Bacteria 1597
248 Ga0105250_10022248 3300009092 Bacteria 2557
249 Ga0105240_10000073 3300009093 Bacteria 201032
250 Ga0105240_10000083 3300009093 Bacteria 192934
251 Ga0105240_10000414 3300009093 Bacteria 79229
252 Ga0105240_10002372 3300009093 Bacteria 30357
253 Ga0105240_10022086 3300009093 Bacteria 8445
254 Ga0105240_10036535 3300009093 Bacteria 6316
255 Ga0105240_10038947 3300009093 Bacteria 6093
256 Ga0105240_10042144 3300009093 Bacteria 5819
257 Ga0105240_10116448 3300009093 Bacteria 3224
258 Ga0105240_10140154 3300009093 Bacteria 2892
259 Ga0105240_10159315 3300009093 Bacteria 2683
260 Ga0105240_10159676 3300009093 Bacteria 2679
261 Ga0105240_10321503 3300009093 Bacteria 1764
262 Ga0105240_10373403 3300009093 Bacteria 1612
263 Ga0111539_10004306 3300009094 Bacteria 18619
264 Ga0111539_10167665 3300009094 Bacteria 2566
265 Ga0111539_10178682 3300009094 Bacteria 2479
266 Ga0105247_10070602 3300009101 Bacteria 2182
267 Ga0105247_10087330 3300009101 Bacteria 1975
268 Ga0114129_10000608 3300009147 Bacteria 44314
269 Ga0114129_10352293 3300009147 Bacteria 1950
270 Ga0114129_10583300 3300009147 Bacteria 1450
271 Ga0105243_10000018 3300009148 Bacteria 227618
272 Ga0105241_10000104 3300009174 Bacteria 60482
273 Ga0105241_10002801 3300009174 Bacteria 13049
274 Ga0105241_10018266 3300009174 Bacteria 5157
275 Ga0105241_10024092 3300009174 Bacteria 4520
276 Ga0105241_10070958 3300009174 Bacteria 2704
277 Ga0105242_10008462 3300009176 Bacteria 7906
278 Ga0105242_10037587 3300009176 Bacteria 3889
279 Ga0105242_10066895 3300009176 Unclassified 2969
280 Ga0105242_10142795 3300009176 Bacteria 2079
281 Ga0105248_10112229 3300009177 Bacteria 3075
282 Ga0105237_10000138 3300009545 Bacteria 102411
283 Ga0105237_10002964 3300009545 Bacteria 20540
284 Ga0105237_10004350 3300009545 Bacteria 16414
285 Ga0105237_10006992 3300009545 Bacteria 12432
286 Ga0105237_10007274 3300009545 Bacteria 12146
287 Ga0105237_10009111 3300009545 Bacteria 10667
288 Ga0105237_10015845 3300009545 Bacteria 7840
289 Ga0105237_10040911 3300009545 Bacteria 4675
290 Ga0105237_10060302 3300009545 Bacteria 3796
291 Ga0105237_10076443 3300009545 Bacteria 3339
292 Ga0105237_10089416 3300009545 Bacteria 3069
293 Ga0105237_10140065 3300009545 Bacteria 2413
294 Ga0105237_10211739 3300009545 Bacteria 1938
295 Ga0105238_10019521 3300009551 Bacteria 6903
296 Ga0105238_10077512 3300009551 Bacteria 3315
297 Ga0105238_10121922 3300009551 Bacteria 2586
298 Ga0105249_10000177 3300009553 Bacteria 74897
299 Ga0105249_10009062 3300009553 Bacteria 8700
300 Ga0105249_10009352 3300009553 Bacteria 8574
301 Ga0105249_10013585 3300009553 Bacteria 7194
302 Ga0105249_10030029 3300009553 Bacteria 4910
303 Ga0105239_10000014 3300010375 Bacteria 325391
304 Ga0105239_10000130 3300010375 Bacteria 105894
305 Ga0105239_10000558 3300010375 Bacteria 53441
306 Ga0105239_10000708 3300010375 Bacteria 47248
307 Ga0105239_10000755 3300010375 Bacteria 45854
308 Ga0105239_10000936 3300010375 Bacteria 41213
309 Ga0105239_10003284 3300010375 Bacteria 19951
310 Ga0105239_10019537 3300010375 Bacteria 7478
311 Ga0105239_10030519 3300010375 Bacteria 5925
312 Ga0105239_10127795 3300010375 Bacteria 2826
313 Ga0105239_10159568 3300010375 Bacteria 2519
314 Ga0105239_10350555 3300010375 Bacteria 1667
315 Ga0105246_10019297 3300011119 Bacteria 4355
316 Ga0105246_10051012 3300011119 Bacteria 2839
317 Ga0157373_10000107 3300013100 Bacteria 65161
318 Ga0157373_10000150 3300013100 Bacteria 56030
319 Ga0157373_10003707 3300013100 Bacteria 11562
320 Ga0157373_10014856 3300013100 Bacteria 5702
321 Ga0157373_10109747 3300013100 Bacteria 1939
322 Ga0157371_10000012 3300013102 Bacteria 355318
323 Ga0157371_10000297 3300013102 Bacteria 65919
324 Ga0157371_10000629 3300013102 Bacteria 41913
325 Ga0157371_10000884 3300013102 Bacteria 33771
326 Ga0157371_10001188 3300013102 Bacteria 27890
327 Ga0157371_10003212 3300013102 Bacteria 15006
328 Ga0157371_10003438 3300013102 Bacteria 14365
329 Ga0157371_10042739 3300013102 Bacteria 3230
330 Ga0157371_10043804 3300013102 Bacteria 3187
331 Ga0157371_10148825 3300013102 Bacteria 1669
332 Ga0157370_10001924 3300013104 Bacteria 25541
333 Ga0157370_10003146 3300013104 Bacteria 19553
334 Ga0157370_10008544 3300013104 Bacteria 11037
335 Ga0157370_10020992 3300013104 Bacteria 6512
336 Ga0157370_10026562 3300013104 Bacteria 5715
337 Ga0157370_10032897 3300013104 Bacteria 5060
338 Ga0157370_10052862 3300013104 Bacteria 3876
339 Ga0157370_10063980 3300013104 Bacteria 3483
340 Ga0157370_10087796 3300013104 Bacteria 2921
341 Ga0157369_10000224 3300013105 Bacteria 78178
342 Ga0157369_10022459 3300013105 Bacteria 7039
343 Ga0157369_10036588 3300013105 Bacteria 5377
344 Ga0157369_10042378 3300013105 Bacteria 4965
345 Ga0157369_10088874 3300013105 Bacteria 3298
346 Ga0157369_10177434 3300013105 Bacteria 2242
347 Ga0157369_10196184 3300013105 Bacteria 2120
348 Ga0157374_10000237 3300013296 Bacteria 51331
349 Ga0157374_10005388 3300013296 Bacteria 10749
350 Ga0157378_10004574 3300013297 Bacteria 12133
351 Ga0157378_10020420 3300013297 Bacteria 5826
352 Ga0157378_10111792 3300013297 Bacteria 2505
353 Ga0157378_10225237 3300013297 Bacteria 1784
354 Ga0157378_10243367 3300013297 Bacteria 1719
355 Ga0163162_10000226 3300013306 Bacteria 51615
356 Ga0163162_10001312 3300013306 Bacteria 23236
357 Ga0163162_10001569 3300013306 Bacteria 21347
358 Ga0163162_10006217 3300013306 Bacteria 11572
359 Ga0163162_10011350 3300013306 Bacteria 8686
360 Ga0163162_10084395 3300013306 Bacteria 3252
361 Ga0163162_10096301 3300013306 Bacteria 3047
362 Ga0163162_10234127 3300013306 Bacteria 1967
363 Ga0163162_10290308 3300013306 Bacteria 1767
364 Ga0157372_10000285 3300013307 Bacteria 56173
365 Ga0157372_10002016 3300013307 Bacteria 22086
366 Ga0157372_10002389 3300013307 Bacteria 20320
367 Ga0157372_10005622 3300013307 Bacteria 13328
368 Ga0157372_10006556 3300013307 Bacteria 12386
369 Ga0157372_10033647 3300013307 Bacteria 5632
370 Ga0157372_10035046 3300013307 Bacteria 5522
371 Ga0157372_10038641 3300013307 Bacteria 5266
372 Ga0157372_10043900 3300013307 Bacteria 4952
373 Ga0157372_10045710 3300013307 Bacteria 4858
374 Ga0157372_10047960 3300013307 Bacteria 4747
375 Ga0157372_10048401 3300013307 Bacteria 4726
376 Ga0157372_10084878 3300013307 Bacteria 3591
377 Ga0157372_10132140 3300013307 Bacteria 2873
378 Ga0157372_10160487 3300013307 Unclassified 2598
379 Ga0157372_10250220 3300013307 Bacteria 2057
380 Ga0157372_10339492 3300013307 Bacteria 1750
381 Ga0157375_10059901 3300013308 Bacteria 3773
382 Ga0157375_10096069 3300013308 Bacteria 3035
383 Ga0157375_10104889 3300013308 Bacteria 2916
384 Ga0157375_10117991 3300013308 Bacteria 2760
385 Ga0157375_10158391 3300013308 Bacteria 2405
386 Ga0157375_10158696 3300013308 Bacteria 2403
387 Ga0157375_10450244 3300013308 Bacteria 1453
388 Ga0163163_10000088 3300014325 Bacteria 101126
389 Ga0163163_10000244 3300014325 Bacteria 55634
390 Ga0163163_10012983 3300014325 Bacteria 7608
391 Ga0157380_10063533 3300014326 Bacteria 2960
392 Ga0157380_10134906 3300014326 Bacteria 2111
393 Ga0157380_10143391 3300014326 Bacteria 2055
394 Ga0182008_10000011 3300014497 Bacteria 297770
395 Ga0182008_10000047 3300014497 Bacteria 108181
396 Ga0157377_10000568 3300014745 Bacteria 15510
397 Ga0157377_10001221 3300014745 Bacteria 10960
398 Ga0157377_10003043 3300014745 Bacteria 7515
399 Ga0157377_10018151 3300014745 Bacteria 3653
400 Ga0157377_10126439 3300014745 Bacteria 1556
401 Ga0157379_10031404 3300014968 Bacteria 4731
402 Ga0157379_10051589 3300014968 Bacteria 3674
403 Ga0157376_10006924 3300014969 Bacteria 8035
404 Ga0157376_10031273 3300014969 Bacteria 4259
405 Ga0157376_10031781 3300014969 Bacteria 4232
406 Ga0157376_10151224 3300014969 Bacteria 2093
407 Ga0157376_10168324 3300014969 Bacteria 1993
408 Ga0157376_10192096 3300014969 Bacteria 1873
409 Ga0157376_10212906 3300014969 Bacteria 1785
410 Ga0182006_1009584 3300015261 Bacteria 4334
411 Ga0163161_10020287 3300017792 Bacteria 4663
412 Ga0163161_10027138 3300017792 Bacteria 4061
413 Ga0163161_10044468 3300017792 Bacteria 3198
414 Ga0163161_10106959 3300017792 Bacteria 2088
415 Ga0163161_10220287 3300017792 Bacteria 1469
416 Ga0213876_10001070 3300021384 Bacteria 17605
417 Ga0213876_10002683 3300021384 Bacteria 10387
418 Ga0209436_101750 3300025208 Bacteria 7134
419 Ga0207427_100071 3300025231 Bacteria 159974
420 Ga0209437_100021 3300025233 Bacteria 646400
421 Ga0209437_100124 3300025233 Bacteria 199789
422 Ga0209258_100193 3300025242 Bacteria 124682
423 Ga0209646_1000050 3300025246 Bacteria 296599
424 Ga0209026_1000282 3300025250 Bacteria 58460
425 Ga0209026_1000826 3300025250 Bacteria 16529
426 Ga0209026_1001733 3300025250 Bacteria 9087
427 Ga0209026_1004176 3300025250 Bacteria 4415
428 Ga0209148_1000167 3300025254 Bacteria 135407
429 Ga0209233_1000035 3300025261 Bacteria 568478
430 Ga0209233_1006884 3300025261 Bacteria 3638
431 Ga0209673_1000339 3300025273 Bacteria 85906
432 Ga0209130_1006364 3300025284 Bacteria 3851
433 Ga0209564_1023743 3300025295 Bacteria 2118
434 Ga0209758_1010862 3300025297 Bacteria 5371
435 Ga0209758_1022385 3300025297 Bacteria 2901
436 Ga0209050_1000440 3300025298 Bacteria 75475
437 Ga0207426_1000525 3300025302 Bacteria 55617
438 Ga0207426_1000815 3300025302 Bacteria 33471
439 Ga0207426_1000933 3300025302 Bacteria 29162
440 Ga0207426_1002563 3300025302 Bacteria 11365
441 Ga0209257_1000005 3300025304 Bacteria 1592528
442 Ga0209257_1003230 3300025304 Bacteria 14357
443 Ga0207642_10025689 3300025899 Bacteria 2387
444 Ga0207710_10029491 3300025900 Bacteria 2388
445 Ga0207688_10129056 3300025901 Unclassified 1481
446 Ga0207680_10000015 3300025903 Bacteria 138253
447 Ga0207680_10009136 3300025903 Bacteria 4902
448 Ga0207680_10044173 3300025903 Bacteria 2619
449 Ga0207647_10001267 3300025904 Bacteria 19442
450 Ga0207647_10005091 3300025904 Bacteria 9689
451 Ga0207647_10014937 3300025904 Bacteria 5336
452 Ga0207647_10146451 3300025904 Bacteria 1382
453 Ga0207645_10000136 3300025907 Bacteria 56153
454 Ga0207645_10018765 3300025907 Bacteria 4543
455 Ga0207645_10025617 3300025907 Bacteria 3815
456 Ga0207645_10036710 3300025907 Unclassified 3147
457 Ga0207643_10064435 3300025908 Unclassified 2097
458 Ga0207705_10001443 3300025909 Bacteria 18970
459 Ga0207705_10006828 3300025909 Bacteria 8433
460 Ga0207705_10010408 3300025909 Bacteria 6763
461 Ga0207705_10072902 3300025909 Bacteria 2491
462 Ga0207705_10077395 3300025909 Bacteria 2420
463 Ga0207705_10080556 3300025909 Bacteria 2373
464 Ga0207654_10002468 3300025911 Bacteria 9402
465 Ga0207707_10003458 3300025912 Bacteria 13997
466 Ga0207707_10056886 3300025912 Bacteria 3404
467 Ga0207707_10104171 3300025912 Bacteria 2479
468 Ga0207695_10000127 3300025913 Bacteria 227338
469 Ga0207695_10000151 3300025913 Bacteria 206493
470 Ga0207695_10000169 3300025913 Bacteria 192566
471 Ga0207695_10000238 3300025913 Bacteria 144406
472 Ga0207695_10000894 3300025913 Bacteria 54057
473 Ga0207695_10001190 3300025913 Bacteria 44747
474 Ga0207695_10015794 3300025913 Bacteria 8869
475 Ga0207695_10048262 3300025913 Bacteria 4498
476 Ga0207695_10060277 3300025913 Bacteria 3929
477 Ga0207695_10108636 3300025913 Bacteria 2758
478 Ga0207695_10185750 3300025913 Bacteria 1998
479 Ga0207695_10276543 3300025913 Bacteria 1573
480 Ga0207671_10000103 3300025914 Bacteria 129408
481 Ga0207671_10001528 3300025914 Bacteria 26548
482 Ga0207671_10002935 3300025914 Bacteria 17576
483 Ga0207671_10005708 3300025914 Bacteria 11360
484 Ga0207671_10008095 3300025914 Bacteria 8975
485 Ga0207671_10010123 3300025914 Bacteria 7814
486 Ga0207671_10026985 3300025914 Bacteria 4297
487 Ga0207671_10031834 3300025914 Bacteria 3928
488 Ga0207660_10042709 3300025917 Bacteria 3183
489 Ga0207660_10112778 3300025917 Bacteria 2048
490 Ga0207657_10042288 3300025919 Bacteria 4022
491 Ga0207657_10137348 3300025919 Bacteria 1999
492 Ga0207657_10181814 3300025919 Bacteria 1699
493 Ga0207649_10000419 3300025920 Bacteria 31284
494 Ga0207652_10000013 3300025921 Bacteria 222247
495 Ga0207652_10000187 3300025921 Bacteria 65282
496 Ga0207652_10002930 3300025921 Bacteria 14278
497 Ga0207652_10006696 3300025921 Bacteria 9283
498 Ga0207652_10061169 3300025921 Bacteria 3251
499 Ga0207652_10071222 3300025921 Bacteria 3020
500 Ga0207681_10047997 3300025923 Bacteria 2880
501 Ga0207681_10051655 3300025923 Bacteria 2786
502 Ga0207681_10077272 3300025923 Unclassified 2340
503 Ga0207650_10112802 3300025925 Bacteria 2107
504 Ga0207644_10079226 3300025931 Bacteria 2423
505 Ga0207690_10000049 3300025932 Bacteria 113589
506 Ga0207690_10008098 3300025932 Bacteria 6237
507 Ga0207690_10021979 3300025932 Bacteria 3963
508 Ga0207690_10043848 3300025932 Bacteria 2946
509 Ga0207706_10002103 3300025933 Bacteria 19496
510 Ga0207706_10024569 3300025933 Bacteria 5402
511 Ga0207706_10059286 3300025933 Bacteria 3371
512 Ga0207706_10110761 3300025933 Bacteria 2415
513 Ga0207686_10000429 3300025934 Bacteria 28636
514 Ga0207686_10089861 3300025934 Unclassified 2025
515 Ga0207709_10000021 3300025935 Bacteria 386722
516 Ga0207670_10007267 3300025936 Bacteria 6172
517 Ga0207670_10015622 3300025936 Bacteria 4541
518 Ga0207670_10059061 3300025936 Bacteria 2608
519 Ga0207670_10146400 3300025936 Bacteria 1747
520 Ga0207704_10036806 3300025938 Bacteria 2819
521 Ga0207704_10070796 3300025938 Bacteria 2210
522 Ga0207704_10087515 3300025938 Bacteria 2035
523 Ga0207691_10040276 3300025940 Bacteria 4317
524 Ga0207691_10042147 3300025940 Bacteria 4208
525 Ga0207689_10001007 3300025942 Bacteria 27057
526 Ga0207689_10004656 3300025942 Bacteria 12404
527 Ga0207689_10014075 3300025942 Bacteria 6809
528 Ga0207689_10019898 3300025942 Bacteria 5653
529 Ga0207689_10026965 3300025942 Bacteria 4810
530 Ga0207689_10047573 3300025942 Bacteria 3540
531 Ga0207689_10063150 3300025942 Bacteria 3046
532 Ga0207661_10000370 3300025944 Bacteria 28914
533 Ga0207661_10030067 3300025944 Bacteria 4179
534 Ga0207661_10120368 3300025944 Bacteria 2234
535 Ga0207661_10245042 3300025944 Bacteria 1591
536 Ga0207679_10000266 3300025945 Bacteria 39927
537 Ga0207679_10001572 3300025945 Bacteria 14273
538 Ga0207679_10021342 3300025945 Bacteria 4390
539 Ga0207667_10000365 3300025949 Bacteria 61074
540 Ga0207667_10000408 3300025949 Bacteria 58389
541 Ga0207667_10000508 3300025949 Bacteria 51422
542 Ga0207667_10001711 3300025949 Bacteria 27600
543 Ga0207667_10035585 3300025949 Bacteria 5341
544 Ga0207667_10048686 3300025949 Bacteria 4480
545 Ga0207667_10106243 3300025949 Bacteria 2896
546 Ga0207667_10120942 3300025949 Bacteria 2698
547 Ga0207667_10134709 3300025949 Bacteria 2544
548 Ga0207667_10146963 3300025949 Bacteria 2426
549 Ga0207667_10188276 3300025949 Bacteria 2118
550 Ga0207667_10291853 3300025949 Bacteria 1666
551 Ga0207651_10069866 3300025960 Bacteria 2482
552 Ga0207651_10108640 3300025960 Bacteria 2077
553 Ga0207651_10116429 3300025960 Bacteria 2017
554 Ga0207712_10002766 3300025961 Bacteria 11216
555 Ga0207712_10011848 3300025961 Bacteria 5559
556 Ga0207712_10022755 3300025961 Bacteria 4131
557 Ga0207712_10062576 3300025961 Bacteria 2646
558 Ga0207712_10130103 3300025961 Bacteria 1917
559 Ga0207668_10058996 3300025972 Bacteria 2686
560 Ga0207640_10058226 3300025981 Bacteria 2545
561 Ga0207640_10076026 3300025981 Bacteria 2278
562 Ga0207658_10021523 3300025986 Bacteria 4479
563 Ga0207658_10034253 3300025986 Bacteria 3628
564 Ga0207658_10208212 3300025986 Bacteria 1637
565 Ga0207677_10017048 3300026023 Bacteria 4319
566 Ga0207677_10028677 3300026023 Bacteria 3525
567 Ga0207677_10130678 3300026023 Bacteria 1906
568 Ga0207677_10139086 3300026023 Bacteria 1856
569 Ga0207703_10007227 3300026035 Bacteria 8831
570 Ga0207703_10050224 3300026035 Bacteria 3375
571 Ga0207703_10061525 3300026035 Bacteria 3073
572 Ga0207639_10019147 3300026041 Bacteria 4877
573 Ga0207639_10044622 3300026041 Bacteria 3334
574 Ga0207639_10094893 3300026041 Bacteria 2396
575 Ga0207639_10109853 3300026041 Bacteria 2245
576 Ga0207678_10023821 3300026067 Bacteria 5353
577 Ga0207678_10098208 3300026067 Bacteria 2502
578 Ga0207708_10143607 3300026075 Bacteria 1874
579 Ga0207702_10032751 3300026078 Bacteria 4337
580 Ga0207702_10054227 3300026078 Bacteria 3396
581 Ga0207702_10082649 3300026078 Bacteria 2793
582 Ga0207702_10206103 3300026078 Bacteria 1825
583 Ga0207641_10000056 3300026088 Bacteria 170719
584 Ga0207641_10007370 3300026088 Bacteria 9156
585 Ga0207641_10037835 3300026088 Bacteria 4032
586 Ga0207648_10000568 3300026089 Bacteria 41399
587 Ga0207648_10004655 3300026089 Bacteria 14042
588 Ga0207648_10019544 3300026089 Bacteria 6114
589 Ga0207648_10029445 3300026089 Bacteria 4869
590 Ga0207648_10066942 3300026089 Bacteria 3132
591 Ga0207648_10256663 3300026089 Bacteria 1559
592 Ga0207676_10011089 3300026095 Bacteria 6433
593 Ga0207676_10024265 3300026095 Bacteria 4485
594 Ga0207676_10076898 3300026095 Bacteria 2698
595 Ga0207676_10215770 3300026095 Bacteria 1705
596 Ga0207676_10282305 3300026095 Bacteria 1508
597 Ga0207674_10010073 3300026116 Bacteria 10748
598 Ga0207674_10016248 3300026116 Bacteria 8152
599 Ga0207674_10084397 3300026116 Bacteria 3174
600 Ga0207674_10125881 3300026116 Bacteria 2528
601 Ga0207674_10210909 3300026116 Bacteria 1891
602 Ga0207674_10272125 3300026116 Bacteria 1641
603 Ga0207675_100003813 3300026118 Bacteria 14671
604 Ga0207675_100007383 3300026118 Bacteria 10388
605 Ga0207675_100021679 3300026118 Bacteria 5980
606 Ga0207675_100048377 3300026118 Bacteria 3969
607 Ga0207675_100053087 3300026118 Bacteria 3782
608 Ga0207683_10002007 3300026121 Bacteria 18003
609 Ga0207683_10007862 3300026121 Bacteria 9124
610 Ga0207698_10003137 3300026142 Bacteria 9906
611 Ga0207698_10042824 3300026142 Bacteria 3387
612 Ga0207698_10112943 3300026142 Bacteria 2281
613 Ga0207428_10096411 3300027907 Bacteria 2290
614 Ga0268266_10000071 3300028379 Bacteria 232887
615 Ga0268266_10004286 3300028379 Bacteria 13730
616 Ga0268265_10091723 3300028380 Bacteria 2430
617 Ga0268264_10000143 3300028381 Bacteria 170031
618 Ga0268264_10001196 3300028381 Bacteria 25064
619 Ga0268264_10001996 3300028381 Bacteria 18331
620 Ga0268264_10006748 3300028381 Bacteria 9645
621 Ga0268264_10026440 3300028381 Bacteria 4743
622 Ga0268264_10049632 3300028381 Bacteria 3492
623 Ga0268264_10063639 3300028381 Bacteria 3102
624 Ga0307517_10012359 3300028786 Bacteria 11728
625 Ga0307515_10000001 3300028794 Bacteria 4259510
626 Ga0307515_10000078 3300028794 Bacteria 227988
627 Ga0307515_10000224 3300028794 Bacteria 140276
628 Ga0307515_10001268 3300028794 Bacteria 57400
629 Ga0265338_10003003 3300028800 Bacteria 24413
630 Ga0265338_10016709 3300028800 Bacteria 7953
631 Ga0307511_10002930 3300030521 Bacteria 17674
632 Ga0316176_1079087 3300030732 Bacteria 6116
633 Ga0316183_1153674 3300030742 Bacteria 79729
634 Ga0316181_1153314 3300030744 Bacteria 3683
635 Ga0265327_10000097 3300031251 Bacteria 193156
636 Ga0265327_10000098 3300031251 Bacteria 190693
637 Ga0265327_10000421 3300031251 Bacteria 77515
638 Ga0265327_10065673 3300031251 Bacteria 1834
639 Ga0265316_10045776 3300031344 Bacteria 3471
640 Ga0307513_10085874 3300031456 Bacteria 3228
641 Ga0307513_10118413 3300031456 Bacteria 2623
642 Ga0307509_10064977 3300031507 Bacteria 3835
643 Ga0307509_10087071 3300031507 Bacteria 3210
644 Ga0307509_10098566 3300031507 Bacteria 2967
645 Ga0307408_100000291 3300031548 Bacteria 48964
646 Ga0307408_100004481 3300031548 Bacteria 9479
647 Ga0307508_10005346 3300031616 Bacteria 12230
648 Ga0307508_10129582 3300031616 Bacteria 2126
649 Ga0265314_10109480 3300031711 Bacteria 1758
650 Ga0307516_10000310 3300031730 Bacteria 63335
651 Ga0307413_10013318 3300031824 Bacteria 4130
652 Ga0307412_10000001 3300031911 Bacteria 822691
653 Ga0307412_10004155 3300031911 Bacteria 8066
654 Ga0307414_10008242 3300032004 Bacteria 5896
655 Ga0307507_10000097 3300033179 Bacteria 139761
656 Ga0307510_10001062 3300033180 Bacteria 29213
657 Ga0373943_0046344 3300035170 Bacteria 2122
658 Ga0373927_0011129 3300035695 Bacteria 5993
659 Ga0373937_0086186 3300036401 Bacteria 2907
660 Ga0373925_0157364 3300037068 Bacteria 1788
661 Ga0395899_0000017 3300037312 Bacteria 440179
662 Ga0395899_0000528 3300037312 Bacteria 41982
663 Ga0395899_0049099 3300037312 Bacteria 3137
664 Ga0395899_0061440 3300037312 Bacteria 2767
665 Ga0395899_0076748 3300037312 Bacteria 2438
666 Ga0395899_0136320 3300037312 Bacteria 1749
667 Ga0395900_0002692 3300037418 Bacteria 19416
668 Ga0395900_0006330 3300037418 Bacteria 12346
669 Ga0395900_0030141 3300037418 Bacteria 5569
670 Ga0395900_0126686 3300037418 Bacteria 2619
671 Ga0395900_0196437 3300037418 Bacteria 2043
672 Ga0395900_0201811 3300037418 Bacteria 2011
673 Ga0395898_0000595 3300037466 Bacteria 67162
674 Ga0395898_0052812 3300037466 Bacteria 3970
675 Ga0395898_0053589 3300037466 Bacteria 3939
676 Ga0395898_0070019 3300037466 Bacteria 3393
677 Ga0395905_0171511 3300037471 Bacteria 2038
678 Ga0395901_0005353 3300038443 Bacteria 12971
679 Ga0395901_0036270 3300038443 Bacteria 5095
680 Ga0395901_0102280 3300038443 Bacteria 3007
681 Ga0436365_0038916 3300039437 Bacteria 17419
682 Ga0436365_1153427 3300039437 Bacteria 7567
683 Ga0439431_0000662 3300041997 Bacteria 7330
684 Ga0439442_001192 3300042002 Bacteria 5172
685 Ga0439449_0017643 3300042007 Bacteria 2680
686 Ga0439457_002182 3300042014 Bacteria 5665
687 Ga0439434_0030071 3300042435 Bacteria 1648
688 Ga0451577_0022294 3300042876 Bacteria 5783
689 Ga0451577_0151882 3300042876 Bacteria 2084
690 Ga0466969_0000382 3300044656 Bacteria 24366
691 Ga0466972_0008451 3300044658 Bacteria 5161
692 Ga0453683_0009781 3300044673 Bacteria 6392
693 Ga0466965_0054364 3300044683 Bacteria 1991
694 Ga0466966_0000176 3300044684 Bacteria 42093
695 Ga0453684_0001680 3300044712 Bacteria 59882
696 Ga0453684_0006862 3300044712 Bacteria 21382
697 Ga0453684_0012596 3300044712 Bacteria 13911
698 Ga0453684_0012652 3300044712 Bacteria 13870
699 Ga0453684_0029368 3300044712 Bacteria 7808
700 Ga0453684_0072153 3300044712 Bacteria 4360
701 Ga0453684_0091945 3300044712 Bacteria 3743
702 Ga0466957_0000383 3300044842 Bacteria 21620
703 Ga0466957_0000577 3300044842 Bacteria 18517
704 Ga0466957_0027271 3300044842 Bacteria 3394
705 Ga0466959_0000016 3300045049 Bacteria 144600
706 Ga0451576_0000022 3300045051 Bacteria 495037
707 Ga0451576_0001027 3300045051 Bacteria 51553
708 Ga0451576_0020942 3300045051 Bacteria 7115
709 Ga0451576_0036766 3300045051 Bacteria 5188
710 Ga0495592_0117596 3300046454 Bacteria 1874
711 Ga0495590_0015951 3300046457 Bacteria 2717
712 Ga0495638_0010167 3300046460 Bacteria 6553
713 Ga0495638_0037416 3300046460 Bacteria 3087
714 Ga0495638_0072589 3300046460 Bacteria 2103
715 Ga0495651_0101376 3300046462 Bacteria 2143
716 Ga0495653_0153104 3300046463 Bacteria 1609
717 Ga0495650_0000095 3300046471 Bacteria 218020
718 Ga0495639_0071530 3300046475 Bacteria 1603
719 Ga0495585_0000034 3300046492 Bacteria 143120
720 Ga0495583_0037967 3300046506 Bacteria 2279
721 Ga0495606_0000009 3300046507 Bacteria 306313
722 Ga0495606_0002808 3300046507 Bacteria 19390
723 Ga0495606_0008253 3300046507 Bacteria 9089
724 Ga0495610_0007711 3300046512 Bacteria 7101
725 Ga0495616_0001155 3300046513 Bacteria 18668
726 Ga0495630_0003153 3300046517 Bacteria 11441
727 Ga0495648_0008498 3300046524 Bacteria 8074
728 Ga0495648_0073901 3300046524 Bacteria 1966
729 Ga0495663_0000124 3300046525 Bacteria 32076
730 Ga0495652_0193578 3300046529 Bacteria 1550
731 Ga0495640_0071735 3300046533 Bacteria 2323
732 Ga0495586_0034672 3300046535 Bacteria 2711
733 Ga0495587_0079106 3300046536 Bacteria 1907
734 Ga0495609_0000225 3300046538 Bacteria 55731
735 Ga0495609_0003375 3300046538 Bacteria 9185
736 Ga0495622_0041305 3300046557 Bacteria 2145
737 Ga0495633_0000085 3300046558 Bacteria 124821
738 Ga0495633_0000174 3300046558 Bacteria 83814
739 Ga0495633_0010277 3300046558 Bacteria 5117
740 Ga0495633_0056397 3300046558 Bacteria 1846
741 Ga0495668_0000017 3300046616 Bacteria 434025
742 Ga0495668_0000106 3300046616 Bacteria 133476
743 Ga0495668_0002317 3300046616 Bacteria 15925
744 Ga0495668_0003962 3300046616 Bacteria 10791
745 Ga0495668_0050960 3300046616 Bacteria 2293
746 Ga0495634_0019397 3300046642 Bacteria 4833
747 Ga0495634_0080296 3300046642 Bacteria 2135
748 Ga0495611_0000231 3300046648 Bacteria 38409
749 Ga0495625_0000007 3300046660 Bacteria 565749
750 Ga0495625_0000155 3300046660 Bacteria 105066
751 Ga0495625_0000761 3300046660 Bacteria 44882
752 Ga0495625_0019255 3300046660 Bacteria 5301
753 Ga0495625_0050589 3300046660 Bacteria 2981
754 Ga0495661_0004014 3300046665 Bacteria 10726
755 Ga0495661_0012459 3300046665 Bacteria 5740
756 Ga0495670_0121987 3300046691 Bacteria 1354
757 Ga0495649_0000007 3300046694 Bacteria 518037
758 Ga0495649_0102680 3300046694 Bacteria 1519
759 Ga0495660_0026059 3300046810 Bacteria 3317
760 Ga0495636_0000075 3300047318 Bacteria 41221
761 Ga0495674_0085538 3300047319 Bacteria 2701
762 Ga0495672_0006964 3300047320 Bacteria 8599
763 Ga0495672_0026125 3300047320 Bacteria 3729
764 Ga0495687_003549 3300047443 Bacteria 11218
765 Ga0495686_0000270 3300047472 Bacteria 92321
766 Ga0495686_0000614 3300047472 Bacteria 49242
767 Ga0495686_0000806 3300047472 Bacteria 40626
768 Ga0495686_0001562 3300047472 Bacteria 24407
769 Ga0495686_0022360 3300047472 Bacteria 4185
770 Ga0495686_0029848 3300047472 Bacteria 3544
771 Ga0495686_0071182 3300047472 Bacteria 2141
772 Ga0496110_0052101 3300048913 Bacteria 3597
773 Ga0496114_0000400 3300048917 Bacteria 32085
774 Ga0496116_0002707 3300048919 Bacteria 18248
775 Ga0496117_0001260 3300048920 Bacteria 37607
776 Ga0496121_0000051 3300048924 Bacteria 315378
777 Ga0496122_0004732 3300048925 Bacteria 16698
778 Ga0496123_0038536 3300048926 Bacteria 3357
779 Ga0496124_0049230 3300048927 Bacteria 3596
780 Ga0501031_0057261 3300049568 Bacteria 2539
781 Ga0501032_0000901 3300049569 Bacteria 24084
782 Ga0501033_0077996 3300049570 Bacteria 2431
783 Ga0501033_0100007 3300049570 Bacteria 2117
784 Ga0501034_0000115 3300049571 Bacteria 146825
785 Ga0501034_0036705 3300049571 Bacteria 4963
786 Ga0501034_0080546 3300049571 Bacteria 3259
787 Ga0501034_0143987 3300049571 Bacteria 2361
788 Ga0501036_0013979 3300049572 Bacteria 6673
789 Ga0501037_0060144 3300049573 Bacteria 2771
790 Ga0501037_0093418 3300049573 Bacteria 2175
791 Ga0501038_0011536 3300049574 Bacteria 8063
792 Ga0501043_0008513 3300049579 Bacteria 8078
793 Ga0501043_0077336 3300049579 Bacteria 2614
794 Ga0501047_0017081 3300049581 Bacteria 6940
795 Ga0501047_0125828 3300049581 Bacteria 2443
796 Ga0501048_0072352 3300049582 Bacteria 2434
797 Ga0501067_0007633 3300049583 Bacteria 6012
798 Ga0501067_0059916 3300049583 Bacteria 2107
799 Ga0501070_0059458 3300049586 Bacteria 3168
800 Ga0501073_0009472 3300049589 Bacteria 7189
801 Ga0501074_0009732 3300049590 Bacteria 6979
802 Ga0501219_001212 3300049703 Bacteria 2783
803 Ga0501080_0017887 3300049742 Bacteria 6560
804 Ga0501080_0052084 3300049742 Bacteria 3810
805 Ga0501035_0138244 3300049822 Bacteria 2119
806 Ga0501035_0203051 3300049822 Bacteria 1699
807 Ga0501044_0005380 3300049823 Bacteria 14218
808 Ga0501044_0018314 3300049823 Bacteria 7505
809 Ga0501044_0125467 3300049823 Bacteria 2565
810 Ga0501284_00005 3300050005 Bacteria 164758
811 nmdc:mga0k408_120_c1 3300050493 Bacteria 38359
812 nmdc:mga0k408_429_c1 3300050493 Bacteria 22975
813 nmdc:mga0k408_8963_c1 3300050493 Bacteria 5383
814 nmdc:mga07m45_118400_c1 3300050496 Bacteria 1529
815 nmdc:mga05p37_170491_c1 3300050507 Bacteria 2654
816 nmdc:mga05p37_914_c1 3300050507 Bacteria 33336
817 nmdc:mga09592_10511_c1 3300050508 Bacteria 7532
818 nmdc:mga09592_38456_c1 3300050508 Bacteria 4017
819 nmdc:mga0qj67_15755_c1 3300050509 Bacteria 5726
820 nmdc:mga06r32_38982_c1 3300050510 Bacteria 4505
821 nmdc:mga08y16_74131_c1 3300050511 Bacteria 3546
822 nmdc:mga0n895_60961_c1 3300050512 Bacteria 3723
823 Ga0500635_0005068 3300053080 Bacteria 3433
824 Ga0500578_0001201 3300053086 Bacteria 27358
825 Ga0500644_0000310 3300053088 Bacteria 25670
826 Ga0500583_0000037 3300053092 Bacteria 92466
827 Ga0500583_0026416 3300053092 Bacteria 2493
828 Ga0500583_0029290 3300053092 Bacteria 2398
829 Ga0500641_0035980 3300053096 Bacteria 1979
830 Ga0500569_000069 3300053109 Bacteria 17168
831 Ga0500608_015160 3300053122 Bacteria 3457
832 Ga0500618_000148 3300053125 Bacteria 58264
833 Ga0500642_0042932 3300053130 Bacteria 1962
834 Ga0500652_003417 3300053131 Bacteria 4810
835 Ga0500568_0001483 3300053139 Bacteria 15042
836 Ga0500568_0033961 3300053139 Bacteria 2089
837 Ga0500577_0001007 3300053142 Bacteria 7261
838 Ga0500589_010221 3300053147 Bacteria 4002
839 Ga0500616_0005085 3300053153 Bacteria 9076
840 Ga0500616_0006607 3300053153 Bacteria 7561
841 Ga0500616_0008456 3300053153 Bacteria 6388
842 Ga0500622_0000722 3300053156 Bacteria 28889
843 Ga0500622_0005024 3300053156 Bacteria 8061
844 Ga0500624_000183 3300053157 Bacteria 24891
845 Ga0500627_0005009 3300053158 Bacteria 4340
846 Ga0500636_0004929 3300053177 Bacteria 7583
847 Ga0500611_000004 3300053727 Bacteria 253326
848 Ga0501082_0026283 3300060353 Bacteria 5015

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10038130 rootH1_100381303 388
2 3300049571 Ga0501034_0143987 Ga0501034_0143987_825_2144 389
3 3300049581 Ga0501047_0017081 Ga0501047_0017081_2024_3343 390
4 3300044683 Ga0466965_0054364 Ga0466965_0054364_11_1240 391
5 3300014326 Ga0157380_10134906 Ga0157380_101349061 393
6 3300021384 Ga0213876_10002683 Ga0213876_100026834 394
7 3300039437 Ga0436365_0038916 Ga0436365_0038916_6190_7512 394
8 3300046691 Ga0495670_0121987 Ga0495670_0121987_65_1303 394
9 3300005539 Ga0068853_100188671 Ga0068853_1001886712 395
10 3300006237 Ga0097621_100053413 Ga0097621_1000534132 395
11 3300013306 Ga0163162_10096301 Ga0163162_100963012 395
12 3300013308 Ga0157375_10104889 Ga0157375_101048892 395
13 3300026095 Ga0207676_10282305 Ga0207676_102823051 395
14 3300046506 Ga0495583_0037967 Ga0495583_0037967_978_2228 398
15 3300044712 Ga0453684_0072153 Ga0453684_0072153_454_1776 400
16 3300014325 Ga0163163_10000244 Ga0163163_1000024414 401
17 3300009545 Ga0105237_10006992 Ga0105237_100069923 402
18 3300010375 Ga0105239_10000755 Ga0105239_1000075524 402
19 3300025914 Ga0207671_10010123 Ga0207671_100101233 402
20 3300013307 Ga0157372_10002389 Ga0157372_1000238918 403
21 3300046694 Ga0495649_0102680 Ga0495649_0102680_106_1428 403
22 3300014969 Ga0157376_10192096 Ga0157376_101920962 404
23 3300036401 Ga0373937_0086186 Ga0373937_0086186_450_1769 404
24 3300046558 Ga0495633_0056397 Ga0495633_0056397_11_1330 404
25 3300005329 Ga0070683_100002836 Ga0070683_1000028365 407
26 3300005535 Ga0070684_100002591 Ga0070684_1000025912 407
27 3300005563 Ga0068855_100001620 Ga0068855_10000162011 407
28 3300005616 Ga0068852_100049177 Ga0068852_1000491772 407
29 3300009093 Ga0105240_10036535 Ga0105240_100365354 407
30 3300013104 Ga0157370_10032897 Ga0157370_100328973 407
31 3300013307 Ga0157372_10035046 Ga0157372_100350465 407
32 3300025913 Ga0207695_10000894 Ga0207695_1000089441 407
33 3300025949 Ga0207667_10000365 Ga0207667_1000036521 407
34 3300026041 Ga0207639_10109853 Ga0207639_101098532 407
35 3300001989 JGI24739J22299_10000776 JGI24739J22299_100007767 408
36 3300003771 Ga0055526_1032839 Ga0055526_10328391 408
37 3300003790 Ga0055528_1004767 Ga0055528_10047672 408
38 3300003791 Ga0055530_10003144 Ga0055530_100031449 408
39 3300003794 Ga0055531_10019966 Ga0055531_100199661 408
40 3300005262 Ga0065165_1000109 Ga0065165_100010938 408
41 3300005289 Ga0065704_10079977 Ga0065704_100799771 408
42 3300009148 Ga0105243_10000018 Ga0105243_10000018125 408
43 3300025273 Ga0209673_1000339 Ga0209673_10003395 408
44 3300025295 Ga0209564_1023743 Ga0209564_10237431 408
45 3300025297 Ga0209758_1022385 Ga0209758_10223851 408
46 3300025298 Ga0209050_1000440 Ga0209050_100044028 408
47 3300025302 Ga0207426_1000933 Ga0207426_100093323 408
48 3300025302 Ga0207426_1002563 Ga0207426_10025633 408
49 3300025304 Ga0209257_1003230 Ga0209257_100323010 408
50 3300025935 Ga0207709_10000021 Ga0207709_1000002171 408
51 3300025208 Ga0209436_101750 Ga0209436_1017502 409
52 3300025284 Ga0209130_1006364 Ga0209130_10063644 409
53 3300025302 Ga0207426_1000525 Ga0207426_100052541 409
54 3300047320 Ga0495672_0026125 Ga0495672_0026125_1330_2616 409
55 3300013307 Ga0157372_10006556 Ga0157372_100065562 410
56 3300031548 Ga0307408_100000291 Ga0307408_1000002915 411
57 3300003316 rootH1_10035980 rootH1_100359801 412
58 3300031507 Ga0307509_10064977 Ga0307509_100649771 412
59 3300035695 Ga0373927_0011129 Ga0373927_0011129_4240_5556 412
60 3300037068 Ga0373925_0157364 Ga0373925_0157364_344_1660 412
61 3300046460 Ga0495638_0010167 Ga0495638_0010167_2681_3997 412
62 3300053092 Ga0500583_0000037 Ga0500583_0000037_31258_32574 412
63 3300053092 Ga0500583_0026416 Ga0500583_0026416_241_1557 412
64 3300053147 Ga0500589_010221 Ga0500589_010221_1631_2947 412
65 3300031730 Ga0307516_10000310 Ga0307516_1000031033 413
66 3300042007 Ga0439449_0017643 Ga0439449_0017643_517_1842 413
67 3300046616 Ga0495668_0000106 Ga0495668_0000106_111855_113177 413
68 3300047318 Ga0495636_0000075 Ga0495636_0000075_27718_29046 413
69 3300005539 Ga0068853_100031729 Ga0068853_1000317294 414
70 3300005578 Ga0068854_100072252 Ga0068854_1000722523 414
71 3300005614 Ga0068856_100046347 Ga0068856_1000463471 414
72 3300009093 Ga0105240_10022086 Ga0105240_100220868 414
73 3300009174 Ga0105241_10018266 Ga0105241_100182661 414
74 3300009545 Ga0105237_10007274 Ga0105237_100072743 414
75 3300009545 Ga0105237_10140065 Ga0105237_101400651 414
76 3300009551 Ga0105238_10019521 Ga0105238_100195213 414
77 3300013307 Ga0157372_10033647 Ga0157372_100336474 414
78 3300025913 Ga0207695_10001190 Ga0207695_1000119010 414
79 3300025914 Ga0207671_10000103 Ga0207671_1000010382 414
80 3300025981 Ga0207640_10076026 Ga0207640_100760262 414
81 3300030521 Ga0307511_10002930 Ga0307511_1000293012 414
82 3300031456 Ga0307513_10118413 Ga0307513_101184131 414
83 3300048924 Ga0496121_0000051 Ga0496121_0000051_191020_192345 414
84 3300002738 JGI25154J39366_1000021 JGI25154J39366_100002188 415
85 3300003215 JGI25153J46596_10003171 JGI25153J46596_100031714 415
86 3300003354 JGI25160J50197_1014100 JGI25160J50197_10141002 415
87 3300005262 Ga0065165_1008080 Ga0065165_10080802 415
88 3300006353 Ga0075370_10064390 Ga0075370_100643902 415
89 3300025246 Ga0209646_1000050 Ga0209646_1000050166 415
90 3300025250 Ga0209026_1000826 Ga0209026_100082610 415
91 3300025297 Ga0209758_1010862 Ga0209758_10108624 415
92 3300025302 Ga0207426_1000815 Ga0207426_100081512 415
93 3300050496 nmdc:mga07m45_118400_c1 nmdc:mga07m45_118400_c1_169_1494 415
94 3300053131 Ga0500652_003417 Ga0500652_003417_1363_2688 415
95 3300009092 Ga0105250_10022248 Ga0105250_100222483 416
96 3300013100 Ga0157373_10000107 Ga0157373_1000010755 416
97 3300013104 Ga0157370_10026562 Ga0157370_100265626 416
98 3300013307 Ga0157372_10005622 Ga0157372_100056222 416
99 3300014497 Ga0182008_10000011 Ga0182008_10000011242 416
100 3300025919 Ga0207657_10137348 Ga0207657_101373482 416
101 3300026078 Ga0207702_10082649 Ga0207702_100826492 416
102 3300026116 Ga0207674_10084397 Ga0207674_100843971 416
103 3300031251 Ga0265327_10065673 Ga0265327_100656732 416
104 3300045051 Ga0451576_0000022 Ga0451576_0000022_427548_428882 416
105 3300046525 Ga0495663_0000124 Ga0495663_0000124_26961_28322 416
106 3300046533 Ga0495640_0071735 Ga0495640_0071735_665_1999 416
107 3300046538 Ga0495609_0000225 Ga0495609_0000225_28344_29705 416
108 3300049581 Ga0501047_0125828 Ga0501047_0125828_827_2152 416
109 3300049822 Ga0501035_0203051 Ga0501035_0203051_292_1617 416
110 3300053156 Ga0500622_0000722 Ga0500622_0000722_5917_7242 416
111 3300003761 Ga0055535_1001800 Ga0055535_10018006 417
112 3300003762 Ga0055542_1005835 Ga0055542_10058353 417
113 3300003794 Ga0055531_10000015 Ga0055531_1000001526 417
114 3300005338 Ga0068868_100077038 Ga0068868_1000770383 417
115 3300005364 Ga0070673_100223552 Ga0070673_1002235521 417
116 3300005367 Ga0070667_100002640 Ga0070667_1000026405 417
117 3300005617 Ga0068859_100031009 Ga0068859_1000310095 417
118 3300005834 Ga0068851_10011250 Ga0068851_100112504 417
119 3300005841 Ga0068863_100029101 Ga0068863_1000291012 417
120 3300005843 Ga0068860_100001511 Ga0068860_10000151118 417
121 3300006237 Ga0097621_100060893 Ga0097621_1000608933 417
122 3300006358 Ga0068871_100174091 Ga0068871_1001740911 417
123 3300006931 Ga0097620_100031009 Ga0097620_1000310095 417
124 3300013297 Ga0157378_10243367 Ga0157378_102433672 417
125 3300013308 Ga0157375_10158391 Ga0157375_101583911 417
126 3300014969 Ga0157376_10006924 Ga0157376_100069248 417
127 3300025242 Ga0209258_100193 Ga0209258_10019328 417
128 3300025254 Ga0209148_1000167 Ga0209148_100016788 417
129 3300025304 Ga0209257_1000005 Ga0209257_1000005439 417
130 3300025986 Ga0207658_10021523 Ga0207658_100215231 417
131 3300026023 Ga0207677_10017048 Ga0207677_100170484 417
132 3300028381 Ga0268264_10001196 Ga0268264_1000119616 417
133 3300031251 Ga0265327_10000097 Ga0265327_10000097120 417
134 3300031251 Ga0265327_10000098 Ga0265327_10000098128 417
135 3300041997 Ga0439431_0000662 Ga0439431_0000662_1596_2915 417
136 3300044842 Ga0466957_0027271 Ga0466957_0027271_1526_2851 417
137 3300053088 Ga0500644_0000310 Ga0500644_0000310_10919_12244 417
138 3300053177 Ga0500636_0004929 Ga0500636_0004929_948_2429 417
139 iso_pu_bacteria 2738541278 2738726072 417
140 iso_pu_bacteria 2840677318 2840679371 417
141 iso_pu_bacteria 2896085136 2896087182 417
142 2162886007 SwRhRL2b_contig_3910478 SwRhRL2b_0926.00008020 418
143 3300005288 Ga0065714_10003604 Ga0065714_1000360414 418
144 3300005289 Ga0065704_10000317 Ga0065704_1000031724 418
145 3300005335 Ga0070666_10000038 Ga0070666_1000003884 418
146 3300005367 Ga0070667_100017912 Ga0070667_1000179122 418
147 3300005539 Ga0068853_100006052 Ga0068853_1000060521 418
148 3300005617 Ga0068859_100000007 Ga0068859_10000000790 418
149 3300005618 Ga0068864_100000685 Ga0068864_10000068514 418
150 3300005841 Ga0068863_100018440 Ga0068863_1000184403 418
151 3300005842 Ga0068858_100003163 Ga0068858_1000031637 418
152 3300005843 Ga0068860_100012160 Ga0068860_1000121606 418
153 3300006931 Ga0097620_100000007 Ga0097620_10000000791 418
154 3300009174 Ga0105241_10000104 Ga0105241_1000010455 418
155 3300009545 Ga0105237_10040911 Ga0105237_100409115 418
156 3300009551 Ga0105238_10077512 Ga0105238_100775122 418
157 3300009553 Ga0105249_10009352 Ga0105249_100093526 418
158 3300010375 Ga0105239_10159568 Ga0105239_101595682 418
159 3300011119 Ga0105246_10051012 Ga0105246_100510121 418
160 3300013102 Ga0157371_10000629 Ga0157371_1000062919 418
161 3300013102 Ga0157371_10000884 Ga0157371_1000088422 418
162 3300013104 Ga0157370_10020992 Ga0157370_100209923 418
163 3300013104 Ga0157370_10087796 Ga0157370_100877962 418
164 3300013297 Ga0157378_10225237 Ga0157378_102252372 418
165 3300013306 Ga0163162_10000226 Ga0163162_1000022618 418
166 3300013308 Ga0157375_10117991 Ga0157375_101179912 418
167 3300014325 Ga0163163_10012983 Ga0163163_100129838 418
168 3300014497 Ga0182008_10000047 Ga0182008_1000004725 418
169 3300015261 Ga0182006_1009584 Ga0182006_10095842 418
170 3300025903 Ga0207680_10000015 Ga0207680_1000001586 418
171 3300025914 Ga0207671_10001528 Ga0207671_1000152819 418
172 3300025942 Ga0207689_10004656 Ga0207689_100046562 418
173 3300025986 Ga0207658_10034253 Ga0207658_100342534 418
174 3300026035 Ga0207703_10007227 Ga0207703_100072279 418
175 3300026088 Ga0207641_10000056 Ga0207641_1000005685 418
176 3300026095 Ga0207676_10024265 Ga0207676_100242654 418
177 3300028381 Ga0268264_10001996 Ga0268264_1000199617 418
178 3300028794 Ga0307515_10000078 Ga0307515_1000007850 418
179 3300031911 Ga0307412_10000001 Ga0307412_10000001598 418
180 3300032004 Ga0307414_10008242 Ga0307414_100082424 418
181 3300044658 Ga0466972_0008451 Ga0466972_0008451_1044_2360 418
182 3300047472 Ga0495686_0000270 Ga0495686_0000270_50359_51672 418
183 3300048917 Ga0496114_0000400 Ga0496114_0000400_11580_12926 418
184 3300053139 Ga0500568_0033961 Ga0500568_0033961_318_1646 418
185 3300053153 Ga0500616_0008456 Ga0500616_0008456_2484_3809 418
186 3300003320 rootH2_10002788 rootH2_1000278812 419
187 3300003320 rootH2_10039222 rootH2_100392224 419
188 3300005289 Ga0065704_10074432 Ga0065704_100744322 419
189 3300005331 Ga0070670_100184203 Ga0070670_1001842032 419
190 3300005563 Ga0068855_100100872 Ga0068855_1001008722 419
191 3300005577 Ga0068857_100005598 Ga0068857_1000055987 419
192 3300005578 Ga0068854_100007508 Ga0068854_1000075086 419
193 3300005614 Ga0068856_100151090 Ga0068856_1001510902 419
194 3300005616 Ga0068852_100001659 Ga0068852_1000016599 419
195 3300005718 Ga0068866_10037107 Ga0068866_100371073 419
196 3300005843 Ga0068860_100007061 Ga0068860_1000070616 419
197 3300006881 Ga0068865_100088202 Ga0068865_1000882021 419
198 3300009545 Ga0105237_10004350 Ga0105237_100043508 419
199 3300009545 Ga0105237_10211739 Ga0105237_102117392 419
200 3300010375 Ga0105239_10000936 Ga0105239_1000093631 419
201 3300010375 Ga0105239_10030519 Ga0105239_100305192 419
202 3300013102 Ga0157371_10000012 Ga0157371_10000012261 419
203 3300013105 Ga0157369_10000224 Ga0157369_1000022429 419
204 3300013307 Ga0157372_10048401 Ga0157372_100484016 419
205 3300025904 Ga0207647_10014937 Ga0207647_100149372 419
206 3300025914 Ga0207671_10031834 Ga0207671_100318344 419
207 3300025949 Ga0207667_10001711 Ga0207667_1000171111 419
208 3300026078 Ga0207702_10206103 Ga0207702_102061031 419
209 3300026089 Ga0207648_10256663 Ga0207648_102566631 419
210 3300026116 Ga0207674_10010073 Ga0207674_100100735 419
211 3300026142 Ga0207698_10003137 Ga0207698_100031373 419
212 3300028381 Ga0268264_10026440 Ga0268264_100264402 419
213 3300031507 Ga0307509_10087071 Ga0307509_100870711 419
214 3300031616 Ga0307508_10005346 Ga0307508_100053466 419
215 3300042014 Ga0439457_002182 Ga0439457_002182_2103_3419 419
216 3300044842 Ga0466957_0000383 Ga0466957_0000383_3899_5215 419
217 3300046457 Ga0495590_0015951 Ga0495590_0015951_16_1380 419
218 3300046616 Ga0495668_0003962 Ga0495668_0003962_4976_6328 419
219 3300046648 Ga0495611_0000231 Ga0495611_0000231_4851_6170 419
220 3300053086 Ga0500578_0001201 Ga0500578_0001201_25825_27141 419
221 3300053096 Ga0500641_0035980 Ga0500641_0035980_263_1615 419
222 3300053153 Ga0500616_0006607 Ga0500616_0006607_5953_7305 419
223 iso_pu_bacteria 2585428061 2587750507 419
224 iso_pu_bacteria 2818991442 2819577170 419
225 iso_pu_bacteria 2818991444 2819589844 419
226 iso_pu_bacteria 2818991460 2819676322 419
227 iso_pu_bacteria 2821136567 2821140457 419
228 iso_pu_bacteria 2884791551 2884796149 419
229 iso_pu_bacteria 2904467357 2904472876 419
230 iso_pu_bacteria 2929154850 2929160071 419
231 iso_pu_bacteria 2929177148 2929178337 419
232 iso_pu_bacteria 2929239360 2929240637 419
233 iso_pu_bacteria 2929921140 2929922487 419
234 iso_pu_bacteria 2945977869 2945980703 419
235 iso_pu_bacteria 2946013367 2946013430 419
236 iso_pu_bacteria 8003151029 8003156411 419
237 3300005338 Ga0068868_100088249 Ga0068868_1000882492 420
238 3300005343 Ga0070687_100052398 Ga0070687_1000523982 420
239 3300005459 Ga0068867_100033978 Ga0068867_1000339785 420
240 3300005471 Ga0070698_100000267 Ga0070698_1000002675 420
241 3300005543 Ga0070672_100035517 Ga0070672_1000355172 420
242 3300005544 Ga0070686_100032749 Ga0070686_1000327492 420
243 3300005563 Ga0068855_100017041 Ga0068855_1000170416 420
244 3300005564 Ga0070664_100020306 Ga0070664_1000203065 420
245 3300005614 Ga0068856_100036347 Ga0068856_1000363471 420
246 3300005615 Ga0070702_100007104 Ga0070702_1000071046 420
247 3300009094 Ga0111539_10167665 Ga0111539_101676653 420
248 3300009147 Ga0114129_10000608 Ga0114129_1000060816 420
249 3300009545 Ga0105237_10015845 Ga0105237_100158453 420
250 3300010375 Ga0105239_10127795 Ga0105239_101277951 420
251 3300013297 Ga0157378_10004574 Ga0157378_1000457411 420
252 3300014745 Ga0157377_10003043 Ga0157377_100030435 420
253 3300025907 Ga0207645_10036710 Ga0207645_100367103 420
254 3300025913 Ga0207695_10185750 Ga0207695_101857502 420
255 3300025931 Ga0207644_10079226 Ga0207644_100792262 420
256 3300025940 Ga0207691_10042147 Ga0207691_100421474 420
257 3300025945 Ga0207679_10021342 Ga0207679_100213422 420
258 3300025949 Ga0207667_10106243 Ga0207667_101062432 420
259 3300025960 Ga0207651_10116429 Ga0207651_101164292 420
260 3300026075 Ga0207708_10143607 Ga0207708_101436071 420
261 3300026078 Ga0207702_10054227 Ga0207702_100542271 420
262 3300026142 Ga0207698_10112943 Ga0207698_101129433 420
263 3300027907 Ga0207428_10096411 Ga0207428_100964113 420
264 3300031507 Ga0307509_10098566 Ga0307509_100985663 420
265 3300031548 Ga0307408_100004481 Ga0307408_1000044811 420
266 3300031616 Ga0307508_10129582 Ga0307508_101295821 420
267 3300031911 Ga0307412_10004155 Ga0307412_100041557 420
268 3300033180 Ga0307510_10001062 Ga0307510_1000106218 420
269 3300044656 Ga0466969_0000382 Ga0466969_0000382_7661_8980 420
270 3300044673 Ga0453683_0009781 Ga0453683_0009781_1860_3173 420
271 3300044684 Ga0466966_0000176 Ga0466966_0000176_2031_3350 420
272 3300044712 Ga0453684_0012652 Ga0453684_0012652_7352_8689 420
273 3300044842 Ga0466957_0000577 Ga0466957_0000577_10390_11703 420
274 3300045049 Ga0466959_0000016 Ga0466959_0000016_50541_51860 420
275 3300045051 Ga0451576_0001027 Ga0451576_0001027_28935_30248 420
276 3300045051 Ga0451576_0020942 Ga0451576_0020942_5272_6585 420
277 3300046460 Ga0495638_0072589 Ga0495638_0072589_155_1474 420
278 3300048919 Ga0496116_0002707 Ga0496116_0002707_13676_15016 420
279 3300048920 Ga0496117_0001260 Ga0496117_0001260_18632_19972 420
280 3300048925 Ga0496122_0004732 Ga0496122_0004732_180_1520 420
281 3300048926 Ga0496123_0038536 Ga0496123_0038536_1213_2553 420
282 3300048927 Ga0496124_0049230 Ga0496124_0049230_2155_3495 420
283 3300050507 nmdc:mga05p37_914_c1 nmdc:mga05p37_914_c1_15168_16487 420
284 3300050511 nmdc:mga08y16_74131_c1 nmdc:mga08y16_74131_c1_1243_2574 420
285 3300053158 Ga0500627_0005009 Ga0500627_0005009_2746_4098 420
286 iso_pu_bacteria 2599185184 2599480785 420
287 iso_pu_bacteria 2721755487 2722726532 420
288 iso_pu_bacteria 2842903701 2842904940 420
289 iso_pu_bacteria 2852623160 2852626522 420
290 iso_pu_bacteria 2881955468 2881957951 420
291 iso_pu_bacteria 2884933994 2884934948 420
292 iso_pu_bacteria 2904780799 2904783607 420
293 iso_pu_bacteria 2919177583 2919182158 420
294 iso_pu_bacteria 2919437846 2919439718 420
295 iso_pu_bacteria 2928078545 2928081679 420
296 iso_pu_bacteria 2928147474 2928150293 420
297 iso_pu_bacteria 2932082852 2932085115 420
298 iso_pu_bacteria 2977232053 2977234672 420
299 3300005331 Ga0070670_100005343 Ga0070670_1000053435 421
300 3300005336 Ga0070680_100004673 Ga0070680_1000046731 421
301 3300005336 Ga0070680_100086978 Ga0070680_1000869783 421
302 3300005530 Ga0070679_100056287 Ga0070679_1000562871 421
303 3300005530 Ga0070679_100056404 Ga0070679_1000564041 421
304 3300005563 Ga0068855_100000145 Ga0068855_10000014528 421
305 3300009093 Ga0105240_10000414 Ga0105240_1000041469 421
306 3300009093 Ga0105240_10038947 Ga0105240_100389472 421
307 3300009093 Ga0105240_10042144 Ga0105240_100421446 421
308 3300009093 Ga0105240_10140154 Ga0105240_101401542 421
309 3300009545 Ga0105237_10009111 Ga0105237_100091112 421
310 3300013102 Ga0157371_10043804 Ga0157371_100438042 421
311 3300013102 Ga0157371_10148825 Ga0157371_101488252 421
312 3300013105 Ga0157369_10042378 Ga0157369_100423787 421
313 3300013105 Ga0157369_10088874 Ga0157369_100888745 421
314 3300013307 Ga0157372_10038641 Ga0157372_100386414 421
315 3300013307 Ga0157372_10045710 Ga0157372_100457103 421
316 3300021384 Ga0213876_10001070 Ga0213876_100010703 421
317 3300025909 Ga0207705_10001443 Ga0207705_1000144312 421
318 3300025909 Ga0207705_10010408 Ga0207705_100104085 421
319 3300025913 Ga0207695_10000169 Ga0207695_1000016978 421
320 3300025913 Ga0207695_10000238 Ga0207695_10000238111 421
321 3300025913 Ga0207695_10060277 Ga0207695_100602775 421
322 3300025914 Ga0207671_10005708 Ga0207671_100057087 421
323 3300025921 Ga0207652_10000187 Ga0207652_100001871 421
324 3300025921 Ga0207652_10061169 Ga0207652_100611694 421
325 3300025944 Ga0207661_10245042 Ga0207661_102450421 421
326 3300025949 Ga0207667_10000508 Ga0207667_1000050833 421
327 3300025949 Ga0207667_10291853 Ga0207667_102918532 421
328 3300025960 Ga0207651_10108640 Ga0207651_101086402 421
329 3300026041 Ga0207639_10094893 Ga0207639_100948932 421
330 3300026067 Ga0207678_10023821 Ga0207678_100238213 421
331 3300026116 Ga0207674_10210909 Ga0207674_102109091 421
332 3300031344 Ga0265316_10045776 Ga0265316_100457763 421
333 3300031824 Ga0307413_10013318 Ga0307413_100133182 421
334 3300037312 Ga0395899_0136320 Ga0395899_0136320_59_1381 421
335 3300037418 Ga0395900_0030141 Ga0395900_0030141_2596_3918 421
336 3300038443 Ga0395901_0102280 Ga0395901_0102280_511_1833 421
337 3300039437 Ga0436365_1153427 Ga0436365_1153427_4187_5509 421
338 3300042876 Ga0451577_0022294 Ga0451577_0022294_1343_2662 421
339 3300044712 Ga0453684_0012596 Ga0453684_0012596_6471_7790 421
340 3300044712 Ga0453684_0029368 Ga0453684_0029368_4444_5763 421
341 3300046507 Ga0495606_0002808 Ga0495606_0002808_9606_10925 421
342 3300046558 Ga0495633_0000085 Ga0495633_0000085_31640_32965 421
343 3300053109 Ga0500569_000069 Ga0500569_000069_10614_11939 421
344 3300053142 Ga0500577_0001007 Ga0500577_0001007_670_1995 421
345 3300053153 Ga0500616_0005085 Ga0500616_0005085_4295_5620 421
346 3300003322 rootL2_10212212 rootL2_102122121 422
347 3300005290 Ga0065712_10003409 Ga0065712_100034092 422
348 3300005290 Ga0065712_10017029 Ga0065712_100170293 422
349 3300005295 Ga0065707_10142526 Ga0065707_101425262 422
350 3300005328 Ga0070676_10018602 Ga0070676_100186022 422
351 3300005329 Ga0070683_100000468 Ga0070683_10000046827 422
352 3300005329 Ga0070683_100099234 Ga0070683_1000992342 422
353 3300005329 Ga0070683_100119074 Ga0070683_1001190742 422
354 3300005331 Ga0070670_100019418 Ga0070670_1000194185 422
355 3300005331 Ga0070670_100123883 Ga0070670_1001238832 422
356 3300005331 Ga0070670_100138870 Ga0070670_1001388702 422
357 3300005331 Ga0070670_100185747 Ga0070670_1001857471 422
358 3300005333 Ga0070677_10018936 Ga0070677_100189362 422
359 3300005334 Ga0068869_100003551 Ga0068869_1000035512 422
360 3300005334 Ga0068869_100009768 Ga0068869_1000097686 422
361 3300005334 Ga0068869_100017086 Ga0068869_1000170865 422
362 3300005335 Ga0070666_10004991 Ga0070666_100049913 422
363 3300005335 Ga0070666_10017523 Ga0070666_100175234 422
364 3300005336 Ga0070680_100000107 Ga0070680_10000010714 422
365 3300005337 Ga0070682_100004790 Ga0070682_1000047906 422
366 3300005338 Ga0068868_100052245 Ga0068868_1000522453 422
367 3300005340 Ga0070689_100067418 Ga0070689_1000674181 422
368 3300005340 Ga0070689_100166102 Ga0070689_1001661021 422
369 3300005341 Ga0070691_10001904 Ga0070691_100019045 422
370 3300005344 Ga0070661_100000179 Ga0070661_10000017952 422
371 3300005344 Ga0070661_100003133 Ga0070661_10000313313 422
372 3300005347 Ga0070668_100113087 Ga0070668_1001130872 422
373 3300005354 Ga0070675_100020576 Ga0070675_1000205765 422
374 3300005354 Ga0070675_100049081 Ga0070675_1000490813 422
375 3300005355 Ga0070671_100114425 Ga0070671_1001144251 422
376 3300005364 Ga0070673_100008952 Ga0070673_1000089521 422
377 3300005365 Ga0070688_100045498 Ga0070688_1000454982 422
378 3300005365 Ga0070688_100052769 Ga0070688_1000527691 422
379 3300005366 Ga0070659_100057148 Ga0070659_1000571482 422
380 3300005366 Ga0070659_100129852 Ga0070659_1001298522 422
381 3300005367 Ga0070667_100037416 Ga0070667_1000374163 422
382 3300005455 Ga0070663_100076544 Ga0070663_1000765441 422
383 3300005456 Ga0070678_100014866 Ga0070678_1000148661 422
384 3300005456 Ga0070678_100099416 Ga0070678_1000994162 422
385 3300005458 Ga0070681_10018750 Ga0070681_100187505 422
386 3300005459 Ga0068867_100011635 Ga0068867_1000116352 422
387 3300005459 Ga0068867_100022600 Ga0068867_1000226005 422
388 3300005459 Ga0068867_100026385 Ga0068867_1000263854 422
389 3300005459 Ga0068867_100049645 Ga0068867_1000496452 422
390 3300005459 Ga0068867_100146902 Ga0068867_1001469021 422
391 3300005459 Ga0068867_100175174 Ga0068867_1001751741 422
392 3300005466 Ga0070685_10014741 Ga0070685_100147413 422
393 3300005471 Ga0070698_100056165 Ga0070698_1000561653 422
394 3300005530 Ga0070679_100004867 Ga0070679_1000048675 422
395 3300005535 Ga0070684_100015367 Ga0070684_1000153675 422
396 3300005535 Ga0070684_100054702 Ga0070684_1000547023 422
397 3300005539 Ga0068853_100005569 Ga0068853_10000556911 422
398 3300005539 Ga0068853_100205012 Ga0068853_1002050121 422
399 3300005543 Ga0070672_100066688 Ga0070672_1000666883 422
400 3300005544 Ga0070686_100045558 Ga0070686_1000455582 422
401 3300005547 Ga0070693_100001913 Ga0070693_1000019134 422
402 3300005548 Ga0070665_100000094 Ga0070665_10000009444 422
403 3300005548 Ga0070665_100061303 Ga0070665_1000613031 422
404 3300005548 Ga0070665_100307857 Ga0070665_1003078571 422
405 3300005563 Ga0068855_100107195 Ga0068855_1001071954 422
406 3300005564 Ga0070664_100000140 Ga0070664_10000014031 422
407 3300005564 Ga0070664_100025386 Ga0070664_1000253866 422
408 3300005564 Ga0070664_100076654 Ga0070664_1000766542 422
409 3300005564 Ga0070664_100167278 Ga0070664_1001672782 422
410 3300005577 Ga0068857_100014523 Ga0068857_1000145233 422
411 3300005577 Ga0068857_100317976 Ga0068857_1003179761 422
412 3300005578 Ga0068854_100051058 Ga0068854_1000510582 422
413 3300005614 Ga0068856_100045155 Ga0068856_1000451551 422
414 3300005616 Ga0068852_100071704 Ga0068852_1000717042 422
415 3300005617 Ga0068859_100005939 Ga0068859_10000593912 422
416 3300005617 Ga0068859_100076094 Ga0068859_1000760944 422
417 3300005617 Ga0068859_100165504 Ga0068859_1001655042 422
418 3300005617 Ga0068859_100339039 Ga0068859_1003390392 422
419 3300005618 Ga0068864_100061903 Ga0068864_1000619034 422
420 3300005719 Ga0068861_100019358 Ga0068861_1000193584 422
421 3300005719 Ga0068861_100061537 Ga0068861_1000615373 422
422 3300005719 Ga0068861_100179625 Ga0068861_1001796251 422
423 3300005834 Ga0068851_10014891 Ga0068851_100148912 422
424 3300005841 Ga0068863_100073091 Ga0068863_1000730911 422
425 3300005842 Ga0068858_100041888 Ga0068858_1000418882 422
426 3300005842 Ga0068858_100082551 Ga0068858_1000825512 422
427 3300005843 Ga0068860_100003681 Ga0068860_1000036817 422
428 3300005843 Ga0068860_100014136 Ga0068860_1000141365 422
429 3300005843 Ga0068860_100094546 Ga0068860_1000945463 422
430 3300005843 Ga0068860_100248020 Ga0068860_1002480202 422
431 3300005844 Ga0068862_100085605 Ga0068862_1000856052 422
432 3300005985 Ga0081539_10076014 Ga0081539_100760142 422
433 3300006195 Ga0075366_10004374 Ga0075366_100043742 422
434 3300006195 Ga0075366_10009009 Ga0075366_100090097 422
435 3300006237 Ga0097621_100003509 Ga0097621_1000035095 422
436 3300006237 Ga0097621_100054450 Ga0097621_1000544502 422
437 3300006237 Ga0097621_100077188 Ga0097621_1000771883 422
438 3300006237 Ga0097621_100084224 Ga0097621_1000842242 422
439 3300006358 Ga0068871_100003013 Ga0068871_1000030136 422
440 3300006358 Ga0068871_100005842 Ga0068871_1000058422 422
441 3300006358 Ga0068871_100113868 Ga0068871_1001138681 422
442 3300006844 Ga0075428_100003257 Ga0075428_10000325719 422
443 3300006844 Ga0075428_100019714 Ga0075428_1000197145 422
444 3300006844 Ga0075428_100216185 Ga0075428_1002161851 422
445 3300006871 Ga0075434_100052957 Ga0075434_1000529573 422
446 3300006880 Ga0075429_100015711 Ga0075429_1000157117 422
447 3300006881 Ga0068865_100002580 Ga0068865_1000025802 422
448 3300006881 Ga0068865_100059325 Ga0068865_1000593252 422
449 3300006881 Ga0068865_100108219 Ga0068865_1001082193 422
450 3300006931 Ga0097620_100005939 Ga0097620_10000593912 422
451 3300006931 Ga0097620_100076089 Ga0097620_1000760894 422
452 3300006931 Ga0097620_100165510 Ga0097620_1001655102 422
453 3300006931 Ga0097620_100339031 Ga0097620_1003390311 422
454 3300009093 Ga0105240_10002372 Ga0105240_100023725 422
455 3300009093 Ga0105240_10116448 Ga0105240_101164482 422
456 3300009093 Ga0105240_10321503 Ga0105240_103215031 422
457 3300009101 Ga0105247_10070602 Ga0105247_100706022 422
458 3300009101 Ga0105247_10087330 Ga0105247_100873302 422
459 3300009147 Ga0114129_10352293 Ga0114129_103522932 422
460 3300009147 Ga0114129_10583300 Ga0114129_105833001 422
461 3300009174 Ga0105241_10002801 Ga0105241_100028016 422
462 3300009176 Ga0105242_10008462 Ga0105242_100084625 422
463 3300009176 Ga0105242_10037587 Ga0105242_100375873 422
464 3300009176 Ga0105242_10066895 Ga0105242_100668954 422
465 3300009176 Ga0105242_10142795 Ga0105242_101427952 422
466 3300009177 Ga0105248_10112229 Ga0105248_101122293 422
467 3300009545 Ga0105237_10002964 Ga0105237_100029642 422
468 3300009545 Ga0105237_10076443 Ga0105237_100764433 422
469 3300009545 Ga0105237_10089416 Ga0105237_100894162 422
470 3300009551 Ga0105238_10121922 Ga0105238_101219222 422
471 3300009553 Ga0105249_10000177 Ga0105249_1000017754 422
472 3300009553 Ga0105249_10013585 Ga0105249_100135854 422
473 3300010375 Ga0105239_10350555 Ga0105239_103505551 422
474 3300011119 Ga0105246_10019297 Ga0105246_100192975 422
475 3300013104 Ga0157370_10008544 Ga0157370_100085445 422
476 3300013104 Ga0157370_10063980 Ga0157370_100639802 422
477 3300013296 Ga0157374_10000237 Ga0157374_1000023716 422
478 3300013296 Ga0157374_10005388 Ga0157374_100053884 422
479 3300013297 Ga0157378_10020420 Ga0157378_100204204 422
480 3300013297 Ga0157378_10111792 Ga0157378_101117921 422
481 3300013306 Ga0163162_10006217 Ga0163162_1000621711 422
482 3300013306 Ga0163162_10011350 Ga0163162_100113504 422
483 3300013306 Ga0163162_10084395 Ga0163162_100843952 422
484 3300013306 Ga0163162_10234127 Ga0163162_102341272 422
485 3300013306 Ga0163162_10290308 Ga0163162_102903081 422
486 3300013308 Ga0157375_10096069 Ga0157375_100960692 422
487 3300013308 Ga0157375_10158696 Ga0157375_101586962 422
488 3300013308 Ga0157375_10450244 Ga0157375_104502441 422
489 3300014325 Ga0163163_10000088 Ga0163163_1000008859 422
490 3300014326 Ga0157380_10063533 Ga0157380_100635331 422
491 3300014326 Ga0157380_10143391 Ga0157380_101433912 422
492 3300014745 Ga0157377_10001221 Ga0157377_100012213 422
493 3300014745 Ga0157377_10018151 Ga0157377_100181513 422
494 3300014745 Ga0157377_10126439 Ga0157377_101264391 422
495 3300014968 Ga0157379_10031404 Ga0157379_100314044 422
496 3300014968 Ga0157379_10051589 Ga0157379_100515892 422
497 3300014969 Ga0157376_10031273 Ga0157376_100312734 422
498 3300014969 Ga0157376_10031781 Ga0157376_100317813 422
499 3300014969 Ga0157376_10151224 Ga0157376_101512243 422
500 3300014969 Ga0157376_10168324 Ga0157376_101683242 422
501 3300014969 Ga0157376_10212906 Ga0157376_102129062 422
502 3300017792 Ga0163161_10020287 Ga0163161_100202873 422
503 3300017792 Ga0163161_10027138 Ga0163161_100271381 422
504 3300017792 Ga0163161_10044468 Ga0163161_100444682 422
505 3300017792 Ga0163161_10106959 Ga0163161_101069592 422
506 3300017792 Ga0163161_10220287 Ga0163161_102202871 422
507 3300025899 Ga0207642_10025689 Ga0207642_100256892 422
508 3300025901 Ga0207688_10129056 Ga0207688_101290561 422
509 3300025903 Ga0207680_10009136 Ga0207680_100091365 422
510 3300025903 Ga0207680_10044173 Ga0207680_100441731 422
511 3300025904 Ga0207647_10146451 Ga0207647_101464511 422
512 3300025907 Ga0207645_10000136 Ga0207645_1000013628 422
513 3300025907 Ga0207645_10018765 Ga0207645_100187653 422
514 3300025907 Ga0207645_10025617 Ga0207645_100256172 422
515 3300025908 Ga0207643_10064435 Ga0207643_100644352 422
516 3300025911 Ga0207654_10002468 Ga0207654_100024684 422
517 3300025912 Ga0207707_10003458 Ga0207707_100034586 422
518 3300025913 Ga0207695_10048262 Ga0207695_100482625 422
519 3300025913 Ga0207695_10108636 Ga0207695_101086363 422
520 3300025917 Ga0207660_10042709 Ga0207660_100427094 422
521 3300025920 Ga0207649_10000419 Ga0207649_1000041927 422
522 3300025921 Ga0207652_10006696 Ga0207652_100066967 422
523 3300025923 Ga0207681_10047997 Ga0207681_100479972 422
524 3300025923 Ga0207681_10077272 Ga0207681_100772721 422
525 3300025925 Ga0207650_10112802 Ga0207650_101128022 422
526 3300025932 Ga0207690_10043848 Ga0207690_100438482 422
527 3300025933 Ga0207706_10002103 Ga0207706_100021031 422
528 3300025933 Ga0207706_10024569 Ga0207706_100245695 422
529 3300025933 Ga0207706_10059286 Ga0207706_100592864 422
530 3300025934 Ga0207686_10000429 Ga0207686_1000042923 422
531 3300025934 Ga0207686_10089861 Ga0207686_100898612 422
532 3300025936 Ga0207670_10015622 Ga0207670_100156223 422
533 3300025936 Ga0207670_10059061 Ga0207670_100590613 422
534 3300025936 Ga0207670_10146400 Ga0207670_101464001 422
535 3300025938 Ga0207704_10036806 Ga0207704_100368063 422
536 3300025938 Ga0207704_10070796 Ga0207704_100707961 422
537 3300025938 Ga0207704_10087515 Ga0207704_100875151 422
538 3300025940 Ga0207691_10040276 Ga0207691_100402764 422
539 3300025942 Ga0207689_10001007 Ga0207689_1000100716 422
540 3300025942 Ga0207689_10014075 Ga0207689_100140753 422
541 3300025942 Ga0207689_10019898 Ga0207689_100198985 422
542 3300025942 Ga0207689_10026965 Ga0207689_100269652 422
543 3300025942 Ga0207689_10063150 Ga0207689_100631501 422
544 3300025944 Ga0207661_10000370 Ga0207661_100003706 422
545 3300025944 Ga0207661_10120368 Ga0207661_101203682 422
546 3300025945 Ga0207679_10000266 Ga0207679_1000026616 422
547 3300025945 Ga0207679_10001572 Ga0207679_1000157216 422
548 3300025949 Ga0207667_10120942 Ga0207667_101209423 422
549 3300025960 Ga0207651_10069866 Ga0207651_100698662 422
550 3300025961 Ga0207712_10002766 Ga0207712_100027662 422
551 3300025961 Ga0207712_10011848 Ga0207712_100118482 422
552 3300025986 Ga0207658_10208212 Ga0207658_102082121 422
553 3300026023 Ga0207677_10028677 Ga0207677_100286774 422
554 3300026023 Ga0207677_10130678 Ga0207677_101306782 422
555 3300026023 Ga0207677_10139086 Ga0207677_101390861 422
556 3300026035 Ga0207703_10061525 Ga0207703_100615252 422
557 3300026041 Ga0207639_10019147 Ga0207639_100191474 422
558 3300026067 Ga0207678_10098208 Ga0207678_100982081 422
559 3300026078 Ga0207702_10032751 Ga0207702_100327511 422
560 3300026088 Ga0207641_10007370 Ga0207641_100073709 422
561 3300026088 Ga0207641_10037835 Ga0207641_100378352 422
562 3300026089 Ga0207648_10000568 Ga0207648_1000056834 422
563 3300026089 Ga0207648_10004655 Ga0207648_1000465512 422
564 3300026089 Ga0207648_10029445 Ga0207648_100294452 422
565 3300026089 Ga0207648_10066942 Ga0207648_100669423 422
566 3300026095 Ga0207676_10076898 Ga0207676_100768982 422
567 3300026095 Ga0207676_10215770 Ga0207676_102157701 422
568 3300026118 Ga0207675_100007383 Ga0207675_10000738312 422
569 3300026118 Ga0207675_100021679 Ga0207675_1000216792 422
570 3300026118 Ga0207675_100048377 Ga0207675_1000483772 422
571 3300026121 Ga0207683_10002007 Ga0207683_100020079 422
572 3300026121 Ga0207683_10007862 Ga0207683_100078626 422
573 3300026142 Ga0207698_10042824 Ga0207698_100428244 422
574 3300028379 Ga0268266_10000071 Ga0268266_1000007139 422
575 3300028381 Ga0268264_10000143 Ga0268264_10000143121 422
576 3300028381 Ga0268264_10006748 Ga0268264_100067484 422
577 3300028381 Ga0268264_10063639 Ga0268264_100636392 422
578 3300028786 Ga0307517_10012359 Ga0307517_100123598 422
579 3300030732 Ga0316176_1079087 Ga0316176_10790873 422
580 3300031456 Ga0307513_10085874 Ga0307513_100858744 422
581 3300035170 Ga0373943_0046344 Ga0373943_0046344_726_2048 422
582 3300042002 Ga0439442_001192 Ga0439442_001192_1354_2679 422
583 3300042876 Ga0451577_0151882 Ga0451577_0151882_194_1525 422
584 3300044712 Ga0453684_0091945 Ga0453684_0091945_694_2025 422
585 3300046454 Ga0495592_0117596 Ga0495592_0117596_332_1654 422
586 3300046460 Ga0495638_0037416 Ga0495638_0037416_1184_2512 422
587 3300046463 Ga0495653_0153104 Ga0495653_0153104_185_1507 422
588 3300046475 Ga0495639_0071530 Ga0495639_0071530_132_1451 422
589 3300046517 Ga0495630_0003153 Ga0495630_0003153_8957_10279 422
590 3300046529 Ga0495652_0193578 Ga0495652_0193578_189_1508 422
591 3300046535 Ga0495586_0034672 Ga0495586_0034672_744_2063 422
592 3300046536 Ga0495587_0079106 Ga0495587_0079106_103_1422 422
593 3300046616 Ga0495668_0002317 Ga0495668_0002317_8044_9363 422
594 3300046642 Ga0495634_0019397 Ga0495634_0019397_2889_4211 422
595 3300046642 Ga0495634_0080296 Ga0495634_0080296_363_1682 422
596 3300047319 Ga0495674_0085538 Ga0495674_0085538_1233_2552 422
597 3300047320 Ga0495672_0006964 Ga0495672_0006964_2223_3548 422
598 3300047472 Ga0495686_0000806 Ga0495686_0000806_23873_25231 422
599 3300047472 Ga0495686_0022360 Ga0495686_0022360_2127_3452 422
600 3300047472 Ga0495686_0029848 Ga0495686_0029848_402_1727 422
601 3300048913 Ga0496110_0052101 Ga0496110_0052101_1193_2515 422
602 3300049568 Ga0501031_0057261 Ga0501031_0057261_827_2152 422
603 3300049571 Ga0501034_0080546 Ga0501034_0080546_1154_2476 422
604 3300049573 Ga0501037_0093418 Ga0501037_0093418_468_1793 422
605 3300049574 Ga0501038_0011536 Ga0501038_0011536_4435_5760 422
606 3300049579 Ga0501043_0008513 Ga0501043_0008513_2629_3954 422
607 3300049582 Ga0501048_0072352 Ga0501048_0072352_350_1672 422
608 3300049583 Ga0501067_0007633 Ga0501067_0007633_1770_3092 422
609 3300049703 Ga0501219_001212 Ga0501219_001212_582_1901 422
610 3300049742 Ga0501080_0052084 Ga0501080_0052084_1994_3316 422
611 3300049823 Ga0501044_0018314 Ga0501044_0018314_1391_2716 422
612 3300049823 Ga0501044_0125467 Ga0501044_0125467_400_1722 422
613 3300050005 Ga0501284_00005 Ga0501284_00005_109365_110684 422
614 3300050493 nmdc:mga0k408_8963_c1 nmdc:mga0k408_8963_c1_2033_3358 422
615 3300050507 nmdc:mga05p37_170491_c1 nmdc:mga05p37_170491_c1_49_1377 422
616 3300050508 nmdc:mga09592_10511_c1 nmdc:mga09592_10511_c1_2274_3605 422
617 3300050508 nmdc:mga09592_38456_c1 nmdc:mga09592_38456_c1_1473_2801 422
618 3300050509 nmdc:mga0qj67_15755_c1 nmdc:mga0qj67_15755_c1_136_1464 422
619 3300050510 nmdc:mga06r32_38982_c1 nmdc:mga06r32_38982_c1_1951_3279 422
620 3300050512 nmdc:mga0n895_60961_c1 nmdc:mga0n895_60961_c1_784_2106 422
621 3300053092 Ga0500583_0029290 Ga0500583_0029290_671_1999 422
622 3300053130 Ga0500642_0042932 Ga0500642_0042932_144_1472 422
623 3300053139 Ga0500568_0001483 Ga0500568_0001483_5148_6473 422
624 3300053727 Ga0500611_000004 Ga0500611_000004_235127_236452 422
625 3300060353 Ga0501082_0026283 Ga0501082_0026283_843_2165 422
626 3300002737 JGI25162J39368_1001130 JGI25162J39368_10011301 423
627 3300002772 JGI25164J39214_1001844 JGI25164J39214_10018441 423
628 3300003214 JGI25165J46597_1001512 JGI25165J46597_10015122 423
629 3300003322 rootL2_10053828 rootL2_100538285 423
630 3300003323 rootH1_10007236 rootH1_100072367 423
631 3300005290 Ga0065712_10000661 Ga0065712_1000066114 423
632 3300005295 Ga0065707_10007629 Ga0065707_100076292 423
633 3300005327 Ga0070658_10019663 Ga0070658_100196634 423
634 3300005327 Ga0070658_10084047 Ga0070658_100840473 423
635 3300005327 Ga0070658_10139003 Ga0070658_101390032 423
636 3300005327 Ga0070658_10170445 Ga0070658_101704452 423
637 3300005334 Ga0068869_100044144 Ga0068869_1000441441 423
638 3300005336 Ga0070680_100059656 Ga0070680_1000596562 423
639 3300005336 Ga0070680_100062464 Ga0070680_1000624643 423
640 3300005337 Ga0070682_100000129 Ga0070682_10000012941 423
641 3300005337 Ga0070682_100079749 Ga0070682_1000797492 423
642 3300005339 Ga0070660_100017754 Ga0070660_1000177542 423
643 3300005339 Ga0070660_100095883 Ga0070660_1000958831 423
644 3300005353 Ga0070669_100004014 Ga0070669_1000040142 423
645 3300005353 Ga0070669_100052457 Ga0070669_1000524573 423
646 3300005354 Ga0070675_100004112 Ga0070675_1000041121 423
647 3300005366 Ga0070659_100031741 Ga0070659_1000317412 423
648 3300005457 Ga0070662_100036667 Ga0070662_1000366672 423
649 3300005458 Ga0070681_10008323 Ga0070681_1000832310 423
650 3300005458 Ga0070681_10079621 Ga0070681_100796213 423
651 3300005530 Ga0070679_100000158 Ga0070679_10000015811 423
652 3300005530 Ga0070679_100004315 Ga0070679_10000431510 423
653 3300005530 Ga0070679_100027513 Ga0070679_1000275136 423
654 3300005530 Ga0070679_100107718 Ga0070679_1001077181 423
655 3300005530 Ga0070679_100270164 Ga0070679_1002701641 423
656 3300005539 Ga0068853_100006293 Ga0068853_1000062931 423
657 3300005539 Ga0068853_100012384 Ga0068853_1000123843 423
658 3300005539 Ga0068853_100042310 Ga0068853_1000423103 423
659 3300005539 Ga0068853_100177983 Ga0068853_1001779832 423
660 3300005563 Ga0068855_100000489 Ga0068855_10000048936 423
661 3300005563 Ga0068855_100152798 Ga0068855_1001527983 423
662 3300005563 Ga0068855_100155294 Ga0068855_1001552942 423
663 3300005577 Ga0068857_100023904 Ga0068857_1000239044 423
664 3300005616 Ga0068852_100013323 Ga0068852_1000133232 423
665 3300005617 Ga0068859_100005587 Ga0068859_1000055877 423
666 3300005617 Ga0068859_100006487 Ga0068859_10000648710 423
667 3300005617 Ga0068859_100007298 Ga0068859_10000729811 423
668 3300005617 Ga0068859_100074642 Ga0068859_1000746424 423
669 3300005618 Ga0068864_100019755 Ga0068864_1000197556 423
670 3300005719 Ga0068861_100065954 Ga0068861_1000659543 423
671 3300005843 Ga0068860_100015699 Ga0068860_1000156996 423
672 3300005843 Ga0068860_100065329 Ga0068860_1000653292 423
673 3300005844 Ga0068862_100096577 Ga0068862_1000965773 423
674 3300005844 Ga0068862_100126300 Ga0068862_1001263002 423
675 3300006931 Ga0097620_100005586 Ga0097620_1000055867 423
676 3300006931 Ga0097620_100006487 Ga0097620_10000648710 423
677 3300006931 Ga0097620_100007298 Ga0097620_10000729811 423
678 3300006931 Ga0097620_100074639 Ga0097620_1000746392 423
679 3300009093 Ga0105240_10159315 Ga0105240_101593152 423
680 3300009093 Ga0105240_10373403 Ga0105240_103734031 423
681 3300009094 Ga0111539_10004306 Ga0111539_1000430616 423
682 3300009094 Ga0111539_10178682 Ga0111539_101786822 423
683 3300009174 Ga0105241_10024092 Ga0105241_100240925 423
684 3300009545 Ga0105237_10060302 Ga0105237_100603022 423
685 3300009553 Ga0105249_10009062 Ga0105249_100090626 423
686 3300009553 Ga0105249_10030029 Ga0105249_100300297 423
687 3300010375 Ga0105239_10000014 Ga0105239_10000014243 423
688 3300010375 Ga0105239_10000130 Ga0105239_1000013018 423
689 3300010375 Ga0105239_10003284 Ga0105239_100032846 423
690 3300013100 Ga0157373_10003707 Ga0157373_100037078 423
691 3300013100 Ga0157373_10014856 Ga0157373_100148563 423
692 3300013100 Ga0157373_10109747 Ga0157373_101097471 423
693 3300013102 Ga0157371_10000297 Ga0157371_100002979 423
694 3300013102 Ga0157371_10001188 Ga0157371_1000118817 423
695 3300013102 Ga0157371_10003212 Ga0157371_1000321210 423
696 3300013102 Ga0157371_10003438 Ga0157371_100034388 423
697 3300013102 Ga0157371_10042739 Ga0157371_100427392 423
698 3300013104 Ga0157370_10001924 Ga0157370_1000192426 423
699 3300013104 Ga0157370_10003146 Ga0157370_1000314613 423
700 3300013104 Ga0157370_10052862 Ga0157370_100528623 423
701 3300013105 Ga0157369_10022459 Ga0157369_100224593 423
702 3300013105 Ga0157369_10036588 Ga0157369_100365885 423
703 3300013105 Ga0157369_10177434 Ga0157369_101774342 423
704 3300013105 Ga0157369_10196184 Ga0157369_101961842 423
705 3300013306 Ga0163162_10001569 Ga0163162_100015698 423
706 3300013307 Ga0157372_10000285 Ga0157372_1000028535 423
707 3300013307 Ga0157372_10043900 Ga0157372_100439005 423
708 3300013307 Ga0157372_10047960 Ga0157372_100479602 423
709 3300013307 Ga0157372_10084878 Ga0157372_100848781 423
710 3300013307 Ga0157372_10132140 Ga0157372_101321401 423
711 3300013307 Ga0157372_10160487 Ga0157372_101604872 423
712 3300013307 Ga0157372_10250220 Ga0157372_102502203 423
713 3300013307 Ga0157372_10339492 Ga0157372_103394921 423
714 3300013308 Ga0157375_10059901 Ga0157375_100599012 423
715 3300014745 Ga0157377_10000568 Ga0157377_1000056811 423
716 3300025231 Ga0207427_100071 Ga0207427_100071157 423
717 3300025233 Ga0209437_100021 Ga0209437_100021102 423
718 3300025261 Ga0209233_1000035 Ga0209233_1000035535 423
719 3300025261 Ga0209233_1006884 Ga0209233_10068844 423
720 3300025900 Ga0207710_10029491 Ga0207710_100294913 423
721 3300025904 Ga0207647_10001267 Ga0207647_100012673 423
722 3300025909 Ga0207705_10006828 Ga0207705_100068281 423
723 3300025909 Ga0207705_10072902 Ga0207705_100729023 423
724 3300025909 Ga0207705_10077395 Ga0207705_100773952 423
725 3300025909 Ga0207705_10080556 Ga0207705_100805562 423
726 3300025912 Ga0207707_10056886 Ga0207707_100568865 423
727 3300025912 Ga0207707_10104171 Ga0207707_101041713 423
728 3300025913 Ga0207695_10015794 Ga0207695_100157948 423
729 3300025913 Ga0207695_10276543 Ga0207695_102765431 423
730 3300025914 Ga0207671_10026985 Ga0207671_100269852 423
731 3300025917 Ga0207660_10112778 Ga0207660_101127782 423
732 3300025919 Ga0207657_10042288 Ga0207657_100422884 423
733 3300025919 Ga0207657_10181814 Ga0207657_101818141 423
734 3300025921 Ga0207652_10000013 Ga0207652_1000001316 423
735 3300025921 Ga0207652_10002930 Ga0207652_100029309 423
736 3300025921 Ga0207652_10071222 Ga0207652_100712221 423
737 3300025923 Ga0207681_10051655 Ga0207681_100516553 423
738 3300025932 Ga0207690_10008098 Ga0207690_100080983 423
739 3300025932 Ga0207690_10021979 Ga0207690_100219794 423
740 3300025933 Ga0207706_10110761 Ga0207706_101107611 423
741 3300025936 Ga0207670_10007267 Ga0207670_100072676 423
742 3300025942 Ga0207689_10047573 Ga0207689_100475735 423
743 3300025949 Ga0207667_10000408 Ga0207667_1000040822 423
744 3300025949 Ga0207667_10035585 Ga0207667_100355855 423
745 3300025949 Ga0207667_10048686 Ga0207667_100486861 423
746 3300025949 Ga0207667_10146963 Ga0207667_101469632 423
747 3300025949 Ga0207667_10188276 Ga0207667_101882761 423
748 3300025961 Ga0207712_10022755 Ga0207712_100227551 423
749 3300025961 Ga0207712_10062576 Ga0207712_100625761 423
750 3300025961 Ga0207712_10130103 Ga0207712_101301032 423
751 3300025972 Ga0207668_10058996 Ga0207668_100589962 423
752 3300026035 Ga0207703_10050224 Ga0207703_100502243 423
753 3300026041 Ga0207639_10044622 Ga0207639_100446223 423
754 3300026089 Ga0207648_10019544 Ga0207648_100195445 423
755 3300026095 Ga0207676_10011089 Ga0207676_100110896 423
756 3300026116 Ga0207674_10016248 Ga0207674_100162482 423
757 3300026116 Ga0207674_10125881 Ga0207674_101258811 423
758 3300026116 Ga0207674_10272125 Ga0207674_102721252 423
759 3300026118 Ga0207675_100003813 Ga0207675_10000381312 423
760 3300026118 Ga0207675_100053087 Ga0207675_1000530874 423
761 3300028380 Ga0268265_10091723 Ga0268265_100917232 423
762 3300028381 Ga0268264_10049632 Ga0268264_100496322 423
763 3300028794 Ga0307515_10000001 Ga0307515_100000011424 423
764 3300028800 Ga0265338_10016709 Ga0265338_100167093 423
765 3300030742 Ga0316183_1153674 Ga0316183_115367432 423
766 3300030744 Ga0316181_1153314 Ga0316181_11533143 423
767 3300031251 Ga0265327_10000421 Ga0265327_1000042135 423
768 3300037312 Ga0395899_0000528 Ga0395899_0000528_23104_24426 423
769 3300037312 Ga0395899_0049099 Ga0395899_0049099_1079_2401 423
770 3300037312 Ga0395899_0061440 Ga0395899_0061440_1129_2451 423
771 3300037312 Ga0395899_0076748 Ga0395899_0076748_715_2037 423
772 3300037418 Ga0395900_0002692 Ga0395900_0002692_5264_6586 423
773 3300037418 Ga0395900_0006330 Ga0395900_0006330_10119_11441 423
774 3300037418 Ga0395900_0126686 Ga0395900_0126686_686_2008 423
775 3300037418 Ga0395900_0196437 Ga0395900_0196437_707_2029 423
776 3300037418 Ga0395900_0201811 Ga0395900_0201811_10_1332 423
777 3300037466 Ga0395898_0000595 Ga0395898_0000595_32363_33685 423
778 3300037466 Ga0395898_0052812 Ga0395898_0052812_2466_3788 423
779 3300037466 Ga0395898_0053589 Ga0395898_0053589_2166_3488 423
780 3300037466 Ga0395898_0070019 Ga0395898_0070019_1910_3235 423
781 3300037471 Ga0395905_0171511 Ga0395905_0171511_399_1721 423
782 3300038443 Ga0395901_0005353 Ga0395901_0005353_7433_8755 423
783 3300038443 Ga0395901_0036270 Ga0395901_0036270_777_2099 423
784 3300042435 Ga0439434_0030071 Ga0439434_0030071_49_1374 423
785 3300046462 Ga0495651_0101376 Ga0495651_0101376_665_1990 423
786 3300047472 Ga0495686_0000614 Ga0495686_0000614_29484_30809 423
787 3300049569 Ga0501032_0000901 Ga0501032_0000901_13382_14710 423
788 3300049570 Ga0501033_0077996 Ga0501033_0077996_954_2276 423
789 3300049570 Ga0501033_0100007 Ga0501033_0100007_356_1678 423
790 3300049571 Ga0501034_0000115 Ga0501034_0000115_140226_141551 423
791 3300049571 Ga0501034_0036705 Ga0501034_0036705_446_1774 423
792 3300049572 Ga0501036_0013979 Ga0501036_0013979_155_1483 423
793 3300049573 Ga0501037_0060144 Ga0501037_0060144_1367_2695 423
794 3300049579 Ga0501043_0077336 Ga0501043_0077336_905_2233 423
795 3300049583 Ga0501067_0059916 Ga0501067_0059916_664_1992 423
796 3300049586 Ga0501070_0059458 Ga0501070_0059458_205_1527 423
797 3300049589 Ga0501073_0009472 Ga0501073_0009472_949_2277 423
798 3300049590 Ga0501074_0009732 Ga0501074_0009732_778_2106 423
799 3300049742 Ga0501080_0017887 Ga0501080_0017887_4675_6003 423
800 3300049822 Ga0501035_0138244 Ga0501035_0138244_276_1604 423
801 3300049823 Ga0501044_0005380 Ga0501044_0005380_1674_3002 423
802 3300053080 Ga0500635_0005068 Ga0500635_0005068_207_1532 423
803 3300053156 Ga0500622_0005024 Ga0500622_0005024_3101_4426 423
804 2162886007 SwRhRL2b_contig_1663050 SwRhRL2b_0644.00005810 424
805 3300001990 JGI24737J22298_10000150 JGI24737J22298_100001507 424
806 3300002067 JGI24735J21928_10000024 JGI24735J21928_1000002489 424
807 3300005288 Ga0065714_10069509 Ga0065714_100695093 424
808 3300005289 Ga0065704_10070140 Ga0065704_10070140362 424
809 3300005329 Ga0070683_100007919 Ga0070683_1000079193 424
810 3300005366 Ga0070659_100000644 Ga0070659_10000064415 424
811 3300005563 Ga0068855_100106589 Ga0068855_1001065892 424
812 3300005563 Ga0068855_100255295 Ga0068855_1002552951 424
813 3300005578 Ga0068854_100013446 Ga0068854_1000134461 424
814 3300009093 Ga0105240_10000073 Ga0105240_10000073134 424
815 3300009093 Ga0105240_10000083 Ga0105240_1000008339 424
816 3300009093 Ga0105240_10159676 Ga0105240_101596763 424
817 3300009174 Ga0105241_10070958 Ga0105241_100709582 424
818 3300009545 Ga0105237_10000138 Ga0105237_1000013882 424
819 3300010375 Ga0105239_10000558 Ga0105239_1000055817 424
820 3300010375 Ga0105239_10000708 Ga0105239_1000070823 424
821 3300010375 Ga0105239_10019537 Ga0105239_100195376 424
822 3300013100 Ga0157373_10000150 Ga0157373_1000015028 424
823 3300013306 Ga0163162_10001312 Ga0163162_1000131211 424
824 3300013307 Ga0157372_10002016 Ga0157372_100020163 424
825 3300025233 Ga0209437_100124 Ga0209437_10012487 424
826 3300025250 Ga0209026_1000282 Ga0209026_10002827 424
827 3300025250 Ga0209026_1001733 Ga0209026_10017336 424
828 3300025250 Ga0209026_1004176 Ga0209026_10041765 424
829 3300025904 Ga0207647_10005091 Ga0207647_1000509114 424
830 3300025913 Ga0207695_10000127 Ga0207695_1000012738 424
831 3300025913 Ga0207695_10000151 Ga0207695_10000151141 424
832 3300025914 Ga0207671_10002935 Ga0207671_1000293510 424
833 3300025914 Ga0207671_10008095 Ga0207671_100080956 424
834 3300025932 Ga0207690_10000049 Ga0207690_1000004994 424
835 3300025944 Ga0207661_10030067 Ga0207661_100300672 424
836 3300025949 Ga0207667_10134709 Ga0207667_101347093 424
837 3300025981 Ga0207640_10058226 Ga0207640_100582261 424
838 3300028379 Ga0268266_10004286 Ga0268266_1000428611 424
839 3300028794 Ga0307515_10000224 Ga0307515_1000022414 424
840 3300028794 Ga0307515_10001268 Ga0307515_1000126822 424
841 3300028800 Ga0265338_10003003 Ga0265338_1000300310 424
842 3300031711 Ga0265314_10109480 Ga0265314_101094802 424
843 3300033179 Ga0307507_10000097 Ga0307507_10000097105 424
844 3300037312 Ga0395899_0000017 Ga0395899_0000017_374421_375749 424
845 3300044712 Ga0453684_0001680 Ga0453684_0001680_14985_16319 424
846 3300044712 Ga0453684_0006862 Ga0453684_0006862_15003_16337 424
847 3300045051 Ga0451576_0036766 Ga0451576_0036766_3218_4558 424
848 3300046471 Ga0495650_0000095 Ga0495650_0000095_200508_201836 424
849 3300046492 Ga0495585_0000034 Ga0495585_0000034_50251_51579 424
850 3300046507 Ga0495606_0000009 Ga0495606_0000009_49160_50488 424
851 3300046507 Ga0495606_0008253 Ga0495606_0008253_7298_8626 424
852 3300046512 Ga0495610_0007711 Ga0495610_0007711_4312_5640 424
853 3300046513 Ga0495616_0001155 Ga0495616_0001155_17273_18601 424
854 3300046524 Ga0495648_0008498 Ga0495648_0008498_1800_3128 424
855 3300046524 Ga0495648_0073901 Ga0495648_0073901_542_1870 424
856 3300046538 Ga0495609_0003375 Ga0495609_0003375_5061_6389 424
857 3300046557 Ga0495622_0041305 Ga0495622_0041305_336_1664 424
858 3300046558 Ga0495633_0000174 Ga0495633_0000174_78322_79650 424
859 3300046558 Ga0495633_0010277 Ga0495633_0010277_551_1879 424
860 3300046616 Ga0495668_0000017 Ga0495668_0000017_109012_110340 424
861 3300046616 Ga0495668_0050960 Ga0495668_0050960_942_2270 424
862 3300046660 Ga0495625_0000007 Ga0495625_0000007_282598_283926 424
863 3300046660 Ga0495625_0000155 Ga0495625_0000155_38526_39854 424
864 3300046660 Ga0495625_0000761 Ga0495625_0000761_31351_32679 424
865 3300046660 Ga0495625_0019255 Ga0495625_0019255_1526_2854 424
866 3300046660 Ga0495625_0050589 Ga0495625_0050589_1631_2959 424
867 3300046665 Ga0495661_0004014 Ga0495661_0004014_4629_5957 424
868 3300046665 Ga0495661_0012459 Ga0495661_0012459_208_1536 424
869 3300046694 Ga0495649_0000007 Ga0495649_0000007_168073_169401 424
870 3300046810 Ga0495660_0026059 Ga0495660_0026059_201_1529 424
871 3300047443 Ga0495687_003549 Ga0495687_003549_5663_6991 424
872 3300047472 Ga0495686_0001562 Ga0495686_0001562_21096_22424 424
873 3300047472 Ga0495686_0071182 Ga0495686_0071182_784_2112 424
874 3300050493 nmdc:mga0k408_120_c1 nmdc:mga0k408_120_c1_11907_13235 424
875 3300050493 nmdc:mga0k408_429_c1 nmdc:mga0k408_429_c1_16105_17433 424
876 3300053122 Ga0500608_015160 Ga0500608_015160_1926_3254 424
877 3300053125 Ga0500618_000148 Ga0500618_000148_20386_21714 424
878 3300053157 Ga0500624_000183 Ga0500624_000183_7206_8534 424

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00448

SRP54

SRP54-type protein, GTPase domain

99

294

0.99

PF02881

SRP54_N

SRP54-type protein, helical bundle domain

5

82

0.96

PF02978

SRP_SPB

Signal peptide binding domain

325

421

0.9

PF06414

Zeta_toxin

Zeta toxin

84

216

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o9f-assembly1.cif.gz_A bacillus subtilis ffh in complex with ppgpp 0.9613 2 297
7o9f-assembly3.cif.gz_C bacillus subtilis ffh in complex with ppgpp 0.9574 2 297
2ng1-assembly1.cif.gz_A n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus 0.9464 3 295
7o9f-assembly1.cif.gz_A bacillus subtilis ffh in complex with ppgpp 0.9457 2 297
3zn8-assembly1.cif.gz_A structural basis of signal sequence surveillance and selection by the srp-sr complex 0.9448 4 295
ID Description Score Start End Superfamily
af_P9WGD9_219_421_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9558 97 294 3.40.50.300
5l3rC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9476 89 282 3.40.50.300
af_A0A0R0L4Y4_128_288_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9471 98 238 3.40.50.300
af_Q4DKX0_351_574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9443 98 294 3.40.50.300
5l3rC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9381 89 282 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A349HVE3-F1-model_v4 Signal recognition particle protein 0.9768 117 297 GO:0003924
GO:0005525
GO:0006614
GO:0048500
AF-A0A3D2J7D6-F1-model_v4 Signal recognition particle protein 0.9726 82 297 GO:0003924
GO:0005525
GO:0006614
GO:0016887
GO:0048500
AF-A0A6N2LJV5-F1-model_v4 SRP54-type proteins GTP-binding domain-containing protein 0.9668 42 275 GO:0003924
GO:0005525
GO:0006614
GO:0016887
GO:0048500
AF-A0A7J3QH51-F1-model_v4 Signal recognition particle-docking protein FtsY 0.9659 129 294 GO:0003924
GO:0005047
GO:0005525
GO:0005886
GO:0006614
AF-G5GA32-F1-model_v4 Signal recognition particle SRP54 helical bundle domain-containing protein 0.9648 1 126 GO:0003924
GO:0005525
GO:0006614
GO:0048500

Feature Viewer

pLDDT pTM Quality
76.11 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map