F484430
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 878 | 352 | 848 | 432 |
Family's Representative Sequence
| Representative Sequence | 3300044842|Ga0466957_0000577|Ga0466957_0000577_10390_11703 |
| Length | 423 |
| Sequence | MFENLTDRLESAFKQIKGEGRITELNIAATVKDIRRALVDADVNYKIAKEFTDKVKDQALGHKVLNAVSPGQLMVKIVKDELAELMGGSESELNAKGSPAVILIAGLQGSGKTTFSAKLANFLKAKRLSPLLVAADIYRPAAIDQLKVLGEQIQVDVYSEPENKNAVEIASNAIKDARSKNKNVVIIDTAGRLAIDEAMMTEVANVKAAVNPQEILFVVDSMTGQDAVNTAKAFNDRLDFTGVVLTKLDGDTRGGAALSIKYTVQKPIKFVSSGEKLDTLDVFYPERMAQRILGMGDITTLVEKAQAQFDEEQARKLEKKIRKNQFNFEDFKQQLEQIKKMGNIKDLLGMIPGVGKAIKDIDISDDAFKGIEAMINSMTPLERTDPDVIDQRRKLRIAKGAGKDIGEVNAFLKQFDGRMGMKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2585428061 | Chryseobacterium sp. CF356 | Isolate | Rhizosphere |
| 3 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 4 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 5 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 6 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 7 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 8 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 9 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 10 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 11 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 12 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 13 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 14 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 15 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 16 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 17 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 18 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 19 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 20 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 21 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 22 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 23 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 24 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 25 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 26 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 27 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 28 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 29 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 30 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 31 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 32 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 33 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 34 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 35 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 36 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 37 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 38 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 39 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 40 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 41 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 42 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 43 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 44 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 46 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 47 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 48 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 49 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 50 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 51 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 52 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 53 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 54 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 55 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 61 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 65 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 67 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 76 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 83 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 88 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 93 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 95 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 96 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 97 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 99 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 100 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 101 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 102 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 103 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 104 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 105 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 106 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 107 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 108 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 109 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 110 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 112 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 113 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 114 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 115 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 116 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 117 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 144 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 148 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 150 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 155 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 156 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 214 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 218 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 219 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 221 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 222 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 223 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 224 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 225 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 226 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 227 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 228 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 229 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 230 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 232 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 233 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 234 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 235 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 236 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 237 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 238 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 242 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 243 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 244 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 245 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 246 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 247 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 248 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 249 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 250 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 251 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 252 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 253 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 254 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 255 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 256 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 257 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 258 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 259 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 260 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 261 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 262 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 298 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 299 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 300 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 301 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 302 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 303 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 304 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 305 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 320 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 324 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 325 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 326 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 333 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 334 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 335 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 336 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 337 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 338 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 339 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 341 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 342 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 343 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 344 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 345 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 346 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 347 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 348 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 349 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 351 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.58 |
| Metatranscriptomes | 0 |
| Isolates | 3.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.52 |
| Nodule | 0 |
| Rhizoplane | 0.34 |
| Rhizosphere | 85.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1663050 | 2162886007 | Bacteria | 482194 |
| 2 | SwRhRL2b_contig_3910478 | 2162886007 | Bacteria | 17291 |
| 3 | JGI24739J22299_10000776 | 3300001989 | Bacteria | 11640 |
| 4 | JGI24737J22298_10000150 | 3300001990 | Bacteria | 21826 |
| 5 | JGI24735J21928_10000024 | 3300002067 | Bacteria | 95227 |
| 6 | JGI25162J39368_1001130 | 3300002737 | Bacteria | 16055 |
| 7 | JGI25154J39366_1000021 | 3300002738 | Bacteria | 221559 |
| 8 | JGI25164J39214_1001844 | 3300002772 | Bacteria | 4004 |
| 9 | JGI25165J46597_1001512 | 3300003214 | Bacteria | 11767 |
| 10 | JGI25153J46596_10003171 | 3300003215 | Bacteria | 9266 |
| 11 | rootH1_10035980 | 3300003316 | Bacteria | 1495 |
| 12 | rootH2_10002788 | 3300003320 | Bacteria | 40387 |
| 13 | rootH2_10039222 | 3300003320 | Bacteria | 5002 |
| 14 | rootL2_10053828 | 3300003322 | Bacteria | 4732 |
| 15 | rootL2_10212212 | 3300003322 | Bacteria | 1691 |
| 16 | rootH1_10007236 | 3300003323 | Bacteria | 15279 |
| 17 | rootH1_10038130 | 3300003323 | Bacteria | 3880 |
| 18 | JGI25160J50197_1014100 | 3300003354 | Bacteria | 2689 |
| 19 | Ga0055535_1001800 | 3300003761 | Bacteria | 9378 |
| 20 | Ga0055542_1005835 | 3300003762 | Bacteria | 2708 |
| 21 | Ga0055526_1032839 | 3300003771 | Bacteria | 1455 |
| 22 | Ga0055528_1004767 | 3300003790 | Bacteria | 6457 |
| 23 | Ga0055530_10003144 | 3300003791 | Bacteria | 9736 |
| 24 | Ga0055531_10000015 | 3300003794 | Bacteria | 182104 |
| 25 | Ga0055531_10019966 | 3300003794 | Bacteria | 2677 |
| 26 | Ga0065165_1000109 | 3300005262 | Bacteria | 137370 |
| 27 | Ga0065165_1008080 | 3300005262 | Bacteria | 5020 |
| 28 | Ga0065714_10003604 | 3300005288 | Bacteria | 18449 |
| 29 | Ga0065714_10069509 | 3300005288 | Bacteria | 4197 |
| 30 | Ga0065704_10000317 | 3300005289 | Bacteria | 33898 |
| 31 | Ga0065704_10070140 | 3300005289 | Bacteria | 482257 |
| 32 | Ga0065704_10074432 | 3300005289 | Bacteria | 6274 |
| 33 | Ga0065704_10079977 | 3300005289 | Bacteria | 4012 |
| 34 | Ga0065712_10000661 | 3300005290 | Bacteria | 11127 |
| 35 | Ga0065712_10003409 | 3300005290 | Bacteria | 3754 |
| 36 | Ga0065712_10017029 | 3300005290 | Bacteria | 3119 |
| 37 | Ga0065707_10007629 | 3300005295 | Bacteria | 4435 |
| 38 | Ga0065707_10142526 | 3300005295 | Bacteria | 1754 |
| 39 | Ga0070658_10019663 | 3300005327 | Bacteria | 5407 |
| 40 | Ga0070658_10084047 | 3300005327 | Bacteria | 2617 |
| 41 | Ga0070658_10139003 | 3300005327 | Bacteria | 2028 |
| 42 | Ga0070658_10170445 | 3300005327 | Bacteria | 1828 |
| 43 | Ga0070676_10018602 | 3300005328 | Bacteria | 3852 |
| 44 | Ga0070683_100000468 | 3300005329 | Bacteria | 28362 |
| 45 | Ga0070683_100002836 | 3300005329 | Bacteria | 13876 |
| 46 | Ga0070683_100007919 | 3300005329 | Bacteria | 9009 |
| 47 | Ga0070683_100099234 | 3300005329 | Bacteria | 2741 |
| 48 | Ga0070683_100119074 | 3300005329 | Bacteria | 2494 |
| 49 | Ga0070670_100005343 | 3300005331 | Bacteria | 10833 |
| 50 | Ga0070670_100019418 | 3300005331 | Bacteria | 5832 |
| 51 | Ga0070670_100123883 | 3300005331 | Bacteria | 2230 |
| 52 | Ga0070670_100138870 | 3300005331 | Bacteria | 2101 |
| 53 | Ga0070670_100184203 | 3300005331 | Bacteria | 1813 |
| 54 | Ga0070670_100185747 | 3300005331 | Unclassified | 1805 |
| 55 | Ga0070677_10018936 | 3300005333 | Unclassified | 2487 |
| 56 | Ga0068869_100003551 | 3300005334 | Bacteria | 9566 |
| 57 | Ga0068869_100009768 | 3300005334 | Bacteria | 6232 |
| 58 | Ga0068869_100017086 | 3300005334 | Bacteria | 4909 |
| 59 | Ga0068869_100044144 | 3300005334 | Bacteria | 3205 |
| 60 | Ga0070666_10000038 | 3300005335 | Bacteria | 115799 |
| 61 | Ga0070666_10004991 | 3300005335 | Bacteria | 8117 |
| 62 | Ga0070666_10017523 | 3300005335 | Bacteria | 4592 |
| 63 | Ga0070680_100000107 | 3300005336 | Bacteria | 48364 |
| 64 | Ga0070680_100004673 | 3300005336 | Bacteria | 10298 |
| 65 | Ga0070680_100059656 | 3300005336 | Bacteria | 3122 |
| 66 | Ga0070680_100062464 | 3300005336 | Bacteria | 3050 |
| 67 | Ga0070680_100086978 | 3300005336 | Bacteria | 2584 |
| 68 | Ga0070682_100000129 | 3300005337 | Bacteria | 64098 |
| 69 | Ga0070682_100004790 | 3300005337 | Bacteria | 7518 |
| 70 | Ga0070682_100079749 | 3300005337 | Bacteria | 2115 |
| 71 | Ga0068868_100052245 | 3300005338 | Bacteria | 3218 |
| 72 | Ga0068868_100077038 | 3300005338 | Bacteria | 2667 |
| 73 | Ga0068868_100088249 | 3300005338 | Bacteria | 2496 |
| 74 | Ga0070660_100017754 | 3300005339 | Bacteria | 5190 |
| 75 | Ga0070660_100095883 | 3300005339 | Bacteria | 2345 |
| 76 | Ga0070689_100067418 | 3300005340 | Bacteria | 2790 |
| 77 | Ga0070689_100166102 | 3300005340 | Bacteria | 1786 |
| 78 | Ga0070691_10001904 | 3300005341 | Bacteria | 9149 |
| 79 | Ga0070687_100052398 | 3300005343 | Bacteria | 2118 |
| 80 | Ga0070661_100000179 | 3300005344 | Bacteria | 52306 |
| 81 | Ga0070661_100003133 | 3300005344 | Bacteria | 11376 |
| 82 | Ga0070668_100113087 | 3300005347 | Bacteria | 2162 |
| 83 | Ga0070669_100004014 | 3300005353 | Bacteria | 10642 |
| 84 | Ga0070669_100052457 | 3300005353 | Bacteria | 2984 |
| 85 | Ga0070675_100004112 | 3300005354 | Bacteria | 11049 |
| 86 | Ga0070675_100020576 | 3300005354 | Bacteria | 5264 |
| 87 | Ga0070675_100049081 | 3300005354 | Bacteria | 3463 |
| 88 | Ga0070671_100114425 | 3300005355 | Bacteria | 2268 |
| 89 | Ga0070673_100008952 | 3300005364 | Bacteria | 6693 |
| 90 | Ga0070673_100223552 | 3300005364 | Bacteria | 1630 |
| 91 | Ga0070688_100045498 | 3300005365 | Bacteria | 2712 |
| 92 | Ga0070688_100052769 | 3300005365 | Bacteria | 2541 |
| 93 | Ga0070659_100000644 | 3300005366 | Bacteria | 25506 |
| 94 | Ga0070659_100031741 | 3300005366 | Bacteria | 4093 |
| 95 | Ga0070659_100057148 | 3300005366 | Bacteria | 3076 |
| 96 | Ga0070659_100129852 | 3300005366 | Bacteria | 2046 |
| 97 | Ga0070667_100002640 | 3300005367 | Bacteria | 15524 |
| 98 | Ga0070667_100017912 | 3300005367 | Bacteria | 5871 |
| 99 | Ga0070667_100037416 | 3300005367 | Bacteria | 4068 |
| 100 | Ga0070663_100076544 | 3300005455 | Bacteria | 2447 |
| 101 | Ga0070678_100014866 | 3300005456 | Bacteria | 4927 |
| 102 | Ga0070678_100099416 | 3300005456 | Bacteria | 2251 |
| 103 | Ga0070662_100036667 | 3300005457 | Bacteria | 3471 |
| 104 | Ga0070681_10008323 | 3300005458 | Bacteria | 10161 |
| 105 | Ga0070681_10018750 | 3300005458 | Bacteria | 6925 |
| 106 | Ga0070681_10079621 | 3300005458 | Bacteria | 3233 |
| 107 | Ga0068867_100011635 | 3300005459 | Bacteria | 6212 |
| 108 | Ga0068867_100022600 | 3300005459 | Bacteria | 4496 |
| 109 | Ga0068867_100026385 | 3300005459 | Bacteria | 4171 |
| 110 | Ga0068867_100033978 | 3300005459 | Bacteria | 3696 |
| 111 | Ga0068867_100049645 | 3300005459 | Bacteria | 3090 |
| 112 | Ga0068867_100146902 | 3300005459 | Bacteria | 1849 |
| 113 | Ga0068867_100175174 | 3300005459 | Bacteria | 1702 |
| 114 | Ga0070685_10014741 | 3300005466 | Bacteria | 4145 |
| 115 | Ga0070698_100000267 | 3300005471 | Bacteria | 52849 |
| 116 | Ga0070698_100056165 | 3300005471 | Bacteria | 3990 |
| 117 | Ga0070679_100000158 | 3300005530 | Bacteria | 54895 |
| 118 | Ga0070679_100004315 | 3300005530 | Bacteria | 13126 |
| 119 | Ga0070679_100004867 | 3300005530 | Bacteria | 12395 |
| 120 | Ga0070679_100027513 | 3300005530 | Bacteria | 5597 |
| 121 | Ga0070679_100056287 | 3300005530 | Bacteria | 3918 |
| 122 | Ga0070679_100056404 | 3300005530 | Bacteria | 3914 |
| 123 | Ga0070679_100107718 | 3300005530 | Bacteria | 2772 |
| 124 | Ga0070679_100270164 | 3300005530 | Bacteria | 1654 |
| 125 | Ga0070684_100002591 | 3300005535 | Bacteria | 13355 |
| 126 | Ga0070684_100015367 | 3300005535 | Bacteria | 6233 |
| 127 | Ga0070684_100054702 | 3300005535 | Bacteria | 3477 |
| 128 | Ga0068853_100005569 | 3300005539 | Bacteria | 9886 |
| 129 | Ga0068853_100006052 | 3300005539 | Bacteria | 9572 |
| 130 | Ga0068853_100006293 | 3300005539 | Bacteria | 9416 |
| 131 | Ga0068853_100012384 | 3300005539 | Bacteria | 6939 |
| 132 | Ga0068853_100031729 | 3300005539 | Bacteria | 4469 |
| 133 | Ga0068853_100042310 | 3300005539 | Bacteria | 3895 |
| 134 | Ga0068853_100177983 | 3300005539 | Bacteria | 1928 |
| 135 | Ga0068853_100188671 | 3300005539 | Bacteria | 1872 |
| 136 | Ga0068853_100205012 | 3300005539 | Bacteria | 1796 |
| 137 | Ga0070672_100035517 | 3300005543 | Bacteria | 3789 |
| 138 | Ga0070672_100066688 | 3300005543 | Bacteria | 2850 |
| 139 | Ga0070686_100032749 | 3300005544 | Bacteria | 3189 |
| 140 | Ga0070686_100045558 | 3300005544 | Bacteria | 2763 |
| 141 | Ga0070693_100001913 | 3300005547 | Bacteria | 9522 |
| 142 | Ga0070665_100000094 | 3300005548 | Bacteria | 171072 |
| 143 | Ga0070665_100061303 | 3300005548 | Bacteria | 3770 |
| 144 | Ga0070665_100307857 | 3300005548 | Bacteria | 1588 |
| 145 | Ga0068855_100000145 | 3300005563 | Bacteria | 91452 |
| 146 | Ga0068855_100000489 | 3300005563 | Bacteria | 48884 |
| 147 | Ga0068855_100001620 | 3300005563 | Bacteria | 28236 |
| 148 | Ga0068855_100017041 | 3300005563 | Bacteria | 8739 |
| 149 | Ga0068855_100100872 | 3300005563 | Bacteria | 3323 |
| 150 | Ga0068855_100106589 | 3300005563 | Bacteria | 3221 |
| 151 | Ga0068855_100107195 | 3300005563 | Bacteria | 3210 |
| 152 | Ga0068855_100152798 | 3300005563 | Bacteria | 2624 |
| 153 | Ga0068855_100155294 | 3300005563 | Bacteria | 2600 |
| 154 | Ga0068855_100255295 | 3300005563 | Bacteria | 1954 |
| 155 | Ga0070664_100000140 | 3300005564 | Bacteria | 49126 |
| 156 | Ga0070664_100020306 | 3300005564 | Bacteria | 5469 |
| 157 | Ga0070664_100025386 | 3300005564 | Bacteria | 4911 |
| 158 | Ga0070664_100076654 | 3300005564 | Bacteria | 2873 |
| 159 | Ga0070664_100167278 | 3300005564 | Bacteria | 1949 |
| 160 | Ga0068857_100005598 | 3300005577 | Bacteria | 10734 |
| 161 | Ga0068857_100014523 | 3300005577 | Bacteria | 6869 |
| 162 | Ga0068857_100023904 | 3300005577 | Bacteria | 5379 |
| 163 | Ga0068857_100317976 | 3300005577 | Bacteria | 1437 |
| 164 | Ga0068854_100007508 | 3300005578 | Bacteria | 6967 |
| 165 | Ga0068854_100013446 | 3300005578 | Bacteria | 5374 |
| 166 | Ga0068854_100051058 | 3300005578 | Bacteria | 2962 |
| 167 | Ga0068854_100072252 | 3300005578 | Bacteria | 2526 |
| 168 | Ga0068856_100036347 | 3300005614 | Bacteria | 4830 |
| 169 | Ga0068856_100045155 | 3300005614 | Bacteria | 4337 |
| 170 | Ga0068856_100046347 | 3300005614 | Bacteria | 4282 |
| 171 | Ga0068856_100151090 | 3300005614 | Bacteria | 2331 |
| 172 | Ga0070702_100007104 | 3300005615 | Bacteria | 5345 |
| 173 | Ga0068852_100001659 | 3300005616 | Bacteria | 15178 |
| 174 | Ga0068852_100013323 | 3300005616 | Bacteria | 6291 |
| 175 | Ga0068852_100049177 | 3300005616 | Bacteria | 3606 |
| 176 | Ga0068852_100071704 | 3300005616 | Bacteria | 3043 |
| 177 | Ga0068859_100000007 | 3300005617 | Bacteria | 390070 |
| 178 | Ga0068859_100005587 | 3300005617 | Bacteria | 12808 |
| 179 | Ga0068859_100005939 | 3300005617 | Bacteria | 12395 |
| 180 | Ga0068859_100006487 | 3300005617 | Bacteria | 11875 |
| 181 | Ga0068859_100007298 | 3300005617 | Bacteria | 11213 |
| 182 | Ga0068859_100031009 | 3300005617 | Bacteria | 5366 |
| 183 | Ga0068859_100074642 | 3300005617 | Bacteria | 3430 |
| 184 | Ga0068859_100076094 | 3300005617 | Bacteria | 3397 |
| 185 | Ga0068859_100165504 | 3300005617 | Bacteria | 2291 |
| 186 | Ga0068859_100339039 | 3300005617 | Bacteria | 1597 |
| 187 | Ga0068864_100000685 | 3300005618 | Bacteria | 28427 |
| 188 | Ga0068864_100019755 | 3300005618 | Bacteria | 5634 |
| 189 | Ga0068864_100061903 | 3300005618 | Bacteria | 3242 |
| 190 | Ga0068866_10037107 | 3300005718 | Bacteria | 2392 |
| 191 | Ga0068861_100019358 | 3300005719 | Bacteria | 4862 |
| 192 | Ga0068861_100061537 | 3300005719 | Bacteria | 2881 |
| 193 | Ga0068861_100065954 | 3300005719 | Bacteria | 2790 |
| 194 | Ga0068861_100179625 | 3300005719 | Bacteria | 1760 |
| 195 | Ga0068851_10011250 | 3300005834 | Bacteria | 4194 |
| 196 | Ga0068851_10014891 | 3300005834 | Bacteria | 3699 |
| 197 | Ga0068863_100018440 | 3300005841 | Bacteria | 6679 |
| 198 | Ga0068863_100029101 | 3300005841 | Bacteria | 5274 |
| 199 | Ga0068863_100073091 | 3300005841 | Bacteria | 3244 |
| 200 | Ga0068858_100003163 | 3300005842 | Bacteria | 16480 |
| 201 | Ga0068858_100041888 | 3300005842 | Bacteria | 4245 |
| 202 | Ga0068858_100082551 | 3300005842 | Bacteria | 2988 |
| 203 | Ga0068860_100001511 | 3300005843 | Bacteria | 25059 |
| 204 | Ga0068860_100003681 | 3300005843 | Bacteria | 15776 |
| 205 | Ga0068860_100007061 | 3300005843 | Bacteria | 11243 |
| 206 | Ga0068860_100012160 | 3300005843 | Bacteria | 8479 |
| 207 | Ga0068860_100014136 | 3300005843 | Bacteria | 7829 |
| 208 | Ga0068860_100015699 | 3300005843 | Bacteria | 7395 |
| 209 | Ga0068860_100065329 | 3300005843 | Bacteria | 3455 |
| 210 | Ga0068860_100094546 | 3300005843 | Bacteria | 2849 |
| 211 | Ga0068860_100248020 | 3300005843 | Unclassified | 1733 |
| 212 | Ga0068862_100085605 | 3300005844 | Bacteria | 2739 |
| 213 | Ga0068862_100096577 | 3300005844 | Unclassified | 2579 |
| 214 | Ga0068862_100126300 | 3300005844 | Bacteria | 2258 |
| 215 | Ga0081539_10076014 | 3300005985 | Bacteria | 1781 |
| 216 | Ga0075366_10004374 | 3300006195 | Bacteria | 7580 |
| 217 | Ga0075366_10009009 | 3300006195 | Bacteria | 5566 |
| 218 | Ga0097621_100003509 | 3300006237 | Bacteria | 10830 |
| 219 | Ga0097621_100053413 | 3300006237 | Bacteria | 3294 |
| 220 | Ga0097621_100054450 | 3300006237 | Bacteria | 3263 |
| 221 | Ga0097621_100060893 | 3300006237 | Bacteria | 3095 |
| 222 | Ga0097621_100077188 | 3300006237 | Bacteria | 2765 |
| 223 | Ga0097621_100084224 | 3300006237 | Bacteria | 2650 |
| 224 | Ga0075370_10064390 | 3300006353 | Bacteria | 2091 |
| 225 | Ga0068871_100003013 | 3300006358 | Bacteria | 11561 |
| 226 | Ga0068871_100005842 | 3300006358 | Bacteria | 8651 |
| 227 | Ga0068871_100113868 | 3300006358 | Bacteria | 2278 |
| 228 | Ga0068871_100174091 | 3300006358 | Bacteria | 1846 |
| 229 | Ga0075428_100003257 | 3300006844 | Bacteria | 17776 |
| 230 | Ga0075428_100019714 | 3300006844 | Bacteria | 7463 |
| 231 | Ga0075428_100216185 | 3300006844 | Bacteria | 2071 |
| 232 | Ga0075434_100052957 | 3300006871 | Bacteria | 4033 |
| 233 | Ga0075429_100015711 | 3300006880 | Bacteria | 6559 |
| 234 | Ga0068865_100002580 | 3300006881 | Bacteria | 10756 |
| 235 | Ga0068865_100059325 | 3300006881 | Bacteria | 2675 |
| 236 | Ga0068865_100088202 | 3300006881 | Bacteria | 2244 |
| 237 | Ga0068865_100108219 | 3300006881 | Unclassified | 2046 |
| 238 | Ga0097620_100000007 | 3300006931 | Bacteria | 390070 |
| 239 | Ga0097620_100005586 | 3300006931 | Bacteria | 12808 |
| 240 | Ga0097620_100005939 | 3300006931 | Bacteria | 12395 |
| 241 | Ga0097620_100006487 | 3300006931 | Bacteria | 11875 |
| 242 | Ga0097620_100007298 | 3300006931 | Bacteria | 11213 |
| 243 | Ga0097620_100031009 | 3300006931 | Bacteria | 5366 |
| 244 | Ga0097620_100074639 | 3300006931 | Bacteria | 3430 |
| 245 | Ga0097620_100076089 | 3300006931 | Bacteria | 3397 |
| 246 | Ga0097620_100165510 | 3300006931 | Bacteria | 2291 |
| 247 | Ga0097620_100339031 | 3300006931 | Bacteria | 1597 |
| 248 | Ga0105250_10022248 | 3300009092 | Bacteria | 2557 |
| 249 | Ga0105240_10000073 | 3300009093 | Bacteria | 201032 |
| 250 | Ga0105240_10000083 | 3300009093 | Bacteria | 192934 |
| 251 | Ga0105240_10000414 | 3300009093 | Bacteria | 79229 |
| 252 | Ga0105240_10002372 | 3300009093 | Bacteria | 30357 |
| 253 | Ga0105240_10022086 | 3300009093 | Bacteria | 8445 |
| 254 | Ga0105240_10036535 | 3300009093 | Bacteria | 6316 |
| 255 | Ga0105240_10038947 | 3300009093 | Bacteria | 6093 |
| 256 | Ga0105240_10042144 | 3300009093 | Bacteria | 5819 |
| 257 | Ga0105240_10116448 | 3300009093 | Bacteria | 3224 |
| 258 | Ga0105240_10140154 | 3300009093 | Bacteria | 2892 |
| 259 | Ga0105240_10159315 | 3300009093 | Bacteria | 2683 |
| 260 | Ga0105240_10159676 | 3300009093 | Bacteria | 2679 |
| 261 | Ga0105240_10321503 | 3300009093 | Bacteria | 1764 |
| 262 | Ga0105240_10373403 | 3300009093 | Bacteria | 1612 |
| 263 | Ga0111539_10004306 | 3300009094 | Bacteria | 18619 |
| 264 | Ga0111539_10167665 | 3300009094 | Bacteria | 2566 |
| 265 | Ga0111539_10178682 | 3300009094 | Bacteria | 2479 |
| 266 | Ga0105247_10070602 | 3300009101 | Bacteria | 2182 |
| 267 | Ga0105247_10087330 | 3300009101 | Bacteria | 1975 |
| 268 | Ga0114129_10000608 | 3300009147 | Bacteria | 44314 |
| 269 | Ga0114129_10352293 | 3300009147 | Bacteria | 1950 |
| 270 | Ga0114129_10583300 | 3300009147 | Bacteria | 1450 |
| 271 | Ga0105243_10000018 | 3300009148 | Bacteria | 227618 |
| 272 | Ga0105241_10000104 | 3300009174 | Bacteria | 60482 |
| 273 | Ga0105241_10002801 | 3300009174 | Bacteria | 13049 |
| 274 | Ga0105241_10018266 | 3300009174 | Bacteria | 5157 |
| 275 | Ga0105241_10024092 | 3300009174 | Bacteria | 4520 |
| 276 | Ga0105241_10070958 | 3300009174 | Bacteria | 2704 |
| 277 | Ga0105242_10008462 | 3300009176 | Bacteria | 7906 |
| 278 | Ga0105242_10037587 | 3300009176 | Bacteria | 3889 |
| 279 | Ga0105242_10066895 | 3300009176 | Unclassified | 2969 |
| 280 | Ga0105242_10142795 | 3300009176 | Bacteria | 2079 |
| 281 | Ga0105248_10112229 | 3300009177 | Bacteria | 3075 |
| 282 | Ga0105237_10000138 | 3300009545 | Bacteria | 102411 |
| 283 | Ga0105237_10002964 | 3300009545 | Bacteria | 20540 |
| 284 | Ga0105237_10004350 | 3300009545 | Bacteria | 16414 |
| 285 | Ga0105237_10006992 | 3300009545 | Bacteria | 12432 |
| 286 | Ga0105237_10007274 | 3300009545 | Bacteria | 12146 |
| 287 | Ga0105237_10009111 | 3300009545 | Bacteria | 10667 |
| 288 | Ga0105237_10015845 | 3300009545 | Bacteria | 7840 |
| 289 | Ga0105237_10040911 | 3300009545 | Bacteria | 4675 |
| 290 | Ga0105237_10060302 | 3300009545 | Bacteria | 3796 |
| 291 | Ga0105237_10076443 | 3300009545 | Bacteria | 3339 |
| 292 | Ga0105237_10089416 | 3300009545 | Bacteria | 3069 |
| 293 | Ga0105237_10140065 | 3300009545 | Bacteria | 2413 |
| 294 | Ga0105237_10211739 | 3300009545 | Bacteria | 1938 |
| 295 | Ga0105238_10019521 | 3300009551 | Bacteria | 6903 |
| 296 | Ga0105238_10077512 | 3300009551 | Bacteria | 3315 |
| 297 | Ga0105238_10121922 | 3300009551 | Bacteria | 2586 |
| 298 | Ga0105249_10000177 | 3300009553 | Bacteria | 74897 |
| 299 | Ga0105249_10009062 | 3300009553 | Bacteria | 8700 |
| 300 | Ga0105249_10009352 | 3300009553 | Bacteria | 8574 |
| 301 | Ga0105249_10013585 | 3300009553 | Bacteria | 7194 |
| 302 | Ga0105249_10030029 | 3300009553 | Bacteria | 4910 |
| 303 | Ga0105239_10000014 | 3300010375 | Bacteria | 325391 |
| 304 | Ga0105239_10000130 | 3300010375 | Bacteria | 105894 |
| 305 | Ga0105239_10000558 | 3300010375 | Bacteria | 53441 |
| 306 | Ga0105239_10000708 | 3300010375 | Bacteria | 47248 |
| 307 | Ga0105239_10000755 | 3300010375 | Bacteria | 45854 |
| 308 | Ga0105239_10000936 | 3300010375 | Bacteria | 41213 |
| 309 | Ga0105239_10003284 | 3300010375 | Bacteria | 19951 |
| 310 | Ga0105239_10019537 | 3300010375 | Bacteria | 7478 |
| 311 | Ga0105239_10030519 | 3300010375 | Bacteria | 5925 |
| 312 | Ga0105239_10127795 | 3300010375 | Bacteria | 2826 |
| 313 | Ga0105239_10159568 | 3300010375 | Bacteria | 2519 |
| 314 | Ga0105239_10350555 | 3300010375 | Bacteria | 1667 |
| 315 | Ga0105246_10019297 | 3300011119 | Bacteria | 4355 |
| 316 | Ga0105246_10051012 | 3300011119 | Bacteria | 2839 |
| 317 | Ga0157373_10000107 | 3300013100 | Bacteria | 65161 |
| 318 | Ga0157373_10000150 | 3300013100 | Bacteria | 56030 |
| 319 | Ga0157373_10003707 | 3300013100 | Bacteria | 11562 |
| 320 | Ga0157373_10014856 | 3300013100 | Bacteria | 5702 |
| 321 | Ga0157373_10109747 | 3300013100 | Bacteria | 1939 |
| 322 | Ga0157371_10000012 | 3300013102 | Bacteria | 355318 |
| 323 | Ga0157371_10000297 | 3300013102 | Bacteria | 65919 |
| 324 | Ga0157371_10000629 | 3300013102 | Bacteria | 41913 |
| 325 | Ga0157371_10000884 | 3300013102 | Bacteria | 33771 |
| 326 | Ga0157371_10001188 | 3300013102 | Bacteria | 27890 |
| 327 | Ga0157371_10003212 | 3300013102 | Bacteria | 15006 |
| 328 | Ga0157371_10003438 | 3300013102 | Bacteria | 14365 |
| 329 | Ga0157371_10042739 | 3300013102 | Bacteria | 3230 |
| 330 | Ga0157371_10043804 | 3300013102 | Bacteria | 3187 |
| 331 | Ga0157371_10148825 | 3300013102 | Bacteria | 1669 |
| 332 | Ga0157370_10001924 | 3300013104 | Bacteria | 25541 |
| 333 | Ga0157370_10003146 | 3300013104 | Bacteria | 19553 |
| 334 | Ga0157370_10008544 | 3300013104 | Bacteria | 11037 |
| 335 | Ga0157370_10020992 | 3300013104 | Bacteria | 6512 |
| 336 | Ga0157370_10026562 | 3300013104 | Bacteria | 5715 |
| 337 | Ga0157370_10032897 | 3300013104 | Bacteria | 5060 |
| 338 | Ga0157370_10052862 | 3300013104 | Bacteria | 3876 |
| 339 | Ga0157370_10063980 | 3300013104 | Bacteria | 3483 |
| 340 | Ga0157370_10087796 | 3300013104 | Bacteria | 2921 |
| 341 | Ga0157369_10000224 | 3300013105 | Bacteria | 78178 |
| 342 | Ga0157369_10022459 | 3300013105 | Bacteria | 7039 |
| 343 | Ga0157369_10036588 | 3300013105 | Bacteria | 5377 |
| 344 | Ga0157369_10042378 | 3300013105 | Bacteria | 4965 |
| 345 | Ga0157369_10088874 | 3300013105 | Bacteria | 3298 |
| 346 | Ga0157369_10177434 | 3300013105 | Bacteria | 2242 |
| 347 | Ga0157369_10196184 | 3300013105 | Bacteria | 2120 |
| 348 | Ga0157374_10000237 | 3300013296 | Bacteria | 51331 |
| 349 | Ga0157374_10005388 | 3300013296 | Bacteria | 10749 |
| 350 | Ga0157378_10004574 | 3300013297 | Bacteria | 12133 |
| 351 | Ga0157378_10020420 | 3300013297 | Bacteria | 5826 |
| 352 | Ga0157378_10111792 | 3300013297 | Bacteria | 2505 |
| 353 | Ga0157378_10225237 | 3300013297 | Bacteria | 1784 |
| 354 | Ga0157378_10243367 | 3300013297 | Bacteria | 1719 |
| 355 | Ga0163162_10000226 | 3300013306 | Bacteria | 51615 |
| 356 | Ga0163162_10001312 | 3300013306 | Bacteria | 23236 |
| 357 | Ga0163162_10001569 | 3300013306 | Bacteria | 21347 |
| 358 | Ga0163162_10006217 | 3300013306 | Bacteria | 11572 |
| 359 | Ga0163162_10011350 | 3300013306 | Bacteria | 8686 |
| 360 | Ga0163162_10084395 | 3300013306 | Bacteria | 3252 |
| 361 | Ga0163162_10096301 | 3300013306 | Bacteria | 3047 |
| 362 | Ga0163162_10234127 | 3300013306 | Bacteria | 1967 |
| 363 | Ga0163162_10290308 | 3300013306 | Bacteria | 1767 |
| 364 | Ga0157372_10000285 | 3300013307 | Bacteria | 56173 |
| 365 | Ga0157372_10002016 | 3300013307 | Bacteria | 22086 |
| 366 | Ga0157372_10002389 | 3300013307 | Bacteria | 20320 |
| 367 | Ga0157372_10005622 | 3300013307 | Bacteria | 13328 |
| 368 | Ga0157372_10006556 | 3300013307 | Bacteria | 12386 |
| 369 | Ga0157372_10033647 | 3300013307 | Bacteria | 5632 |
| 370 | Ga0157372_10035046 | 3300013307 | Bacteria | 5522 |
| 371 | Ga0157372_10038641 | 3300013307 | Bacteria | 5266 |
| 372 | Ga0157372_10043900 | 3300013307 | Bacteria | 4952 |
| 373 | Ga0157372_10045710 | 3300013307 | Bacteria | 4858 |
| 374 | Ga0157372_10047960 | 3300013307 | Bacteria | 4747 |
| 375 | Ga0157372_10048401 | 3300013307 | Bacteria | 4726 |
| 376 | Ga0157372_10084878 | 3300013307 | Bacteria | 3591 |
| 377 | Ga0157372_10132140 | 3300013307 | Bacteria | 2873 |
| 378 | Ga0157372_10160487 | 3300013307 | Unclassified | 2598 |
| 379 | Ga0157372_10250220 | 3300013307 | Bacteria | 2057 |
| 380 | Ga0157372_10339492 | 3300013307 | Bacteria | 1750 |
| 381 | Ga0157375_10059901 | 3300013308 | Bacteria | 3773 |
| 382 | Ga0157375_10096069 | 3300013308 | Bacteria | 3035 |
| 383 | Ga0157375_10104889 | 3300013308 | Bacteria | 2916 |
| 384 | Ga0157375_10117991 | 3300013308 | Bacteria | 2760 |
| 385 | Ga0157375_10158391 | 3300013308 | Bacteria | 2405 |
| 386 | Ga0157375_10158696 | 3300013308 | Bacteria | 2403 |
| 387 | Ga0157375_10450244 | 3300013308 | Bacteria | 1453 |
| 388 | Ga0163163_10000088 | 3300014325 | Bacteria | 101126 |
| 389 | Ga0163163_10000244 | 3300014325 | Bacteria | 55634 |
| 390 | Ga0163163_10012983 | 3300014325 | Bacteria | 7608 |
| 391 | Ga0157380_10063533 | 3300014326 | Bacteria | 2960 |
| 392 | Ga0157380_10134906 | 3300014326 | Bacteria | 2111 |
| 393 | Ga0157380_10143391 | 3300014326 | Bacteria | 2055 |
| 394 | Ga0182008_10000011 | 3300014497 | Bacteria | 297770 |
| 395 | Ga0182008_10000047 | 3300014497 | Bacteria | 108181 |
| 396 | Ga0157377_10000568 | 3300014745 | Bacteria | 15510 |
| 397 | Ga0157377_10001221 | 3300014745 | Bacteria | 10960 |
| 398 | Ga0157377_10003043 | 3300014745 | Bacteria | 7515 |
| 399 | Ga0157377_10018151 | 3300014745 | Bacteria | 3653 |
| 400 | Ga0157377_10126439 | 3300014745 | Bacteria | 1556 |
| 401 | Ga0157379_10031404 | 3300014968 | Bacteria | 4731 |
| 402 | Ga0157379_10051589 | 3300014968 | Bacteria | 3674 |
| 403 | Ga0157376_10006924 | 3300014969 | Bacteria | 8035 |
| 404 | Ga0157376_10031273 | 3300014969 | Bacteria | 4259 |
| 405 | Ga0157376_10031781 | 3300014969 | Bacteria | 4232 |
| 406 | Ga0157376_10151224 | 3300014969 | Bacteria | 2093 |
| 407 | Ga0157376_10168324 | 3300014969 | Bacteria | 1993 |
| 408 | Ga0157376_10192096 | 3300014969 | Bacteria | 1873 |
| 409 | Ga0157376_10212906 | 3300014969 | Bacteria | 1785 |
| 410 | Ga0182006_1009584 | 3300015261 | Bacteria | 4334 |
| 411 | Ga0163161_10020287 | 3300017792 | Bacteria | 4663 |
| 412 | Ga0163161_10027138 | 3300017792 | Bacteria | 4061 |
| 413 | Ga0163161_10044468 | 3300017792 | Bacteria | 3198 |
| 414 | Ga0163161_10106959 | 3300017792 | Bacteria | 2088 |
| 415 | Ga0163161_10220287 | 3300017792 | Bacteria | 1469 |
| 416 | Ga0213876_10001070 | 3300021384 | Bacteria | 17605 |
| 417 | Ga0213876_10002683 | 3300021384 | Bacteria | 10387 |
| 418 | Ga0209436_101750 | 3300025208 | Bacteria | 7134 |
| 419 | Ga0207427_100071 | 3300025231 | Bacteria | 159974 |
| 420 | Ga0209437_100021 | 3300025233 | Bacteria | 646400 |
| 421 | Ga0209437_100124 | 3300025233 | Bacteria | 199789 |
| 422 | Ga0209258_100193 | 3300025242 | Bacteria | 124682 |
| 423 | Ga0209646_1000050 | 3300025246 | Bacteria | 296599 |
| 424 | Ga0209026_1000282 | 3300025250 | Bacteria | 58460 |
| 425 | Ga0209026_1000826 | 3300025250 | Bacteria | 16529 |
| 426 | Ga0209026_1001733 | 3300025250 | Bacteria | 9087 |
| 427 | Ga0209026_1004176 | 3300025250 | Bacteria | 4415 |
| 428 | Ga0209148_1000167 | 3300025254 | Bacteria | 135407 |
| 429 | Ga0209233_1000035 | 3300025261 | Bacteria | 568478 |
| 430 | Ga0209233_1006884 | 3300025261 | Bacteria | 3638 |
| 431 | Ga0209673_1000339 | 3300025273 | Bacteria | 85906 |
| 432 | Ga0209130_1006364 | 3300025284 | Bacteria | 3851 |
| 433 | Ga0209564_1023743 | 3300025295 | Bacteria | 2118 |
| 434 | Ga0209758_1010862 | 3300025297 | Bacteria | 5371 |
| 435 | Ga0209758_1022385 | 3300025297 | Bacteria | 2901 |
| 436 | Ga0209050_1000440 | 3300025298 | Bacteria | 75475 |
| 437 | Ga0207426_1000525 | 3300025302 | Bacteria | 55617 |
| 438 | Ga0207426_1000815 | 3300025302 | Bacteria | 33471 |
| 439 | Ga0207426_1000933 | 3300025302 | Bacteria | 29162 |
| 440 | Ga0207426_1002563 | 3300025302 | Bacteria | 11365 |
| 441 | Ga0209257_1000005 | 3300025304 | Bacteria | 1592528 |
| 442 | Ga0209257_1003230 | 3300025304 | Bacteria | 14357 |
| 443 | Ga0207642_10025689 | 3300025899 | Bacteria | 2387 |
| 444 | Ga0207710_10029491 | 3300025900 | Bacteria | 2388 |
| 445 | Ga0207688_10129056 | 3300025901 | Unclassified | 1481 |
| 446 | Ga0207680_10000015 | 3300025903 | Bacteria | 138253 |
| 447 | Ga0207680_10009136 | 3300025903 | Bacteria | 4902 |
| 448 | Ga0207680_10044173 | 3300025903 | Bacteria | 2619 |
| 449 | Ga0207647_10001267 | 3300025904 | Bacteria | 19442 |
| 450 | Ga0207647_10005091 | 3300025904 | Bacteria | 9689 |
| 451 | Ga0207647_10014937 | 3300025904 | Bacteria | 5336 |
| 452 | Ga0207647_10146451 | 3300025904 | Bacteria | 1382 |
| 453 | Ga0207645_10000136 | 3300025907 | Bacteria | 56153 |
| 454 | Ga0207645_10018765 | 3300025907 | Bacteria | 4543 |
| 455 | Ga0207645_10025617 | 3300025907 | Bacteria | 3815 |
| 456 | Ga0207645_10036710 | 3300025907 | Unclassified | 3147 |
| 457 | Ga0207643_10064435 | 3300025908 | Unclassified | 2097 |
| 458 | Ga0207705_10001443 | 3300025909 | Bacteria | 18970 |
| 459 | Ga0207705_10006828 | 3300025909 | Bacteria | 8433 |
| 460 | Ga0207705_10010408 | 3300025909 | Bacteria | 6763 |
| 461 | Ga0207705_10072902 | 3300025909 | Bacteria | 2491 |
| 462 | Ga0207705_10077395 | 3300025909 | Bacteria | 2420 |
| 463 | Ga0207705_10080556 | 3300025909 | Bacteria | 2373 |
| 464 | Ga0207654_10002468 | 3300025911 | Bacteria | 9402 |
| 465 | Ga0207707_10003458 | 3300025912 | Bacteria | 13997 |
| 466 | Ga0207707_10056886 | 3300025912 | Bacteria | 3404 |
| 467 | Ga0207707_10104171 | 3300025912 | Bacteria | 2479 |
| 468 | Ga0207695_10000127 | 3300025913 | Bacteria | 227338 |
| 469 | Ga0207695_10000151 | 3300025913 | Bacteria | 206493 |
| 470 | Ga0207695_10000169 | 3300025913 | Bacteria | 192566 |
| 471 | Ga0207695_10000238 | 3300025913 | Bacteria | 144406 |
| 472 | Ga0207695_10000894 | 3300025913 | Bacteria | 54057 |
| 473 | Ga0207695_10001190 | 3300025913 | Bacteria | 44747 |
| 474 | Ga0207695_10015794 | 3300025913 | Bacteria | 8869 |
| 475 | Ga0207695_10048262 | 3300025913 | Bacteria | 4498 |
| 476 | Ga0207695_10060277 | 3300025913 | Bacteria | 3929 |
| 477 | Ga0207695_10108636 | 3300025913 | Bacteria | 2758 |
| 478 | Ga0207695_10185750 | 3300025913 | Bacteria | 1998 |
| 479 | Ga0207695_10276543 | 3300025913 | Bacteria | 1573 |
| 480 | Ga0207671_10000103 | 3300025914 | Bacteria | 129408 |
| 481 | Ga0207671_10001528 | 3300025914 | Bacteria | 26548 |
| 482 | Ga0207671_10002935 | 3300025914 | Bacteria | 17576 |
| 483 | Ga0207671_10005708 | 3300025914 | Bacteria | 11360 |
| 484 | Ga0207671_10008095 | 3300025914 | Bacteria | 8975 |
| 485 | Ga0207671_10010123 | 3300025914 | Bacteria | 7814 |
| 486 | Ga0207671_10026985 | 3300025914 | Bacteria | 4297 |
| 487 | Ga0207671_10031834 | 3300025914 | Bacteria | 3928 |
| 488 | Ga0207660_10042709 | 3300025917 | Bacteria | 3183 |
| 489 | Ga0207660_10112778 | 3300025917 | Bacteria | 2048 |
| 490 | Ga0207657_10042288 | 3300025919 | Bacteria | 4022 |
| 491 | Ga0207657_10137348 | 3300025919 | Bacteria | 1999 |
| 492 | Ga0207657_10181814 | 3300025919 | Bacteria | 1699 |
| 493 | Ga0207649_10000419 | 3300025920 | Bacteria | 31284 |
| 494 | Ga0207652_10000013 | 3300025921 | Bacteria | 222247 |
| 495 | Ga0207652_10000187 | 3300025921 | Bacteria | 65282 |
| 496 | Ga0207652_10002930 | 3300025921 | Bacteria | 14278 |
| 497 | Ga0207652_10006696 | 3300025921 | Bacteria | 9283 |
| 498 | Ga0207652_10061169 | 3300025921 | Bacteria | 3251 |
| 499 | Ga0207652_10071222 | 3300025921 | Bacteria | 3020 |
| 500 | Ga0207681_10047997 | 3300025923 | Bacteria | 2880 |
| 501 | Ga0207681_10051655 | 3300025923 | Bacteria | 2786 |
| 502 | Ga0207681_10077272 | 3300025923 | Unclassified | 2340 |
| 503 | Ga0207650_10112802 | 3300025925 | Bacteria | 2107 |
| 504 | Ga0207644_10079226 | 3300025931 | Bacteria | 2423 |
| 505 | Ga0207690_10000049 | 3300025932 | Bacteria | 113589 |
| 506 | Ga0207690_10008098 | 3300025932 | Bacteria | 6237 |
| 507 | Ga0207690_10021979 | 3300025932 | Bacteria | 3963 |
| 508 | Ga0207690_10043848 | 3300025932 | Bacteria | 2946 |
| 509 | Ga0207706_10002103 | 3300025933 | Bacteria | 19496 |
| 510 | Ga0207706_10024569 | 3300025933 | Bacteria | 5402 |
| 511 | Ga0207706_10059286 | 3300025933 | Bacteria | 3371 |
| 512 | Ga0207706_10110761 | 3300025933 | Bacteria | 2415 |
| 513 | Ga0207686_10000429 | 3300025934 | Bacteria | 28636 |
| 514 | Ga0207686_10089861 | 3300025934 | Unclassified | 2025 |
| 515 | Ga0207709_10000021 | 3300025935 | Bacteria | 386722 |
| 516 | Ga0207670_10007267 | 3300025936 | Bacteria | 6172 |
| 517 | Ga0207670_10015622 | 3300025936 | Bacteria | 4541 |
| 518 | Ga0207670_10059061 | 3300025936 | Bacteria | 2608 |
| 519 | Ga0207670_10146400 | 3300025936 | Bacteria | 1747 |
| 520 | Ga0207704_10036806 | 3300025938 | Bacteria | 2819 |
| 521 | Ga0207704_10070796 | 3300025938 | Bacteria | 2210 |
| 522 | Ga0207704_10087515 | 3300025938 | Bacteria | 2035 |
| 523 | Ga0207691_10040276 | 3300025940 | Bacteria | 4317 |
| 524 | Ga0207691_10042147 | 3300025940 | Bacteria | 4208 |
| 525 | Ga0207689_10001007 | 3300025942 | Bacteria | 27057 |
| 526 | Ga0207689_10004656 | 3300025942 | Bacteria | 12404 |
| 527 | Ga0207689_10014075 | 3300025942 | Bacteria | 6809 |
| 528 | Ga0207689_10019898 | 3300025942 | Bacteria | 5653 |
| 529 | Ga0207689_10026965 | 3300025942 | Bacteria | 4810 |
| 530 | Ga0207689_10047573 | 3300025942 | Bacteria | 3540 |
| 531 | Ga0207689_10063150 | 3300025942 | Bacteria | 3046 |
| 532 | Ga0207661_10000370 | 3300025944 | Bacteria | 28914 |
| 533 | Ga0207661_10030067 | 3300025944 | Bacteria | 4179 |
| 534 | Ga0207661_10120368 | 3300025944 | Bacteria | 2234 |
| 535 | Ga0207661_10245042 | 3300025944 | Bacteria | 1591 |
| 536 | Ga0207679_10000266 | 3300025945 | Bacteria | 39927 |
| 537 | Ga0207679_10001572 | 3300025945 | Bacteria | 14273 |
| 538 | Ga0207679_10021342 | 3300025945 | Bacteria | 4390 |
| 539 | Ga0207667_10000365 | 3300025949 | Bacteria | 61074 |
| 540 | Ga0207667_10000408 | 3300025949 | Bacteria | 58389 |
| 541 | Ga0207667_10000508 | 3300025949 | Bacteria | 51422 |
| 542 | Ga0207667_10001711 | 3300025949 | Bacteria | 27600 |
| 543 | Ga0207667_10035585 | 3300025949 | Bacteria | 5341 |
| 544 | Ga0207667_10048686 | 3300025949 | Bacteria | 4480 |
| 545 | Ga0207667_10106243 | 3300025949 | Bacteria | 2896 |
| 546 | Ga0207667_10120942 | 3300025949 | Bacteria | 2698 |
| 547 | Ga0207667_10134709 | 3300025949 | Bacteria | 2544 |
| 548 | Ga0207667_10146963 | 3300025949 | Bacteria | 2426 |
| 549 | Ga0207667_10188276 | 3300025949 | Bacteria | 2118 |
| 550 | Ga0207667_10291853 | 3300025949 | Bacteria | 1666 |
| 551 | Ga0207651_10069866 | 3300025960 | Bacteria | 2482 |
| 552 | Ga0207651_10108640 | 3300025960 | Bacteria | 2077 |
| 553 | Ga0207651_10116429 | 3300025960 | Bacteria | 2017 |
| 554 | Ga0207712_10002766 | 3300025961 | Bacteria | 11216 |
| 555 | Ga0207712_10011848 | 3300025961 | Bacteria | 5559 |
| 556 | Ga0207712_10022755 | 3300025961 | Bacteria | 4131 |
| 557 | Ga0207712_10062576 | 3300025961 | Bacteria | 2646 |
| 558 | Ga0207712_10130103 | 3300025961 | Bacteria | 1917 |
| 559 | Ga0207668_10058996 | 3300025972 | Bacteria | 2686 |
| 560 | Ga0207640_10058226 | 3300025981 | Bacteria | 2545 |
| 561 | Ga0207640_10076026 | 3300025981 | Bacteria | 2278 |
| 562 | Ga0207658_10021523 | 3300025986 | Bacteria | 4479 |
| 563 | Ga0207658_10034253 | 3300025986 | Bacteria | 3628 |
| 564 | Ga0207658_10208212 | 3300025986 | Bacteria | 1637 |
| 565 | Ga0207677_10017048 | 3300026023 | Bacteria | 4319 |
| 566 | Ga0207677_10028677 | 3300026023 | Bacteria | 3525 |
| 567 | Ga0207677_10130678 | 3300026023 | Bacteria | 1906 |
| 568 | Ga0207677_10139086 | 3300026023 | Bacteria | 1856 |
| 569 | Ga0207703_10007227 | 3300026035 | Bacteria | 8831 |
| 570 | Ga0207703_10050224 | 3300026035 | Bacteria | 3375 |
| 571 | Ga0207703_10061525 | 3300026035 | Bacteria | 3073 |
| 572 | Ga0207639_10019147 | 3300026041 | Bacteria | 4877 |
| 573 | Ga0207639_10044622 | 3300026041 | Bacteria | 3334 |
| 574 | Ga0207639_10094893 | 3300026041 | Bacteria | 2396 |
| 575 | Ga0207639_10109853 | 3300026041 | Bacteria | 2245 |
| 576 | Ga0207678_10023821 | 3300026067 | Bacteria | 5353 |
| 577 | Ga0207678_10098208 | 3300026067 | Bacteria | 2502 |
| 578 | Ga0207708_10143607 | 3300026075 | Bacteria | 1874 |
| 579 | Ga0207702_10032751 | 3300026078 | Bacteria | 4337 |
| 580 | Ga0207702_10054227 | 3300026078 | Bacteria | 3396 |
| 581 | Ga0207702_10082649 | 3300026078 | Bacteria | 2793 |
| 582 | Ga0207702_10206103 | 3300026078 | Bacteria | 1825 |
| 583 | Ga0207641_10000056 | 3300026088 | Bacteria | 170719 |
| 584 | Ga0207641_10007370 | 3300026088 | Bacteria | 9156 |
| 585 | Ga0207641_10037835 | 3300026088 | Bacteria | 4032 |
| 586 | Ga0207648_10000568 | 3300026089 | Bacteria | 41399 |
| 587 | Ga0207648_10004655 | 3300026089 | Bacteria | 14042 |
| 588 | Ga0207648_10019544 | 3300026089 | Bacteria | 6114 |
| 589 | Ga0207648_10029445 | 3300026089 | Bacteria | 4869 |
| 590 | Ga0207648_10066942 | 3300026089 | Bacteria | 3132 |
| 591 | Ga0207648_10256663 | 3300026089 | Bacteria | 1559 |
| 592 | Ga0207676_10011089 | 3300026095 | Bacteria | 6433 |
| 593 | Ga0207676_10024265 | 3300026095 | Bacteria | 4485 |
| 594 | Ga0207676_10076898 | 3300026095 | Bacteria | 2698 |
| 595 | Ga0207676_10215770 | 3300026095 | Bacteria | 1705 |
| 596 | Ga0207676_10282305 | 3300026095 | Bacteria | 1508 |
| 597 | Ga0207674_10010073 | 3300026116 | Bacteria | 10748 |
| 598 | Ga0207674_10016248 | 3300026116 | Bacteria | 8152 |
| 599 | Ga0207674_10084397 | 3300026116 | Bacteria | 3174 |
| 600 | Ga0207674_10125881 | 3300026116 | Bacteria | 2528 |
| 601 | Ga0207674_10210909 | 3300026116 | Bacteria | 1891 |
| 602 | Ga0207674_10272125 | 3300026116 | Bacteria | 1641 |
| 603 | Ga0207675_100003813 | 3300026118 | Bacteria | 14671 |
| 604 | Ga0207675_100007383 | 3300026118 | Bacteria | 10388 |
| 605 | Ga0207675_100021679 | 3300026118 | Bacteria | 5980 |
| 606 | Ga0207675_100048377 | 3300026118 | Bacteria | 3969 |
| 607 | Ga0207675_100053087 | 3300026118 | Bacteria | 3782 |
| 608 | Ga0207683_10002007 | 3300026121 | Bacteria | 18003 |
| 609 | Ga0207683_10007862 | 3300026121 | Bacteria | 9124 |
| 610 | Ga0207698_10003137 | 3300026142 | Bacteria | 9906 |
| 611 | Ga0207698_10042824 | 3300026142 | Bacteria | 3387 |
| 612 | Ga0207698_10112943 | 3300026142 | Bacteria | 2281 |
| 613 | Ga0207428_10096411 | 3300027907 | Bacteria | 2290 |
| 614 | Ga0268266_10000071 | 3300028379 | Bacteria | 232887 |
| 615 | Ga0268266_10004286 | 3300028379 | Bacteria | 13730 |
| 616 | Ga0268265_10091723 | 3300028380 | Bacteria | 2430 |
| 617 | Ga0268264_10000143 | 3300028381 | Bacteria | 170031 |
| 618 | Ga0268264_10001196 | 3300028381 | Bacteria | 25064 |
| 619 | Ga0268264_10001996 | 3300028381 | Bacteria | 18331 |
| 620 | Ga0268264_10006748 | 3300028381 | Bacteria | 9645 |
| 621 | Ga0268264_10026440 | 3300028381 | Bacteria | 4743 |
| 622 | Ga0268264_10049632 | 3300028381 | Bacteria | 3492 |
| 623 | Ga0268264_10063639 | 3300028381 | Bacteria | 3102 |
| 624 | Ga0307517_10012359 | 3300028786 | Bacteria | 11728 |
| 625 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 626 | Ga0307515_10000078 | 3300028794 | Bacteria | 227988 |
| 627 | Ga0307515_10000224 | 3300028794 | Bacteria | 140276 |
| 628 | Ga0307515_10001268 | 3300028794 | Bacteria | 57400 |
| 629 | Ga0265338_10003003 | 3300028800 | Bacteria | 24413 |
| 630 | Ga0265338_10016709 | 3300028800 | Bacteria | 7953 |
| 631 | Ga0307511_10002930 | 3300030521 | Bacteria | 17674 |
| 632 | Ga0316176_1079087 | 3300030732 | Bacteria | 6116 |
| 633 | Ga0316183_1153674 | 3300030742 | Bacteria | 79729 |
| 634 | Ga0316181_1153314 | 3300030744 | Bacteria | 3683 |
| 635 | Ga0265327_10000097 | 3300031251 | Bacteria | 193156 |
| 636 | Ga0265327_10000098 | 3300031251 | Bacteria | 190693 |
| 637 | Ga0265327_10000421 | 3300031251 | Bacteria | 77515 |
| 638 | Ga0265327_10065673 | 3300031251 | Bacteria | 1834 |
| 639 | Ga0265316_10045776 | 3300031344 | Bacteria | 3471 |
| 640 | Ga0307513_10085874 | 3300031456 | Bacteria | 3228 |
| 641 | Ga0307513_10118413 | 3300031456 | Bacteria | 2623 |
| 642 | Ga0307509_10064977 | 3300031507 | Bacteria | 3835 |
| 643 | Ga0307509_10087071 | 3300031507 | Bacteria | 3210 |
| 644 | Ga0307509_10098566 | 3300031507 | Bacteria | 2967 |
| 645 | Ga0307408_100000291 | 3300031548 | Bacteria | 48964 |
| 646 | Ga0307408_100004481 | 3300031548 | Bacteria | 9479 |
| 647 | Ga0307508_10005346 | 3300031616 | Bacteria | 12230 |
| 648 | Ga0307508_10129582 | 3300031616 | Bacteria | 2126 |
| 649 | Ga0265314_10109480 | 3300031711 | Bacteria | 1758 |
| 650 | Ga0307516_10000310 | 3300031730 | Bacteria | 63335 |
| 651 | Ga0307413_10013318 | 3300031824 | Bacteria | 4130 |
| 652 | Ga0307412_10000001 | 3300031911 | Bacteria | 822691 |
| 653 | Ga0307412_10004155 | 3300031911 | Bacteria | 8066 |
| 654 | Ga0307414_10008242 | 3300032004 | Bacteria | 5896 |
| 655 | Ga0307507_10000097 | 3300033179 | Bacteria | 139761 |
| 656 | Ga0307510_10001062 | 3300033180 | Bacteria | 29213 |
| 657 | Ga0373943_0046344 | 3300035170 | Bacteria | 2122 |
| 658 | Ga0373927_0011129 | 3300035695 | Bacteria | 5993 |
| 659 | Ga0373937_0086186 | 3300036401 | Bacteria | 2907 |
| 660 | Ga0373925_0157364 | 3300037068 | Bacteria | 1788 |
| 661 | Ga0395899_0000017 | 3300037312 | Bacteria | 440179 |
| 662 | Ga0395899_0000528 | 3300037312 | Bacteria | 41982 |
| 663 | Ga0395899_0049099 | 3300037312 | Bacteria | 3137 |
| 664 | Ga0395899_0061440 | 3300037312 | Bacteria | 2767 |
| 665 | Ga0395899_0076748 | 3300037312 | Bacteria | 2438 |
| 666 | Ga0395899_0136320 | 3300037312 | Bacteria | 1749 |
| 667 | Ga0395900_0002692 | 3300037418 | Bacteria | 19416 |
| 668 | Ga0395900_0006330 | 3300037418 | Bacteria | 12346 |
| 669 | Ga0395900_0030141 | 3300037418 | Bacteria | 5569 |
| 670 | Ga0395900_0126686 | 3300037418 | Bacteria | 2619 |
| 671 | Ga0395900_0196437 | 3300037418 | Bacteria | 2043 |
| 672 | Ga0395900_0201811 | 3300037418 | Bacteria | 2011 |
| 673 | Ga0395898_0000595 | 3300037466 | Bacteria | 67162 |
| 674 | Ga0395898_0052812 | 3300037466 | Bacteria | 3970 |
| 675 | Ga0395898_0053589 | 3300037466 | Bacteria | 3939 |
| 676 | Ga0395898_0070019 | 3300037466 | Bacteria | 3393 |
| 677 | Ga0395905_0171511 | 3300037471 | Bacteria | 2038 |
| 678 | Ga0395901_0005353 | 3300038443 | Bacteria | 12971 |
| 679 | Ga0395901_0036270 | 3300038443 | Bacteria | 5095 |
| 680 | Ga0395901_0102280 | 3300038443 | Bacteria | 3007 |
| 681 | Ga0436365_0038916 | 3300039437 | Bacteria | 17419 |
| 682 | Ga0436365_1153427 | 3300039437 | Bacteria | 7567 |
| 683 | Ga0439431_0000662 | 3300041997 | Bacteria | 7330 |
| 684 | Ga0439442_001192 | 3300042002 | Bacteria | 5172 |
| 685 | Ga0439449_0017643 | 3300042007 | Bacteria | 2680 |
| 686 | Ga0439457_002182 | 3300042014 | Bacteria | 5665 |
| 687 | Ga0439434_0030071 | 3300042435 | Bacteria | 1648 |
| 688 | Ga0451577_0022294 | 3300042876 | Bacteria | 5783 |
| 689 | Ga0451577_0151882 | 3300042876 | Bacteria | 2084 |
| 690 | Ga0466969_0000382 | 3300044656 | Bacteria | 24366 |
| 691 | Ga0466972_0008451 | 3300044658 | Bacteria | 5161 |
| 692 | Ga0453683_0009781 | 3300044673 | Bacteria | 6392 |
| 693 | Ga0466965_0054364 | 3300044683 | Bacteria | 1991 |
| 694 | Ga0466966_0000176 | 3300044684 | Bacteria | 42093 |
| 695 | Ga0453684_0001680 | 3300044712 | Bacteria | 59882 |
| 696 | Ga0453684_0006862 | 3300044712 | Bacteria | 21382 |
| 697 | Ga0453684_0012596 | 3300044712 | Bacteria | 13911 |
| 698 | Ga0453684_0012652 | 3300044712 | Bacteria | 13870 |
| 699 | Ga0453684_0029368 | 3300044712 | Bacteria | 7808 |
| 700 | Ga0453684_0072153 | 3300044712 | Bacteria | 4360 |
| 701 | Ga0453684_0091945 | 3300044712 | Bacteria | 3743 |
| 702 | Ga0466957_0000383 | 3300044842 | Bacteria | 21620 |
| 703 | Ga0466957_0000577 | 3300044842 | Bacteria | 18517 |
| 704 | Ga0466957_0027271 | 3300044842 | Bacteria | 3394 |
| 705 | Ga0466959_0000016 | 3300045049 | Bacteria | 144600 |
| 706 | Ga0451576_0000022 | 3300045051 | Bacteria | 495037 |
| 707 | Ga0451576_0001027 | 3300045051 | Bacteria | 51553 |
| 708 | Ga0451576_0020942 | 3300045051 | Bacteria | 7115 |
| 709 | Ga0451576_0036766 | 3300045051 | Bacteria | 5188 |
| 710 | Ga0495592_0117596 | 3300046454 | Bacteria | 1874 |
| 711 | Ga0495590_0015951 | 3300046457 | Bacteria | 2717 |
| 712 | Ga0495638_0010167 | 3300046460 | Bacteria | 6553 |
| 713 | Ga0495638_0037416 | 3300046460 | Bacteria | 3087 |
| 714 | Ga0495638_0072589 | 3300046460 | Bacteria | 2103 |
| 715 | Ga0495651_0101376 | 3300046462 | Bacteria | 2143 |
| 716 | Ga0495653_0153104 | 3300046463 | Bacteria | 1609 |
| 717 | Ga0495650_0000095 | 3300046471 | Bacteria | 218020 |
| 718 | Ga0495639_0071530 | 3300046475 | Bacteria | 1603 |
| 719 | Ga0495585_0000034 | 3300046492 | Bacteria | 143120 |
| 720 | Ga0495583_0037967 | 3300046506 | Bacteria | 2279 |
| 721 | Ga0495606_0000009 | 3300046507 | Bacteria | 306313 |
| 722 | Ga0495606_0002808 | 3300046507 | Bacteria | 19390 |
| 723 | Ga0495606_0008253 | 3300046507 | Bacteria | 9089 |
| 724 | Ga0495610_0007711 | 3300046512 | Bacteria | 7101 |
| 725 | Ga0495616_0001155 | 3300046513 | Bacteria | 18668 |
| 726 | Ga0495630_0003153 | 3300046517 | Bacteria | 11441 |
| 727 | Ga0495648_0008498 | 3300046524 | Bacteria | 8074 |
| 728 | Ga0495648_0073901 | 3300046524 | Bacteria | 1966 |
| 729 | Ga0495663_0000124 | 3300046525 | Bacteria | 32076 |
| 730 | Ga0495652_0193578 | 3300046529 | Bacteria | 1550 |
| 731 | Ga0495640_0071735 | 3300046533 | Bacteria | 2323 |
| 732 | Ga0495586_0034672 | 3300046535 | Bacteria | 2711 |
| 733 | Ga0495587_0079106 | 3300046536 | Bacteria | 1907 |
| 734 | Ga0495609_0000225 | 3300046538 | Bacteria | 55731 |
| 735 | Ga0495609_0003375 | 3300046538 | Bacteria | 9185 |
| 736 | Ga0495622_0041305 | 3300046557 | Bacteria | 2145 |
| 737 | Ga0495633_0000085 | 3300046558 | Bacteria | 124821 |
| 738 | Ga0495633_0000174 | 3300046558 | Bacteria | 83814 |
| 739 | Ga0495633_0010277 | 3300046558 | Bacteria | 5117 |
| 740 | Ga0495633_0056397 | 3300046558 | Bacteria | 1846 |
| 741 | Ga0495668_0000017 | 3300046616 | Bacteria | 434025 |
| 742 | Ga0495668_0000106 | 3300046616 | Bacteria | 133476 |
| 743 | Ga0495668_0002317 | 3300046616 | Bacteria | 15925 |
| 744 | Ga0495668_0003962 | 3300046616 | Bacteria | 10791 |
| 745 | Ga0495668_0050960 | 3300046616 | Bacteria | 2293 |
| 746 | Ga0495634_0019397 | 3300046642 | Bacteria | 4833 |
| 747 | Ga0495634_0080296 | 3300046642 | Bacteria | 2135 |
| 748 | Ga0495611_0000231 | 3300046648 | Bacteria | 38409 |
| 749 | Ga0495625_0000007 | 3300046660 | Bacteria | 565749 |
| 750 | Ga0495625_0000155 | 3300046660 | Bacteria | 105066 |
| 751 | Ga0495625_0000761 | 3300046660 | Bacteria | 44882 |
| 752 | Ga0495625_0019255 | 3300046660 | Bacteria | 5301 |
| 753 | Ga0495625_0050589 | 3300046660 | Bacteria | 2981 |
| 754 | Ga0495661_0004014 | 3300046665 | Bacteria | 10726 |
| 755 | Ga0495661_0012459 | 3300046665 | Bacteria | 5740 |
| 756 | Ga0495670_0121987 | 3300046691 | Bacteria | 1354 |
| 757 | Ga0495649_0000007 | 3300046694 | Bacteria | 518037 |
| 758 | Ga0495649_0102680 | 3300046694 | Bacteria | 1519 |
| 759 | Ga0495660_0026059 | 3300046810 | Bacteria | 3317 |
| 760 | Ga0495636_0000075 | 3300047318 | Bacteria | 41221 |
| 761 | Ga0495674_0085538 | 3300047319 | Bacteria | 2701 |
| 762 | Ga0495672_0006964 | 3300047320 | Bacteria | 8599 |
| 763 | Ga0495672_0026125 | 3300047320 | Bacteria | 3729 |
| 764 | Ga0495687_003549 | 3300047443 | Bacteria | 11218 |
| 765 | Ga0495686_0000270 | 3300047472 | Bacteria | 92321 |
| 766 | Ga0495686_0000614 | 3300047472 | Bacteria | 49242 |
| 767 | Ga0495686_0000806 | 3300047472 | Bacteria | 40626 |
| 768 | Ga0495686_0001562 | 3300047472 | Bacteria | 24407 |
| 769 | Ga0495686_0022360 | 3300047472 | Bacteria | 4185 |
| 770 | Ga0495686_0029848 | 3300047472 | Bacteria | 3544 |
| 771 | Ga0495686_0071182 | 3300047472 | Bacteria | 2141 |
| 772 | Ga0496110_0052101 | 3300048913 | Bacteria | 3597 |
| 773 | Ga0496114_0000400 | 3300048917 | Bacteria | 32085 |
| 774 | Ga0496116_0002707 | 3300048919 | Bacteria | 18248 |
| 775 | Ga0496117_0001260 | 3300048920 | Bacteria | 37607 |
| 776 | Ga0496121_0000051 | 3300048924 | Bacteria | 315378 |
| 777 | Ga0496122_0004732 | 3300048925 | Bacteria | 16698 |
| 778 | Ga0496123_0038536 | 3300048926 | Bacteria | 3357 |
| 779 | Ga0496124_0049230 | 3300048927 | Bacteria | 3596 |
| 780 | Ga0501031_0057261 | 3300049568 | Bacteria | 2539 |
| 781 | Ga0501032_0000901 | 3300049569 | Bacteria | 24084 |
| 782 | Ga0501033_0077996 | 3300049570 | Bacteria | 2431 |
| 783 | Ga0501033_0100007 | 3300049570 | Bacteria | 2117 |
| 784 | Ga0501034_0000115 | 3300049571 | Bacteria | 146825 |
| 785 | Ga0501034_0036705 | 3300049571 | Bacteria | 4963 |
| 786 | Ga0501034_0080546 | 3300049571 | Bacteria | 3259 |
| 787 | Ga0501034_0143987 | 3300049571 | Bacteria | 2361 |
| 788 | Ga0501036_0013979 | 3300049572 | Bacteria | 6673 |
| 789 | Ga0501037_0060144 | 3300049573 | Bacteria | 2771 |
| 790 | Ga0501037_0093418 | 3300049573 | Bacteria | 2175 |
| 791 | Ga0501038_0011536 | 3300049574 | Bacteria | 8063 |
| 792 | Ga0501043_0008513 | 3300049579 | Bacteria | 8078 |
| 793 | Ga0501043_0077336 | 3300049579 | Bacteria | 2614 |
| 794 | Ga0501047_0017081 | 3300049581 | Bacteria | 6940 |
| 795 | Ga0501047_0125828 | 3300049581 | Bacteria | 2443 |
| 796 | Ga0501048_0072352 | 3300049582 | Bacteria | 2434 |
| 797 | Ga0501067_0007633 | 3300049583 | Bacteria | 6012 |
| 798 | Ga0501067_0059916 | 3300049583 | Bacteria | 2107 |
| 799 | Ga0501070_0059458 | 3300049586 | Bacteria | 3168 |
| 800 | Ga0501073_0009472 | 3300049589 | Bacteria | 7189 |
| 801 | Ga0501074_0009732 | 3300049590 | Bacteria | 6979 |
| 802 | Ga0501219_001212 | 3300049703 | Bacteria | 2783 |
| 803 | Ga0501080_0017887 | 3300049742 | Bacteria | 6560 |
| 804 | Ga0501080_0052084 | 3300049742 | Bacteria | 3810 |
| 805 | Ga0501035_0138244 | 3300049822 | Bacteria | 2119 |
| 806 | Ga0501035_0203051 | 3300049822 | Bacteria | 1699 |
| 807 | Ga0501044_0005380 | 3300049823 | Bacteria | 14218 |
| 808 | Ga0501044_0018314 | 3300049823 | Bacteria | 7505 |
| 809 | Ga0501044_0125467 | 3300049823 | Bacteria | 2565 |
| 810 | Ga0501284_00005 | 3300050005 | Bacteria | 164758 |
| 811 | nmdc:mga0k408_120_c1 | 3300050493 | Bacteria | 38359 |
| 812 | nmdc:mga0k408_429_c1 | 3300050493 | Bacteria | 22975 |
| 813 | nmdc:mga0k408_8963_c1 | 3300050493 | Bacteria | 5383 |
| 814 | nmdc:mga07m45_118400_c1 | 3300050496 | Bacteria | 1529 |
| 815 | nmdc:mga05p37_170491_c1 | 3300050507 | Bacteria | 2654 |
| 816 | nmdc:mga05p37_914_c1 | 3300050507 | Bacteria | 33336 |
| 817 | nmdc:mga09592_10511_c1 | 3300050508 | Bacteria | 7532 |
| 818 | nmdc:mga09592_38456_c1 | 3300050508 | Bacteria | 4017 |
| 819 | nmdc:mga0qj67_15755_c1 | 3300050509 | Bacteria | 5726 |
| 820 | nmdc:mga06r32_38982_c1 | 3300050510 | Bacteria | 4505 |
| 821 | nmdc:mga08y16_74131_c1 | 3300050511 | Bacteria | 3546 |
| 822 | nmdc:mga0n895_60961_c1 | 3300050512 | Bacteria | 3723 |
| 823 | Ga0500635_0005068 | 3300053080 | Bacteria | 3433 |
| 824 | Ga0500578_0001201 | 3300053086 | Bacteria | 27358 |
| 825 | Ga0500644_0000310 | 3300053088 | Bacteria | 25670 |
| 826 | Ga0500583_0000037 | 3300053092 | Bacteria | 92466 |
| 827 | Ga0500583_0026416 | 3300053092 | Bacteria | 2493 |
| 828 | Ga0500583_0029290 | 3300053092 | Bacteria | 2398 |
| 829 | Ga0500641_0035980 | 3300053096 | Bacteria | 1979 |
| 830 | Ga0500569_000069 | 3300053109 | Bacteria | 17168 |
| 831 | Ga0500608_015160 | 3300053122 | Bacteria | 3457 |
| 832 | Ga0500618_000148 | 3300053125 | Bacteria | 58264 |
| 833 | Ga0500642_0042932 | 3300053130 | Bacteria | 1962 |
| 834 | Ga0500652_003417 | 3300053131 | Bacteria | 4810 |
| 835 | Ga0500568_0001483 | 3300053139 | Bacteria | 15042 |
| 836 | Ga0500568_0033961 | 3300053139 | Bacteria | 2089 |
| 837 | Ga0500577_0001007 | 3300053142 | Bacteria | 7261 |
| 838 | Ga0500589_010221 | 3300053147 | Bacteria | 4002 |
| 839 | Ga0500616_0005085 | 3300053153 | Bacteria | 9076 |
| 840 | Ga0500616_0006607 | 3300053153 | Bacteria | 7561 |
| 841 | Ga0500616_0008456 | 3300053153 | Bacteria | 6388 |
| 842 | Ga0500622_0000722 | 3300053156 | Bacteria | 28889 |
| 843 | Ga0500622_0005024 | 3300053156 | Bacteria | 8061 |
| 844 | Ga0500624_000183 | 3300053157 | Bacteria | 24891 |
| 845 | Ga0500627_0005009 | 3300053158 | Bacteria | 4340 |
| 846 | Ga0500636_0004929 | 3300053177 | Bacteria | 7583 |
| 847 | Ga0500611_000004 | 3300053727 | Bacteria | 253326 |
| 848 | Ga0501082_0026283 | 3300060353 | Bacteria | 5015 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003323 | rootH1_10038130 | rootH1_100381303 | 388 |
| 2 | 3300049571 | Ga0501034_0143987 | Ga0501034_0143987_825_2144 | 389 |
| 3 | 3300049581 | Ga0501047_0017081 | Ga0501047_0017081_2024_3343 | 390 |
| 4 | 3300044683 | Ga0466965_0054364 | Ga0466965_0054364_11_1240 | 391 |
| 5 | 3300014326 | Ga0157380_10134906 | Ga0157380_101349061 | 393 |
| 6 | 3300021384 | Ga0213876_10002683 | Ga0213876_100026834 | 394 |
| 7 | 3300039437 | Ga0436365_0038916 | Ga0436365_0038916_6190_7512 | 394 |
| 8 | 3300046691 | Ga0495670_0121987 | Ga0495670_0121987_65_1303 | 394 |
| 9 | 3300005539 | Ga0068853_100188671 | Ga0068853_1001886712 | 395 |
| 10 | 3300006237 | Ga0097621_100053413 | Ga0097621_1000534132 | 395 |
| 11 | 3300013306 | Ga0163162_10096301 | Ga0163162_100963012 | 395 |
| 12 | 3300013308 | Ga0157375_10104889 | Ga0157375_101048892 | 395 |
| 13 | 3300026095 | Ga0207676_10282305 | Ga0207676_102823051 | 395 |
| 14 | 3300046506 | Ga0495583_0037967 | Ga0495583_0037967_978_2228 | 398 |
| 15 | 3300044712 | Ga0453684_0072153 | Ga0453684_0072153_454_1776 | 400 |
| 16 | 3300014325 | Ga0163163_10000244 | Ga0163163_1000024414 | 401 |
| 17 | 3300009545 | Ga0105237_10006992 | Ga0105237_100069923 | 402 |
| 18 | 3300010375 | Ga0105239_10000755 | Ga0105239_1000075524 | 402 |
| 19 | 3300025914 | Ga0207671_10010123 | Ga0207671_100101233 | 402 |
| 20 | 3300013307 | Ga0157372_10002389 | Ga0157372_1000238918 | 403 |
| 21 | 3300046694 | Ga0495649_0102680 | Ga0495649_0102680_106_1428 | 403 |
| 22 | 3300014969 | Ga0157376_10192096 | Ga0157376_101920962 | 404 |
| 23 | 3300036401 | Ga0373937_0086186 | Ga0373937_0086186_450_1769 | 404 |
| 24 | 3300046558 | Ga0495633_0056397 | Ga0495633_0056397_11_1330 | 404 |
| 25 | 3300005329 | Ga0070683_100002836 | Ga0070683_1000028365 | 407 |
| 26 | 3300005535 | Ga0070684_100002591 | Ga0070684_1000025912 | 407 |
| 27 | 3300005563 | Ga0068855_100001620 | Ga0068855_10000162011 | 407 |
| 28 | 3300005616 | Ga0068852_100049177 | Ga0068852_1000491772 | 407 |
| 29 | 3300009093 | Ga0105240_10036535 | Ga0105240_100365354 | 407 |
| 30 | 3300013104 | Ga0157370_10032897 | Ga0157370_100328973 | 407 |
| 31 | 3300013307 | Ga0157372_10035046 | Ga0157372_100350465 | 407 |
| 32 | 3300025913 | Ga0207695_10000894 | Ga0207695_1000089441 | 407 |
| 33 | 3300025949 | Ga0207667_10000365 | Ga0207667_1000036521 | 407 |
| 34 | 3300026041 | Ga0207639_10109853 | Ga0207639_101098532 | 407 |
| 35 | 3300001989 | JGI24739J22299_10000776 | JGI24739J22299_100007767 | 408 |
| 36 | 3300003771 | Ga0055526_1032839 | Ga0055526_10328391 | 408 |
| 37 | 3300003790 | Ga0055528_1004767 | Ga0055528_10047672 | 408 |
| 38 | 3300003791 | Ga0055530_10003144 | Ga0055530_100031449 | 408 |
| 39 | 3300003794 | Ga0055531_10019966 | Ga0055531_100199661 | 408 |
| 40 | 3300005262 | Ga0065165_1000109 | Ga0065165_100010938 | 408 |
| 41 | 3300005289 | Ga0065704_10079977 | Ga0065704_100799771 | 408 |
| 42 | 3300009148 | Ga0105243_10000018 | Ga0105243_10000018125 | 408 |
| 43 | 3300025273 | Ga0209673_1000339 | Ga0209673_10003395 | 408 |
| 44 | 3300025295 | Ga0209564_1023743 | Ga0209564_10237431 | 408 |
| 45 | 3300025297 | Ga0209758_1022385 | Ga0209758_10223851 | 408 |
| 46 | 3300025298 | Ga0209050_1000440 | Ga0209050_100044028 | 408 |
| 47 | 3300025302 | Ga0207426_1000933 | Ga0207426_100093323 | 408 |
| 48 | 3300025302 | Ga0207426_1002563 | Ga0207426_10025633 | 408 |
| 49 | 3300025304 | Ga0209257_1003230 | Ga0209257_100323010 | 408 |
| 50 | 3300025935 | Ga0207709_10000021 | Ga0207709_1000002171 | 408 |
| 51 | 3300025208 | Ga0209436_101750 | Ga0209436_1017502 | 409 |
| 52 | 3300025284 | Ga0209130_1006364 | Ga0209130_10063644 | 409 |
| 53 | 3300025302 | Ga0207426_1000525 | Ga0207426_100052541 | 409 |
| 54 | 3300047320 | Ga0495672_0026125 | Ga0495672_0026125_1330_2616 | 409 |
| 55 | 3300013307 | Ga0157372_10006556 | Ga0157372_100065562 | 410 |
| 56 | 3300031548 | Ga0307408_100000291 | Ga0307408_1000002915 | 411 |
| 57 | 3300003316 | rootH1_10035980 | rootH1_100359801 | 412 |
| 58 | 3300031507 | Ga0307509_10064977 | Ga0307509_100649771 | 412 |
| 59 | 3300035695 | Ga0373927_0011129 | Ga0373927_0011129_4240_5556 | 412 |
| 60 | 3300037068 | Ga0373925_0157364 | Ga0373925_0157364_344_1660 | 412 |
| 61 | 3300046460 | Ga0495638_0010167 | Ga0495638_0010167_2681_3997 | 412 |
| 62 | 3300053092 | Ga0500583_0000037 | Ga0500583_0000037_31258_32574 | 412 |
| 63 | 3300053092 | Ga0500583_0026416 | Ga0500583_0026416_241_1557 | 412 |
| 64 | 3300053147 | Ga0500589_010221 | Ga0500589_010221_1631_2947 | 412 |
| 65 | 3300031730 | Ga0307516_10000310 | Ga0307516_1000031033 | 413 |
| 66 | 3300042007 | Ga0439449_0017643 | Ga0439449_0017643_517_1842 | 413 |
| 67 | 3300046616 | Ga0495668_0000106 | Ga0495668_0000106_111855_113177 | 413 |
| 68 | 3300047318 | Ga0495636_0000075 | Ga0495636_0000075_27718_29046 | 413 |
| 69 | 3300005539 | Ga0068853_100031729 | Ga0068853_1000317294 | 414 |
| 70 | 3300005578 | Ga0068854_100072252 | Ga0068854_1000722523 | 414 |
| 71 | 3300005614 | Ga0068856_100046347 | Ga0068856_1000463471 | 414 |
| 72 | 3300009093 | Ga0105240_10022086 | Ga0105240_100220868 | 414 |
| 73 | 3300009174 | Ga0105241_10018266 | Ga0105241_100182661 | 414 |
| 74 | 3300009545 | Ga0105237_10007274 | Ga0105237_100072743 | 414 |
| 75 | 3300009545 | Ga0105237_10140065 | Ga0105237_101400651 | 414 |
| 76 | 3300009551 | Ga0105238_10019521 | Ga0105238_100195213 | 414 |
| 77 | 3300013307 | Ga0157372_10033647 | Ga0157372_100336474 | 414 |
| 78 | 3300025913 | Ga0207695_10001190 | Ga0207695_1000119010 | 414 |
| 79 | 3300025914 | Ga0207671_10000103 | Ga0207671_1000010382 | 414 |
| 80 | 3300025981 | Ga0207640_10076026 | Ga0207640_100760262 | 414 |
| 81 | 3300030521 | Ga0307511_10002930 | Ga0307511_1000293012 | 414 |
| 82 | 3300031456 | Ga0307513_10118413 | Ga0307513_101184131 | 414 |
| 83 | 3300048924 | Ga0496121_0000051 | Ga0496121_0000051_191020_192345 | 414 |
| 84 | 3300002738 | JGI25154J39366_1000021 | JGI25154J39366_100002188 | 415 |
| 85 | 3300003215 | JGI25153J46596_10003171 | JGI25153J46596_100031714 | 415 |
| 86 | 3300003354 | JGI25160J50197_1014100 | JGI25160J50197_10141002 | 415 |
| 87 | 3300005262 | Ga0065165_1008080 | Ga0065165_10080802 | 415 |
| 88 | 3300006353 | Ga0075370_10064390 | Ga0075370_100643902 | 415 |
| 89 | 3300025246 | Ga0209646_1000050 | Ga0209646_1000050166 | 415 |
| 90 | 3300025250 | Ga0209026_1000826 | Ga0209026_100082610 | 415 |
| 91 | 3300025297 | Ga0209758_1010862 | Ga0209758_10108624 | 415 |
| 92 | 3300025302 | Ga0207426_1000815 | Ga0207426_100081512 | 415 |
| 93 | 3300050496 | nmdc:mga07m45_118400_c1 | nmdc:mga07m45_118400_c1_169_1494 | 415 |
| 94 | 3300053131 | Ga0500652_003417 | Ga0500652_003417_1363_2688 | 415 |
| 95 | 3300009092 | Ga0105250_10022248 | Ga0105250_100222483 | 416 |
| 96 | 3300013100 | Ga0157373_10000107 | Ga0157373_1000010755 | 416 |
| 97 | 3300013104 | Ga0157370_10026562 | Ga0157370_100265626 | 416 |
| 98 | 3300013307 | Ga0157372_10005622 | Ga0157372_100056222 | 416 |
| 99 | 3300014497 | Ga0182008_10000011 | Ga0182008_10000011242 | 416 |
| 100 | 3300025919 | Ga0207657_10137348 | Ga0207657_101373482 | 416 |
| 101 | 3300026078 | Ga0207702_10082649 | Ga0207702_100826492 | 416 |
| 102 | 3300026116 | Ga0207674_10084397 | Ga0207674_100843971 | 416 |
| 103 | 3300031251 | Ga0265327_10065673 | Ga0265327_100656732 | 416 |
| 104 | 3300045051 | Ga0451576_0000022 | Ga0451576_0000022_427548_428882 | 416 |
| 105 | 3300046525 | Ga0495663_0000124 | Ga0495663_0000124_26961_28322 | 416 |
| 106 | 3300046533 | Ga0495640_0071735 | Ga0495640_0071735_665_1999 | 416 |
| 107 | 3300046538 | Ga0495609_0000225 | Ga0495609_0000225_28344_29705 | 416 |
| 108 | 3300049581 | Ga0501047_0125828 | Ga0501047_0125828_827_2152 | 416 |
| 109 | 3300049822 | Ga0501035_0203051 | Ga0501035_0203051_292_1617 | 416 |
| 110 | 3300053156 | Ga0500622_0000722 | Ga0500622_0000722_5917_7242 | 416 |
| 111 | 3300003761 | Ga0055535_1001800 | Ga0055535_10018006 | 417 |
| 112 | 3300003762 | Ga0055542_1005835 | Ga0055542_10058353 | 417 |
| 113 | 3300003794 | Ga0055531_10000015 | Ga0055531_1000001526 | 417 |
| 114 | 3300005338 | Ga0068868_100077038 | Ga0068868_1000770383 | 417 |
| 115 | 3300005364 | Ga0070673_100223552 | Ga0070673_1002235521 | 417 |
| 116 | 3300005367 | Ga0070667_100002640 | Ga0070667_1000026405 | 417 |
| 117 | 3300005617 | Ga0068859_100031009 | Ga0068859_1000310095 | 417 |
| 118 | 3300005834 | Ga0068851_10011250 | Ga0068851_100112504 | 417 |
| 119 | 3300005841 | Ga0068863_100029101 | Ga0068863_1000291012 | 417 |
| 120 | 3300005843 | Ga0068860_100001511 | Ga0068860_10000151118 | 417 |
| 121 | 3300006237 | Ga0097621_100060893 | Ga0097621_1000608933 | 417 |
| 122 | 3300006358 | Ga0068871_100174091 | Ga0068871_1001740911 | 417 |
| 123 | 3300006931 | Ga0097620_100031009 | Ga0097620_1000310095 | 417 |
| 124 | 3300013297 | Ga0157378_10243367 | Ga0157378_102433672 | 417 |
| 125 | 3300013308 | Ga0157375_10158391 | Ga0157375_101583911 | 417 |
| 126 | 3300014969 | Ga0157376_10006924 | Ga0157376_100069248 | 417 |
| 127 | 3300025242 | Ga0209258_100193 | Ga0209258_10019328 | 417 |
| 128 | 3300025254 | Ga0209148_1000167 | Ga0209148_100016788 | 417 |
| 129 | 3300025304 | Ga0209257_1000005 | Ga0209257_1000005439 | 417 |
| 130 | 3300025986 | Ga0207658_10021523 | Ga0207658_100215231 | 417 |
| 131 | 3300026023 | Ga0207677_10017048 | Ga0207677_100170484 | 417 |
| 132 | 3300028381 | Ga0268264_10001196 | Ga0268264_1000119616 | 417 |
| 133 | 3300031251 | Ga0265327_10000097 | Ga0265327_10000097120 | 417 |
| 134 | 3300031251 | Ga0265327_10000098 | Ga0265327_10000098128 | 417 |
| 135 | 3300041997 | Ga0439431_0000662 | Ga0439431_0000662_1596_2915 | 417 |
| 136 | 3300044842 | Ga0466957_0027271 | Ga0466957_0027271_1526_2851 | 417 |
| 137 | 3300053088 | Ga0500644_0000310 | Ga0500644_0000310_10919_12244 | 417 |
| 138 | 3300053177 | Ga0500636_0004929 | Ga0500636_0004929_948_2429 | 417 |
| 139 | iso_pu_bacteria | 2738541278 | 2738726072 | 417 |
| 140 | iso_pu_bacteria | 2840677318 | 2840679371 | 417 |
| 141 | iso_pu_bacteria | 2896085136 | 2896087182 | 417 |
| 142 | 2162886007 | SwRhRL2b_contig_3910478 | SwRhRL2b_0926.00008020 | 418 |
| 143 | 3300005288 | Ga0065714_10003604 | Ga0065714_1000360414 | 418 |
| 144 | 3300005289 | Ga0065704_10000317 | Ga0065704_1000031724 | 418 |
| 145 | 3300005335 | Ga0070666_10000038 | Ga0070666_1000003884 | 418 |
| 146 | 3300005367 | Ga0070667_100017912 | Ga0070667_1000179122 | 418 |
| 147 | 3300005539 | Ga0068853_100006052 | Ga0068853_1000060521 | 418 |
| 148 | 3300005617 | Ga0068859_100000007 | Ga0068859_10000000790 | 418 |
| 149 | 3300005618 | Ga0068864_100000685 | Ga0068864_10000068514 | 418 |
| 150 | 3300005841 | Ga0068863_100018440 | Ga0068863_1000184403 | 418 |
| 151 | 3300005842 | Ga0068858_100003163 | Ga0068858_1000031637 | 418 |
| 152 | 3300005843 | Ga0068860_100012160 | Ga0068860_1000121606 | 418 |
| 153 | 3300006931 | Ga0097620_100000007 | Ga0097620_10000000791 | 418 |
| 154 | 3300009174 | Ga0105241_10000104 | Ga0105241_1000010455 | 418 |
| 155 | 3300009545 | Ga0105237_10040911 | Ga0105237_100409115 | 418 |
| 156 | 3300009551 | Ga0105238_10077512 | Ga0105238_100775122 | 418 |
| 157 | 3300009553 | Ga0105249_10009352 | Ga0105249_100093526 | 418 |
| 158 | 3300010375 | Ga0105239_10159568 | Ga0105239_101595682 | 418 |
| 159 | 3300011119 | Ga0105246_10051012 | Ga0105246_100510121 | 418 |
| 160 | 3300013102 | Ga0157371_10000629 | Ga0157371_1000062919 | 418 |
| 161 | 3300013102 | Ga0157371_10000884 | Ga0157371_1000088422 | 418 |
| 162 | 3300013104 | Ga0157370_10020992 | Ga0157370_100209923 | 418 |
| 163 | 3300013104 | Ga0157370_10087796 | Ga0157370_100877962 | 418 |
| 164 | 3300013297 | Ga0157378_10225237 | Ga0157378_102252372 | 418 |
| 165 | 3300013306 | Ga0163162_10000226 | Ga0163162_1000022618 | 418 |
| 166 | 3300013308 | Ga0157375_10117991 | Ga0157375_101179912 | 418 |
| 167 | 3300014325 | Ga0163163_10012983 | Ga0163163_100129838 | 418 |
| 168 | 3300014497 | Ga0182008_10000047 | Ga0182008_1000004725 | 418 |
| 169 | 3300015261 | Ga0182006_1009584 | Ga0182006_10095842 | 418 |
| 170 | 3300025903 | Ga0207680_10000015 | Ga0207680_1000001586 | 418 |
| 171 | 3300025914 | Ga0207671_10001528 | Ga0207671_1000152819 | 418 |
| 172 | 3300025942 | Ga0207689_10004656 | Ga0207689_100046562 | 418 |
| 173 | 3300025986 | Ga0207658_10034253 | Ga0207658_100342534 | 418 |
| 174 | 3300026035 | Ga0207703_10007227 | Ga0207703_100072279 | 418 |
| 175 | 3300026088 | Ga0207641_10000056 | Ga0207641_1000005685 | 418 |
| 176 | 3300026095 | Ga0207676_10024265 | Ga0207676_100242654 | 418 |
| 177 | 3300028381 | Ga0268264_10001996 | Ga0268264_1000199617 | 418 |
| 178 | 3300028794 | Ga0307515_10000078 | Ga0307515_1000007850 | 418 |
| 179 | 3300031911 | Ga0307412_10000001 | Ga0307412_10000001598 | 418 |
| 180 | 3300032004 | Ga0307414_10008242 | Ga0307414_100082424 | 418 |
| 181 | 3300044658 | Ga0466972_0008451 | Ga0466972_0008451_1044_2360 | 418 |
| 182 | 3300047472 | Ga0495686_0000270 | Ga0495686_0000270_50359_51672 | 418 |
| 183 | 3300048917 | Ga0496114_0000400 | Ga0496114_0000400_11580_12926 | 418 |
| 184 | 3300053139 | Ga0500568_0033961 | Ga0500568_0033961_318_1646 | 418 |
| 185 | 3300053153 | Ga0500616_0008456 | Ga0500616_0008456_2484_3809 | 418 |
| 186 | 3300003320 | rootH2_10002788 | rootH2_1000278812 | 419 |
| 187 | 3300003320 | rootH2_10039222 | rootH2_100392224 | 419 |
| 188 | 3300005289 | Ga0065704_10074432 | Ga0065704_100744322 | 419 |
| 189 | 3300005331 | Ga0070670_100184203 | Ga0070670_1001842032 | 419 |
| 190 | 3300005563 | Ga0068855_100100872 | Ga0068855_1001008722 | 419 |
| 191 | 3300005577 | Ga0068857_100005598 | Ga0068857_1000055987 | 419 |
| 192 | 3300005578 | Ga0068854_100007508 | Ga0068854_1000075086 | 419 |
| 193 | 3300005614 | Ga0068856_100151090 | Ga0068856_1001510902 | 419 |
| 194 | 3300005616 | Ga0068852_100001659 | Ga0068852_1000016599 | 419 |
| 195 | 3300005718 | Ga0068866_10037107 | Ga0068866_100371073 | 419 |
| 196 | 3300005843 | Ga0068860_100007061 | Ga0068860_1000070616 | 419 |
| 197 | 3300006881 | Ga0068865_100088202 | Ga0068865_1000882021 | 419 |
| 198 | 3300009545 | Ga0105237_10004350 | Ga0105237_100043508 | 419 |
| 199 | 3300009545 | Ga0105237_10211739 | Ga0105237_102117392 | 419 |
| 200 | 3300010375 | Ga0105239_10000936 | Ga0105239_1000093631 | 419 |
| 201 | 3300010375 | Ga0105239_10030519 | Ga0105239_100305192 | 419 |
| 202 | 3300013102 | Ga0157371_10000012 | Ga0157371_10000012261 | 419 |
| 203 | 3300013105 | Ga0157369_10000224 | Ga0157369_1000022429 | 419 |
| 204 | 3300013307 | Ga0157372_10048401 | Ga0157372_100484016 | 419 |
| 205 | 3300025904 | Ga0207647_10014937 | Ga0207647_100149372 | 419 |
| 206 | 3300025914 | Ga0207671_10031834 | Ga0207671_100318344 | 419 |
| 207 | 3300025949 | Ga0207667_10001711 | Ga0207667_1000171111 | 419 |
| 208 | 3300026078 | Ga0207702_10206103 | Ga0207702_102061031 | 419 |
| 209 | 3300026089 | Ga0207648_10256663 | Ga0207648_102566631 | 419 |
| 210 | 3300026116 | Ga0207674_10010073 | Ga0207674_100100735 | 419 |
| 211 | 3300026142 | Ga0207698_10003137 | Ga0207698_100031373 | 419 |
| 212 | 3300028381 | Ga0268264_10026440 | Ga0268264_100264402 | 419 |
| 213 | 3300031507 | Ga0307509_10087071 | Ga0307509_100870711 | 419 |
| 214 | 3300031616 | Ga0307508_10005346 | Ga0307508_100053466 | 419 |
| 215 | 3300042014 | Ga0439457_002182 | Ga0439457_002182_2103_3419 | 419 |
| 216 | 3300044842 | Ga0466957_0000383 | Ga0466957_0000383_3899_5215 | 419 |
| 217 | 3300046457 | Ga0495590_0015951 | Ga0495590_0015951_16_1380 | 419 |
| 218 | 3300046616 | Ga0495668_0003962 | Ga0495668_0003962_4976_6328 | 419 |
| 219 | 3300046648 | Ga0495611_0000231 | Ga0495611_0000231_4851_6170 | 419 |
| 220 | 3300053086 | Ga0500578_0001201 | Ga0500578_0001201_25825_27141 | 419 |
| 221 | 3300053096 | Ga0500641_0035980 | Ga0500641_0035980_263_1615 | 419 |
| 222 | 3300053153 | Ga0500616_0006607 | Ga0500616_0006607_5953_7305 | 419 |
| 223 | iso_pu_bacteria | 2585428061 | 2587750507 | 419 |
| 224 | iso_pu_bacteria | 2818991442 | 2819577170 | 419 |
| 225 | iso_pu_bacteria | 2818991444 | 2819589844 | 419 |
| 226 | iso_pu_bacteria | 2818991460 | 2819676322 | 419 |
| 227 | iso_pu_bacteria | 2821136567 | 2821140457 | 419 |
| 228 | iso_pu_bacteria | 2884791551 | 2884796149 | 419 |
| 229 | iso_pu_bacteria | 2904467357 | 2904472876 | 419 |
| 230 | iso_pu_bacteria | 2929154850 | 2929160071 | 419 |
| 231 | iso_pu_bacteria | 2929177148 | 2929178337 | 419 |
| 232 | iso_pu_bacteria | 2929239360 | 2929240637 | 419 |
| 233 | iso_pu_bacteria | 2929921140 | 2929922487 | 419 |
| 234 | iso_pu_bacteria | 2945977869 | 2945980703 | 419 |
| 235 | iso_pu_bacteria | 2946013367 | 2946013430 | 419 |
| 236 | iso_pu_bacteria | 8003151029 | 8003156411 | 419 |
| 237 | 3300005338 | Ga0068868_100088249 | Ga0068868_1000882492 | 420 |
| 238 | 3300005343 | Ga0070687_100052398 | Ga0070687_1000523982 | 420 |
| 239 | 3300005459 | Ga0068867_100033978 | Ga0068867_1000339785 | 420 |
| 240 | 3300005471 | Ga0070698_100000267 | Ga0070698_1000002675 | 420 |
| 241 | 3300005543 | Ga0070672_100035517 | Ga0070672_1000355172 | 420 |
| 242 | 3300005544 | Ga0070686_100032749 | Ga0070686_1000327492 | 420 |
| 243 | 3300005563 | Ga0068855_100017041 | Ga0068855_1000170416 | 420 |
| 244 | 3300005564 | Ga0070664_100020306 | Ga0070664_1000203065 | 420 |
| 245 | 3300005614 | Ga0068856_100036347 | Ga0068856_1000363471 | 420 |
| 246 | 3300005615 | Ga0070702_100007104 | Ga0070702_1000071046 | 420 |
| 247 | 3300009094 | Ga0111539_10167665 | Ga0111539_101676653 | 420 |
| 248 | 3300009147 | Ga0114129_10000608 | Ga0114129_1000060816 | 420 |
| 249 | 3300009545 | Ga0105237_10015845 | Ga0105237_100158453 | 420 |
| 250 | 3300010375 | Ga0105239_10127795 | Ga0105239_101277951 | 420 |
| 251 | 3300013297 | Ga0157378_10004574 | Ga0157378_1000457411 | 420 |
| 252 | 3300014745 | Ga0157377_10003043 | Ga0157377_100030435 | 420 |
| 253 | 3300025907 | Ga0207645_10036710 | Ga0207645_100367103 | 420 |
| 254 | 3300025913 | Ga0207695_10185750 | Ga0207695_101857502 | 420 |
| 255 | 3300025931 | Ga0207644_10079226 | Ga0207644_100792262 | 420 |
| 256 | 3300025940 | Ga0207691_10042147 | Ga0207691_100421474 | 420 |
| 257 | 3300025945 | Ga0207679_10021342 | Ga0207679_100213422 | 420 |
| 258 | 3300025949 | Ga0207667_10106243 | Ga0207667_101062432 | 420 |
| 259 | 3300025960 | Ga0207651_10116429 | Ga0207651_101164292 | 420 |
| 260 | 3300026075 | Ga0207708_10143607 | Ga0207708_101436071 | 420 |
| 261 | 3300026078 | Ga0207702_10054227 | Ga0207702_100542271 | 420 |
| 262 | 3300026142 | Ga0207698_10112943 | Ga0207698_101129433 | 420 |
| 263 | 3300027907 | Ga0207428_10096411 | Ga0207428_100964113 | 420 |
| 264 | 3300031507 | Ga0307509_10098566 | Ga0307509_100985663 | 420 |
| 265 | 3300031548 | Ga0307408_100004481 | Ga0307408_1000044811 | 420 |
| 266 | 3300031616 | Ga0307508_10129582 | Ga0307508_101295821 | 420 |
| 267 | 3300031911 | Ga0307412_10004155 | Ga0307412_100041557 | 420 |
| 268 | 3300033180 | Ga0307510_10001062 | Ga0307510_1000106218 | 420 |
| 269 | 3300044656 | Ga0466969_0000382 | Ga0466969_0000382_7661_8980 | 420 |
| 270 | 3300044673 | Ga0453683_0009781 | Ga0453683_0009781_1860_3173 | 420 |
| 271 | 3300044684 | Ga0466966_0000176 | Ga0466966_0000176_2031_3350 | 420 |
| 272 | 3300044712 | Ga0453684_0012652 | Ga0453684_0012652_7352_8689 | 420 |
| 273 | 3300044842 | Ga0466957_0000577 | Ga0466957_0000577_10390_11703 | 420 |
| 274 | 3300045049 | Ga0466959_0000016 | Ga0466959_0000016_50541_51860 | 420 |
| 275 | 3300045051 | Ga0451576_0001027 | Ga0451576_0001027_28935_30248 | 420 |
| 276 | 3300045051 | Ga0451576_0020942 | Ga0451576_0020942_5272_6585 | 420 |
| 277 | 3300046460 | Ga0495638_0072589 | Ga0495638_0072589_155_1474 | 420 |
| 278 | 3300048919 | Ga0496116_0002707 | Ga0496116_0002707_13676_15016 | 420 |
| 279 | 3300048920 | Ga0496117_0001260 | Ga0496117_0001260_18632_19972 | 420 |
| 280 | 3300048925 | Ga0496122_0004732 | Ga0496122_0004732_180_1520 | 420 |
| 281 | 3300048926 | Ga0496123_0038536 | Ga0496123_0038536_1213_2553 | 420 |
| 282 | 3300048927 | Ga0496124_0049230 | Ga0496124_0049230_2155_3495 | 420 |
| 283 | 3300050507 | nmdc:mga05p37_914_c1 | nmdc:mga05p37_914_c1_15168_16487 | 420 |
| 284 | 3300050511 | nmdc:mga08y16_74131_c1 | nmdc:mga08y16_74131_c1_1243_2574 | 420 |
| 285 | 3300053158 | Ga0500627_0005009 | Ga0500627_0005009_2746_4098 | 420 |
| 286 | iso_pu_bacteria | 2599185184 | 2599480785 | 420 |
| 287 | iso_pu_bacteria | 2721755487 | 2722726532 | 420 |
| 288 | iso_pu_bacteria | 2842903701 | 2842904940 | 420 |
| 289 | iso_pu_bacteria | 2852623160 | 2852626522 | 420 |
| 290 | iso_pu_bacteria | 2881955468 | 2881957951 | 420 |
| 291 | iso_pu_bacteria | 2884933994 | 2884934948 | 420 |
| 292 | iso_pu_bacteria | 2904780799 | 2904783607 | 420 |
| 293 | iso_pu_bacteria | 2919177583 | 2919182158 | 420 |
| 294 | iso_pu_bacteria | 2919437846 | 2919439718 | 420 |
| 295 | iso_pu_bacteria | 2928078545 | 2928081679 | 420 |
| 296 | iso_pu_bacteria | 2928147474 | 2928150293 | 420 |
| 297 | iso_pu_bacteria | 2932082852 | 2932085115 | 420 |
| 298 | iso_pu_bacteria | 2977232053 | 2977234672 | 420 |
| 299 | 3300005331 | Ga0070670_100005343 | Ga0070670_1000053435 | 421 |
| 300 | 3300005336 | Ga0070680_100004673 | Ga0070680_1000046731 | 421 |
| 301 | 3300005336 | Ga0070680_100086978 | Ga0070680_1000869783 | 421 |
| 302 | 3300005530 | Ga0070679_100056287 | Ga0070679_1000562871 | 421 |
| 303 | 3300005530 | Ga0070679_100056404 | Ga0070679_1000564041 | 421 |
| 304 | 3300005563 | Ga0068855_100000145 | Ga0068855_10000014528 | 421 |
| 305 | 3300009093 | Ga0105240_10000414 | Ga0105240_1000041469 | 421 |
| 306 | 3300009093 | Ga0105240_10038947 | Ga0105240_100389472 | 421 |
| 307 | 3300009093 | Ga0105240_10042144 | Ga0105240_100421446 | 421 |
| 308 | 3300009093 | Ga0105240_10140154 | Ga0105240_101401542 | 421 |
| 309 | 3300009545 | Ga0105237_10009111 | Ga0105237_100091112 | 421 |
| 310 | 3300013102 | Ga0157371_10043804 | Ga0157371_100438042 | 421 |
| 311 | 3300013102 | Ga0157371_10148825 | Ga0157371_101488252 | 421 |
| 312 | 3300013105 | Ga0157369_10042378 | Ga0157369_100423787 | 421 |
| 313 | 3300013105 | Ga0157369_10088874 | Ga0157369_100888745 | 421 |
| 314 | 3300013307 | Ga0157372_10038641 | Ga0157372_100386414 | 421 |
| 315 | 3300013307 | Ga0157372_10045710 | Ga0157372_100457103 | 421 |
| 316 | 3300021384 | Ga0213876_10001070 | Ga0213876_100010703 | 421 |
| 317 | 3300025909 | Ga0207705_10001443 | Ga0207705_1000144312 | 421 |
| 318 | 3300025909 | Ga0207705_10010408 | Ga0207705_100104085 | 421 |
| 319 | 3300025913 | Ga0207695_10000169 | Ga0207695_1000016978 | 421 |
| 320 | 3300025913 | Ga0207695_10000238 | Ga0207695_10000238111 | 421 |
| 321 | 3300025913 | Ga0207695_10060277 | Ga0207695_100602775 | 421 |
| 322 | 3300025914 | Ga0207671_10005708 | Ga0207671_100057087 | 421 |
| 323 | 3300025921 | Ga0207652_10000187 | Ga0207652_100001871 | 421 |
| 324 | 3300025921 | Ga0207652_10061169 | Ga0207652_100611694 | 421 |
| 325 | 3300025944 | Ga0207661_10245042 | Ga0207661_102450421 | 421 |
| 326 | 3300025949 | Ga0207667_10000508 | Ga0207667_1000050833 | 421 |
| 327 | 3300025949 | Ga0207667_10291853 | Ga0207667_102918532 | 421 |
| 328 | 3300025960 | Ga0207651_10108640 | Ga0207651_101086402 | 421 |
| 329 | 3300026041 | Ga0207639_10094893 | Ga0207639_100948932 | 421 |
| 330 | 3300026067 | Ga0207678_10023821 | Ga0207678_100238213 | 421 |
| 331 | 3300026116 | Ga0207674_10210909 | Ga0207674_102109091 | 421 |
| 332 | 3300031344 | Ga0265316_10045776 | Ga0265316_100457763 | 421 |
| 333 | 3300031824 | Ga0307413_10013318 | Ga0307413_100133182 | 421 |
| 334 | 3300037312 | Ga0395899_0136320 | Ga0395899_0136320_59_1381 | 421 |
| 335 | 3300037418 | Ga0395900_0030141 | Ga0395900_0030141_2596_3918 | 421 |
| 336 | 3300038443 | Ga0395901_0102280 | Ga0395901_0102280_511_1833 | 421 |
| 337 | 3300039437 | Ga0436365_1153427 | Ga0436365_1153427_4187_5509 | 421 |
| 338 | 3300042876 | Ga0451577_0022294 | Ga0451577_0022294_1343_2662 | 421 |
| 339 | 3300044712 | Ga0453684_0012596 | Ga0453684_0012596_6471_7790 | 421 |
| 340 | 3300044712 | Ga0453684_0029368 | Ga0453684_0029368_4444_5763 | 421 |
| 341 | 3300046507 | Ga0495606_0002808 | Ga0495606_0002808_9606_10925 | 421 |
| 342 | 3300046558 | Ga0495633_0000085 | Ga0495633_0000085_31640_32965 | 421 |
| 343 | 3300053109 | Ga0500569_000069 | Ga0500569_000069_10614_11939 | 421 |
| 344 | 3300053142 | Ga0500577_0001007 | Ga0500577_0001007_670_1995 | 421 |
| 345 | 3300053153 | Ga0500616_0005085 | Ga0500616_0005085_4295_5620 | 421 |
| 346 | 3300003322 | rootL2_10212212 | rootL2_102122121 | 422 |
| 347 | 3300005290 | Ga0065712_10003409 | Ga0065712_100034092 | 422 |
| 348 | 3300005290 | Ga0065712_10017029 | Ga0065712_100170293 | 422 |
| 349 | 3300005295 | Ga0065707_10142526 | Ga0065707_101425262 | 422 |
| 350 | 3300005328 | Ga0070676_10018602 | Ga0070676_100186022 | 422 |
| 351 | 3300005329 | Ga0070683_100000468 | Ga0070683_10000046827 | 422 |
| 352 | 3300005329 | Ga0070683_100099234 | Ga0070683_1000992342 | 422 |
| 353 | 3300005329 | Ga0070683_100119074 | Ga0070683_1001190742 | 422 |
| 354 | 3300005331 | Ga0070670_100019418 | Ga0070670_1000194185 | 422 |
| 355 | 3300005331 | Ga0070670_100123883 | Ga0070670_1001238832 | 422 |
| 356 | 3300005331 | Ga0070670_100138870 | Ga0070670_1001388702 | 422 |
| 357 | 3300005331 | Ga0070670_100185747 | Ga0070670_1001857471 | 422 |
| 358 | 3300005333 | Ga0070677_10018936 | Ga0070677_100189362 | 422 |
| 359 | 3300005334 | Ga0068869_100003551 | Ga0068869_1000035512 | 422 |
| 360 | 3300005334 | Ga0068869_100009768 | Ga0068869_1000097686 | 422 |
| 361 | 3300005334 | Ga0068869_100017086 | Ga0068869_1000170865 | 422 |
| 362 | 3300005335 | Ga0070666_10004991 | Ga0070666_100049913 | 422 |
| 363 | 3300005335 | Ga0070666_10017523 | Ga0070666_100175234 | 422 |
| 364 | 3300005336 | Ga0070680_100000107 | Ga0070680_10000010714 | 422 |
| 365 | 3300005337 | Ga0070682_100004790 | Ga0070682_1000047906 | 422 |
| 366 | 3300005338 | Ga0068868_100052245 | Ga0068868_1000522453 | 422 |
| 367 | 3300005340 | Ga0070689_100067418 | Ga0070689_1000674181 | 422 |
| 368 | 3300005340 | Ga0070689_100166102 | Ga0070689_1001661021 | 422 |
| 369 | 3300005341 | Ga0070691_10001904 | Ga0070691_100019045 | 422 |
| 370 | 3300005344 | Ga0070661_100000179 | Ga0070661_10000017952 | 422 |
| 371 | 3300005344 | Ga0070661_100003133 | Ga0070661_10000313313 | 422 |
| 372 | 3300005347 | Ga0070668_100113087 | Ga0070668_1001130872 | 422 |
| 373 | 3300005354 | Ga0070675_100020576 | Ga0070675_1000205765 | 422 |
| 374 | 3300005354 | Ga0070675_100049081 | Ga0070675_1000490813 | 422 |
| 375 | 3300005355 | Ga0070671_100114425 | Ga0070671_1001144251 | 422 |
| 376 | 3300005364 | Ga0070673_100008952 | Ga0070673_1000089521 | 422 |
| 377 | 3300005365 | Ga0070688_100045498 | Ga0070688_1000454982 | 422 |
| 378 | 3300005365 | Ga0070688_100052769 | Ga0070688_1000527691 | 422 |
| 379 | 3300005366 | Ga0070659_100057148 | Ga0070659_1000571482 | 422 |
| 380 | 3300005366 | Ga0070659_100129852 | Ga0070659_1001298522 | 422 |
| 381 | 3300005367 | Ga0070667_100037416 | Ga0070667_1000374163 | 422 |
| 382 | 3300005455 | Ga0070663_100076544 | Ga0070663_1000765441 | 422 |
| 383 | 3300005456 | Ga0070678_100014866 | Ga0070678_1000148661 | 422 |
| 384 | 3300005456 | Ga0070678_100099416 | Ga0070678_1000994162 | 422 |
| 385 | 3300005458 | Ga0070681_10018750 | Ga0070681_100187505 | 422 |
| 386 | 3300005459 | Ga0068867_100011635 | Ga0068867_1000116352 | 422 |
| 387 | 3300005459 | Ga0068867_100022600 | Ga0068867_1000226005 | 422 |
| 388 | 3300005459 | Ga0068867_100026385 | Ga0068867_1000263854 | 422 |
| 389 | 3300005459 | Ga0068867_100049645 | Ga0068867_1000496452 | 422 |
| 390 | 3300005459 | Ga0068867_100146902 | Ga0068867_1001469021 | 422 |
| 391 | 3300005459 | Ga0068867_100175174 | Ga0068867_1001751741 | 422 |
| 392 | 3300005466 | Ga0070685_10014741 | Ga0070685_100147413 | 422 |
| 393 | 3300005471 | Ga0070698_100056165 | Ga0070698_1000561653 | 422 |
| 394 | 3300005530 | Ga0070679_100004867 | Ga0070679_1000048675 | 422 |
| 395 | 3300005535 | Ga0070684_100015367 | Ga0070684_1000153675 | 422 |
| 396 | 3300005535 | Ga0070684_100054702 | Ga0070684_1000547023 | 422 |
| 397 | 3300005539 | Ga0068853_100005569 | Ga0068853_10000556911 | 422 |
| 398 | 3300005539 | Ga0068853_100205012 | Ga0068853_1002050121 | 422 |
| 399 | 3300005543 | Ga0070672_100066688 | Ga0070672_1000666883 | 422 |
| 400 | 3300005544 | Ga0070686_100045558 | Ga0070686_1000455582 | 422 |
| 401 | 3300005547 | Ga0070693_100001913 | Ga0070693_1000019134 | 422 |
| 402 | 3300005548 | Ga0070665_100000094 | Ga0070665_10000009444 | 422 |
| 403 | 3300005548 | Ga0070665_100061303 | Ga0070665_1000613031 | 422 |
| 404 | 3300005548 | Ga0070665_100307857 | Ga0070665_1003078571 | 422 |
| 405 | 3300005563 | Ga0068855_100107195 | Ga0068855_1001071954 | 422 |
| 406 | 3300005564 | Ga0070664_100000140 | Ga0070664_10000014031 | 422 |
| 407 | 3300005564 | Ga0070664_100025386 | Ga0070664_1000253866 | 422 |
| 408 | 3300005564 | Ga0070664_100076654 | Ga0070664_1000766542 | 422 |
| 409 | 3300005564 | Ga0070664_100167278 | Ga0070664_1001672782 | 422 |
| 410 | 3300005577 | Ga0068857_100014523 | Ga0068857_1000145233 | 422 |
| 411 | 3300005577 | Ga0068857_100317976 | Ga0068857_1003179761 | 422 |
| 412 | 3300005578 | Ga0068854_100051058 | Ga0068854_1000510582 | 422 |
| 413 | 3300005614 | Ga0068856_100045155 | Ga0068856_1000451551 | 422 |
| 414 | 3300005616 | Ga0068852_100071704 | Ga0068852_1000717042 | 422 |
| 415 | 3300005617 | Ga0068859_100005939 | Ga0068859_10000593912 | 422 |
| 416 | 3300005617 | Ga0068859_100076094 | Ga0068859_1000760944 | 422 |
| 417 | 3300005617 | Ga0068859_100165504 | Ga0068859_1001655042 | 422 |
| 418 | 3300005617 | Ga0068859_100339039 | Ga0068859_1003390392 | 422 |
| 419 | 3300005618 | Ga0068864_100061903 | Ga0068864_1000619034 | 422 |
| 420 | 3300005719 | Ga0068861_100019358 | Ga0068861_1000193584 | 422 |
| 421 | 3300005719 | Ga0068861_100061537 | Ga0068861_1000615373 | 422 |
| 422 | 3300005719 | Ga0068861_100179625 | Ga0068861_1001796251 | 422 |
| 423 | 3300005834 | Ga0068851_10014891 | Ga0068851_100148912 | 422 |
| 424 | 3300005841 | Ga0068863_100073091 | Ga0068863_1000730911 | 422 |
| 425 | 3300005842 | Ga0068858_100041888 | Ga0068858_1000418882 | 422 |
| 426 | 3300005842 | Ga0068858_100082551 | Ga0068858_1000825512 | 422 |
| 427 | 3300005843 | Ga0068860_100003681 | Ga0068860_1000036817 | 422 |
| 428 | 3300005843 | Ga0068860_100014136 | Ga0068860_1000141365 | 422 |
| 429 | 3300005843 | Ga0068860_100094546 | Ga0068860_1000945463 | 422 |
| 430 | 3300005843 | Ga0068860_100248020 | Ga0068860_1002480202 | 422 |
| 431 | 3300005844 | Ga0068862_100085605 | Ga0068862_1000856052 | 422 |
| 432 | 3300005985 | Ga0081539_10076014 | Ga0081539_100760142 | 422 |
| 433 | 3300006195 | Ga0075366_10004374 | Ga0075366_100043742 | 422 |
| 434 | 3300006195 | Ga0075366_10009009 | Ga0075366_100090097 | 422 |
| 435 | 3300006237 | Ga0097621_100003509 | Ga0097621_1000035095 | 422 |
| 436 | 3300006237 | Ga0097621_100054450 | Ga0097621_1000544502 | 422 |
| 437 | 3300006237 | Ga0097621_100077188 | Ga0097621_1000771883 | 422 |
| 438 | 3300006237 | Ga0097621_100084224 | Ga0097621_1000842242 | 422 |
| 439 | 3300006358 | Ga0068871_100003013 | Ga0068871_1000030136 | 422 |
| 440 | 3300006358 | Ga0068871_100005842 | Ga0068871_1000058422 | 422 |
| 441 | 3300006358 | Ga0068871_100113868 | Ga0068871_1001138681 | 422 |
| 442 | 3300006844 | Ga0075428_100003257 | Ga0075428_10000325719 | 422 |
| 443 | 3300006844 | Ga0075428_100019714 | Ga0075428_1000197145 | 422 |
| 444 | 3300006844 | Ga0075428_100216185 | Ga0075428_1002161851 | 422 |
| 445 | 3300006871 | Ga0075434_100052957 | Ga0075434_1000529573 | 422 |
| 446 | 3300006880 | Ga0075429_100015711 | Ga0075429_1000157117 | 422 |
| 447 | 3300006881 | Ga0068865_100002580 | Ga0068865_1000025802 | 422 |
| 448 | 3300006881 | Ga0068865_100059325 | Ga0068865_1000593252 | 422 |
| 449 | 3300006881 | Ga0068865_100108219 | Ga0068865_1001082193 | 422 |
| 450 | 3300006931 | Ga0097620_100005939 | Ga0097620_10000593912 | 422 |
| 451 | 3300006931 | Ga0097620_100076089 | Ga0097620_1000760894 | 422 |
| 452 | 3300006931 | Ga0097620_100165510 | Ga0097620_1001655102 | 422 |
| 453 | 3300006931 | Ga0097620_100339031 | Ga0097620_1003390311 | 422 |
| 454 | 3300009093 | Ga0105240_10002372 | Ga0105240_100023725 | 422 |
| 455 | 3300009093 | Ga0105240_10116448 | Ga0105240_101164482 | 422 |
| 456 | 3300009093 | Ga0105240_10321503 | Ga0105240_103215031 | 422 |
| 457 | 3300009101 | Ga0105247_10070602 | Ga0105247_100706022 | 422 |
| 458 | 3300009101 | Ga0105247_10087330 | Ga0105247_100873302 | 422 |
| 459 | 3300009147 | Ga0114129_10352293 | Ga0114129_103522932 | 422 |
| 460 | 3300009147 | Ga0114129_10583300 | Ga0114129_105833001 | 422 |
| 461 | 3300009174 | Ga0105241_10002801 | Ga0105241_100028016 | 422 |
| 462 | 3300009176 | Ga0105242_10008462 | Ga0105242_100084625 | 422 |
| 463 | 3300009176 | Ga0105242_10037587 | Ga0105242_100375873 | 422 |
| 464 | 3300009176 | Ga0105242_10066895 | Ga0105242_100668954 | 422 |
| 465 | 3300009176 | Ga0105242_10142795 | Ga0105242_101427952 | 422 |
| 466 | 3300009177 | Ga0105248_10112229 | Ga0105248_101122293 | 422 |
| 467 | 3300009545 | Ga0105237_10002964 | Ga0105237_100029642 | 422 |
| 468 | 3300009545 | Ga0105237_10076443 | Ga0105237_100764433 | 422 |
| 469 | 3300009545 | Ga0105237_10089416 | Ga0105237_100894162 | 422 |
| 470 | 3300009551 | Ga0105238_10121922 | Ga0105238_101219222 | 422 |
| 471 | 3300009553 | Ga0105249_10000177 | Ga0105249_1000017754 | 422 |
| 472 | 3300009553 | Ga0105249_10013585 | Ga0105249_100135854 | 422 |
| 473 | 3300010375 | Ga0105239_10350555 | Ga0105239_103505551 | 422 |
| 474 | 3300011119 | Ga0105246_10019297 | Ga0105246_100192975 | 422 |
| 475 | 3300013104 | Ga0157370_10008544 | Ga0157370_100085445 | 422 |
| 476 | 3300013104 | Ga0157370_10063980 | Ga0157370_100639802 | 422 |
| 477 | 3300013296 | Ga0157374_10000237 | Ga0157374_1000023716 | 422 |
| 478 | 3300013296 | Ga0157374_10005388 | Ga0157374_100053884 | 422 |
| 479 | 3300013297 | Ga0157378_10020420 | Ga0157378_100204204 | 422 |
| 480 | 3300013297 | Ga0157378_10111792 | Ga0157378_101117921 | 422 |
| 481 | 3300013306 | Ga0163162_10006217 | Ga0163162_1000621711 | 422 |
| 482 | 3300013306 | Ga0163162_10011350 | Ga0163162_100113504 | 422 |
| 483 | 3300013306 | Ga0163162_10084395 | Ga0163162_100843952 | 422 |
| 484 | 3300013306 | Ga0163162_10234127 | Ga0163162_102341272 | 422 |
| 485 | 3300013306 | Ga0163162_10290308 | Ga0163162_102903081 | 422 |
| 486 | 3300013308 | Ga0157375_10096069 | Ga0157375_100960692 | 422 |
| 487 | 3300013308 | Ga0157375_10158696 | Ga0157375_101586962 | 422 |
| 488 | 3300013308 | Ga0157375_10450244 | Ga0157375_104502441 | 422 |
| 489 | 3300014325 | Ga0163163_10000088 | Ga0163163_1000008859 | 422 |
| 490 | 3300014326 | Ga0157380_10063533 | Ga0157380_100635331 | 422 |
| 491 | 3300014326 | Ga0157380_10143391 | Ga0157380_101433912 | 422 |
| 492 | 3300014745 | Ga0157377_10001221 | Ga0157377_100012213 | 422 |
| 493 | 3300014745 | Ga0157377_10018151 | Ga0157377_100181513 | 422 |
| 494 | 3300014745 | Ga0157377_10126439 | Ga0157377_101264391 | 422 |
| 495 | 3300014968 | Ga0157379_10031404 | Ga0157379_100314044 | 422 |
| 496 | 3300014968 | Ga0157379_10051589 | Ga0157379_100515892 | 422 |
| 497 | 3300014969 | Ga0157376_10031273 | Ga0157376_100312734 | 422 |
| 498 | 3300014969 | Ga0157376_10031781 | Ga0157376_100317813 | 422 |
| 499 | 3300014969 | Ga0157376_10151224 | Ga0157376_101512243 | 422 |
| 500 | 3300014969 | Ga0157376_10168324 | Ga0157376_101683242 | 422 |
| 501 | 3300014969 | Ga0157376_10212906 | Ga0157376_102129062 | 422 |
| 502 | 3300017792 | Ga0163161_10020287 | Ga0163161_100202873 | 422 |
| 503 | 3300017792 | Ga0163161_10027138 | Ga0163161_100271381 | 422 |
| 504 | 3300017792 | Ga0163161_10044468 | Ga0163161_100444682 | 422 |
| 505 | 3300017792 | Ga0163161_10106959 | Ga0163161_101069592 | 422 |
| 506 | 3300017792 | Ga0163161_10220287 | Ga0163161_102202871 | 422 |
| 507 | 3300025899 | Ga0207642_10025689 | Ga0207642_100256892 | 422 |
| 508 | 3300025901 | Ga0207688_10129056 | Ga0207688_101290561 | 422 |
| 509 | 3300025903 | Ga0207680_10009136 | Ga0207680_100091365 | 422 |
| 510 | 3300025903 | Ga0207680_10044173 | Ga0207680_100441731 | 422 |
| 511 | 3300025904 | Ga0207647_10146451 | Ga0207647_101464511 | 422 |
| 512 | 3300025907 | Ga0207645_10000136 | Ga0207645_1000013628 | 422 |
| 513 | 3300025907 | Ga0207645_10018765 | Ga0207645_100187653 | 422 |
| 514 | 3300025907 | Ga0207645_10025617 | Ga0207645_100256172 | 422 |
| 515 | 3300025908 | Ga0207643_10064435 | Ga0207643_100644352 | 422 |
| 516 | 3300025911 | Ga0207654_10002468 | Ga0207654_100024684 | 422 |
| 517 | 3300025912 | Ga0207707_10003458 | Ga0207707_100034586 | 422 |
| 518 | 3300025913 | Ga0207695_10048262 | Ga0207695_100482625 | 422 |
| 519 | 3300025913 | Ga0207695_10108636 | Ga0207695_101086363 | 422 |
| 520 | 3300025917 | Ga0207660_10042709 | Ga0207660_100427094 | 422 |
| 521 | 3300025920 | Ga0207649_10000419 | Ga0207649_1000041927 | 422 |
| 522 | 3300025921 | Ga0207652_10006696 | Ga0207652_100066967 | 422 |
| 523 | 3300025923 | Ga0207681_10047997 | Ga0207681_100479972 | 422 |
| 524 | 3300025923 | Ga0207681_10077272 | Ga0207681_100772721 | 422 |
| 525 | 3300025925 | Ga0207650_10112802 | Ga0207650_101128022 | 422 |
| 526 | 3300025932 | Ga0207690_10043848 | Ga0207690_100438482 | 422 |
| 527 | 3300025933 | Ga0207706_10002103 | Ga0207706_100021031 | 422 |
| 528 | 3300025933 | Ga0207706_10024569 | Ga0207706_100245695 | 422 |
| 529 | 3300025933 | Ga0207706_10059286 | Ga0207706_100592864 | 422 |
| 530 | 3300025934 | Ga0207686_10000429 | Ga0207686_1000042923 | 422 |
| 531 | 3300025934 | Ga0207686_10089861 | Ga0207686_100898612 | 422 |
| 532 | 3300025936 | Ga0207670_10015622 | Ga0207670_100156223 | 422 |
| 533 | 3300025936 | Ga0207670_10059061 | Ga0207670_100590613 | 422 |
| 534 | 3300025936 | Ga0207670_10146400 | Ga0207670_101464001 | 422 |
| 535 | 3300025938 | Ga0207704_10036806 | Ga0207704_100368063 | 422 |
| 536 | 3300025938 | Ga0207704_10070796 | Ga0207704_100707961 | 422 |
| 537 | 3300025938 | Ga0207704_10087515 | Ga0207704_100875151 | 422 |
| 538 | 3300025940 | Ga0207691_10040276 | Ga0207691_100402764 | 422 |
| 539 | 3300025942 | Ga0207689_10001007 | Ga0207689_1000100716 | 422 |
| 540 | 3300025942 | Ga0207689_10014075 | Ga0207689_100140753 | 422 |
| 541 | 3300025942 | Ga0207689_10019898 | Ga0207689_100198985 | 422 |
| 542 | 3300025942 | Ga0207689_10026965 | Ga0207689_100269652 | 422 |
| 543 | 3300025942 | Ga0207689_10063150 | Ga0207689_100631501 | 422 |
| 544 | 3300025944 | Ga0207661_10000370 | Ga0207661_100003706 | 422 |
| 545 | 3300025944 | Ga0207661_10120368 | Ga0207661_101203682 | 422 |
| 546 | 3300025945 | Ga0207679_10000266 | Ga0207679_1000026616 | 422 |
| 547 | 3300025945 | Ga0207679_10001572 | Ga0207679_1000157216 | 422 |
| 548 | 3300025949 | Ga0207667_10120942 | Ga0207667_101209423 | 422 |
| 549 | 3300025960 | Ga0207651_10069866 | Ga0207651_100698662 | 422 |
| 550 | 3300025961 | Ga0207712_10002766 | Ga0207712_100027662 | 422 |
| 551 | 3300025961 | Ga0207712_10011848 | Ga0207712_100118482 | 422 |
| 552 | 3300025986 | Ga0207658_10208212 | Ga0207658_102082121 | 422 |
| 553 | 3300026023 | Ga0207677_10028677 | Ga0207677_100286774 | 422 |
| 554 | 3300026023 | Ga0207677_10130678 | Ga0207677_101306782 | 422 |
| 555 | 3300026023 | Ga0207677_10139086 | Ga0207677_101390861 | 422 |
| 556 | 3300026035 | Ga0207703_10061525 | Ga0207703_100615252 | 422 |
| 557 | 3300026041 | Ga0207639_10019147 | Ga0207639_100191474 | 422 |
| 558 | 3300026067 | Ga0207678_10098208 | Ga0207678_100982081 | 422 |
| 559 | 3300026078 | Ga0207702_10032751 | Ga0207702_100327511 | 422 |
| 560 | 3300026088 | Ga0207641_10007370 | Ga0207641_100073709 | 422 |
| 561 | 3300026088 | Ga0207641_10037835 | Ga0207641_100378352 | 422 |
| 562 | 3300026089 | Ga0207648_10000568 | Ga0207648_1000056834 | 422 |
| 563 | 3300026089 | Ga0207648_10004655 | Ga0207648_1000465512 | 422 |
| 564 | 3300026089 | Ga0207648_10029445 | Ga0207648_100294452 | 422 |
| 565 | 3300026089 | Ga0207648_10066942 | Ga0207648_100669423 | 422 |
| 566 | 3300026095 | Ga0207676_10076898 | Ga0207676_100768982 | 422 |
| 567 | 3300026095 | Ga0207676_10215770 | Ga0207676_102157701 | 422 |
| 568 | 3300026118 | Ga0207675_100007383 | Ga0207675_10000738312 | 422 |
| 569 | 3300026118 | Ga0207675_100021679 | Ga0207675_1000216792 | 422 |
| 570 | 3300026118 | Ga0207675_100048377 | Ga0207675_1000483772 | 422 |
| 571 | 3300026121 | Ga0207683_10002007 | Ga0207683_100020079 | 422 |
| 572 | 3300026121 | Ga0207683_10007862 | Ga0207683_100078626 | 422 |
| 573 | 3300026142 | Ga0207698_10042824 | Ga0207698_100428244 | 422 |
| 574 | 3300028379 | Ga0268266_10000071 | Ga0268266_1000007139 | 422 |
| 575 | 3300028381 | Ga0268264_10000143 | Ga0268264_10000143121 | 422 |
| 576 | 3300028381 | Ga0268264_10006748 | Ga0268264_100067484 | 422 |
| 577 | 3300028381 | Ga0268264_10063639 | Ga0268264_100636392 | 422 |
| 578 | 3300028786 | Ga0307517_10012359 | Ga0307517_100123598 | 422 |
| 579 | 3300030732 | Ga0316176_1079087 | Ga0316176_10790873 | 422 |
| 580 | 3300031456 | Ga0307513_10085874 | Ga0307513_100858744 | 422 |
| 581 | 3300035170 | Ga0373943_0046344 | Ga0373943_0046344_726_2048 | 422 |
| 582 | 3300042002 | Ga0439442_001192 | Ga0439442_001192_1354_2679 | 422 |
| 583 | 3300042876 | Ga0451577_0151882 | Ga0451577_0151882_194_1525 | 422 |
| 584 | 3300044712 | Ga0453684_0091945 | Ga0453684_0091945_694_2025 | 422 |
| 585 | 3300046454 | Ga0495592_0117596 | Ga0495592_0117596_332_1654 | 422 |
| 586 | 3300046460 | Ga0495638_0037416 | Ga0495638_0037416_1184_2512 | 422 |
| 587 | 3300046463 | Ga0495653_0153104 | Ga0495653_0153104_185_1507 | 422 |
| 588 | 3300046475 | Ga0495639_0071530 | Ga0495639_0071530_132_1451 | 422 |
| 589 | 3300046517 | Ga0495630_0003153 | Ga0495630_0003153_8957_10279 | 422 |
| 590 | 3300046529 | Ga0495652_0193578 | Ga0495652_0193578_189_1508 | 422 |
| 591 | 3300046535 | Ga0495586_0034672 | Ga0495586_0034672_744_2063 | 422 |
| 592 | 3300046536 | Ga0495587_0079106 | Ga0495587_0079106_103_1422 | 422 |
| 593 | 3300046616 | Ga0495668_0002317 | Ga0495668_0002317_8044_9363 | 422 |
| 594 | 3300046642 | Ga0495634_0019397 | Ga0495634_0019397_2889_4211 | 422 |
| 595 | 3300046642 | Ga0495634_0080296 | Ga0495634_0080296_363_1682 | 422 |
| 596 | 3300047319 | Ga0495674_0085538 | Ga0495674_0085538_1233_2552 | 422 |
| 597 | 3300047320 | Ga0495672_0006964 | Ga0495672_0006964_2223_3548 | 422 |
| 598 | 3300047472 | Ga0495686_0000806 | Ga0495686_0000806_23873_25231 | 422 |
| 599 | 3300047472 | Ga0495686_0022360 | Ga0495686_0022360_2127_3452 | 422 |
| 600 | 3300047472 | Ga0495686_0029848 | Ga0495686_0029848_402_1727 | 422 |
| 601 | 3300048913 | Ga0496110_0052101 | Ga0496110_0052101_1193_2515 | 422 |
| 602 | 3300049568 | Ga0501031_0057261 | Ga0501031_0057261_827_2152 | 422 |
| 603 | 3300049571 | Ga0501034_0080546 | Ga0501034_0080546_1154_2476 | 422 |
| 604 | 3300049573 | Ga0501037_0093418 | Ga0501037_0093418_468_1793 | 422 |
| 605 | 3300049574 | Ga0501038_0011536 | Ga0501038_0011536_4435_5760 | 422 |
| 606 | 3300049579 | Ga0501043_0008513 | Ga0501043_0008513_2629_3954 | 422 |
| 607 | 3300049582 | Ga0501048_0072352 | Ga0501048_0072352_350_1672 | 422 |
| 608 | 3300049583 | Ga0501067_0007633 | Ga0501067_0007633_1770_3092 | 422 |
| 609 | 3300049703 | Ga0501219_001212 | Ga0501219_001212_582_1901 | 422 |
| 610 | 3300049742 | Ga0501080_0052084 | Ga0501080_0052084_1994_3316 | 422 |
| 611 | 3300049823 | Ga0501044_0018314 | Ga0501044_0018314_1391_2716 | 422 |
| 612 | 3300049823 | Ga0501044_0125467 | Ga0501044_0125467_400_1722 | 422 |
| 613 | 3300050005 | Ga0501284_00005 | Ga0501284_00005_109365_110684 | 422 |
| 614 | 3300050493 | nmdc:mga0k408_8963_c1 | nmdc:mga0k408_8963_c1_2033_3358 | 422 |
| 615 | 3300050507 | nmdc:mga05p37_170491_c1 | nmdc:mga05p37_170491_c1_49_1377 | 422 |
| 616 | 3300050508 | nmdc:mga09592_10511_c1 | nmdc:mga09592_10511_c1_2274_3605 | 422 |
| 617 | 3300050508 | nmdc:mga09592_38456_c1 | nmdc:mga09592_38456_c1_1473_2801 | 422 |
| 618 | 3300050509 | nmdc:mga0qj67_15755_c1 | nmdc:mga0qj67_15755_c1_136_1464 | 422 |
| 619 | 3300050510 | nmdc:mga06r32_38982_c1 | nmdc:mga06r32_38982_c1_1951_3279 | 422 |
| 620 | 3300050512 | nmdc:mga0n895_60961_c1 | nmdc:mga0n895_60961_c1_784_2106 | 422 |
| 621 | 3300053092 | Ga0500583_0029290 | Ga0500583_0029290_671_1999 | 422 |
| 622 | 3300053130 | Ga0500642_0042932 | Ga0500642_0042932_144_1472 | 422 |
| 623 | 3300053139 | Ga0500568_0001483 | Ga0500568_0001483_5148_6473 | 422 |
| 624 | 3300053727 | Ga0500611_000004 | Ga0500611_000004_235127_236452 | 422 |
| 625 | 3300060353 | Ga0501082_0026283 | Ga0501082_0026283_843_2165 | 422 |
| 626 | 3300002737 | JGI25162J39368_1001130 | JGI25162J39368_10011301 | 423 |
| 627 | 3300002772 | JGI25164J39214_1001844 | JGI25164J39214_10018441 | 423 |
| 628 | 3300003214 | JGI25165J46597_1001512 | JGI25165J46597_10015122 | 423 |
| 629 | 3300003322 | rootL2_10053828 | rootL2_100538285 | 423 |
| 630 | 3300003323 | rootH1_10007236 | rootH1_100072367 | 423 |
| 631 | 3300005290 | Ga0065712_10000661 | Ga0065712_1000066114 | 423 |
| 632 | 3300005295 | Ga0065707_10007629 | Ga0065707_100076292 | 423 |
| 633 | 3300005327 | Ga0070658_10019663 | Ga0070658_100196634 | 423 |
| 634 | 3300005327 | Ga0070658_10084047 | Ga0070658_100840473 | 423 |
| 635 | 3300005327 | Ga0070658_10139003 | Ga0070658_101390032 | 423 |
| 636 | 3300005327 | Ga0070658_10170445 | Ga0070658_101704452 | 423 |
| 637 | 3300005334 | Ga0068869_100044144 | Ga0068869_1000441441 | 423 |
| 638 | 3300005336 | Ga0070680_100059656 | Ga0070680_1000596562 | 423 |
| 639 | 3300005336 | Ga0070680_100062464 | Ga0070680_1000624643 | 423 |
| 640 | 3300005337 | Ga0070682_100000129 | Ga0070682_10000012941 | 423 |
| 641 | 3300005337 | Ga0070682_100079749 | Ga0070682_1000797492 | 423 |
| 642 | 3300005339 | Ga0070660_100017754 | Ga0070660_1000177542 | 423 |
| 643 | 3300005339 | Ga0070660_100095883 | Ga0070660_1000958831 | 423 |
| 644 | 3300005353 | Ga0070669_100004014 | Ga0070669_1000040142 | 423 |
| 645 | 3300005353 | Ga0070669_100052457 | Ga0070669_1000524573 | 423 |
| 646 | 3300005354 | Ga0070675_100004112 | Ga0070675_1000041121 | 423 |
| 647 | 3300005366 | Ga0070659_100031741 | Ga0070659_1000317412 | 423 |
| 648 | 3300005457 | Ga0070662_100036667 | Ga0070662_1000366672 | 423 |
| 649 | 3300005458 | Ga0070681_10008323 | Ga0070681_1000832310 | 423 |
| 650 | 3300005458 | Ga0070681_10079621 | Ga0070681_100796213 | 423 |
| 651 | 3300005530 | Ga0070679_100000158 | Ga0070679_10000015811 | 423 |
| 652 | 3300005530 | Ga0070679_100004315 | Ga0070679_10000431510 | 423 |
| 653 | 3300005530 | Ga0070679_100027513 | Ga0070679_1000275136 | 423 |
| 654 | 3300005530 | Ga0070679_100107718 | Ga0070679_1001077181 | 423 |
| 655 | 3300005530 | Ga0070679_100270164 | Ga0070679_1002701641 | 423 |
| 656 | 3300005539 | Ga0068853_100006293 | Ga0068853_1000062931 | 423 |
| 657 | 3300005539 | Ga0068853_100012384 | Ga0068853_1000123843 | 423 |
| 658 | 3300005539 | Ga0068853_100042310 | Ga0068853_1000423103 | 423 |
| 659 | 3300005539 | Ga0068853_100177983 | Ga0068853_1001779832 | 423 |
| 660 | 3300005563 | Ga0068855_100000489 | Ga0068855_10000048936 | 423 |
| 661 | 3300005563 | Ga0068855_100152798 | Ga0068855_1001527983 | 423 |
| 662 | 3300005563 | Ga0068855_100155294 | Ga0068855_1001552942 | 423 |
| 663 | 3300005577 | Ga0068857_100023904 | Ga0068857_1000239044 | 423 |
| 664 | 3300005616 | Ga0068852_100013323 | Ga0068852_1000133232 | 423 |
| 665 | 3300005617 | Ga0068859_100005587 | Ga0068859_1000055877 | 423 |
| 666 | 3300005617 | Ga0068859_100006487 | Ga0068859_10000648710 | 423 |
| 667 | 3300005617 | Ga0068859_100007298 | Ga0068859_10000729811 | 423 |
| 668 | 3300005617 | Ga0068859_100074642 | Ga0068859_1000746424 | 423 |
| 669 | 3300005618 | Ga0068864_100019755 | Ga0068864_1000197556 | 423 |
| 670 | 3300005719 | Ga0068861_100065954 | Ga0068861_1000659543 | 423 |
| 671 | 3300005843 | Ga0068860_100015699 | Ga0068860_1000156996 | 423 |
| 672 | 3300005843 | Ga0068860_100065329 | Ga0068860_1000653292 | 423 |
| 673 | 3300005844 | Ga0068862_100096577 | Ga0068862_1000965773 | 423 |
| 674 | 3300005844 | Ga0068862_100126300 | Ga0068862_1001263002 | 423 |
| 675 | 3300006931 | Ga0097620_100005586 | Ga0097620_1000055867 | 423 |
| 676 | 3300006931 | Ga0097620_100006487 | Ga0097620_10000648710 | 423 |
| 677 | 3300006931 | Ga0097620_100007298 | Ga0097620_10000729811 | 423 |
| 678 | 3300006931 | Ga0097620_100074639 | Ga0097620_1000746392 | 423 |
| 679 | 3300009093 | Ga0105240_10159315 | Ga0105240_101593152 | 423 |
| 680 | 3300009093 | Ga0105240_10373403 | Ga0105240_103734031 | 423 |
| 681 | 3300009094 | Ga0111539_10004306 | Ga0111539_1000430616 | 423 |
| 682 | 3300009094 | Ga0111539_10178682 | Ga0111539_101786822 | 423 |
| 683 | 3300009174 | Ga0105241_10024092 | Ga0105241_100240925 | 423 |
| 684 | 3300009545 | Ga0105237_10060302 | Ga0105237_100603022 | 423 |
| 685 | 3300009553 | Ga0105249_10009062 | Ga0105249_100090626 | 423 |
| 686 | 3300009553 | Ga0105249_10030029 | Ga0105249_100300297 | 423 |
| 687 | 3300010375 | Ga0105239_10000014 | Ga0105239_10000014243 | 423 |
| 688 | 3300010375 | Ga0105239_10000130 | Ga0105239_1000013018 | 423 |
| 689 | 3300010375 | Ga0105239_10003284 | Ga0105239_100032846 | 423 |
| 690 | 3300013100 | Ga0157373_10003707 | Ga0157373_100037078 | 423 |
| 691 | 3300013100 | Ga0157373_10014856 | Ga0157373_100148563 | 423 |
| 692 | 3300013100 | Ga0157373_10109747 | Ga0157373_101097471 | 423 |
| 693 | 3300013102 | Ga0157371_10000297 | Ga0157371_100002979 | 423 |
| 694 | 3300013102 | Ga0157371_10001188 | Ga0157371_1000118817 | 423 |
| 695 | 3300013102 | Ga0157371_10003212 | Ga0157371_1000321210 | 423 |
| 696 | 3300013102 | Ga0157371_10003438 | Ga0157371_100034388 | 423 |
| 697 | 3300013102 | Ga0157371_10042739 | Ga0157371_100427392 | 423 |
| 698 | 3300013104 | Ga0157370_10001924 | Ga0157370_1000192426 | 423 |
| 699 | 3300013104 | Ga0157370_10003146 | Ga0157370_1000314613 | 423 |
| 700 | 3300013104 | Ga0157370_10052862 | Ga0157370_100528623 | 423 |
| 701 | 3300013105 | Ga0157369_10022459 | Ga0157369_100224593 | 423 |
| 702 | 3300013105 | Ga0157369_10036588 | Ga0157369_100365885 | 423 |
| 703 | 3300013105 | Ga0157369_10177434 | Ga0157369_101774342 | 423 |
| 704 | 3300013105 | Ga0157369_10196184 | Ga0157369_101961842 | 423 |
| 705 | 3300013306 | Ga0163162_10001569 | Ga0163162_100015698 | 423 |
| 706 | 3300013307 | Ga0157372_10000285 | Ga0157372_1000028535 | 423 |
| 707 | 3300013307 | Ga0157372_10043900 | Ga0157372_100439005 | 423 |
| 708 | 3300013307 | Ga0157372_10047960 | Ga0157372_100479602 | 423 |
| 709 | 3300013307 | Ga0157372_10084878 | Ga0157372_100848781 | 423 |
| 710 | 3300013307 | Ga0157372_10132140 | Ga0157372_101321401 | 423 |
| 711 | 3300013307 | Ga0157372_10160487 | Ga0157372_101604872 | 423 |
| 712 | 3300013307 | Ga0157372_10250220 | Ga0157372_102502203 | 423 |
| 713 | 3300013307 | Ga0157372_10339492 | Ga0157372_103394921 | 423 |
| 714 | 3300013308 | Ga0157375_10059901 | Ga0157375_100599012 | 423 |
| 715 | 3300014745 | Ga0157377_10000568 | Ga0157377_1000056811 | 423 |
| 716 | 3300025231 | Ga0207427_100071 | Ga0207427_100071157 | 423 |
| 717 | 3300025233 | Ga0209437_100021 | Ga0209437_100021102 | 423 |
| 718 | 3300025261 | Ga0209233_1000035 | Ga0209233_1000035535 | 423 |
| 719 | 3300025261 | Ga0209233_1006884 | Ga0209233_10068844 | 423 |
| 720 | 3300025900 | Ga0207710_10029491 | Ga0207710_100294913 | 423 |
| 721 | 3300025904 | Ga0207647_10001267 | Ga0207647_100012673 | 423 |
| 722 | 3300025909 | Ga0207705_10006828 | Ga0207705_100068281 | 423 |
| 723 | 3300025909 | Ga0207705_10072902 | Ga0207705_100729023 | 423 |
| 724 | 3300025909 | Ga0207705_10077395 | Ga0207705_100773952 | 423 |
| 725 | 3300025909 | Ga0207705_10080556 | Ga0207705_100805562 | 423 |
| 726 | 3300025912 | Ga0207707_10056886 | Ga0207707_100568865 | 423 |
| 727 | 3300025912 | Ga0207707_10104171 | Ga0207707_101041713 | 423 |
| 728 | 3300025913 | Ga0207695_10015794 | Ga0207695_100157948 | 423 |
| 729 | 3300025913 | Ga0207695_10276543 | Ga0207695_102765431 | 423 |
| 730 | 3300025914 | Ga0207671_10026985 | Ga0207671_100269852 | 423 |
| 731 | 3300025917 | Ga0207660_10112778 | Ga0207660_101127782 | 423 |
| 732 | 3300025919 | Ga0207657_10042288 | Ga0207657_100422884 | 423 |
| 733 | 3300025919 | Ga0207657_10181814 | Ga0207657_101818141 | 423 |
| 734 | 3300025921 | Ga0207652_10000013 | Ga0207652_1000001316 | 423 |
| 735 | 3300025921 | Ga0207652_10002930 | Ga0207652_100029309 | 423 |
| 736 | 3300025921 | Ga0207652_10071222 | Ga0207652_100712221 | 423 |
| 737 | 3300025923 | Ga0207681_10051655 | Ga0207681_100516553 | 423 |
| 738 | 3300025932 | Ga0207690_10008098 | Ga0207690_100080983 | 423 |
| 739 | 3300025932 | Ga0207690_10021979 | Ga0207690_100219794 | 423 |
| 740 | 3300025933 | Ga0207706_10110761 | Ga0207706_101107611 | 423 |
| 741 | 3300025936 | Ga0207670_10007267 | Ga0207670_100072676 | 423 |
| 742 | 3300025942 | Ga0207689_10047573 | Ga0207689_100475735 | 423 |
| 743 | 3300025949 | Ga0207667_10000408 | Ga0207667_1000040822 | 423 |
| 744 | 3300025949 | Ga0207667_10035585 | Ga0207667_100355855 | 423 |
| 745 | 3300025949 | Ga0207667_10048686 | Ga0207667_100486861 | 423 |
| 746 | 3300025949 | Ga0207667_10146963 | Ga0207667_101469632 | 423 |
| 747 | 3300025949 | Ga0207667_10188276 | Ga0207667_101882761 | 423 |
| 748 | 3300025961 | Ga0207712_10022755 | Ga0207712_100227551 | 423 |
| 749 | 3300025961 | Ga0207712_10062576 | Ga0207712_100625761 | 423 |
| 750 | 3300025961 | Ga0207712_10130103 | Ga0207712_101301032 | 423 |
| 751 | 3300025972 | Ga0207668_10058996 | Ga0207668_100589962 | 423 |
| 752 | 3300026035 | Ga0207703_10050224 | Ga0207703_100502243 | 423 |
| 753 | 3300026041 | Ga0207639_10044622 | Ga0207639_100446223 | 423 |
| 754 | 3300026089 | Ga0207648_10019544 | Ga0207648_100195445 | 423 |
| 755 | 3300026095 | Ga0207676_10011089 | Ga0207676_100110896 | 423 |
| 756 | 3300026116 | Ga0207674_10016248 | Ga0207674_100162482 | 423 |
| 757 | 3300026116 | Ga0207674_10125881 | Ga0207674_101258811 | 423 |
| 758 | 3300026116 | Ga0207674_10272125 | Ga0207674_102721252 | 423 |
| 759 | 3300026118 | Ga0207675_100003813 | Ga0207675_10000381312 | 423 |
| 760 | 3300026118 | Ga0207675_100053087 | Ga0207675_1000530874 | 423 |
| 761 | 3300028380 | Ga0268265_10091723 | Ga0268265_100917232 | 423 |
| 762 | 3300028381 | Ga0268264_10049632 | Ga0268264_100496322 | 423 |
| 763 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000011424 | 423 |
| 764 | 3300028800 | Ga0265338_10016709 | Ga0265338_100167093 | 423 |
| 765 | 3300030742 | Ga0316183_1153674 | Ga0316183_115367432 | 423 |
| 766 | 3300030744 | Ga0316181_1153314 | Ga0316181_11533143 | 423 |
| 767 | 3300031251 | Ga0265327_10000421 | Ga0265327_1000042135 | 423 |
| 768 | 3300037312 | Ga0395899_0000528 | Ga0395899_0000528_23104_24426 | 423 |
| 769 | 3300037312 | Ga0395899_0049099 | Ga0395899_0049099_1079_2401 | 423 |
| 770 | 3300037312 | Ga0395899_0061440 | Ga0395899_0061440_1129_2451 | 423 |
| 771 | 3300037312 | Ga0395899_0076748 | Ga0395899_0076748_715_2037 | 423 |
| 772 | 3300037418 | Ga0395900_0002692 | Ga0395900_0002692_5264_6586 | 423 |
| 773 | 3300037418 | Ga0395900_0006330 | Ga0395900_0006330_10119_11441 | 423 |
| 774 | 3300037418 | Ga0395900_0126686 | Ga0395900_0126686_686_2008 | 423 |
| 775 | 3300037418 | Ga0395900_0196437 | Ga0395900_0196437_707_2029 | 423 |
| 776 | 3300037418 | Ga0395900_0201811 | Ga0395900_0201811_10_1332 | 423 |
| 777 | 3300037466 | Ga0395898_0000595 | Ga0395898_0000595_32363_33685 | 423 |
| 778 | 3300037466 | Ga0395898_0052812 | Ga0395898_0052812_2466_3788 | 423 |
| 779 | 3300037466 | Ga0395898_0053589 | Ga0395898_0053589_2166_3488 | 423 |
| 780 | 3300037466 | Ga0395898_0070019 | Ga0395898_0070019_1910_3235 | 423 |
| 781 | 3300037471 | Ga0395905_0171511 | Ga0395905_0171511_399_1721 | 423 |
| 782 | 3300038443 | Ga0395901_0005353 | Ga0395901_0005353_7433_8755 | 423 |
| 783 | 3300038443 | Ga0395901_0036270 | Ga0395901_0036270_777_2099 | 423 |
| 784 | 3300042435 | Ga0439434_0030071 | Ga0439434_0030071_49_1374 | 423 |
| 785 | 3300046462 | Ga0495651_0101376 | Ga0495651_0101376_665_1990 | 423 |
| 786 | 3300047472 | Ga0495686_0000614 | Ga0495686_0000614_29484_30809 | 423 |
| 787 | 3300049569 | Ga0501032_0000901 | Ga0501032_0000901_13382_14710 | 423 |
| 788 | 3300049570 | Ga0501033_0077996 | Ga0501033_0077996_954_2276 | 423 |
| 789 | 3300049570 | Ga0501033_0100007 | Ga0501033_0100007_356_1678 | 423 |
| 790 | 3300049571 | Ga0501034_0000115 | Ga0501034_0000115_140226_141551 | 423 |
| 791 | 3300049571 | Ga0501034_0036705 | Ga0501034_0036705_446_1774 | 423 |
| 792 | 3300049572 | Ga0501036_0013979 | Ga0501036_0013979_155_1483 | 423 |
| 793 | 3300049573 | Ga0501037_0060144 | Ga0501037_0060144_1367_2695 | 423 |
| 794 | 3300049579 | Ga0501043_0077336 | Ga0501043_0077336_905_2233 | 423 |
| 795 | 3300049583 | Ga0501067_0059916 | Ga0501067_0059916_664_1992 | 423 |
| 796 | 3300049586 | Ga0501070_0059458 | Ga0501070_0059458_205_1527 | 423 |
| 797 | 3300049589 | Ga0501073_0009472 | Ga0501073_0009472_949_2277 | 423 |
| 798 | 3300049590 | Ga0501074_0009732 | Ga0501074_0009732_778_2106 | 423 |
| 799 | 3300049742 | Ga0501080_0017887 | Ga0501080_0017887_4675_6003 | 423 |
| 800 | 3300049822 | Ga0501035_0138244 | Ga0501035_0138244_276_1604 | 423 |
| 801 | 3300049823 | Ga0501044_0005380 | Ga0501044_0005380_1674_3002 | 423 |
| 802 | 3300053080 | Ga0500635_0005068 | Ga0500635_0005068_207_1532 | 423 |
| 803 | 3300053156 | Ga0500622_0005024 | Ga0500622_0005024_3101_4426 | 423 |
| 804 | 2162886007 | SwRhRL2b_contig_1663050 | SwRhRL2b_0644.00005810 | 424 |
| 805 | 3300001990 | JGI24737J22298_10000150 | JGI24737J22298_100001507 | 424 |
| 806 | 3300002067 | JGI24735J21928_10000024 | JGI24735J21928_1000002489 | 424 |
| 807 | 3300005288 | Ga0065714_10069509 | Ga0065714_100695093 | 424 |
| 808 | 3300005289 | Ga0065704_10070140 | Ga0065704_10070140362 | 424 |
| 809 | 3300005329 | Ga0070683_100007919 | Ga0070683_1000079193 | 424 |
| 810 | 3300005366 | Ga0070659_100000644 | Ga0070659_10000064415 | 424 |
| 811 | 3300005563 | Ga0068855_100106589 | Ga0068855_1001065892 | 424 |
| 812 | 3300005563 | Ga0068855_100255295 | Ga0068855_1002552951 | 424 |
| 813 | 3300005578 | Ga0068854_100013446 | Ga0068854_1000134461 | 424 |
| 814 | 3300009093 | Ga0105240_10000073 | Ga0105240_10000073134 | 424 |
| 815 | 3300009093 | Ga0105240_10000083 | Ga0105240_1000008339 | 424 |
| 816 | 3300009093 | Ga0105240_10159676 | Ga0105240_101596763 | 424 |
| 817 | 3300009174 | Ga0105241_10070958 | Ga0105241_100709582 | 424 |
| 818 | 3300009545 | Ga0105237_10000138 | Ga0105237_1000013882 | 424 |
| 819 | 3300010375 | Ga0105239_10000558 | Ga0105239_1000055817 | 424 |
| 820 | 3300010375 | Ga0105239_10000708 | Ga0105239_1000070823 | 424 |
| 821 | 3300010375 | Ga0105239_10019537 | Ga0105239_100195376 | 424 |
| 822 | 3300013100 | Ga0157373_10000150 | Ga0157373_1000015028 | 424 |
| 823 | 3300013306 | Ga0163162_10001312 | Ga0163162_1000131211 | 424 |
| 824 | 3300013307 | Ga0157372_10002016 | Ga0157372_100020163 | 424 |
| 825 | 3300025233 | Ga0209437_100124 | Ga0209437_10012487 | 424 |
| 826 | 3300025250 | Ga0209026_1000282 | Ga0209026_10002827 | 424 |
| 827 | 3300025250 | Ga0209026_1001733 | Ga0209026_10017336 | 424 |
| 828 | 3300025250 | Ga0209026_1004176 | Ga0209026_10041765 | 424 |
| 829 | 3300025904 | Ga0207647_10005091 | Ga0207647_1000509114 | 424 |
| 830 | 3300025913 | Ga0207695_10000127 | Ga0207695_1000012738 | 424 |
| 831 | 3300025913 | Ga0207695_10000151 | Ga0207695_10000151141 | 424 |
| 832 | 3300025914 | Ga0207671_10002935 | Ga0207671_1000293510 | 424 |
| 833 | 3300025914 | Ga0207671_10008095 | Ga0207671_100080956 | 424 |
| 834 | 3300025932 | Ga0207690_10000049 | Ga0207690_1000004994 | 424 |
| 835 | 3300025944 | Ga0207661_10030067 | Ga0207661_100300672 | 424 |
| 836 | 3300025949 | Ga0207667_10134709 | Ga0207667_101347093 | 424 |
| 837 | 3300025981 | Ga0207640_10058226 | Ga0207640_100582261 | 424 |
| 838 | 3300028379 | Ga0268266_10004286 | Ga0268266_1000428611 | 424 |
| 839 | 3300028794 | Ga0307515_10000224 | Ga0307515_1000022414 | 424 |
| 840 | 3300028794 | Ga0307515_10001268 | Ga0307515_1000126822 | 424 |
| 841 | 3300028800 | Ga0265338_10003003 | Ga0265338_1000300310 | 424 |
| 842 | 3300031711 | Ga0265314_10109480 | Ga0265314_101094802 | 424 |
| 843 | 3300033179 | Ga0307507_10000097 | Ga0307507_10000097105 | 424 |
| 844 | 3300037312 | Ga0395899_0000017 | Ga0395899_0000017_374421_375749 | 424 |
| 845 | 3300044712 | Ga0453684_0001680 | Ga0453684_0001680_14985_16319 | 424 |
| 846 | 3300044712 | Ga0453684_0006862 | Ga0453684_0006862_15003_16337 | 424 |
| 847 | 3300045051 | Ga0451576_0036766 | Ga0451576_0036766_3218_4558 | 424 |
| 848 | 3300046471 | Ga0495650_0000095 | Ga0495650_0000095_200508_201836 | 424 |
| 849 | 3300046492 | Ga0495585_0000034 | Ga0495585_0000034_50251_51579 | 424 |
| 850 | 3300046507 | Ga0495606_0000009 | Ga0495606_0000009_49160_50488 | 424 |
| 851 | 3300046507 | Ga0495606_0008253 | Ga0495606_0008253_7298_8626 | 424 |
| 852 | 3300046512 | Ga0495610_0007711 | Ga0495610_0007711_4312_5640 | 424 |
| 853 | 3300046513 | Ga0495616_0001155 | Ga0495616_0001155_17273_18601 | 424 |
| 854 | 3300046524 | Ga0495648_0008498 | Ga0495648_0008498_1800_3128 | 424 |
| 855 | 3300046524 | Ga0495648_0073901 | Ga0495648_0073901_542_1870 | 424 |
| 856 | 3300046538 | Ga0495609_0003375 | Ga0495609_0003375_5061_6389 | 424 |
| 857 | 3300046557 | Ga0495622_0041305 | Ga0495622_0041305_336_1664 | 424 |
| 858 | 3300046558 | Ga0495633_0000174 | Ga0495633_0000174_78322_79650 | 424 |
| 859 | 3300046558 | Ga0495633_0010277 | Ga0495633_0010277_551_1879 | 424 |
| 860 | 3300046616 | Ga0495668_0000017 | Ga0495668_0000017_109012_110340 | 424 |
| 861 | 3300046616 | Ga0495668_0050960 | Ga0495668_0050960_942_2270 | 424 |
| 862 | 3300046660 | Ga0495625_0000007 | Ga0495625_0000007_282598_283926 | 424 |
| 863 | 3300046660 | Ga0495625_0000155 | Ga0495625_0000155_38526_39854 | 424 |
| 864 | 3300046660 | Ga0495625_0000761 | Ga0495625_0000761_31351_32679 | 424 |
| 865 | 3300046660 | Ga0495625_0019255 | Ga0495625_0019255_1526_2854 | 424 |
| 866 | 3300046660 | Ga0495625_0050589 | Ga0495625_0050589_1631_2959 | 424 |
| 867 | 3300046665 | Ga0495661_0004014 | Ga0495661_0004014_4629_5957 | 424 |
| 868 | 3300046665 | Ga0495661_0012459 | Ga0495661_0012459_208_1536 | 424 |
| 869 | 3300046694 | Ga0495649_0000007 | Ga0495649_0000007_168073_169401 | 424 |
| 870 | 3300046810 | Ga0495660_0026059 | Ga0495660_0026059_201_1529 | 424 |
| 871 | 3300047443 | Ga0495687_003549 | Ga0495687_003549_5663_6991 | 424 |
| 872 | 3300047472 | Ga0495686_0001562 | Ga0495686_0001562_21096_22424 | 424 |
| 873 | 3300047472 | Ga0495686_0071182 | Ga0495686_0071182_784_2112 | 424 |
| 874 | 3300050493 | nmdc:mga0k408_120_c1 | nmdc:mga0k408_120_c1_11907_13235 | 424 |
| 875 | 3300050493 | nmdc:mga0k408_429_c1 | nmdc:mga0k408_429_c1_16105_17433 | 424 |
| 876 | 3300053122 | Ga0500608_015160 | Ga0500608_015160_1926_3254 | 424 |
| 877 | 3300053125 | Ga0500618_000148 | Ga0500618_000148_20386_21714 | 424 |
| 878 | 3300053157 | Ga0500624_000183 | Ga0500624_000183_7206_8534 | 424 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7o9f-assembly1.cif.gz_A | bacillus subtilis ffh in complex with ppgpp | 0.9613 | 2 | 297 |
| 7o9f-assembly3.cif.gz_C | bacillus subtilis ffh in complex with ppgpp | 0.9574 | 2 | 297 |
| 2ng1-assembly1.cif.gz_A | n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus | 0.9464 | 3 | 295 |
| 7o9f-assembly1.cif.gz_A | bacillus subtilis ffh in complex with ppgpp | 0.9457 | 2 | 297 |
| 3zn8-assembly1.cif.gz_A | structural basis of signal sequence surveillance and selection by the srp-sr complex | 0.9448 | 4 | 295 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGD9_219_421_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9558 | 97 | 294 | 3.40.50.300 |
| 5l3rC02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9476 | 89 | 282 | 3.40.50.300 |
| af_A0A0R0L4Y4_128_288_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9471 | 98 | 238 | 3.40.50.300 |
| af_Q4DKX0_351_574_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9443 | 98 | 294 | 3.40.50.300 |
| 5l3rC02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9381 | 89 | 282 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A349HVE3-F1-model_v4 | Signal recognition particle protein | 0.9768 | 117 | 297 |
GO:0003924
GO:0005525 GO:0006614 GO:0048500 |
| AF-A0A3D2J7D6-F1-model_v4 | Signal recognition particle protein | 0.9726 | 82 | 297 |
GO:0003924
GO:0005525 GO:0006614 GO:0016887 GO:0048500 |
| AF-A0A6N2LJV5-F1-model_v4 | SRP54-type proteins GTP-binding domain-containing protein | 0.9668 | 42 | 275 |
GO:0003924
GO:0005525 GO:0006614 GO:0016887 GO:0048500 |
| AF-A0A7J3QH51-F1-model_v4 | Signal recognition particle-docking protein FtsY | 0.9659 | 129 | 294 |
GO:0003924
GO:0005047 GO:0005525 GO:0005886 GO:0006614 |
| AF-G5GA32-F1-model_v4 | Signal recognition particle SRP54 helical bundle domain-containing protein | 0.9648 | 1 | 126 |
GO:0003924
GO:0005525 GO:0006614 GO:0048500 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar