F484443
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 879 | 415 | 872 | 234 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100462824|Ga0070680_1004628242 |
| Length | 258 |
| Sequence | MNRPRPRCDAAIAPSPRSSALTSSHRSRRGFGHVETWVFDLDNTLYPHHLNLWQQVDERIRSYVAEFLKVSKDEAFRVQKDYYRRYGTTMRGLMTEHGLKPDDYLEYVHQIDHSPLTPDPALGDALEKLPGRKLILTNGTRKHAEAVMARLEIDRHFEDVFDIAAADLDPKPLPQVYQRFLALHQVDPAKAAMFEDLARNLEVPHALGMTTVLVVPHGQREVFREGWELEGRDAPHVDHVTDDLAGYLRDIVRPAAPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 3 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 4 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 6 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 8 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 9 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 10 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 13 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 14 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 15 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 16 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 17 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 18 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 19 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 20 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 21 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 24 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 93 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 94 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 96 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 97 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 98 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 101 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 102 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 104 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 105 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 106 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 107 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 108 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 109 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 110 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 111 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 112 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 114 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 115 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 130 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 133 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 134 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 148 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 149 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 210 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 212 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 220 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 227 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 228 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 229 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 230 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 231 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 232 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 234 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 239 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 242 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 243 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 246 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 247 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 249 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 256 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 257 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 260 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 261 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 262 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 265 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 266 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 267 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 268 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 269 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 270 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 271 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 272 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 273 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 274 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 275 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 276 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 277 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 278 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 279 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 280 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 281 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 282 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 283 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 345 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 346 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 347 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 348 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 349 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 350 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 353 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 354 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 355 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 356 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 357 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 358 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 359 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 377 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 378 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 379 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 380 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 381 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 382 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 391 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 397 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 398 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 399 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 400 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 401 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 402 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 403 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 404 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 406 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 407 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 408 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 411 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 412 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 413 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 414 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 415 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.09 |
| Metatranscriptomes | 0.11 |
| Isolates | 0.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.21 |
| Nodule | 1.14 |
| Rhizoplane | 5.8 |
| Rhizosphere | 87.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214828534 | 2209111006 | Bacteria | 9441 |
| 2 | ARcpr5oldR_c000010 | 3300000041 | Bacteria | 39074 |
| 3 | ARSoilYngRDRAFT_c00060 | 3300000042 | Bacteria | 17969 |
| 4 | ARcpr5yngRDRAFT_c000016 | 3300000043 | Bacteria | 29226 |
| 5 | ARSoilOldRDRAFT_c000011 | 3300000044 | Bacteria | 42914 |
| 6 | ARCol0oldRDRAFT_c00012 | 3300000045 | Bacteria | 14081 |
| 7 | ARCol0yngRDRAFT_1000018 | 3300000652 | Bacteria | 30924 |
| 8 | JGI24746J21847_1007946 | 3300001977 | Bacteria | 1610 |
| 9 | JGI24739J22299_10059068 | 3300001989 | Bacteria | 1216 |
| 10 | JGI24743J22301_10024590 | 3300001991 | Bacteria | 1164 |
| 11 | JGI24750J21931_1000096 | 3300002070 | Bacteria | 13445 |
| 12 | JGI24750J21931_1005344 | 3300002070 | Bacteria | 1579 |
| 13 | JGI24748J21848_1000302 | 3300002074 | Bacteria | 5782 |
| 14 | JGI24738J21930_10000997 | 3300002075 | Bacteria | 8121 |
| 15 | JGI24738J21930_10015540 | 3300002075 | Bacteria | 1617 |
| 16 | JGI24749J21850_1001768 | 3300002076 | Bacteria | 3058 |
| 17 | JGI24744J21845_10001649 | 3300002077 | Bacteria | 4465 |
| 18 | JGI24033J26618_1000471 | 3300002155 | Bacteria | 3965 |
| 19 | JGI24742J22300_10000916 | 3300002244 | Bacteria | 4501 |
| 20 | JGI24742J22300_10003081 | 3300002244 | Bacteria | 2697 |
| 21 | JGI24751J29686_10007269 | 3300002459 | Bacteria | 2262 |
| 22 | Ga0065716_1001756 | 3300005277 | Bacteria | 3560 |
| 23 | Ga0065704_10080159 | 3300005289 | Bacteria | 3999 |
| 24 | Ga0065712_10075299 | 3300005290 | Bacteria | 3891 |
| 25 | Ga0065715_10007070 | 3300005293 | Bacteria | 5698 |
| 26 | Ga0065715_10099107 | 3300005293 | Bacteria | 3453 |
| 27 | Ga0065715_10136801 | 3300005293 | Bacteria | 1917 |
| 28 | Ga0065707_10174416 | 3300005295 | Bacteria | 1461 |
| 29 | Ga0070676_10000506 | 3300005328 | Bacteria | 18658 |
| 30 | Ga0070676_10112545 | 3300005328 | Bacteria | 1697 |
| 31 | Ga0070683_100014228 | 3300005329 | Bacteria | 6954 |
| 32 | Ga0070690_100007842 | 3300005330 | Bacteria | 6123 |
| 33 | Ga0070690_100010449 | 3300005330 | Bacteria | 5404 |
| 34 | Ga0070690_100174897 | 3300005330 | Bacteria | 1480 |
| 35 | Ga0070670_100004573 | 3300005331 | Bacteria | 11607 |
| 36 | Ga0070670_100034128 | 3300005331 | Bacteria | 4379 |
| 37 | Ga0070677_10000227 | 3300005333 | Bacteria | 19393 |
| 38 | Ga0068869_100001832 | 3300005334 | Bacteria | 12767 |
| 39 | Ga0068869_100007353 | 3300005334 | Bacteria | 7029 |
| 40 | Ga0070666_10006992 | 3300005335 | Bacteria | 6955 |
| 41 | Ga0070666_10036086 | 3300005335 | Bacteria | 3279 |
| 42 | Ga0070680_100003424 | 3300005336 | Bacteria | 11842 |
| 43 | Ga0070680_100063627 | 3300005336 | Bacteria | 3022 |
| 44 | Ga0070680_100462824 | 3300005336 | Bacteria | 1083 |
| 45 | Ga0070682_100001699 | 3300005337 | Bacteria | 12232 |
| 46 | Ga0070682_100050082 | 3300005337 | Bacteria | 2606 |
| 47 | Ga0068868_100011853 | 3300005338 | Bacteria | 6357 |
| 48 | Ga0068868_100012331 | 3300005338 | Bacteria | 6246 |
| 49 | Ga0068868_100065314 | 3300005338 | Bacteria | 2890 |
| 50 | Ga0070660_100038742 | 3300005339 | Bacteria | 3619 |
| 51 | Ga0070689_100000668 | 3300005340 | Bacteria | 20748 |
| 52 | Ga0070689_100088514 | 3300005340 | Bacteria | 2437 |
| 53 | Ga0070689_100127239 | 3300005340 | Bacteria | 2040 |
| 54 | Ga0070691_10014701 | 3300005341 | Bacteria | 3592 |
| 55 | Ga0070687_100000527 | 3300005343 | Bacteria | 12848 |
| 56 | Ga0070687_100038150 | 3300005343 | Bacteria | 2406 |
| 57 | Ga0070687_100228897 | 3300005343 | Bacteria | 1143 |
| 58 | Ga0070692_10001083 | 3300005345 | Bacteria | 9454 |
| 59 | Ga0070692_10014018 | 3300005345 | Bacteria | 3752 |
| 60 | Ga0070668_100003117 | 3300005347 | Bacteria | 12247 |
| 61 | Ga0070669_100224679 | 3300005353 | Bacteria | 1486 |
| 62 | Ga0070675_100002954 | 3300005354 | Bacteria | 12826 |
| 63 | Ga0070675_100020637 | 3300005354 | Bacteria | 5257 |
| 64 | Ga0070675_100366607 | 3300005354 | Bacteria | 1280 |
| 65 | Ga0070671_100003210 | 3300005355 | Bacteria | 12748 |
| 66 | Ga0070671_100026233 | 3300005355 | Bacteria | 4787 |
| 67 | Ga0070671_100038884 | 3300005355 | Bacteria | 3949 |
| 68 | Ga0070671_100052167 | 3300005355 | Bacteria | 3401 |
| 69 | Ga0070671_100172776 | 3300005355 | Bacteria | 1828 |
| 70 | Ga0070674_100009633 | 3300005356 | Bacteria | 5793 |
| 71 | Ga0070673_100001477 | 3300005364 | Bacteria | 13763 |
| 72 | Ga0070673_100008698 | 3300005364 | Bacteria | 6770 |
| 73 | Ga0070673_100222991 | 3300005364 | Bacteria | 1632 |
| 74 | Ga0070688_100001239 | 3300005365 | Bacteria | 12735 |
| 75 | Ga0070688_100012611 | 3300005365 | Bacteria | 4738 |
| 76 | Ga0070688_100017884 | 3300005365 | Bacteria | 4077 |
| 77 | Ga0070688_100069139 | 3300005365 | Bacteria | 2254 |
| 78 | Ga0070688_100073957 | 3300005365 | Bacteria | 2187 |
| 79 | Ga0070659_100023902 | 3300005366 | Bacteria | 4681 |
| 80 | Ga0070659_100233962 | 3300005366 | Bacteria | 1519 |
| 81 | Ga0070667_100022264 | 3300005367 | Bacteria | 5258 |
| 82 | Ga0070667_100089271 | 3300005367 | Bacteria | 2648 |
| 83 | Ga0070709_10019255 | 3300005434 | Bacteria | 3944 |
| 84 | Ga0070709_10234450 | 3300005434 | Bacteria | 1315 |
| 85 | Ga0070714_100074119 | 3300005435 | Bacteria | 2950 |
| 86 | Ga0070713_100029883 | 3300005436 | Bacteria | 4321 |
| 87 | Ga0070713_100071863 | 3300005436 | Bacteria | 2925 |
| 88 | Ga0070713_100251269 | 3300005436 | Bacteria | 1613 |
| 89 | Ga0070710_10069603 | 3300005437 | Bacteria | 2025 |
| 90 | Ga0070701_10070848 | 3300005438 | Bacteria | 1863 |
| 91 | Ga0070711_100025583 | 3300005439 | Bacteria | 3864 |
| 92 | Ga0070711_100064990 | 3300005439 | Bacteria | 2550 |
| 93 | Ga0070705_100001458 | 3300005440 | Bacteria | 12507 |
| 94 | Ga0070700_100001211 | 3300005441 | Bacteria | 12787 |
| 95 | Ga0070700_100002278 | 3300005441 | Bacteria | 9750 |
| 96 | Ga0070694_100001764 | 3300005444 | Bacteria | 12786 |
| 97 | Ga0070694_100107362 | 3300005444 | Bacteria | 1984 |
| 98 | Ga0070708_100036600 | 3300005445 | Bacteria | 4281 |
| 99 | Ga0070663_100065868 | 3300005455 | Bacteria | 2623 |
| 100 | Ga0070663_100198516 | 3300005455 | Bacteria | 1564 |
| 101 | Ga0070678_100000525 | 3300005456 | Bacteria | 18583 |
| 102 | Ga0070678_100114733 | 3300005456 | Bacteria | 2114 |
| 103 | Ga0070662_100002968 | 3300005457 | Bacteria | 10539 |
| 104 | Ga0070662_100029329 | 3300005457 | Bacteria | 3839 |
| 105 | Ga0070662_100233026 | 3300005457 | Bacteria | 1474 |
| 106 | Ga0070681_10102104 | 3300005458 | Bacteria | 2813 |
| 107 | Ga0068867_100002950 | 3300005459 | Bacteria | 11984 |
| 108 | Ga0068867_100003711 | 3300005459 | Bacteria | 10742 |
| 109 | Ga0070685_10003505 | 3300005466 | Bacteria | 7982 |
| 110 | Ga0070685_10143393 | 3300005466 | Bacteria | 1506 |
| 111 | Ga0070706_100290798 | 3300005467 | Bacteria | 1525 |
| 112 | Ga0070679_100015045 | 3300005530 | Bacteria | 7434 |
| 113 | Ga0070679_100034800 | 3300005530 | Bacteria | 4995 |
| 114 | Ga0070679_100487804 | 3300005530 | Bacteria | 1176 |
| 115 | Ga0070684_100020944 | 3300005535 | Bacteria | 5429 |
| 116 | Ga0070684_100052856 | 3300005535 | Bacteria | 3534 |
| 117 | Ga0070684_100095217 | 3300005535 | Bacteria | 2652 |
| 118 | Ga0068853_100045084 | 3300005539 | Bacteria | 3776 |
| 119 | Ga0070672_100006952 | 3300005543 | Bacteria | 7653 |
| 120 | Ga0070686_100001573 | 3300005544 | Bacteria | 12811 |
| 121 | Ga0070686_100068268 | 3300005544 | Bacteria | 2318 |
| 122 | Ga0070696_100030640 | 3300005546 | Bacteria | 3685 |
| 123 | Ga0070693_100000880 | 3300005547 | Bacteria | 13363 |
| 124 | Ga0070665_100056009 | 3300005548 | Bacteria | 3954 |
| 125 | Ga0070665_100146697 | 3300005548 | Bacteria | 2362 |
| 126 | Ga0070665_100175390 | 3300005548 | Bacteria | 2144 |
| 127 | Ga0070665_101130573 | 3300005548 | Bacteria | 794 |
| 128 | Ga0070704_100001917 | 3300005549 | Bacteria | 11493 |
| 129 | Ga0070704_100104467 | 3300005549 | Bacteria | 2142 |
| 130 | Ga0068855_100592098 | 3300005563 | Bacteria | 1197 |
| 131 | Ga0070664_100002934 | 3300005564 | Bacteria | 13792 |
| 132 | Ga0070664_100014397 | 3300005564 | Bacteria | 6450 |
| 133 | Ga0070664_100153442 | 3300005564 | Bacteria | 2034 |
| 134 | Ga0070664_100180771 | 3300005564 | Bacteria | 1874 |
| 135 | Ga0068857_100000358 | 3300005577 | Bacteria | 31869 |
| 136 | Ga0068857_100376240 | 3300005577 | Bacteria | 1318 |
| 137 | Ga0068854_100008663 | 3300005578 | Bacteria | 6548 |
| 138 | Ga0068854_100275369 | 3300005578 | Bacteria | 1353 |
| 139 | Ga0068856_100065255 | 3300005614 | Bacteria | 3597 |
| 140 | Ga0068856_100119127 | 3300005614 | Bacteria | 2641 |
| 141 | Ga0068856_100156786 | 3300005614 | Bacteria | 2287 |
| 142 | Ga0070702_100013601 | 3300005615 | Bacteria | 4112 |
| 143 | Ga0068852_100021772 | 3300005616 | Bacteria | 5127 |
| 144 | Ga0068859_100005591 | 3300005617 | Bacteria | 12805 |
| 145 | Ga0068859_100018152 | 3300005617 | Bacteria | 7070 |
| 146 | Ga0068859_100310219 | 3300005617 | Bacteria | 1671 |
| 147 | Ga0068864_100001988 | 3300005618 | Bacteria | 16835 |
| 148 | Ga0068864_100044813 | 3300005618 | Bacteria | 3793 |
| 149 | Ga0068866_10048931 | 3300005718 | Bacteria | 2139 |
| 150 | Ga0068861_100001805 | 3300005719 | Bacteria | 13785 |
| 151 | Ga0068861_100028834 | 3300005719 | Bacteria | 4053 |
| 152 | Ga0068870_10000025 | 3300005840 | Bacteria | 46848 |
| 153 | Ga0068870_10008401 | 3300005840 | Bacteria | 4643 |
| 154 | Ga0068863_100002964 | 3300005841 | Bacteria | 16783 |
| 155 | Ga0068863_100003083 | 3300005841 | Bacteria | 16468 |
| 156 | Ga0068858_100003227 | 3300005842 | Bacteria | 16273 |
| 157 | Ga0068858_100026853 | 3300005842 | Bacteria | 5348 |
| 158 | Ga0068858_100432981 | 3300005842 | Bacteria | 1266 |
| 159 | Ga0068858_100558164 | 3300005842 | Bacteria | 1109 |
| 160 | Ga0068860_100013320 | 3300005843 | Bacteria | 8062 |
| 161 | Ga0068860_100588190 | 3300005843 | Bacteria | 1118 |
| 162 | Ga0068862_100243383 | 3300005844 | Bacteria | 1636 |
| 163 | Ga0081455_10000276 | 3300005937 | Bacteria | 68055 |
| 164 | Ga0081455_10002463 | 3300005937 | Bacteria | 22024 |
| 165 | Ga0081455_10023997 | 3300005937 | Bacteria | 5660 |
| 166 | Ga0081455_10030467 | 3300005937 | Bacteria | 4899 |
| 167 | Ga0081540_1003744 | 3300005983 | Bacteria | 11917 |
| 168 | Ga0081540_1039896 | 3300005983 | Bacteria | 2455 |
| 169 | Ga0070717_10071648 | 3300006028 | Bacteria | 2892 |
| 170 | Ga0070717_10148248 | 3300006028 | Bacteria | 2028 |
| 171 | Ga0070717_10506230 | 3300006028 | Bacteria | 1092 |
| 172 | Ga0075365_10084204 | 3300006038 | Bacteria | 2158 |
| 173 | Ga0075368_10013700 | 3300006042 | Bacteria | 2981 |
| 174 | Ga0075368_10028565 | 3300006042 | Bacteria | 2155 |
| 175 | Ga0075368_10037514 | 3300006042 | Bacteria | 1895 |
| 176 | Ga0075364_10088279 | 3300006051 | Bacteria | 2056 |
| 177 | Ga0075364_10094554 | 3300006051 | Bacteria | 1986 |
| 178 | Ga0070715_10094663 | 3300006163 | Bacteria | 1381 |
| 179 | Ga0070715_10165699 | 3300006163 | Bacteria | 1096 |
| 180 | Ga0070712_100033595 | 3300006175 | Bacteria | 3472 |
| 181 | Ga0070712_100100946 | 3300006175 | Bacteria | 2133 |
| 182 | Ga0070712_100230769 | 3300006175 | Bacteria | 1470 |
| 183 | Ga0075362_10022833 | 3300006177 | Bacteria | 2640 |
| 184 | Ga0075362_10158854 | 3300006177 | Bacteria | 1087 |
| 185 | Ga0075367_10079141 | 3300006178 | Bacteria | 1986 |
| 186 | Ga0075367_10156249 | 3300006178 | Bacteria | 1417 |
| 187 | Ga0097621_100000456 | 3300006237 | Bacteria | 28666 |
| 188 | Ga0097621_100037929 | 3300006237 | Bacteria | 3865 |
| 189 | Ga0097621_100052081 | 3300006237 | Bacteria | 3333 |
| 190 | Ga0075370_10058511 | 3300006353 | Bacteria | 2192 |
| 191 | Ga0068871_100004245 | 3300006358 | Bacteria | 9933 |
| 192 | Ga0068871_100020804 | 3300006358 | Bacteria | 5032 |
| 193 | Ga0068871_100024937 | 3300006358 | Bacteria | 4645 |
| 194 | Ga0075428_100268105 | 3300006844 | Bacteria | 1837 |
| 195 | Ga0075430_100042214 | 3300006846 | Bacteria | 3857 |
| 196 | Ga0075430_100236559 | 3300006846 | Bacteria | 1514 |
| 197 | Ga0075431_100094786 | 3300006847 | Bacteria | 3081 |
| 198 | Ga0075431_100173127 | 3300006847 | Bacteria | 2218 |
| 199 | Ga0075433_10247616 | 3300006852 | Bacteria | 1581 |
| 200 | Ga0075434_100004861 | 3300006871 | Bacteria | 12175 |
| 201 | Ga0075434_100105570 | 3300006871 | Bacteria | 2827 |
| 202 | Ga0075434_100143730 | 3300006871 | Bacteria | 2406 |
| 203 | Ga0075429_100572698 | 3300006880 | Bacteria | 989 |
| 204 | Ga0075429_100607676 | 3300006880 | Bacteria | 958 |
| 205 | Ga0068865_100019723 | 3300006881 | Bacteria | 4366 |
| 206 | Ga0097620_100005590 | 3300006931 | Bacteria | 12805 |
| 207 | Ga0097620_100018152 | 3300006931 | Bacteria | 7070 |
| 208 | Ga0097620_100310218 | 3300006931 | Bacteria | 1671 |
| 209 | Ga0075435_100050168 | 3300007076 | Bacteria | 3358 |
| 210 | Ga0075435_100079258 | 3300007076 | Bacteria | 2695 |
| 211 | Ga0099795_10005314 | 3300007788 | Bacteria | 3412 |
| 212 | Ga0105244_10032578 | 3300009036 | Bacteria | 2757 |
| 213 | Ga0105250_10089502 | 3300009092 | Bacteria | 1251 |
| 214 | Ga0105240_10111998 | 3300009093 | Bacteria | 3300 |
| 215 | Ga0105240_10230582 | 3300009093 | Bacteria | 2152 |
| 216 | Ga0111539_10003331 | 3300009094 | Bacteria | 21223 |
| 217 | Ga0111539_10007321 | 3300009094 | Bacteria | 14133 |
| 218 | Ga0105245_10000183 | 3300009098 | Bacteria | 59105 |
| 219 | Ga0105245_10038415 | 3300009098 | Bacteria | 4259 |
| 220 | Ga0105245_10130624 | 3300009098 | Bacteria | 2356 |
| 221 | Ga0105245_10224069 | 3300009098 | Bacteria | 1816 |
| 222 | Ga0105247_10009563 | 3300009101 | Bacteria | 5882 |
| 223 | Ga0105247_10012907 | 3300009101 | Bacteria | 5011 |
| 224 | Ga0105247_10019428 | 3300009101 | Bacteria | 4079 |
| 225 | Ga0114129_10001218 | 3300009147 | Bacteria | 34180 |
| 226 | Ga0114129_10143612 | 3300009147 | Bacteria | 3270 |
| 227 | Ga0114129_10271211 | 3300009147 | Bacteria | 2270 |
| 228 | Ga0105243_10001561 | 3300009148 | Bacteria | 20018 |
| 229 | Ga0105241_10003567 | 3300009174 | Bacteria | 11569 |
| 230 | Ga0105242_10000701 | 3300009176 | Bacteria | 26184 |
| 231 | Ga0105242_10081550 | 3300009176 | Bacteria | 2705 |
| 232 | Ga0105248_10010394 | 3300009177 | Bacteria | 10250 |
| 233 | Ga0105248_10039630 | 3300009177 | Bacteria | 5279 |
| 234 | Ga0105248_10150227 | 3300009177 | Bacteria | 2628 |
| 235 | Ga0105248_10438683 | 3300009177 | Bacteria | 1471 |
| 236 | Ga0105248_10554388 | 3300009177 | Bacteria | 1297 |
| 237 | Ga0105237_10081640 | 3300009545 | Bacteria | 3224 |
| 238 | Ga0105237_10369590 | 3300009545 | Bacteria | 1439 |
| 239 | Ga0105238_10137275 | 3300009551 | Bacteria | 2423 |
| 240 | Ga0105238_10198677 | 3300009551 | Bacteria | 1980 |
| 241 | Ga0105238_10237032 | 3300009551 | Bacteria | 1802 |
| 242 | Ga0105238_10288067 | 3300009551 | Bacteria | 1624 |
| 243 | Ga0105249_10061656 | 3300009553 | Bacteria | 3442 |
| 244 | Ga0105249_10135144 | 3300009553 | Bacteria | 2359 |
| 245 | Ga0099796_10001281 | 3300010159 | Bacteria | 4957 |
| 246 | Ga0099796_10095590 | 3300010159 | Bacteria | 1110 |
| 247 | Ga0105239_10007315 | 3300010375 | Bacteria | 12675 |
| 248 | Ga0105239_10075680 | 3300010375 | Bacteria | 3702 |
| 249 | Ga0105239_10109477 | 3300010375 | Bacteria | 3062 |
| 250 | Ga0105239_10124653 | 3300010375 | Bacteria | 2862 |
| 251 | Ga0105239_10222955 | 3300010375 | Bacteria | 2115 |
| 252 | Ga0105239_10733186 | 3300010375 | Bacteria | 1131 |
| 253 | Ga0105246_10040206 | 3300011119 | Bacteria | 3155 |
| 254 | Ga0157313_1001654 | 3300012503 | Bacteria | 1236 |
| 255 | Ga0157338_1001595 | 3300012515 | Bacteria | 1651 |
| 256 | Ga0157371_10089641 | 3300013102 | Bacteria | 2178 |
| 257 | Ga0157371_10198437 | 3300013102 | Bacteria | 1438 |
| 258 | Ga0157369_10182437 | 3300013105 | Bacteria | 2208 |
| 259 | Ga0157369_10354496 | 3300013105 | Bacteria | 1524 |
| 260 | Ga0157374_10000463 | 3300013296 | Bacteria | 36848 |
| 261 | Ga0157374_10005521 | 3300013296 | Bacteria | 10633 |
| 262 | Ga0157374_10113975 | 3300013296 | Bacteria | 2602 |
| 263 | Ga0157378_10000613 | 3300013297 | Bacteria | 33512 |
| 264 | Ga0157378_10078613 | 3300013297 | Bacteria | 2976 |
| 265 | Ga0157378_10317747 | 3300013297 | Bacteria | 1512 |
| 266 | Ga0163162_10005908 | 3300013306 | Bacteria | 11842 |
| 267 | Ga0163162_10112257 | 3300013306 | Bacteria | 2824 |
| 268 | Ga0163162_10320702 | 3300013306 | Bacteria | 1682 |
| 269 | Ga0157375_10004786 | 3300013308 | Bacteria | 11768 |
| 270 | Ga0157375_10076811 | 3300013308 | Bacteria | 3368 |
| 271 | Ga0157375_10514386 | 3300013308 | Bacteria | 1361 |
| 272 | Ga0163163_10001239 | 3300014325 | Bacteria | 21547 |
| 273 | Ga0163163_10025813 | 3300014325 | Bacteria | 5604 |
| 274 | Ga0163163_10096112 | 3300014325 | Bacteria | 2983 |
| 275 | Ga0163163_10323863 | 3300014325 | Bacteria | 1595 |
| 276 | Ga0157380_10004641 | 3300014326 | Bacteria | 9554 |
| 277 | Ga0157377_10001711 | 3300014745 | Bacteria | 9575 |
| 278 | Ga0157377_10021447 | 3300014745 | Bacteria | 3398 |
| 279 | Ga0157379_10003902 | 3300014968 | Bacteria | 12714 |
| 280 | Ga0157379_10004577 | 3300014968 | Bacteria | 11866 |
| 281 | Ga0157379_10033161 | 3300014968 | Bacteria | 4605 |
| 282 | Ga0157376_10003730 | 3300014969 | Bacteria | 10526 |
| 283 | Ga0157376_10028988 | 3300014969 | Bacteria | 4407 |
| 284 | Ga0157376_10046136 | 3300014969 | Bacteria | 3592 |
| 285 | Ga0163161_10001492 | 3300017792 | Bacteria | 17279 |
| 286 | Ga0206353_11182671 | 3300020082 | Bacteria | 1787 |
| 287 | Ga0213876_10076060 | 3300021384 | Bacteria | 1773 |
| 288 | Ga0213876_10164681 | 3300021384 | Bacteria | 1180 |
| 289 | Ga0213875_10000011 | 3300021388 | Bacteria | 332447 |
| 290 | Ga0207666_1000140 | 3300025271 | Bacteria | 11329 |
| 291 | Ga0207673_1000714 | 3300025290 | Bacteria | 3557 |
| 292 | Ga0207682_10000062 | 3300025893 | Bacteria | 46841 |
| 293 | Ga0207692_10224337 | 3300025898 | Bacteria | 1115 |
| 294 | Ga0207710_10004068 | 3300025900 | Bacteria | 6431 |
| 295 | Ga0207710_10016736 | 3300025900 | Bacteria | 3104 |
| 296 | Ga0207710_10024743 | 3300025900 | Bacteria | 2588 |
| 297 | Ga0207710_10264788 | 3300025900 | Bacteria | 862 |
| 298 | Ga0207688_10001290 | 3300025901 | Bacteria | 12987 |
| 299 | Ga0207680_10005019 | 3300025903 | Bacteria | 6305 |
| 300 | Ga0207680_10155059 | 3300025903 | Bacteria | 1530 |
| 301 | Ga0207647_10003504 | 3300025904 | Bacteria | 11767 |
| 302 | Ga0207647_10017409 | 3300025904 | Bacteria | 4884 |
| 303 | Ga0207685_10058088 | 3300025905 | Bacteria | 1521 |
| 304 | Ga0207685_10125361 | 3300025905 | Bacteria | 1133 |
| 305 | Ga0207699_10115923 | 3300025906 | Bacteria | 1724 |
| 306 | Ga0207699_10157162 | 3300025906 | Bacteria | 1510 |
| 307 | Ga0207645_10000248 | 3300025907 | Bacteria | 44949 |
| 308 | Ga0207645_10049727 | 3300025907 | Bacteria | 2677 |
| 309 | Ga0207645_10094260 | 3300025907 | Bacteria | 1927 |
| 310 | Ga0207643_10000064 | 3300025908 | Bacteria | 70490 |
| 311 | Ga0207643_10009464 | 3300025908 | Bacteria | 5233 |
| 312 | Ga0207654_10001623 | 3300025911 | Bacteria | 11742 |
| 313 | Ga0207654_10140118 | 3300025911 | Bacteria | 1541 |
| 314 | Ga0207671_10007347 | 3300025914 | Bacteria | 9567 |
| 315 | Ga0207671_10116264 | 3300025914 | Bacteria | 2040 |
| 316 | Ga0207693_10028571 | 3300025915 | Bacteria | 4407 |
| 317 | Ga0207693_10030951 | 3300025915 | Bacteria | 4227 |
| 318 | Ga0207693_10039913 | 3300025915 | Bacteria | 3696 |
| 319 | Ga0207693_10147608 | 3300025915 | Bacteria | 1849 |
| 320 | Ga0207663_10014105 | 3300025916 | Bacteria | 4366 |
| 321 | Ga0207663_10018380 | 3300025916 | Bacteria | 3918 |
| 322 | Ga0207663_10050733 | 3300025916 | Bacteria | 2580 |
| 323 | Ga0207660_10000194 | 3300025917 | Bacteria | 38742 |
| 324 | Ga0207662_10004066 | 3300025918 | Bacteria | 7635 |
| 325 | Ga0207657_10006919 | 3300025919 | Bacteria | 11695 |
| 326 | Ga0207657_10033938 | 3300025919 | Bacteria | 4595 |
| 327 | Ga0207649_10000234 | 3300025920 | Bacteria | 45397 |
| 328 | Ga0207652_10001613 | 3300025921 | Bacteria | 19823 |
| 329 | Ga0207646_10560944 | 3300025922 | Bacteria | 1026 |
| 330 | Ga0207681_10000794 | 3300025923 | Bacteria | 20828 |
| 331 | Ga0207681_10013919 | 3300025923 | Bacteria | 4984 |
| 332 | Ga0207694_10733360 | 3300025924 | Bacteria | 834 |
| 333 | Ga0207650_10009594 | 3300025925 | Bacteria | 6619 |
| 334 | Ga0207650_10021193 | 3300025925 | Bacteria | 4595 |
| 335 | Ga0207650_10056285 | 3300025925 | Bacteria | 2922 |
| 336 | Ga0207659_10000172 | 3300025926 | Bacteria | 38725 |
| 337 | Ga0207659_10005666 | 3300025926 | Bacteria | 7599 |
| 338 | Ga0207687_10008699 | 3300025927 | Bacteria | 6631 |
| 339 | Ga0207687_10024271 | 3300025927 | Bacteria | 4049 |
| 340 | Ga0207687_10056318 | 3300025927 | Bacteria | 2758 |
| 341 | Ga0207700_10148256 | 3300025928 | Bacteria | 1936 |
| 342 | Ga0207664_10021143 | 3300025929 | Bacteria | 4833 |
| 343 | Ga0207664_10113715 | 3300025929 | Bacteria | 2254 |
| 344 | Ga0207664_10766688 | 3300025929 | Bacteria | 868 |
| 345 | Ga0207644_10000439 | 3300025931 | Bacteria | 26923 |
| 346 | Ga0207644_10024988 | 3300025931 | Bacteria | 4104 |
| 347 | Ga0207644_10060993 | 3300025931 | Bacteria | 2730 |
| 348 | Ga0207644_10075967 | 3300025931 | Bacteria | 2470 |
| 349 | Ga0207690_10000796 | 3300025932 | Bacteria | 20342 |
| 350 | Ga0207690_10025613 | 3300025932 | Bacteria | 3706 |
| 351 | Ga0207706_10004291 | 3300025933 | Bacteria | 13400 |
| 352 | Ga0207706_10005059 | 3300025933 | Bacteria | 12314 |
| 353 | Ga0207686_10001093 | 3300025934 | Bacteria | 15891 |
| 354 | Ga0207686_10044339 | 3300025934 | Bacteria | 2730 |
| 355 | Ga0207686_10117395 | 3300025934 | Bacteria | 1805 |
| 356 | Ga0207709_10001438 | 3300025935 | Bacteria | 16619 |
| 357 | Ga0207709_10043780 | 3300025935 | Bacteria | 2701 |
| 358 | Ga0207670_10000807 | 3300025936 | Bacteria | 16336 |
| 359 | Ga0207670_10030728 | 3300025936 | Bacteria | 3433 |
| 360 | Ga0207670_10104223 | 3300025936 | Bacteria | 2031 |
| 361 | Ga0207670_10104583 | 3300025936 | Bacteria | 2028 |
| 362 | Ga0207669_10000141 | 3300025937 | Bacteria | 34618 |
| 363 | Ga0207669_10010680 | 3300025937 | Bacteria | 4430 |
| 364 | Ga0207704_10000755 | 3300025938 | Bacteria | 14264 |
| 365 | Ga0207704_10004770 | 3300025938 | Bacteria | 6225 |
| 366 | Ga0207704_10487023 | 3300025938 | Bacteria | 991 |
| 367 | Ga0207665_10203496 | 3300025939 | Bacteria | 1443 |
| 368 | Ga0207665_10395219 | 3300025939 | Bacteria | 1052 |
| 369 | Ga0207711_10006747 | 3300025941 | Bacteria | 9652 |
| 370 | Ga0207711_10071197 | 3300025941 | Bacteria | 3017 |
| 371 | Ga0207711_10461921 | 3300025941 | Bacteria | 1182 |
| 372 | Ga0207689_10004430 | 3300025942 | Bacteria | 12738 |
| 373 | Ga0207689_10029667 | 3300025942 | Bacteria | 4565 |
| 374 | Ga0207661_10000098 | 3300025944 | Bacteria | 55518 |
| 375 | Ga0207679_10000174 | 3300025945 | Bacteria | 53051 |
| 376 | Ga0207679_10073705 | 3300025945 | Bacteria | 2584 |
| 377 | Ga0207679_10166636 | 3300025945 | Bacteria | 1810 |
| 378 | Ga0207651_10000782 | 3300025960 | Bacteria | 13684 |
| 379 | Ga0207651_10011899 | 3300025960 | Bacteria | 4891 |
| 380 | Ga0207651_10027084 | 3300025960 | Bacteria | 3595 |
| 381 | Ga0207712_10000659 | 3300025961 | Bacteria | 26800 |
| 382 | Ga0207712_10067484 | 3300025961 | Bacteria | 2560 |
| 383 | Ga0207712_10781975 | 3300025961 | Bacteria | 838 |
| 384 | Ga0207668_10001107 | 3300025972 | Bacteria | 16030 |
| 385 | Ga0207668_10015312 | 3300025972 | Bacteria | 4761 |
| 386 | Ga0207640_10000846 | 3300025981 | Bacteria | 17376 |
| 387 | Ga0207640_10062755 | 3300025981 | Bacteria | 2467 |
| 388 | Ga0207658_10186912 | 3300025986 | Bacteria | 1719 |
| 389 | Ga0207677_10031190 | 3300026023 | Bacteria | 3412 |
| 390 | Ga0207677_10337358 | 3300026023 | Bacteria | 1258 |
| 391 | Ga0207703_10002433 | 3300026035 | Bacteria | 16135 |
| 392 | Ga0207703_10010252 | 3300026035 | Bacteria | 7340 |
| 393 | Ga0207703_10355064 | 3300026035 | Bacteria | 1351 |
| 394 | Ga0207639_10249017 | 3300026041 | Bacteria | 1548 |
| 395 | Ga0207678_10001059 | 3300026067 | Bacteria | 25176 |
| 396 | Ga0207678_10236838 | 3300026067 | Bacteria | 1563 |
| 397 | Ga0207708_10002793 | 3300026075 | Bacteria | 12833 |
| 398 | Ga0207708_10006968 | 3300026075 | Bacteria | 8358 |
| 399 | Ga0207702_10089635 | 3300026078 | Bacteria | 2690 |
| 400 | Ga0207702_10241850 | 3300026078 | Bacteria | 1691 |
| 401 | Ga0207641_10000622 | 3300026088 | Bacteria | 38657 |
| 402 | Ga0207641_10020383 | 3300026088 | Bacteria | 5445 |
| 403 | Ga0207648_10002750 | 3300026089 | Bacteria | 18697 |
| 404 | Ga0207648_10031513 | 3300026089 | Bacteria | 4688 |
| 405 | Ga0207648_10118031 | 3300026089 | Bacteria | 2331 |
| 406 | Ga0207676_10002696 | 3300026095 | Bacteria | 12630 |
| 407 | Ga0207676_10006905 | 3300026095 | Bacteria | 8046 |
| 408 | Ga0207674_10001342 | 3300026116 | Bacteria | 31848 |
| 409 | Ga0207674_10312762 | 3300026116 | Bacteria | 1520 |
| 410 | Ga0207674_10365561 | 3300026116 | Bacteria | 1395 |
| 411 | Ga0207675_100110796 | 3300026118 | Bacteria | 2590 |
| 412 | Ga0207683_10001193 | 3300026121 | Bacteria | 23509 |
| 413 | Ga0207683_10031134 | 3300026121 | Bacteria | 4629 |
| 414 | Ga0207683_10039243 | 3300026121 | Bacteria | 4130 |
| 415 | Ga0207698_10016429 | 3300026142 | Bacteria | 4988 |
| 416 | Ga0207698_10340025 | 3300026142 | Bacteria | 1413 |
| 417 | Ga0209589_1000017 | 3300027357 | Bacteria | 215546 |
| 418 | Ga0209489_100018 | 3300027361 | Bacteria | 215546 |
| 419 | Ga0209700_100028 | 3300027363 | Bacteria | 215546 |
| 420 | Ga0209179_1016890 | 3300027512 | Bacteria | 1374 |
| 421 | Ga0209999_1006731 | 3300027543 | Bacteria | 2068 |
| 422 | Ga0209970_1007996 | 3300027614 | Bacteria | 1736 |
| 423 | Ga0210002_1021945 | 3300027617 | Bacteria | 1034 |
| 424 | Ga0209983_1024340 | 3300027665 | Bacteria | 1274 |
| 425 | Ga0209971_1000957 | 3300027682 | Bacteria | 7413 |
| 426 | Ga0209966_1008911 | 3300027695 | Bacteria | 1787 |
| 427 | Ga0207428_10000513 | 3300027907 | Bacteria | 46311 |
| 428 | Ga0207428_10000626 | 3300027907 | Bacteria | 41522 |
| 429 | Ga0207428_10001020 | 3300027907 | Bacteria | 31018 |
| 430 | Ga0207428_10202037 | 3300027907 | Bacteria | 1495 |
| 431 | Ga0207428_10236088 | 3300027907 | Bacteria | 1367 |
| 432 | Ga0268266_10071484 | 3300028379 | Bacteria | 3007 |
| 433 | Ga0268266_10174688 | 3300028379 | Bacteria | 1952 |
| 434 | Ga0268265_10002370 | 3300028380 | Bacteria | 14256 |
| 435 | Ga0268265_10144309 | 3300028380 | Bacteria | 1997 |
| 436 | Ga0268264_10004444 | 3300028381 | Bacteria | 11961 |
| 437 | Ga0268264_10021393 | 3300028381 | Bacteria | 5282 |
| 438 | Ga0265339_10054727 | 3300031249 | Bacteria | 2166 |
| 439 | Ga0265313_10018002 | 3300031595 | Bacteria | 3985 |
| 440 | Ga0265314_10006316 | 3300031711 | Bacteria | 10511 |
| 441 | Ga0373930_0000172 | 3300034816 | Bacteria | 7575 |
| 442 | Ga0373930_0043872 | 3300034816 | Bacteria | 960 |
| 443 | Ga0373948_0000049 | 3300034817 | Bacteria | 12986 |
| 444 | Ga0373958_0004863 | 3300034819 | Bacteria | 2010 |
| 445 | Ga0373959_0004938 | 3300034820 | Bacteria | 2173 |
| 446 | Ga0373938_0000119 | 3300034957 | Bacteria | 10987 |
| 447 | Ga0373938_0004504 | 3300034957 | Bacteria | 2331 |
| 448 | Ga0373926_0031660 | 3300035083 | Bacteria | 1866 |
| 449 | Ga0373926_0044087 | 3300035083 | Bacteria | 1597 |
| 450 | Ga0373926_0059986 | 3300035083 | Bacteria | 1385 |
| 451 | Ga0373928_0000148 | 3300035084 | Bacteria | 13499 |
| 452 | Ga0373929_0001447 | 3300035085 | Bacteria | 4530 |
| 453 | Ga0373934_0005597 | 3300035086 | Bacteria | 4652 |
| 454 | Ga0373934_0011264 | 3300035086 | Bacteria | 3365 |
| 455 | Ga0373940_0001153 | 3300035088 | Bacteria | 4629 |
| 456 | Ga0373949_0000443 | 3300035090 | Bacteria | 14272 |
| 457 | Ga0373949_0005247 | 3300035090 | Bacteria | 2900 |
| 458 | Ga0373951_0000403 | 3300035091 | Bacteria | 12758 |
| 459 | Ga0373952_0002943 | 3300035092 | Bacteria | 3074 |
| 460 | Ga0373923_0003390 | 3300035111 | Bacteria | 5101 |
| 461 | Ga0373923_0052325 | 3300035111 | Bacteria | 1715 |
| 462 | Ga0373923_0061558 | 3300035111 | Bacteria | 1595 |
| 463 | Ga0373923_0076444 | 3300035111 | Bacteria | 1446 |
| 464 | Ga0373932_0000822 | 3300035112 | Bacteria | 9175 |
| 465 | Ga0373936_0013078 | 3300035113 | Bacteria | 3166 |
| 466 | Ga0373936_0088512 | 3300035113 | Bacteria | 1296 |
| 467 | Ga0373939_0001066 | 3300035114 | Bacteria | 6756 |
| 468 | Ga0373941_0000259 | 3300035115 | Bacteria | 10177 |
| 469 | Ga0373941_0016607 | 3300035115 | Bacteria | 2004 |
| 470 | Ga0373945_0129330 | 3300035116 | Bacteria | 1010 |
| 471 | Ga0373953_0000832 | 3300035117 | Bacteria | 8634 |
| 472 | Ga0373953_0001693 | 3300035117 | Bacteria | 6486 |
| 473 | Ga0373953_0193681 | 3300035117 | Bacteria | 878 |
| 474 | Ga0373954_0006437 | 3300035118 | Bacteria | 5121 |
| 475 | Ga0373954_0012278 | 3300035118 | Bacteria | 3807 |
| 476 | Ga0373954_0012732 | 3300035118 | Bacteria | 3744 |
| 477 | Ga0373954_0127673 | 3300035118 | Bacteria | 1237 |
| 478 | Ga0373956_0002668 | 3300035119 | Bacteria | 7215 |
| 479 | Ga0373957_0046077 | 3300035120 | Bacteria | 1654 |
| 480 | Ga0373960_0000277 | 3300035121 | Bacteria | 9832 |
| 481 | Ga0373960_0003722 | 3300035121 | Bacteria | 3465 |
| 482 | Ga0373943_0002631 | 3300035170 | Bacteria | 8167 |
| 483 | Ga0373943_0012624 | 3300035170 | Bacteria | 3807 |
| 484 | Ga0373943_0015417 | 3300035170 | Bacteria | 3471 |
| 485 | Ga0373943_0035562 | 3300035170 | Bacteria | 2381 |
| 486 | Ga0373943_0194294 | 3300035170 | Bacteria | 1121 |
| 487 | Ga0373946_0002013 | 3300035171 | Bacteria | 7119 |
| 488 | Ga0373946_0028788 | 3300035171 | Bacteria | 2206 |
| 489 | Ga0373946_0034727 | 3300035171 | Bacteria | 2037 |
| 490 | Ga0373955_0000084 | 3300035172 | Bacteria | 38310 |
| 491 | Ga0373955_0002931 | 3300035172 | Bacteria | 7483 |
| 492 | Ga0373955_0003085 | 3300035172 | Bacteria | 7290 |
| 493 | Ga0373942_0001742 | 3300035207 | Bacteria | 5518 |
| 494 | Ga0373942_0003780 | 3300035207 | Bacteria | 3543 |
| 495 | Ga0373961_0008049 | 3300035241 | Bacteria | 2559 |
| 496 | Ga0373962_0005737 | 3300035242 | Bacteria | 2998 |
| 497 | Ga0373924_0000855 | 3300035410 | Bacteria | 9580 |
| 498 | Ga0373924_0010074 | 3300035410 | Bacteria | 3480 |
| 499 | Ga0373924_0015332 | 3300035410 | Bacteria | 2913 |
| 500 | Ga0373924_0142968 | 3300035410 | Bacteria | 1044 |
| 501 | Ga0373931_0020016 | 3300035691 | Bacteria | 3345 |
| 502 | Ga0373931_0044941 | 3300035691 | Bacteria | 2330 |
| 503 | Ga0373935_0000285 | 3300035692 | Bacteria | 24974 |
| 504 | Ga0373935_0041739 | 3300035692 | Bacteria | 2883 |
| 505 | Ga0373935_0053048 | 3300035692 | Bacteria | 2579 |
| 506 | Ga0373935_0056303 | 3300035692 | Bacteria | 2507 |
| 507 | Ga0373935_0089396 | 3300035692 | Bacteria | 2014 |
| 508 | Ga0373935_0276952 | 3300035692 | Bacteria | 1180 |
| 509 | Ga0373927_0046507 | 3300035695 | Bacteria | 2807 |
| 510 | Ga0373927_0065939 | 3300035695 | Bacteria | 2341 |
| 511 | Ga0373927_0116718 | 3300035695 | Bacteria | 1741 |
| 512 | Ga0373933_0001174 | 3300035724 | Bacteria | 15531 |
| 513 | Ga0373933_0003452 | 3300035724 | Bacteria | 8794 |
| 514 | Ga0373933_0011554 | 3300035724 | Bacteria | 4872 |
| 515 | Ga0373947_0013785 | 3300035725 | Bacteria | 4634 |
| 516 | Ga0373947_0029806 | 3300035725 | Bacteria | 3203 |
| 517 | Ga0373947_0040236 | 3300035725 | Bacteria | 2784 |
| 518 | Ga0373947_0069276 | 3300035725 | Bacteria | 2159 |
| 519 | Ga0373947_0099621 | 3300035725 | Bacteria | 1824 |
| 520 | Ga0373937_0000006 | 3300036401 | Bacteria | 194781 |
| 521 | Ga0373937_0000887 | 3300036401 | Bacteria | 25651 |
| 522 | Ga0373937_0004926 | 3300036401 | Bacteria | 11347 |
| 523 | Ga0373937_0016095 | 3300036401 | Bacteria | 6634 |
| 524 | Ga0373925_0000002 | 3300037068 | Bacteria | 368879 |
| 525 | Ga0373925_0113397 | 3300037068 | Bacteria | 2096 |
| 526 | Ga0395899_0006286 | 3300037312 | Bacteria | 9196 |
| 527 | Ga0395899_0161232 | 3300037312 | Bacteria | 1584 |
| 528 | Ga0395900_0004809 | 3300037418 | Bacteria | 14227 |
| 529 | Ga0395898_0002323 | 3300037466 | Bacteria | 22720 |
| 530 | Ga0395898_0015089 | 3300037466 | Bacteria | 7930 |
| 531 | Ga0395898_0069464 | 3300037466 | Bacteria | 3408 |
| 532 | Ga0436364_0728139 | 3300037853 | Bacteria | 64829 |
| 533 | Ga0436364_0828220 | 3300037853 | Bacteria | 1584 |
| 534 | Ga0436364_0840315 | 3300037853 | Bacteria | 2204 |
| 535 | Ga0436364_1112770 | 3300037853 | Bacteria | 981 |
| 536 | Ga0436364_1478908 | 3300037853 | Bacteria | 3559 |
| 537 | Ga0395901_0042160 | 3300038443 | Bacteria | 4731 |
| 538 | Ga0395901_0098476 | 3300038443 | Bacteria | 3066 |
| 539 | Ga0242420_029371 | 3300038996 | Bacteria | 1014 |
| 540 | Ga0436365_0229718 | 3300039437 | Bacteria | 2717 |
| 541 | Ga0436365_0560971 | 3300039437 | Bacteria | 2412 |
| 542 | Ga0436365_1263360 | 3300039437 | Bacteria | 4996 |
| 543 | Ga0436365_1905431 | 3300039437 | Bacteria | 904 |
| 544 | Ga0436361_0074879 | 3300039447 | Bacteria | 1455 |
| 545 | Ga0436362_1216740 | 3300039453 | Bacteria | 911 |
| 546 | Ga0439453_0006113 | 3300041408 | Bacteria | 1862 |
| 547 | Ga0439450_004177 | 3300042008 | Bacteria | 2449 |
| 548 | Ga0439455_0047916 | 3300042012 | Bacteria | 1110 |
| 549 | Ga0439464_0019328 | 3300042439 | Bacteria | 1859 |
| 550 | Ga0439460_0036225 | 3300042461 | Bacteria | 1430 |
| 551 | Ga0439460_0083476 | 3300042461 | Bacteria | 1006 |
| 552 | Ga0466963_0032994 | 3300044694 | Bacteria | 3357 |
| 553 | Ga0466963_0120790 | 3300044694 | Bacteria | 1803 |
| 554 | Ga0453684_0067523 | 3300044712 | Bacteria | 4547 |
| 555 | Ga0466971_0221586 | 3300044719 | Bacteria | 897 |
| 556 | Ga0466958_0114627 | 3300045836 | Bacteria | 1684 |
| 557 | Ga0466967_0093846 | 3300045976 | Bacteria | 2731 |
| 558 | Ga0495592_0000039 | 3300046454 | Bacteria | 124471 |
| 559 | Ga0495592_0012894 | 3300046454 | Bacteria | 6353 |
| 560 | Ga0495592_0220152 | 3300046454 | Bacteria | 1270 |
| 561 | Ga0495592_0286490 | 3300046454 | Bacteria | 1075 |
| 562 | Ga0495603_0008468 | 3300046455 | Bacteria | 6212 |
| 563 | Ga0495629_0014928 | 3300046459 | Bacteria | 5582 |
| 564 | Ga0495629_0096408 | 3300046459 | Bacteria | 2063 |
| 565 | Ga0495641_0051382 | 3300046461 | Bacteria | 1882 |
| 566 | Ga0495641_0055219 | 3300046461 | Bacteria | 1803 |
| 567 | Ga0495651_0000419 | 3300046462 | Bacteria | 32901 |
| 568 | Ga0495651_0002460 | 3300046462 | Bacteria | 14317 |
| 569 | Ga0495651_0016376 | 3300046462 | Bacteria | 5741 |
| 570 | Ga0495653_0000006 | 3300046463 | Bacteria | 363285 |
| 571 | Ga0495653_0006076 | 3300046463 | Bacteria | 9893 |
| 572 | Ga0495653_0033111 | 3300046463 | Bacteria | 4096 |
| 573 | Ga0495580_0112900 | 3300046472 | Bacteria | 1887 |
| 574 | Ga0495580_0132656 | 3300046472 | Bacteria | 1727 |
| 575 | Ga0495580_0200598 | 3300046472 | Bacteria | 1374 |
| 576 | Ga0495582_0024567 | 3300046473 | Bacteria | 3298 |
| 577 | Ga0495582_0141623 | 3300046473 | Bacteria | 1363 |
| 578 | Ga0495639_0089627 | 3300046475 | Bacteria | 1441 |
| 579 | Ga0495639_0093452 | 3300046475 | Bacteria | 1413 |
| 580 | Ga0495662_0000905 | 3300046476 | Bacteria | 14495 |
| 581 | Ga0495662_0021205 | 3300046476 | Bacteria | 3142 |
| 582 | Ga0495662_0029468 | 3300046476 | Bacteria | 2651 |
| 583 | Ga0495662_0047662 | 3300046476 | Bacteria | 2069 |
| 584 | Ga0495664_0000002 | 3300046477 | Bacteria | 625183 |
| 585 | Ga0495664_0079552 | 3300046477 | Bacteria | 1964 |
| 586 | Ga0495584_0002534 | 3300046491 | Bacteria | 10334 |
| 587 | Ga0495584_0039375 | 3300046491 | Bacteria | 2388 |
| 588 | Ga0495584_0051186 | 3300046491 | Bacteria | 2080 |
| 589 | Ga0495585_0000546 | 3300046492 | Bacteria | 35582 |
| 590 | Ga0495607_0002967 | 3300046501 | Bacteria | 13310 |
| 591 | Ga0495608_0000009 | 3300046511 | Bacteria | 266614 |
| 592 | Ga0495608_0000557 | 3300046511 | Bacteria | 25706 |
| 593 | Ga0495608_0003247 | 3300046511 | Bacteria | 11627 |
| 594 | Ga0495608_0019871 | 3300046511 | Bacteria | 4619 |
| 595 | Ga0495618_0000005 | 3300046514 | Bacteria | 230421 |
| 596 | Ga0495618_0022293 | 3300046514 | Bacteria | 3911 |
| 597 | Ga0495618_0110801 | 3300046514 | Bacteria | 1757 |
| 598 | Ga0495628_0000002 | 3300046516 | Bacteria | 589399 |
| 599 | Ga0495628_0064458 | 3300046516 | Bacteria | 2868 |
| 600 | Ga0495630_0001565 | 3300046517 | Bacteria | 15914 |
| 601 | Ga0495630_0014783 | 3300046517 | Bacteria | 5692 |
| 602 | Ga0495630_0129073 | 3300046517 | Bacteria | 1919 |
| 603 | Ga0495630_0129581 | 3300046517 | Bacteria | 1915 |
| 604 | Ga0495630_0400518 | 3300046517 | Bacteria | 1051 |
| 605 | Ga0495630_0609976 | 3300046517 | Bacteria | 836 |
| 606 | Ga0495637_0040739 | 3300046520 | Bacteria | 1998 |
| 607 | Ga0495652_0000004 | 3300046529 | Bacteria | 588877 |
| 608 | Ga0495652_0004247 | 3300046529 | Bacteria | 13763 |
| 609 | Ga0495652_0181958 | 3300046529 | Bacteria | 1612 |
| 610 | Ga0495652_0427069 | 3300046529 | Bacteria | 932 |
| 611 | Ga0495665_0025722 | 3300046531 | Bacteria | 3160 |
| 612 | Ga0495665_0094704 | 3300046531 | Bacteria | 1568 |
| 613 | Ga0495665_0175419 | 3300046531 | Bacteria | 1115 |
| 614 | Ga0495640_0000005 | 3300046533 | Bacteria | 318271 |
| 615 | Ga0495640_0004068 | 3300046533 | Bacteria | 11704 |
| 616 | Ga0495640_0006625 | 3300046533 | Bacteria | 9136 |
| 617 | Ga0495640_0221237 | 3300046533 | Bacteria | 1194 |
| 618 | Ga0495640_0377545 | 3300046533 | Bacteria | 872 |
| 619 | Ga0495586_0006325 | 3300046535 | Bacteria | 6327 |
| 620 | Ga0495586_0013094 | 3300046535 | Bacteria | 4396 |
| 621 | Ga0495587_0000007 | 3300046536 | Bacteria | 290788 |
| 622 | Ga0495587_0000884 | 3300046536 | Bacteria | 19811 |
| 623 | Ga0495587_0004155 | 3300046536 | Bacteria | 9581 |
| 624 | Ga0495587_0038364 | 3300046536 | Bacteria | 2873 |
| 625 | Ga0495598_0011961 | 3300046537 | Bacteria | 2116 |
| 626 | Ga0495645_0000003 | 3300046543 | Bacteria | 570133 |
| 627 | Ga0495645_0002731 | 3300046543 | Bacteria | 11976 |
| 628 | Ga0495645_0008028 | 3300046543 | Bacteria | 7350 |
| 629 | Ga0495645_0052708 | 3300046543 | Bacteria | 2959 |
| 630 | Ga0495633_0203445 | 3300046558 | Bacteria | 908 |
| 631 | Ga0495667_0000002 | 3300046559 | Bacteria | 437535 |
| 632 | Ga0495667_0001476 | 3300046559 | Bacteria | 15495 |
| 633 | Ga0495667_0002899 | 3300046559 | Bacteria | 11503 |
| 634 | Ga0495667_0011622 | 3300046559 | Bacteria | 5961 |
| 635 | Ga0495656_0063131 | 3300046615 | Bacteria | 1622 |
| 636 | Ga0495634_0000022 | 3300046642 | Bacteria | 118988 |
| 637 | Ga0495634_0000880 | 3300046642 | Bacteria | 28844 |
| 638 | Ga0495634_0018294 | 3300046642 | Bacteria | 4990 |
| 639 | Ga0495634_0033896 | 3300046642 | Bacteria | 3505 |
| 640 | Ga0495611_0024465 | 3300046648 | Bacteria | 2627 |
| 641 | Ga0495635_0000020 | 3300046663 | Bacteria | 189698 |
| 642 | Ga0495635_0007077 | 3300046663 | Bacteria | 7843 |
| 643 | Ga0495635_0153782 | 3300046663 | Bacteria | 1566 |
| 644 | Ga0495659_0000633 | 3300046664 | Bacteria | 12802 |
| 645 | Ga0495659_0042944 | 3300046664 | Bacteria | 1620 |
| 646 | Ga0495657_0000435 | 3300046675 | Bacteria | 38963 |
| 647 | Ga0495657_0006177 | 3300046675 | Bacteria | 9391 |
| 648 | Ga0495599_0000001 | 3300046678 | Bacteria | 537563 |
| 649 | Ga0495599_0003181 | 3300046678 | Bacteria | 9567 |
| 650 | Ga0495599_0020964 | 3300046678 | Bacteria | 4074 |
| 651 | Ga0495623_0000001 | 3300046679 | Bacteria | 313861 |
| 652 | Ga0495623_0001616 | 3300046679 | Bacteria | 15135 |
| 653 | Ga0495623_0004039 | 3300046679 | Bacteria | 9663 |
| 654 | Ga0495646_0000014 | 3300046680 | Bacteria | 143781 |
| 655 | Ga0495646_0001738 | 3300046680 | Bacteria | 13068 |
| 656 | Ga0495646_0005955 | 3300046680 | Bacteria | 7729 |
| 657 | Ga0495647_0176918 | 3300046681 | Bacteria | 927 |
| 658 | Ga0495658_0191340 | 3300046683 | Bacteria | 1272 |
| 659 | Ga0495658_0524663 | 3300046683 | Bacteria | 758 |
| 660 | Ga0495669_0082759 | 3300046684 | Bacteria | 1475 |
| 661 | Ga0495613_0044676 | 3300046689 | Bacteria | 3276 |
| 662 | Ga0495613_0064793 | 3300046689 | Bacteria | 2672 |
| 663 | Ga0495613_0113546 | 3300046689 | Bacteria | 1950 |
| 664 | Ga0495624_0010998 | 3300046690 | Bacteria | 6232 |
| 665 | Ga0495624_0051510 | 3300046690 | Bacteria | 2604 |
| 666 | Ga0495624_0065820 | 3300046690 | Bacteria | 2263 |
| 667 | Ga0495624_0116189 | 3300046690 | Bacteria | 1644 |
| 668 | Ga0495670_0034778 | 3300046691 | Bacteria | 2511 |
| 669 | Ga0495670_0152633 | 3300046691 | Bacteria | 1211 |
| 670 | Ga0495671_0057604 | 3300046692 | Bacteria | 1923 |
| 671 | Ga0495649_0168163 | 3300046694 | Bacteria | 1148 |
| 672 | Ga0495589_0006699 | 3300046794 | Bacteria | 6067 |
| 673 | Ga0495589_0140245 | 3300046794 | Bacteria | 1158 |
| 674 | Ga0495600_0000006 | 3300046809 | Bacteria | 151916 |
| 675 | Ga0495600_0001126 | 3300046809 | Bacteria | 14581 |
| 676 | Ga0495600_0061021 | 3300046809 | Bacteria | 2462 |
| 677 | Ga0495600_0080530 | 3300046809 | Bacteria | 2126 |
| 678 | Ga0495581_0013446 | 3300047315 | Bacteria | 4746 |
| 679 | Ga0495581_0170358 | 3300047315 | Bacteria | 1273 |
| 680 | Ga0495604_0000005 | 3300047317 | Bacteria | 424516 |
| 681 | Ga0495604_0000388 | 3300047317 | Bacteria | 39748 |
| 682 | Ga0495604_0003734 | 3300047317 | Bacteria | 12126 |
| 683 | Ga0495674_0000003 | 3300047319 | Bacteria | 562126 |
| 684 | Ga0495674_0003431 | 3300047319 | Bacteria | 15402 |
| 685 | Ga0495674_0025645 | 3300047319 | Bacteria | 5401 |
| 686 | Ga0495674_0044184 | 3300047319 | Bacteria | 3962 |
| 687 | Ga0495674_0418186 | 3300047319 | Bacteria | 1080 |
| 688 | Ga0495676_0111462 | 3300047321 | Bacteria | 2006 |
| 689 | Ga0495680_0000002 | 3300047322 | Bacteria | 197533 |
| 690 | Ga0495680_0016395 | 3300047322 | Bacteria | 6367 |
| 691 | Ga0495680_0040619 | 3300047322 | Bacteria | 3705 |
| 692 | Ga0495680_0150939 | 3300047322 | Bacteria | 1694 |
| 693 | Ga0495675_0000010 | 3300047444 | Bacteria | 153375 |
| 694 | Ga0495675_0000740 | 3300047444 | Bacteria | 20363 |
| 695 | Ga0495675_0001614 | 3300047444 | Bacteria | 13543 |
| 696 | Ga0495675_0064098 | 3300047444 | Bacteria | 2325 |
| 697 | Ga0495679_080326 | 3300047446 | Bacteria | 927 |
| 698 | Ga0495681_0077249 | 3300047470 | Bacteria | 1495 |
| 699 | Ga0495681_0116549 | 3300047470 | Bacteria | 1151 |
| 700 | Ga0495684_0000028 | 3300047471 | Bacteria | 123549 |
| 701 | Ga0495684_0003551 | 3300047471 | Bacteria | 12183 |
| 702 | Ga0495684_0021577 | 3300047471 | Bacteria | 4958 |
| 703 | Ga0495684_0051579 | 3300047471 | Bacteria | 3139 |
| 704 | Ga0495684_0478386 | 3300047471 | Bacteria | 860 |
| 705 | Ga0495684_0554604 | 3300047471 | Bacteria | 782 |
| 706 | Ga0495593_0001612 | 3300047673 | Bacteria | 13339 |
| 707 | Ga0495593_0004471 | 3300047673 | Bacteria | 8308 |
| 708 | Ga0495593_0169985 | 3300047673 | Bacteria | 1099 |
| 709 | Ga0495602_0000054 | 3300048088 | Bacteria | 111411 |
| 710 | Ga0495602_0002218 | 3300048088 | Bacteria | 19614 |
| 711 | Ga0495602_0011547 | 3300048088 | Bacteria | 9127 |
| 712 | Ga0495602_0040529 | 3300048088 | Bacteria | 4268 |
| 713 | Ga0495614_0090871 | 3300048089 | Bacteria | 1328 |
| 714 | Ga0495614_0151859 | 3300048089 | Bacteria | 1033 |
| 715 | Ga0496100_0000447 | 3300048903 | Bacteria | 19924 |
| 716 | Ga0496100_0017409 | 3300048903 | Bacteria | 4241 |
| 717 | Ga0496100_0024478 | 3300048903 | Bacteria | 3683 |
| 718 | Ga0496100_0047104 | 3300048903 | Bacteria | 2776 |
| 719 | Ga0496100_0225085 | 3300048903 | Bacteria | 1378 |
| 720 | Ga0496101_0012092 | 3300048904 | Bacteria | 5752 |
| 721 | Ga0496101_0053265 | 3300048904 | Bacteria | 2918 |
| 722 | Ga0496102_0002354 | 3300048905 | Bacteria | 16125 |
| 723 | Ga0496102_0014509 | 3300048905 | Bacteria | 6845 |
| 724 | Ga0496102_0040672 | 3300048905 | Bacteria | 4206 |
| 725 | Ga0496103_0000837 | 3300048906 | Bacteria | 22480 |
| 726 | Ga0496103_0007675 | 3300048906 | Bacteria | 6415 |
| 727 | Ga0496104_0035330 | 3300048907 | Bacteria | 4666 |
| 728 | Ga0496104_0062693 | 3300048907 | Bacteria | 3525 |
| 729 | Ga0496104_0642819 | 3300048907 | Bacteria | 970 |
| 730 | Ga0496105_0007075 | 3300048908 | Bacteria | 8647 |
| 731 | Ga0496105_0115477 | 3300048908 | Bacteria | 2214 |
| 732 | Ga0496106_0001351 | 3300048909 | Bacteria | 18370 |
| 733 | Ga0496106_0022736 | 3300048909 | Bacteria | 4659 |
| 734 | Ga0496106_0023808 | 3300048909 | Bacteria | 4551 |
| 735 | Ga0496106_0101982 | 3300048909 | Bacteria | 2226 |
| 736 | Ga0496106_0115921 | 3300048909 | Bacteria | 2089 |
| 737 | Ga0496107_0001211 | 3300048910 | Bacteria | 15713 |
| 738 | Ga0496107_0013175 | 3300048910 | Bacteria | 5777 |
| 739 | Ga0496107_0040023 | 3300048910 | Bacteria | 3363 |
| 740 | Ga0496107_0041357 | 3300048910 | Bacteria | 3309 |
| 741 | Ga0496107_0130955 | 3300048910 | Bacteria | 1852 |
| 742 | Ga0496108_0008033 | 3300048911 | Bacteria | 8566 |
| 743 | Ga0496108_0031743 | 3300048911 | Bacteria | 4384 |
| 744 | Ga0496108_0043391 | 3300048911 | Bacteria | 3756 |
| 745 | Ga0496109_0000188 | 3300048912 | Bacteria | 61633 |
| 746 | Ga0496109_0002868 | 3300048912 | Bacteria | 14419 |
| 747 | Ga0496109_0005044 | 3300048912 | Bacteria | 11034 |
| 748 | Ga0496109_0065905 | 3300048912 | Bacteria | 3315 |
| 749 | Ga0496110_0016529 | 3300048913 | Bacteria | 6160 |
| 750 | Ga0496110_0108269 | 3300048913 | Bacteria | 2495 |
| 751 | Ga0496110_0127504 | 3300048913 | Bacteria | 2296 |
| 752 | Ga0496111_0010895 | 3300048914 | Bacteria | 6116 |
| 753 | Ga0496111_0091948 | 3300048914 | Bacteria | 2224 |
| 754 | Ga0496112_0004798 | 3300048915 | Bacteria | 11537 |
| 755 | Ga0496112_0007486 | 3300048915 | Bacteria | 9693 |
| 756 | Ga0496112_0093926 | 3300048915 | Bacteria | 2970 |
| 757 | Ga0496113_0000496 | 3300048916 | Bacteria | 19347 |
| 758 | Ga0496114_0001734 | 3300048917 | Bacteria | 16551 |
| 759 | Ga0496114_0030068 | 3300048917 | Bacteria | 4466 |
| 760 | Ga0496114_0034378 | 3300048917 | Bacteria | 4181 |
| 761 | Ga0496114_0242151 | 3300048917 | Bacteria | 1586 |
| 762 | Ga0496114_0262248 | 3300048917 | Bacteria | 1521 |
| 763 | Ga0496115_0000592 | 3300048918 | Bacteria | 27769 |
| 764 | Ga0496115_0007067 | 3300048918 | Bacteria | 8247 |
| 765 | Ga0496115_0089728 | 3300048918 | Bacteria | 2510 |
| 766 | Ga0496126_0003899 | 3300048929 | Bacteria | 18338 |
| 767 | Ga0501031_0151647 | 3300049568 | Bacteria | 1515 |
| 768 | Ga0501032_0110350 | 3300049569 | Bacteria | 1821 |
| 769 | Ga0501034_0023811 | 3300049571 | Bacteria | 6236 |
| 770 | Ga0501034_0293529 | 3300049571 | Bacteria | 1563 |
| 771 | Ga0501034_0380635 | 3300049571 | Bacteria | 1336 |
| 772 | Ga0501034_0487164 | 3300049571 | Bacteria | 1148 |
| 773 | Ga0501037_0305979 | 3300049573 | Bacteria | 1103 |
| 774 | Ga0501038_0569430 | 3300049574 | Bacteria | 860 |
| 775 | Ga0501039_0055753 | 3300049575 | Bacteria | 3061 |
| 776 | Ga0501039_0215510 | 3300049575 | Bacteria | 1510 |
| 777 | Ga0501047_0279597 | 3300049581 | Bacteria | 1514 |
| 778 | Ga0501069_0063843 | 3300049585 | Bacteria | 2057 |
| 779 | Ga0501069_0159532 | 3300049585 | Bacteria | 1298 |
| 780 | Ga0501070_0043799 | 3300049586 | Bacteria | 3724 |
| 781 | Ga0501070_0143788 | 3300049586 | Bacteria | 1969 |
| 782 | Ga0501070_0214907 | 3300049586 | Bacteria | 1578 |
| 783 | Ga0501073_0131591 | 3300049589 | Bacteria | 1734 |
| 784 | Ga0501074_0433129 | 3300049590 | Bacteria | 933 |
| 785 | Ga0501075_0250208 | 3300049591 | Bacteria | 1351 |
| 786 | Ga0501076_0050146 | 3300049592 | Bacteria | 3302 |
| 787 | Ga0501080_0201546 | 3300049742 | Bacteria | 1827 |
| 788 | Ga0501083_0030084 | 3300049744 | Bacteria | 3731 |
| 789 | Ga0501035_0031991 | 3300049822 | Bacteria | 4790 |
| 790 | Ga0501044_0259155 | 3300049823 | Bacteria | 1678 |
| 791 | nmdc:mga03n38_82410_c1 | 3300050490 | Bacteria | 1514 |
| 792 | nmdc:mga00v17_119195_c1 | 3300050491 | Bacteria | 1679 |
| 793 | nmdc:mga0yw44_12231_c1 | 3300050492 | Bacteria | 4466 |
| 794 | nmdc:mga0yw44_72984_c2 | 3300050492 | Bacteria | 1702 |
| 795 | nmdc:mga06z11_168572_c1 | 3300050494 | Bacteria | 1256 |
| 796 | nmdc:mga06z11_57924_c1 | 3300050494 | Bacteria | 2009 |
| 797 | nmdc:mga06z11_59561_c1 | 3300050494 | Bacteria | 1985 |
| 798 | nmdc:mga06z11_88037_c1 | 3300050494 | Bacteria | 1681 |
| 799 | nmdc:mga04h51_118721_c1 | 3300050495 | Bacteria | 983 |
| 800 | nmdc:mga07m45_21722_c1 | 3300050496 | Bacteria | 3498 |
| 801 | nmdc:mga07m45_58611_c1 | 3300050496 | Bacteria | 2179 |
| 802 | nmdc:mga05p37_1114_c1 | 3300050507 | Bacteria | 30870 |
| 803 | nmdc:mga05p37_227168_c1 | 3300050507 | Bacteria | 2250 |
| 804 | nmdc:mga05p37_502234_c1 | 3300050507 | Bacteria | 1391 |
| 805 | nmdc:mga09592_1302_c1 | 3300050508 | Bacteria | 20054 |
| 806 | nmdc:mga09592_377475_c1 | 3300050508 | Bacteria | 1226 |
| 807 | nmdc:mga0qj67_30519_c1 | 3300050509 | Bacteria | 4198 |
| 808 | nmdc:mga06r32_102341_c1 | 3300050510 | Bacteria | 2812 |
| 809 | nmdc:mga06r32_314991_c1 | 3300050510 | Bacteria | 1550 |
| 810 | nmdc:mga06r32_506271_c1 | 3300050510 | Bacteria | 1184 |
| 811 | nmdc:mga06r32_533222_c1 | 3300050510 | Bacteria | 1149 |
| 812 | nmdc:mga06r32_839005_c1 | 3300050510 | Bacteria | 878 |
| 813 | nmdc:mga06r32_95767_c1 | 3300050510 | Bacteria | 2906 |
| 814 | nmdc:mga08y16_52239_c1 | 3300050511 | Bacteria | 4276 |
| 815 | nmdc:mga08y16_7407_c1 | 3300050511 | Bacteria | 11499 |
| 816 | nmdc:mga08y16_8501_c1 | 3300050511 | Bacteria | 10750 |
| 817 | nmdc:mga08y16_8959_c1 | 3300050511 | Bacteria | 10509 |
| 818 | nmdc:mga0n895_334522_c1 | 3300050512 | Bacteria | 1534 |
| 819 | nmdc:mga0n895_3698_c1 | 3300050512 | Bacteria | 12366 |
| 820 | nmdc:mga0n895_4199_c1 | 3300050512 | Bacteria | 7300 |
| 821 | nmdc:mga0n895_651_c1 | 3300050512 | Bacteria | 24245 |
| 822 | nmdc:mga0n895_75564_c1 | 3300050512 | Bacteria | 3349 |
| 823 | nmdc:mga0n895_824194_c1 | 3300050512 | Bacteria | 917 |
| 824 | nmdc:mga0n895_851556_c1 | 3300050512 | Bacteria | 899 |
| 825 | nmdc:mga0rr50_20997_c1 | 3300050513 | Bacteria | 4449 |
| 826 | nmdc:mga0rr50_217615_c1 | 3300050513 | Bacteria | 1576 |
| 827 | nmdc:mga0rr50_46463_c1 | 3300050513 | Bacteria | 3197 |
| 828 | nmdc:mga0a205_14086_c1 | 3300050515 | Bacteria | 7461 |
| 829 | nmdc:mga0a205_63855_c1 | 3300050515 | Bacteria | 3557 |
| 830 | nmdc:mga0a205_64850_c1 | 3300050515 | Bacteria | 3528 |
| 831 | nmdc:mga0a205_80131_c1 | 3300050515 | Bacteria | 3155 |
| 832 | nmdc:mga0sz30_132340_c1 | 3300050516 | Bacteria | 1099 |
| 833 | Ga0495601_0000008 | 3300053077 | Bacteria | 362152 |
| 834 | Ga0495601_0001082 | 3300053077 | Bacteria | 14935 |
| 835 | Ga0495601_0017682 | 3300053077 | Bacteria | 4330 |
| 836 | Ga0495601_0052190 | 3300053077 | Bacteria | 2581 |
| 837 | Ga0495601_0069786 | 3300053077 | Bacteria | 2241 |
| 838 | Ga0495612_0000002 | 3300053078 | Bacteria | 310466 |
| 839 | Ga0495612_0004845 | 3300053078 | Bacteria | 5572 |
| 840 | Ga0495612_0008244 | 3300053078 | Bacteria | 4232 |
| 841 | Ga0495612_0077205 | 3300053078 | Bacteria | 1396 |
| 842 | Ga0495655_0012868 | 3300053083 | Bacteria | 1715 |
| 843 | Ga0495595_0000008 | 3300053084 | Bacteria | 196206 |
| 844 | Ga0495595_0000976 | 3300053084 | Bacteria | 11021 |
| 845 | Ga0495595_0010760 | 3300053084 | Bacteria | 3811 |
| 846 | Ga0495595_0021904 | 3300053084 | Bacteria | 2798 |
| 847 | Ga0495595_0144088 | 3300053084 | Bacteria | 1170 |
| 848 | Ga0495595_0274133 | 3300053084 | Bacteria | 846 |
| 849 | Ga0495619_0000002 | 3300053085 | Bacteria | 530226 |
| 850 | Ga0495619_0004422 | 3300053085 | Bacteria | 8963 |
| 851 | Ga0495619_0011111 | 3300053085 | Bacteria | 5662 |
| 852 | Ga0495619_0012012 | 3300053085 | Bacteria | 5456 |
| 853 | Ga0495619_0036703 | 3300053085 | Bacteria | 3192 |
| 854 | Ga0495619_0145705 | 3300053085 | Bacteria | 1632 |
| 855 | Ga0500643_009800 | 3300053087 | Bacteria | 3627 |
| 856 | Ga0500644_0059035 | 3300053088 | Bacteria | 1344 |
| 857 | Ga0500566_0057455 | 3300053094 | Bacteria | 2210 |
| 858 | Ga0500641_0008962 | 3300053096 | Bacteria | 3586 |
| 859 | Ga0500562_082389 | 3300053108 | Bacteria | 871 |
| 860 | Ga0500593_001757 | 3300053117 | Bacteria | 7804 |
| 861 | Ga0500594_0057298 | 3300053118 | Bacteria | 1114 |
| 862 | Ga0500595_000010 | 3300053119 | Bacteria | 275806 |
| 863 | Ga0500595_015011 | 3300053119 | Bacteria | 2921 |
| 864 | Ga0500658_0163472 | 3300053134 | Bacteria | 1009 |
| 865 | Ga0500568_0000002 | 3300053139 | Bacteria | 880601 |
| 866 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 867 | Ga0500616_0032210 | 3300053153 | Bacteria | 2866 |
| 868 | Ga0500645_000469 | 3300053730 | Bacteria | 27530 |
| 869 | Ga0501084_0140956 | 3300054114 | Bacteria | 2030 |
| 870 | Ga0501082_0053986 | 3300060353 | Bacteria | 3464 |
| 871 | Ga0501082_0441402 | 3300060353 | Bacteria | 1137 |
| 872 | Ga0530510_0296131 | 3300061734 | Bacteria | 1210 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035118 | Ga0373954_0127673 | Ga0373954_0127673_515_1210 | 209 |
| 2 | 3300037853 | Ga0436364_1112770 | Ga0436364_1112770_300_971 | 216 |
| 3 | 3300053153 | Ga0500616_0032210 | Ga0500616_0032210_768_1430 | 216 |
| 4 | 3300053730 | Ga0500645_000469 | Ga0500645_000469_11469_12125 | 216 |
| 5 | 3300009036 | Ga0105244_10032578 | Ga0105244_100325784 | 217 |
| 6 | 3300009093 | Ga0105240_10111998 | Ga0105240_101119983 | 217 |
| 7 | 3300009094 | Ga0111539_10003331 | Ga0111539_1000333110 | 217 |
| 8 | 3300009094 | Ga0111539_10007321 | Ga0111539_1000732112 | 217 |
| 9 | 3300009098 | Ga0105245_10000183 | Ga0105245_1000018344 | 217 |
| 10 | 3300009147 | Ga0114129_10001218 | Ga0114129_1000121830 | 217 |
| 11 | 3300009148 | Ga0105243_10001561 | Ga0105243_100015613 | 217 |
| 12 | 3300009174 | Ga0105241_10003567 | Ga0105241_100035672 | 217 |
| 13 | 3300009176 | Ga0105242_10000701 | Ga0105242_100007013 | 217 |
| 14 | 3300009177 | Ga0105248_10010394 | Ga0105248_1001039410 | 217 |
| 15 | 3300009551 | Ga0105238_10137275 | Ga0105238_101372752 | 217 |
| 16 | 3300010375 | Ga0105239_10007315 | Ga0105239_100073153 | 217 |
| 17 | 3300010375 | Ga0105239_10733186 | Ga0105239_107331862 | 217 |
| 18 | 3300012503 | Ga0157313_1001654 | Ga0157313_10016542 | 217 |
| 19 | 3300012515 | Ga0157338_1001595 | Ga0157338_10015952 | 217 |
| 20 | 3300013296 | Ga0157374_10000463 | Ga0157374_100004637 | 217 |
| 21 | 3300013297 | Ga0157378_10000613 | Ga0157378_100006133 | 217 |
| 22 | 3300013306 | Ga0163162_10005908 | Ga0163162_1000590812 | 217 |
| 23 | 3300013308 | Ga0157375_10004786 | Ga0157375_100047862 | 217 |
| 24 | 3300013308 | Ga0157375_10514386 | Ga0157375_105143862 | 217 |
| 25 | 3300014325 | Ga0163163_10025813 | Ga0163163_100258134 | 217 |
| 26 | 3300014326 | Ga0157380_10004641 | Ga0157380_1000464110 | 217 |
| 27 | 3300014745 | Ga0157377_10021447 | Ga0157377_100214473 | 217 |
| 28 | 3300014968 | Ga0157379_10003902 | Ga0157379_100039023 | 217 |
| 29 | 3300014969 | Ga0157376_10003730 | Ga0157376_100037302 | 217 |
| 30 | 3300020082 | Ga0206353_11182671 | Ga0206353_111826712 | 217 |
| 31 | 3300025906 | Ga0207699_10157162 | Ga0207699_101571622 | 217 |
| 32 | 3300034819 | Ga0373958_0004863 | Ga0373958_0004863_350_1003 | 217 |
| 33 | 3300034957 | Ga0373938_0004504 | Ga0373938_0004504_536_1189 | 217 |
| 34 | 3300035090 | Ga0373949_0005247 | Ga0373949_0005247_1801_2454 | 217 |
| 35 | 3300035112 | Ga0373932_0000822 | Ga0373932_0000822_8437_9090 | 217 |
| 36 | 3300035115 | Ga0373941_0016607 | Ga0373941_0016607_227_880 | 217 |
| 37 | 3300035121 | Ga0373960_0000277 | Ga0373960_0000277_393_1046 | 217 |
| 38 | 3300035121 | Ga0373960_0003722 | Ga0373960_0003722_1923_2576 | 217 |
| 39 | 3300035207 | Ga0373942_0001742 | Ga0373942_0001742_2980_3633 | 217 |
| 40 | 3300035691 | Ga0373931_0020016 | Ga0373931_0020016_468_1121 | 217 |
| 41 | 3300035691 | Ga0373931_0044941 | Ga0373931_0044941_1451_2104 | 217 |
| 42 | 3300038996 | Ga0242420_029371 | Ga0242420_029371_51_704 | 217 |
| 43 | 3300046454 | Ga0495592_0220152 | Ga0495592_0220152_11_685 | 217 |
| 44 | 3300046491 | Ga0495584_0039375 | Ga0495584_0039375_1609_2262 | 217 |
| 45 | 3300046517 | Ga0495630_0014783 | Ga0495630_0014783_5007_5681 | 217 |
| 46 | 3300047322 | Ga0495680_0150939 | Ga0495680_0150939_287_940 | 217 |
| 47 | 3300048903 | Ga0496100_0000447 | Ga0496100_0000447_18921_19574 | 217 |
| 48 | 3300048904 | Ga0496101_0053265 | Ga0496101_0053265_537_1190 | 217 |
| 49 | 3300048905 | Ga0496102_0002354 | Ga0496102_0002354_15122_15775 | 217 |
| 50 | 3300048906 | Ga0496103_0000837 | Ga0496103_0000837_14067_14720 | 217 |
| 51 | 3300048909 | Ga0496106_0001351 | Ga0496106_0001351_9733_10386 | 217 |
| 52 | 3300048910 | Ga0496107_0001211 | Ga0496107_0001211_850_1503 | 217 |
| 53 | 3300048911 | Ga0496108_0031743 | Ga0496108_0031743_3036_3689 | 217 |
| 54 | 3300048912 | Ga0496109_0000188 | Ga0496109_0000188_10618_11271 | 217 |
| 55 | 3300048912 | Ga0496109_0002868 | Ga0496109_0002868_8799_9455 | 217 |
| 56 | 3300048914 | Ga0496111_0091948 | Ga0496111_0091948_1136_1789 | 217 |
| 57 | 3300048915 | Ga0496112_0004798 | Ga0496112_0004798_5553_6209 | 217 |
| 58 | 3300048915 | Ga0496112_0093926 | Ga0496112_0093926_2233_2886 | 217 |
| 59 | 3300048917 | Ga0496114_0001734 | Ga0496114_0001734_14771_15424 | 217 |
| 60 | 3300048918 | Ga0496115_0000592 | Ga0496115_0000592_14659_15312 | 217 |
| 61 | 3300049581 | Ga0501047_0279597 | Ga0501047_0279597_11_667 | 217 |
| 62 | 3300049592 | Ga0501076_0050146 | Ga0501076_0050146_907_1560 | 217 |
| 63 | 3300050494 | nmdc:mga06z11_168572_c1 | nmdc:mga06z11_168572_c1_545_1198 | 217 |
| 64 | 3300050507 | nmdc:mga05p37_1114_c1 | nmdc:mga05p37_1114_c1_20537_21190 | 217 |
| 65 | 3300050508 | nmdc:mga09592_1302_c1 | nmdc:mga09592_1302_c1_17781_18434 | 217 |
| 66 | 3300050509 | nmdc:mga0qj67_30519_c1 | nmdc:mga0qj67_30519_c1_1130_1783 | 217 |
| 67 | 3300050510 | nmdc:mga06r32_95767_c1 | nmdc:mga06r32_95767_c1_633_1286 | 217 |
| 68 | 3300050511 | nmdc:mga08y16_7407_c1 | nmdc:mga08y16_7407_c1_6923_7576 | 217 |
| 69 | 3300050511 | nmdc:mga08y16_8501_c1 | nmdc:mga08y16_8501_c1_633_1286 | 217 |
| 70 | 3300050511 | nmdc:mga08y16_8959_c1 | nmdc:mga08y16_8959_c1_2837_3490 | 217 |
| 71 | 3300050512 | nmdc:mga0n895_3698_c1 | nmdc:mga0n895_3698_c1_1201_1854 | 217 |
| 72 | 3300050512 | nmdc:mga0n895_651_c1 | nmdc:mga0n895_651_c1_11810_12463 | 217 |
| 73 | 3300050513 | nmdc:mga0rr50_20997_c1 | nmdc:mga0rr50_20997_c1_2159_2812 | 217 |
| 74 | 3300050513 | nmdc:mga0rr50_46463_c1 | nmdc:mga0rr50_46463_c1_2086_2739 | 217 |
| 75 | 3300050515 | nmdc:mga0a205_63855_c1 | nmdc:mga0a205_63855_c1_2416_3069 | 217 |
| 76 | 3300050515 | nmdc:mga0a205_64850_c1 | nmdc:mga0a205_64850_c1_1648_2301 | 217 |
| 77 | 3300060353 | Ga0501082_0441402 | Ga0501082_0441402_414_1067 | 217 |
| 78 | 3300046459 | Ga0495629_0096408 | Ga0495629_0096408_846_1502 | 218 |
| 79 | 3300046475 | Ga0495639_0089627 | Ga0495639_0089627_576_1232 | 218 |
| 80 | 3300053117 | Ga0500593_001757 | Ga0500593_001757_6872_7561 | 223 |
| 81 | 3300053139 | Ga0500568_0000002 | Ga0500568_0000002_493014_493703 | 223 |
| 82 | iso_pu_bacteria | 2515154112 | 2515624142 | 226 |
| 83 | iso_pu_bacteria | 2935975950 | 2935982334 | 226 |
| 84 | iso_pu_bacteria | 8019629233 | 8019638642 | 226 |
| 85 | iso_pu_bacteria | 8019638758 | 8019641096 | 226 |
| 86 | iso_pu_bacteria | 8019659431 | 8019666444 | 226 |
| 87 | iso_pu_bacteria | 8019668869 | 8019676105 | 226 |
| 88 | iso_pu_bacteria | 8019678201 | 8019679880 | 226 |
| 89 | 3300005436 | Ga0070713_100251269 | Ga0070713_1002512692 | 227 |
| 90 | 3300049571 | Ga0501034_0023811 | Ga0501034_0023811_4282_4989 | 227 |
| 91 | 3300049742 | Ga0501080_0201546 | Ga0501080_0201546_375_1061 | 227 |
| 92 | 3300053134 | Ga0500658_0163472 | Ga0500658_0163472_139_843 | 227 |
| 93 | 3300049822 | Ga0501035_0031991 | Ga0501035_0031991_534_1223 | 228 |
| 94 | 3300053087 | Ga0500643_009800 | Ga0500643_009800_1185_1877 | 228 |
| 95 | 3300053088 | Ga0500644_0059035 | Ga0500644_0059035_255_947 | 228 |
| 96 | 3300053094 | Ga0500566_0057455 | Ga0500566_0057455_289_981 | 228 |
| 97 | 3300053118 | Ga0500594_0057298 | Ga0500594_0057298_151_843 | 228 |
| 98 | 3300053119 | Ga0500595_000010 | Ga0500595_000010_244687_245379 | 228 |
| 99 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_580241_580939 | 228 |
| 100 | 3300021384 | Ga0213876_10076060 | Ga0213876_100760602 | 229 |
| 101 | 3300021384 | Ga0213876_10164681 | Ga0213876_101646812 | 229 |
| 102 | 3300021388 | Ga0213875_10000011 | Ga0213875_10000011161 | 229 |
| 103 | 3300035111 | Ga0373923_0076444 | Ga0373923_0076444_203_901 | 229 |
| 104 | 3300035118 | Ga0373954_0012732 | Ga0373954_0012732_804_1502 | 229 |
| 105 | 3300035410 | Ga0373924_0015332 | Ga0373924_0015332_2184_2882 | 229 |
| 106 | 3300035724 | Ga0373933_0003452 | Ga0373933_0003452_2020_2718 | 229 |
| 107 | 3300036401 | Ga0373937_0016095 | Ga0373937_0016095_3824_4522 | 229 |
| 108 | 3300037853 | Ga0436364_0728139 | Ga0436364_0728139_18969_19703 | 229 |
| 109 | 3300037853 | Ga0436364_0828220 | Ga0436364_0828220_853_1557 | 229 |
| 110 | 3300037853 | Ga0436364_1478908 | Ga0436364_1478908_2388_3092 | 229 |
| 111 | 3300039437 | Ga0436365_1263360 | Ga0436365_1263360_2163_2867 | 229 |
| 112 | 3300039437 | Ga0436365_1905431 | Ga0436365_1905431_78_782 | 229 |
| 113 | 3300039453 | Ga0436362_1216740 | Ga0436362_1216740_29_733 | 229 |
| 114 | 3300046529 | Ga0495652_0181958 | Ga0495652_0181958_446_1144 | 229 |
| 115 | 3300046536 | Ga0495587_0038364 | Ga0495587_0038364_638_1336 | 229 |
| 116 | 3300046559 | Ga0495667_0011622 | Ga0495667_0011622_2899_3597 | 229 |
| 117 | 3300046663 | Ga0495635_0153782 | Ga0495635_0153782_703_1410 | 229 |
| 118 | 3300046809 | Ga0495600_0080530 | Ga0495600_0080530_73_771 | 229 |
| 119 | 3300047444 | Ga0495675_0064098 | Ga0495675_0064098_760_1458 | 229 |
| 120 | 3300048088 | Ga0495602_0040529 | Ga0495602_0040529_2357_3055 | 229 |
| 121 | 3300049585 | Ga0501069_0159532 | Ga0501069_0159532_552_1241 | 229 |
| 122 | 3300053077 | Ga0495601_0052190 | Ga0495601_0052190_133_831 | 229 |
| 123 | 3300053084 | Ga0495595_0144088 | Ga0495595_0144088_135_839 | 229 |
| 124 | 3300053085 | Ga0495619_0004422 | Ga0495619_0004422_3035_3742 | 229 |
| 125 | 3300048929 | Ga0496126_0003899 | Ga0496126_0003899_5376_6068 | 230 |
| 126 | 3300049575 | Ga0501039_0055753 | Ga0501039_0055753_1672_2364 | 230 |
| 127 | 3300049585 | Ga0501069_0063843 | Ga0501069_0063843_550_1245 | 230 |
| 128 | 3300049586 | Ga0501070_0043799 | Ga0501070_0043799_2969_3664 | 230 |
| 129 | 3300049586 | Ga0501070_0143788 | Ga0501070_0143788_901_1599 | 230 |
| 130 | 3300005338 | Ga0068868_100011853 | Ga0068868_1000118532 | 231 |
| 131 | 3300005937 | Ga0081455_10000276 | Ga0081455_1000027654 | 231 |
| 132 | 3300006042 | Ga0075368_10013700 | Ga0075368_100137003 | 231 |
| 133 | 3300006042 | Ga0075368_10028565 | Ga0075368_100285652 | 231 |
| 134 | 3300006051 | Ga0075364_10094554 | Ga0075364_100945542 | 231 |
| 135 | 3300006177 | Ga0075362_10158854 | Ga0075362_101588542 | 231 |
| 136 | 3300006178 | Ga0075367_10079141 | Ga0075367_100791412 | 231 |
| 137 | 3300006353 | Ga0075370_10058511 | Ga0075370_100585112 | 231 |
| 138 | 3300009093 | Ga0105240_10230582 | Ga0105240_102305823 | 231 |
| 139 | 3300009545 | Ga0105237_10369590 | Ga0105237_103695902 | 231 |
| 140 | 3300027357 | Ga0209589_1000017 | Ga0209589_1000017155 | 231 |
| 141 | 3300027361 | Ga0209489_100018 | Ga0209489_100018155 | 231 |
| 142 | 3300027363 | Ga0209700_100028 | Ga0209700_100028155 | 231 |
| 143 | 3300035113 | Ga0373936_0088512 | Ga0373936_0088512_97_798 | 231 |
| 144 | 3300037312 | Ga0395899_0006286 | Ga0395899_0006286_2834_3544 | 231 |
| 145 | 3300037312 | Ga0395899_0161232 | Ga0395899_0161232_752_1462 | 231 |
| 146 | 3300037418 | Ga0395900_0004809 | Ga0395900_0004809_10497_11207 | 231 |
| 147 | 3300037466 | Ga0395898_0002323 | Ga0395898_0002323_17043_17753 | 231 |
| 148 | 3300037466 | Ga0395898_0015089 | Ga0395898_0015089_5538_6248 | 231 |
| 149 | 3300037466 | Ga0395898_0069464 | Ga0395898_0069464_913_1617 | 231 |
| 150 | 3300037853 | Ga0436364_0840315 | Ga0436364_0840315_155_856 | 231 |
| 151 | 3300038443 | Ga0395901_0042160 | Ga0395901_0042160_1945_2655 | 231 |
| 152 | 3300038443 | Ga0395901_0098476 | Ga0395901_0098476_366_1070 | 231 |
| 153 | 3300039437 | Ga0436365_0229718 | Ga0436365_0229718_731_1432 | 231 |
| 154 | 3300039437 | Ga0436365_0560971 | Ga0436365_0560971_963_1670 | 231 |
| 155 | 3300044719 | Ga0466971_0221586 | Ga0466971_0221586_123_824 | 231 |
| 156 | 3300048903 | Ga0496100_0225085 | Ga0496100_0225085_532_1233 | 231 |
| 157 | 3300048910 | Ga0496107_0130955 | Ga0496107_0130955_563_1264 | 231 |
| 158 | 3300050494 | nmdc:mga06z11_57924_c1 | nmdc:mga06z11_57924_c1_131_835 | 231 |
| 159 | 3300050494 | nmdc:mga06z11_88037_c1 | nmdc:mga06z11_88037_c1_165_866 | 231 |
| 160 | 3300050496 | nmdc:mga07m45_21722_c1 | nmdc:mga07m45_21722_c1_710_1411 | 231 |
| 161 | 3300050496 | nmdc:mga07m45_58611_c1 | nmdc:mga07m45_58611_c1_1078_1782 | 231 |
| 162 | 3300050510 | nmdc:mga06r32_839005_c1 | nmdc:mga06r32_839005_c1_153_857 | 231 |
| 163 | 3300053108 | Ga0500562_082389 | Ga0500562_082389_59_760 | 231 |
| 164 | 3300053119 | Ga0500595_015011 | Ga0500595_015011_1250_1951 | 231 |
| 165 | 3300005340 | Ga0070689_100127239 | Ga0070689_1001272392 | 232 |
| 166 | 3300005355 | Ga0070671_100052167 | Ga0070671_1000521675 | 232 |
| 167 | 3300005364 | Ga0070673_100008698 | Ga0070673_1000086986 | 232 |
| 168 | 3300005365 | Ga0070688_100073957 | Ga0070688_1000739571 | 232 |
| 169 | 3300005366 | Ga0070659_100233962 | Ga0070659_1002339621 | 232 |
| 170 | 3300005434 | Ga0070709_10234450 | Ga0070709_102344502 | 232 |
| 171 | 3300005530 | Ga0070679_100487804 | Ga0070679_1004878042 | 232 |
| 172 | 3300005842 | Ga0068858_100432981 | Ga0068858_1004329812 | 232 |
| 173 | 3300005843 | Ga0068860_100588190 | Ga0068860_1005881902 | 232 |
| 174 | 3300005937 | Ga0081455_10023997 | Ga0081455_100239978 | 232 |
| 175 | 3300005937 | Ga0081455_10030467 | Ga0081455_100304674 | 232 |
| 176 | 3300005983 | Ga0081540_1039896 | Ga0081540_10398962 | 232 |
| 177 | 3300006028 | Ga0070717_10071648 | Ga0070717_100716482 | 232 |
| 178 | 3300006028 | Ga0070717_10148248 | Ga0070717_101482484 | 232 |
| 179 | 3300006051 | Ga0075364_10088279 | Ga0075364_100882792 | 232 |
| 180 | 3300006175 | Ga0070712_100230769 | Ga0070712_1002307692 | 232 |
| 181 | 3300006177 | Ga0075362_10022833 | Ga0075362_100228332 | 232 |
| 182 | 3300006844 | Ga0075428_100268105 | Ga0075428_1002681052 | 232 |
| 183 | 3300006846 | Ga0075430_100236559 | Ga0075430_1002365592 | 232 |
| 184 | 3300006847 | Ga0075431_100094786 | Ga0075431_1000947863 | 232 |
| 185 | 3300006880 | Ga0075429_100572698 | Ga0075429_1005726982 | 232 |
| 186 | 3300006880 | Ga0075429_100607676 | Ga0075429_1006076761 | 232 |
| 187 | 3300007788 | Ga0099795_10005314 | Ga0099795_100053144 | 232 |
| 188 | 3300009098 | Ga0105245_10130624 | Ga0105245_101306244 | 232 |
| 189 | 3300009147 | Ga0114129_10143612 | Ga0114129_101436122 | 232 |
| 190 | 3300009177 | Ga0105248_10438683 | Ga0105248_104386833 | 232 |
| 191 | 3300010159 | Ga0099796_10001281 | Ga0099796_100012811 | 232 |
| 192 | 3300010375 | Ga0105239_10109477 | Ga0105239_101094775 | 232 |
| 193 | 3300014325 | Ga0163163_10323863 | Ga0163163_103238632 | 232 |
| 194 | 3300014969 | Ga0157376_10046136 | Ga0157376_100461366 | 232 |
| 195 | 3300025905 | Ga0207685_10058088 | Ga0207685_100580882 | 232 |
| 196 | 3300025906 | Ga0207699_10115923 | Ga0207699_101159232 | 232 |
| 197 | 3300025915 | Ga0207693_10039913 | Ga0207693_100399135 | 232 |
| 198 | 3300025915 | Ga0207693_10147608 | Ga0207693_101476082 | 232 |
| 199 | 3300025925 | Ga0207650_10021193 | Ga0207650_100211936 | 232 |
| 200 | 3300025929 | Ga0207664_10113715 | Ga0207664_101137151 | 232 |
| 201 | 3300025929 | Ga0207664_10766688 | Ga0207664_107666881 | 232 |
| 202 | 3300025931 | Ga0207644_10060993 | Ga0207644_100609931 | 232 |
| 203 | 3300025936 | Ga0207670_10104583 | Ga0207670_101045834 | 232 |
| 204 | 3300025939 | Ga0207665_10203496 | Ga0207665_102034962 | 232 |
| 205 | 3300025939 | Ga0207665_10395219 | Ga0207665_103952192 | 232 |
| 206 | 3300025960 | Ga0207651_10027084 | Ga0207651_100270842 | 232 |
| 207 | 3300026035 | Ga0207703_10355064 | Ga0207703_103550642 | 232 |
| 208 | 3300027512 | Ga0209179_1016890 | Ga0209179_10168902 | 232 |
| 209 | 3300028379 | Ga0268266_10174688 | Ga0268266_101746884 | 232 |
| 210 | 3300035083 | Ga0373926_0044087 | Ga0373926_0044087_248_949 | 232 |
| 211 | 3300035111 | Ga0373923_0003390 | Ga0373923_0003390_2800_3507 | 232 |
| 212 | 3300035113 | Ga0373936_0013078 | Ga0373936_0013078_472_1179 | 232 |
| 213 | 3300035114 | Ga0373939_0001066 | Ga0373939_0001066_1733_2437 | 232 |
| 214 | 3300035117 | Ga0373953_0001693 | Ga0373953_0001693_32_739 | 232 |
| 215 | 3300035118 | Ga0373954_0012278 | Ga0373954_0012278_1665_2372 | 232 |
| 216 | 3300035170 | Ga0373943_0002631 | Ga0373943_0002631_7087_7794 | 232 |
| 217 | 3300035171 | Ga0373946_0002013 | Ga0373946_0002013_4888_5595 | 232 |
| 218 | 3300035171 | Ga0373946_0028788 | Ga0373946_0028788_1372_2091 | 232 |
| 219 | 3300035172 | Ga0373955_0000084 | Ga0373955_0000084_31612_32319 | 232 |
| 220 | 3300035410 | Ga0373924_0000855 | Ga0373924_0000855_3624_4331 | 232 |
| 221 | 3300035692 | Ga0373935_0000285 | Ga0373935_0000285_6011_6718 | 232 |
| 222 | 3300035692 | Ga0373935_0056303 | Ga0373935_0056303_566_1285 | 232 |
| 223 | 3300035695 | Ga0373927_0046507 | Ga0373927_0046507_1412_2119 | 232 |
| 224 | 3300035725 | Ga0373947_0013785 | Ga0373947_0013785_2855_3574 | 232 |
| 225 | 3300035725 | Ga0373947_0029806 | Ga0373947_0029806_1742_2449 | 232 |
| 226 | 3300035725 | Ga0373947_0069276 | Ga0373947_0069276_748_1455 | 232 |
| 227 | 3300036401 | Ga0373937_0000006 | Ga0373937_0000006_76813_77520 | 232 |
| 228 | 3300037068 | Ga0373925_0000002 | Ga0373925_0000002_208389_209096 | 232 |
| 229 | 3300042461 | Ga0439460_0083476 | Ga0439460_0083476_277_987 | 232 |
| 230 | 3300044694 | Ga0466963_0032994 | Ga0466963_0032994_1506_2213 | 232 |
| 231 | 3300044694 | Ga0466963_0120790 | Ga0466963_0120790_885_1592 | 232 |
| 232 | 3300045836 | Ga0466958_0114627 | Ga0466958_0114627_79_786 | 232 |
| 233 | 3300045976 | Ga0466967_0093846 | Ga0466967_0093846_519_1226 | 232 |
| 234 | 3300046454 | Ga0495592_0000039 | Ga0495592_0000039_81635_82342 | 232 |
| 235 | 3300046454 | Ga0495592_0286490 | Ga0495592_0286490_57_758 | 232 |
| 236 | 3300046461 | Ga0495641_0055219 | Ga0495641_0055219_664_1365 | 232 |
| 237 | 3300046462 | Ga0495651_0002460 | Ga0495651_0002460_1188_1895 | 232 |
| 238 | 3300046463 | Ga0495653_0000006 | Ga0495653_0000006_208537_209244 | 232 |
| 239 | 3300046463 | Ga0495653_0033111 | Ga0495653_0033111_578_1279 | 232 |
| 240 | 3300046472 | Ga0495580_0200598 | Ga0495580_0200598_375_1076 | 232 |
| 241 | 3300046473 | Ga0495582_0024567 | Ga0495582_0024567_2329_3030 | 232 |
| 242 | 3300046473 | Ga0495582_0141623 | Ga0495582_0141623_46_753 | 232 |
| 243 | 3300046475 | Ga0495639_0093452 | Ga0495639_0093452_670_1371 | 232 |
| 244 | 3300046476 | Ga0495662_0000905 | Ga0495662_0000905_12919_13626 | 232 |
| 245 | 3300046476 | Ga0495662_0021205 | Ga0495662_0021205_2391_3098 | 232 |
| 246 | 3300046477 | Ga0495664_0000002 | Ga0495664_0000002_244171_244878 | 232 |
| 247 | 3300046492 | Ga0495585_0000546 | Ga0495585_0000546_32473_33174 | 232 |
| 248 | 3300046501 | Ga0495607_0002967 | Ga0495607_0002967_9814_10515 | 232 |
| 249 | 3300046511 | Ga0495608_0000009 | Ga0495608_0000009_235557_236264 | 232 |
| 250 | 3300046511 | Ga0495608_0019871 | Ga0495608_0019871_2934_3635 | 232 |
| 251 | 3300046514 | Ga0495618_0000005 | Ga0495618_0000005_21530_22237 | 232 |
| 252 | 3300046516 | Ga0495628_0000002 | Ga0495628_0000002_208556_209263 | 232 |
| 253 | 3300046517 | Ga0495630_0001565 | Ga0495630_0001565_3237_3944 | 232 |
| 254 | 3300046517 | Ga0495630_0129073 | Ga0495630_0129073_11_712 | 232 |
| 255 | 3300046529 | Ga0495652_0000004 | Ga0495652_0000004_379620_380327 | 232 |
| 256 | 3300046531 | Ga0495665_0025722 | Ga0495665_0025722_853_1560 | 232 |
| 257 | 3300046531 | Ga0495665_0175419 | Ga0495665_0175419_259_966 | 232 |
| 258 | 3300046533 | Ga0495640_0000005 | Ga0495640_0000005_235572_236279 | 232 |
| 259 | 3300046533 | Ga0495640_0221237 | Ga0495640_0221237_186_905 | 232 |
| 260 | 3300046533 | Ga0495640_0377545 | Ga0495640_0377545_92_799 | 232 |
| 261 | 3300046535 | Ga0495586_0006325 | Ga0495586_0006325_2112_2813 | 232 |
| 262 | 3300046536 | Ga0495587_0000007 | Ga0495587_0000007_81963_82670 | 232 |
| 263 | 3300046537 | Ga0495598_0011961 | Ga0495598_0011961_394_1095 | 232 |
| 264 | 3300046543 | Ga0495645_0000003 | Ga0495645_0000003_189807_190514 | 232 |
| 265 | 3300046543 | Ga0495645_0052708 | Ga0495645_0052708_708_1409 | 232 |
| 266 | 3300046558 | Ga0495633_0203445 | Ga0495633_0203445_124_825 | 232 |
| 267 | 3300046559 | Ga0495667_0000002 | Ga0495667_0000002_228460_229167 | 232 |
| 268 | 3300046642 | Ga0495634_0000022 | Ga0495634_0000022_72776_73483 | 232 |
| 269 | 3300046642 | Ga0495634_0018294 | Ga0495634_0018294_869_1588 | 232 |
| 270 | 3300046648 | Ga0495611_0024465 | Ga0495611_0024465_1774_2475 | 232 |
| 271 | 3300046663 | Ga0495635_0000020 | Ga0495635_0000020_17929_18636 | 232 |
| 272 | 3300046664 | Ga0495659_0000633 | Ga0495659_0000633_40_741 | 232 |
| 273 | 3300046675 | Ga0495657_0000435 | Ga0495657_0000435_29124_29831 | 232 |
| 274 | 3300046678 | Ga0495599_0000001 | Ga0495599_0000001_347234_347941 | 232 |
| 275 | 3300046679 | Ga0495623_0000001 | Ga0495623_0000001_116179_116886 | 232 |
| 276 | 3300046680 | Ga0495646_0000014 | Ga0495646_0000014_110583_111290 | 232 |
| 277 | 3300046683 | Ga0495658_0524663 | Ga0495658_0524663_32_739 | 232 |
| 278 | 3300046689 | Ga0495613_0064793 | Ga0495613_0064793_217_936 | 232 |
| 279 | 3300046690 | Ga0495624_0010998 | Ga0495624_0010998_460_1161 | 232 |
| 280 | 3300046690 | Ga0495624_0116189 | Ga0495624_0116189_338_1045 | 232 |
| 281 | 3300046691 | Ga0495670_0152633 | Ga0495670_0152633_268_969 | 232 |
| 282 | 3300046794 | Ga0495589_0006699 | Ga0495589_0006699_3667_4368 | 232 |
| 283 | 3300046809 | Ga0495600_0000006 | Ga0495600_0000006_77714_78421 | 232 |
| 284 | 3300047315 | Ga0495581_0013446 | Ga0495581_0013446_2568_3275 | 232 |
| 285 | 3300047317 | Ga0495604_0000005 | Ga0495604_0000005_234200_234907 | 232 |
| 286 | 3300047319 | Ga0495674_0000003 | Ga0495674_0000003_352863_353570 | 232 |
| 287 | 3300047319 | Ga0495674_0044184 | Ga0495674_0044184_2250_2969 | 232 |
| 288 | 3300047319 | Ga0495674_0418186 | Ga0495674_0418186_212_919 | 232 |
| 289 | 3300047322 | Ga0495680_0000002 | Ga0495680_0000002_11623_12330 | 232 |
| 290 | 3300047444 | Ga0495675_0000010 | Ga0495675_0000010_107724_108431 | 232 |
| 291 | 3300047470 | Ga0495681_0116549 | Ga0495681_0116549_24_725 | 232 |
| 292 | 3300047471 | Ga0495684_0000028 | Ga0495684_0000028_41015_41722 | 232 |
| 293 | 3300047471 | Ga0495684_0051579 | Ga0495684_0051579_1576_2277 | 232 |
| 294 | 3300047471 | Ga0495684_0554604 | Ga0495684_0554604_19_726 | 232 |
| 295 | 3300047673 | Ga0495593_0001612 | Ga0495593_0001612_6167_6874 | 232 |
| 296 | 3300047673 | Ga0495593_0004471 | Ga0495593_0004471_2942_3643 | 232 |
| 297 | 3300048088 | Ga0495602_0000054 | Ga0495602_0000054_47400_48107 | 232 |
| 298 | 3300049568 | Ga0501031_0151647 | Ga0501031_0151647_549_1256 | 232 |
| 299 | 3300049569 | Ga0501032_0110350 | Ga0501032_0110350_131_838 | 232 |
| 300 | 3300049571 | Ga0501034_0487164 | Ga0501034_0487164_405_1112 | 232 |
| 301 | 3300049575 | Ga0501039_0215510 | Ga0501039_0215510_579_1286 | 232 |
| 302 | 3300049589 | Ga0501073_0131591 | Ga0501073_0131591_425_1132 | 232 |
| 303 | 3300049590 | Ga0501074_0433129 | Ga0501074_0433129_19_726 | 232 |
| 304 | 3300049744 | Ga0501083_0030084 | Ga0501083_0030084_2368_3075 | 232 |
| 305 | 3300050491 | nmdc:mga00v17_119195_c1 | nmdc:mga00v17_119195_c1_448_1152 | 232 |
| 306 | 3300050508 | nmdc:mga09592_377475_c1 | nmdc:mga09592_377475_c1_108_806 | 232 |
| 307 | 3300050510 | nmdc:mga06r32_102341_c1 | nmdc:mga06r32_102341_c1_984_1682 | 232 |
| 308 | 3300050510 | nmdc:mga06r32_314991_c1 | nmdc:mga06r32_314991_c1_164_862 | 232 |
| 309 | 3300050510 | nmdc:mga06r32_533222_c1 | nmdc:mga06r32_533222_c1_279_983 | 232 |
| 310 | 3300050512 | nmdc:mga0n895_851556_c1 | nmdc:mga0n895_851556_c1_65_793 | 232 |
| 311 | 3300053077 | Ga0495601_0000008 | Ga0495601_0000008_113479_114186 | 232 |
| 312 | 3300053077 | Ga0495601_0001082 | Ga0495601_0001082_3550_4269 | 232 |
| 313 | 3300053078 | Ga0495612_0000002 | Ga0495612_0000002_120152_120859 | 232 |
| 314 | 3300053078 | Ga0495612_0077205 | Ga0495612_0077205_161_862 | 232 |
| 315 | 3300053084 | Ga0495595_0000008 | Ga0495595_0000008_113607_114314 | 232 |
| 316 | 3300053084 | Ga0495595_0010760 | Ga0495595_0010760_1407_2108 | 232 |
| 317 | 3300053085 | Ga0495619_0000002 | Ga0495619_0000002_208559_209266 | 232 |
| 318 | 3300053085 | Ga0495619_0145705 | Ga0495619_0145705_11_712 | 232 |
| 319 | 3300061734 | Ga0530510_0296131 | Ga0530510_0296131_459_1187 | 232 |
| 320 | 3300001977 | JGI24746J21847_1007946 | JGI24746J21847_10079462 | 233 |
| 321 | 3300001989 | JGI24739J22299_10059068 | JGI24739J22299_100590681 | 233 |
| 322 | 3300001991 | JGI24743J22301_10024590 | JGI24743J22301_100245901 | 233 |
| 323 | 3300002070 | JGI24750J21931_1005344 | JGI24750J21931_10053442 | 233 |
| 324 | 3300002075 | JGI24738J21930_10015540 | JGI24738J21930_100155402 | 233 |
| 325 | 3300002076 | JGI24749J21850_1001768 | JGI24749J21850_10017682 | 233 |
| 326 | 3300002077 | JGI24744J21845_10001649 | JGI24744J21845_100016493 | 233 |
| 327 | 3300002244 | JGI24742J22300_10000916 | JGI24742J22300_100009164 | 233 |
| 328 | 3300002459 | JGI24751J29686_10007269 | JGI24751J29686_100072692 | 233 |
| 329 | 3300005330 | Ga0070690_100010449 | Ga0070690_1000104494 | 233 |
| 330 | 3300005331 | Ga0070670_100034128 | Ga0070670_1000341283 | 233 |
| 331 | 3300005334 | Ga0068869_100007353 | Ga0068869_1000073537 | 233 |
| 332 | 3300005335 | Ga0070666_10006992 | Ga0070666_100069922 | 233 |
| 333 | 3300005337 | Ga0070682_100050082 | Ga0070682_1000500822 | 233 |
| 334 | 3300005338 | Ga0068868_100065314 | Ga0068868_1000653142 | 233 |
| 335 | 3300005340 | Ga0070689_100088514 | Ga0070689_1000885142 | 233 |
| 336 | 3300005341 | Ga0070691_10014701 | Ga0070691_100147012 | 233 |
| 337 | 3300005343 | Ga0070687_100038150 | Ga0070687_1000381503 | 233 |
| 338 | 3300005345 | Ga0070692_10014018 | Ga0070692_100140182 | 233 |
| 339 | 3300005353 | Ga0070669_100224679 | Ga0070669_1002246792 | 233 |
| 340 | 3300005354 | Ga0070675_100020637 | Ga0070675_1000206374 | 233 |
| 341 | 3300005355 | Ga0070671_100026233 | Ga0070671_1000262334 | 233 |
| 342 | 3300005356 | Ga0070674_100009633 | Ga0070674_1000096332 | 233 |
| 343 | 3300005364 | Ga0070673_100222991 | Ga0070673_1002229912 | 233 |
| 344 | 3300005365 | Ga0070688_100012611 | Ga0070688_1000126114 | 233 |
| 345 | 3300005366 | Ga0070659_100023902 | Ga0070659_1000239022 | 233 |
| 346 | 3300005436 | Ga0070713_100071863 | Ga0070713_1000718633 | 233 |
| 347 | 3300005437 | Ga0070710_10069603 | Ga0070710_100696032 | 233 |
| 348 | 3300005441 | Ga0070700_100002278 | Ga0070700_1000022786 | 233 |
| 349 | 3300005444 | Ga0070694_100107362 | Ga0070694_1001073621 | 233 |
| 350 | 3300005455 | Ga0070663_100065868 | Ga0070663_1000658683 | 233 |
| 351 | 3300005457 | Ga0070662_100029329 | Ga0070662_1000293294 | 233 |
| 352 | 3300005459 | Ga0068867_100003711 | Ga0068867_1000037112 | 233 |
| 353 | 3300005466 | Ga0070685_10143393 | Ga0070685_101433932 | 233 |
| 354 | 3300005535 | Ga0070684_100020944 | Ga0070684_1000209444 | 233 |
| 355 | 3300005539 | Ga0068853_100045084 | Ga0068853_1000450842 | 233 |
| 356 | 3300005543 | Ga0070672_100006952 | Ga0070672_1000069526 | 233 |
| 357 | 3300005544 | Ga0070686_100068268 | Ga0070686_1000682682 | 233 |
| 358 | 3300005546 | Ga0070696_100030640 | Ga0070696_1000306403 | 233 |
| 359 | 3300005548 | Ga0070665_100146697 | Ga0070665_1001466972 | 233 |
| 360 | 3300005548 | Ga0070665_100175390 | Ga0070665_1001753902 | 233 |
| 361 | 3300005563 | Ga0068855_100592098 | Ga0068855_1005920982 | 233 |
| 362 | 3300005564 | Ga0070664_100153442 | Ga0070664_1001534422 | 233 |
| 363 | 3300005577 | Ga0068857_100376240 | Ga0068857_1003762402 | 233 |
| 364 | 3300005614 | Ga0068856_100119127 | Ga0068856_1001191273 | 233 |
| 365 | 3300005615 | Ga0070702_100013601 | Ga0070702_1000136014 | 233 |
| 366 | 3300005616 | Ga0068852_100021772 | Ga0068852_1000217723 | 233 |
| 367 | 3300005617 | Ga0068859_100018152 | Ga0068859_1000181526 | 233 |
| 368 | 3300005618 | Ga0068864_100044813 | Ga0068864_1000448133 | 233 |
| 369 | 3300005719 | Ga0068861_100028834 | Ga0068861_1000288342 | 233 |
| 370 | 3300005840 | Ga0068870_10008401 | Ga0068870_100084013 | 233 |
| 371 | 3300005841 | Ga0068863_100003083 | Ga0068863_1000030833 | 233 |
| 372 | 3300005842 | Ga0068858_100026853 | Ga0068858_1000268533 | 233 |
| 373 | 3300005843 | Ga0068860_100013320 | Ga0068860_1000133209 | 233 |
| 374 | 3300005844 | Ga0068862_100243383 | Ga0068862_1002433832 | 233 |
| 375 | 3300006038 | Ga0075365_10084204 | Ga0075365_100842042 | 233 |
| 376 | 3300006042 | Ga0075368_10037514 | Ga0075368_100375142 | 233 |
| 377 | 3300006175 | Ga0070712_100033595 | Ga0070712_1000335953 | 233 |
| 378 | 3300006178 | Ga0075367_10156249 | Ga0075367_101562492 | 233 |
| 379 | 3300006237 | Ga0097621_100037929 | Ga0097621_1000379294 | 233 |
| 380 | 3300006358 | Ga0068871_100020804 | Ga0068871_1000208042 | 233 |
| 381 | 3300006846 | Ga0075430_100042214 | Ga0075430_1000422143 | 233 |
| 382 | 3300006847 | Ga0075431_100173127 | Ga0075431_1001731271 | 233 |
| 383 | 3300006881 | Ga0068865_100019723 | Ga0068865_1000197234 | 233 |
| 384 | 3300006931 | Ga0097620_100018152 | Ga0097620_1000181523 | 233 |
| 385 | 3300009092 | Ga0105250_10089502 | Ga0105250_100895022 | 233 |
| 386 | 3300009098 | Ga0105245_10038415 | Ga0105245_100384152 | 233 |
| 387 | 3300009101 | Ga0105247_10019428 | Ga0105247_100194282 | 233 |
| 388 | 3300009177 | Ga0105248_10150227 | Ga0105248_101502272 | 233 |
| 389 | 3300009545 | Ga0105237_10081640 | Ga0105237_100816403 | 233 |
| 390 | 3300009551 | Ga0105238_10237032 | Ga0105238_102370322 | 233 |
| 391 | 3300009553 | Ga0105249_10061656 | Ga0105249_100616562 | 233 |
| 392 | 3300010159 | Ga0099796_10095590 | Ga0099796_100955901 | 233 |
| 393 | 3300010375 | Ga0105239_10075680 | Ga0105239_100756803 | 233 |
| 394 | 3300010375 | Ga0105239_10222955 | Ga0105239_102229552 | 233 |
| 395 | 3300011119 | Ga0105246_10040206 | Ga0105246_100402062 | 233 |
| 396 | 3300013296 | Ga0157374_10005521 | Ga0157374_100055216 | 233 |
| 397 | 3300013297 | Ga0157378_10078613 | Ga0157378_100786132 | 233 |
| 398 | 3300013306 | Ga0163162_10112257 | Ga0163162_101122572 | 233 |
| 399 | 3300014325 | Ga0163163_10096112 | Ga0163163_100961122 | 233 |
| 400 | 3300014745 | Ga0157377_10001711 | Ga0157377_100017114 | 233 |
| 401 | 3300025900 | Ga0207710_10016736 | Ga0207710_100167363 | 233 |
| 402 | 3300025901 | Ga0207688_10001290 | Ga0207688_1000129011 | 233 |
| 403 | 3300025903 | Ga0207680_10005019 | Ga0207680_100050194 | 233 |
| 404 | 3300025904 | Ga0207647_10017409 | Ga0207647_100174094 | 233 |
| 405 | 3300025907 | Ga0207645_10094260 | Ga0207645_100942602 | 233 |
| 406 | 3300025908 | Ga0207643_10009464 | Ga0207643_100094643 | 233 |
| 407 | 3300025911 | Ga0207654_10140118 | Ga0207654_101401182 | 233 |
| 408 | 3300025914 | Ga0207671_10116264 | Ga0207671_101162642 | 233 |
| 409 | 3300025915 | Ga0207693_10028571 | Ga0207693_100285714 | 233 |
| 410 | 3300025916 | Ga0207663_10014105 | Ga0207663_100141054 | 233 |
| 411 | 3300025918 | Ga0207662_10004066 | Ga0207662_100040666 | 233 |
| 412 | 3300025923 | Ga0207681_10013919 | Ga0207681_100139192 | 233 |
| 413 | 3300025925 | Ga0207650_10009594 | Ga0207650_100095943 | 233 |
| 414 | 3300025926 | Ga0207659_10005666 | Ga0207659_100056662 | 233 |
| 415 | 3300025927 | Ga0207687_10056318 | Ga0207687_100563182 | 233 |
| 416 | 3300025931 | Ga0207644_10024988 | Ga0207644_100249883 | 233 |
| 417 | 3300025932 | Ga0207690_10025613 | Ga0207690_100256133 | 233 |
| 418 | 3300025933 | Ga0207706_10004291 | Ga0207706_1000429114 | 233 |
| 419 | 3300025934 | Ga0207686_10044339 | Ga0207686_100443392 | 233 |
| 420 | 3300025935 | Ga0207709_10043780 | Ga0207709_100437803 | 233 |
| 421 | 3300025936 | Ga0207670_10030728 | Ga0207670_100307282 | 233 |
| 422 | 3300025937 | Ga0207669_10010680 | Ga0207669_100106803 | 233 |
| 423 | 3300025938 | Ga0207704_10004770 | Ga0207704_100047702 | 233 |
| 424 | 3300025942 | Ga0207689_10029667 | Ga0207689_100296674 | 233 |
| 425 | 3300025945 | Ga0207679_10073705 | Ga0207679_100737052 | 233 |
| 426 | 3300025960 | Ga0207651_10011899 | Ga0207651_100118994 | 233 |
| 427 | 3300025961 | Ga0207712_10067484 | Ga0207712_100674842 | 233 |
| 428 | 3300025972 | Ga0207668_10015312 | Ga0207668_100153124 | 233 |
| 429 | 3300025981 | Ga0207640_10062755 | Ga0207640_100627552 | 233 |
| 430 | 3300026023 | Ga0207677_10337358 | Ga0207677_103373582 | 233 |
| 431 | 3300026035 | Ga0207703_10010252 | Ga0207703_100102526 | 233 |
| 432 | 3300026041 | Ga0207639_10249017 | Ga0207639_102490172 | 233 |
| 433 | 3300026075 | Ga0207708_10006968 | Ga0207708_100069682 | 233 |
| 434 | 3300026088 | Ga0207641_10020383 | Ga0207641_100203834 | 233 |
| 435 | 3300026089 | Ga0207648_10002750 | Ga0207648_1000275017 | 233 |
| 436 | 3300026095 | Ga0207676_10006905 | Ga0207676_100069054 | 233 |
| 437 | 3300026116 | Ga0207674_10312762 | Ga0207674_103127621 | 233 |
| 438 | 3300026116 | Ga0207674_10365561 | Ga0207674_103655612 | 233 |
| 439 | 3300026118 | Ga0207675_100110796 | Ga0207675_1001107962 | 233 |
| 440 | 3300026121 | Ga0207683_10031134 | Ga0207683_100311342 | 233 |
| 441 | 3300026142 | Ga0207698_10340025 | Ga0207698_103400252 | 233 |
| 442 | 3300027907 | Ga0207428_10202037 | Ga0207428_102020372 | 233 |
| 443 | 3300028380 | Ga0268265_10144309 | Ga0268265_101443092 | 233 |
| 444 | 3300028381 | Ga0268264_10021393 | Ga0268264_100213934 | 233 |
| 445 | 3300035083 | Ga0373926_0031660 | Ga0373926_0031660_403_1110 | 233 |
| 446 | 3300035170 | Ga0373943_0012624 | Ga0373943_0012624_2069_2776 | 233 |
| 447 | 3300035695 | Ga0373927_0116718 | Ga0373927_0116718_989_1696 | 233 |
| 448 | 3300039447 | Ga0436361_0074879 | Ga0436361_0074879_15_722 | 233 |
| 449 | 3300046455 | Ga0495603_0008468 | Ga0495603_0008468_3217_3924 | 233 |
| 450 | 3300046461 | Ga0495641_0051382 | Ga0495641_0051382_422_1129 | 233 |
| 451 | 3300046472 | Ga0495580_0132656 | Ga0495580_0132656_702_1409 | 233 |
| 452 | 3300046476 | Ga0495662_0047662 | Ga0495662_0047662_1178_1885 | 233 |
| 453 | 3300046491 | Ga0495584_0002534 | Ga0495584_0002534_8474_9184 | 233 |
| 454 | 3300046491 | Ga0495584_0051186 | Ga0495584_0051186_133_840 | 233 |
| 455 | 3300046517 | Ga0495630_0609976 | Ga0495630_0609976_16_723 | 233 |
| 456 | 3300046520 | Ga0495637_0040739 | Ga0495637_0040739_151_858 | 233 |
| 457 | 3300046615 | Ga0495656_0063131 | Ga0495656_0063131_311_1018 | 233 |
| 458 | 3300046664 | Ga0495659_0042944 | Ga0495659_0042944_200_907 | 233 |
| 459 | 3300046683 | Ga0495658_0191340 | Ga0495658_0191340_421_1128 | 233 |
| 460 | 3300046684 | Ga0495669_0082759 | Ga0495669_0082759_686_1393 | 233 |
| 461 | 3300046689 | Ga0495613_0113546 | Ga0495613_0113546_712_1419 | 233 |
| 462 | 3300046690 | Ga0495624_0051510 | Ga0495624_0051510_883_1590 | 233 |
| 463 | 3300046691 | Ga0495670_0034778 | Ga0495670_0034778_677_1384 | 233 |
| 464 | 3300046692 | Ga0495671_0057604 | Ga0495671_0057604_1002_1709 | 233 |
| 465 | 3300046694 | Ga0495649_0168163 | Ga0495649_0168163_195_902 | 233 |
| 466 | 3300046794 | Ga0495589_0140245 | Ga0495589_0140245_58_765 | 233 |
| 467 | 3300047321 | Ga0495676_0111462 | Ga0495676_0111462_876_1583 | 233 |
| 468 | 3300047446 | Ga0495679_080326 | Ga0495679_080326_157_864 | 233 |
| 469 | 3300047470 | Ga0495681_0077249 | Ga0495681_0077249_247_954 | 233 |
| 470 | 3300047673 | Ga0495593_0169985 | Ga0495593_0169985_152_853 | 233 |
| 471 | 3300048089 | Ga0495614_0090871 | Ga0495614_0090871_607_1314 | 233 |
| 472 | 3300048903 | Ga0496100_0017409 | Ga0496100_0017409_1678_2385 | 233 |
| 473 | 3300048903 | Ga0496100_0047104 | Ga0496100_0047104_2036_2743 | 233 |
| 474 | 3300048904 | Ga0496101_0012092 | Ga0496101_0012092_3392_4099 | 233 |
| 475 | 3300048905 | Ga0496102_0014509 | Ga0496102_0014509_4123_4830 | 233 |
| 476 | 3300048906 | Ga0496103_0007675 | Ga0496103_0007675_1048_1755 | 233 |
| 477 | 3300048907 | Ga0496104_0035330 | Ga0496104_0035330_3264_3971 | 233 |
| 478 | 3300048908 | Ga0496105_0007075 | Ga0496105_0007075_3868_4575 | 233 |
| 479 | 3300048909 | Ga0496106_0022736 | Ga0496106_0022736_1835_2542 | 233 |
| 480 | 3300048910 | Ga0496107_0041357 | Ga0496107_0041357_500_1207 | 233 |
| 481 | 3300048911 | Ga0496108_0043391 | Ga0496108_0043391_1239_1946 | 233 |
| 482 | 3300048912 | Ga0496109_0065905 | Ga0496109_0065905_363_1070 | 233 |
| 483 | 3300048913 | Ga0496110_0016529 | Ga0496110_0016529_2926_3633 | 233 |
| 484 | 3300048914 | Ga0496111_0010895 | Ga0496111_0010895_3867_4574 | 233 |
| 485 | 3300048915 | Ga0496112_0007486 | Ga0496112_0007486_2400_3107 | 233 |
| 486 | 3300048916 | Ga0496113_0000496 | Ga0496113_0000496_14030_14737 | 233 |
| 487 | 3300048917 | Ga0496114_0034378 | Ga0496114_0034378_824_1531 | 233 |
| 488 | 3300048917 | Ga0496114_0242151 | Ga0496114_0242151_711_1418 | 233 |
| 489 | 3300048917 | Ga0496114_0262248 | Ga0496114_0262248_140_847 | 233 |
| 490 | 3300048918 | Ga0496115_0007067 | Ga0496115_0007067_4493_5200 | 233 |
| 491 | 3300049573 | Ga0501037_0305979 | Ga0501037_0305979_333_1049 | 233 |
| 492 | 3300049591 | Ga0501075_0250208 | Ga0501075_0250208_554_1267 | 233 |
| 493 | 3300050492 | nmdc:mga0yw44_12231_c1 | nmdc:mga0yw44_12231_c1_2465_3172 | 233 |
| 494 | 3300050492 | nmdc:mga0yw44_72984_c2 | nmdc:mga0yw44_72984_c2_169_882 | 233 |
| 495 | 3300050494 | nmdc:mga06z11_59561_c1 | nmdc:mga06z11_59561_c1_1019_1726 | 233 |
| 496 | 3300050495 | nmdc:mga04h51_118721_c1 | nmdc:mga04h51_118721_c1_41_748 | 233 |
| 497 | 3300050510 | nmdc:mga06r32_506271_c1 | nmdc:mga06r32_506271_c1_90_797 | 233 |
| 498 | 3300050511 | nmdc:mga08y16_52239_c1 | nmdc:mga08y16_52239_c1_519_1226 | 233 |
| 499 | 3300050515 | nmdc:mga0a205_80131_c1 | nmdc:mga0a205_80131_c1_1400_2107 | 233 |
| 500 | 3300050516 | nmdc:mga0sz30_132340_c1 | nmdc:mga0sz30_132340_c1_34_741 | 233 |
| 501 | 3300053083 | Ga0495655_0012868 | Ga0495655_0012868_261_968 | 233 |
| 502 | 3300053084 | Ga0495595_0274133 | Ga0495595_0274133_108_815 | 233 |
| 503 | 3300005435 | Ga0070714_100074119 | Ga0070714_1000741191 | 234 |
| 504 | 3300005535 | Ga0070684_100095217 | Ga0070684_1000952171 | 234 |
| 505 | 3300005983 | Ga0081540_1003744 | Ga0081540_100374412 | 234 |
| 506 | 3300009551 | Ga0105238_10198677 | Ga0105238_101986772 | 234 |
| 507 | 3300013102 | Ga0157371_10198437 | Ga0157371_101984372 | 234 |
| 508 | 3300013105 | Ga0157369_10354496 | Ga0157369_103544962 | 234 |
| 509 | 3300027907 | Ga0207428_10001020 | Ga0207428_1000102024 | 234 |
| 510 | 3300031711 | Ga0265314_10006316 | Ga0265314_1000631612 | 234 |
| 511 | 3300035170 | Ga0373943_0194294 | Ga0373943_0194294_401_1111 | 234 |
| 512 | 3300035692 | Ga0373935_0089396 | Ga0373935_0089396_681_1394 | 234 |
| 513 | 3300035725 | Ga0373947_0040236 | Ga0373947_0040236_467_1180 | 234 |
| 514 | 3300049823 | Ga0501044_0259155 | Ga0501044_0259155_684_1397 | 234 |
| 515 | 3300050507 | nmdc:mga05p37_502234_c1 | nmdc:mga05p37_502234_c1_283_996 | 234 |
| 516 | 2209111006 | 2214828534 | 2213866799 | 235 |
| 517 | 3300000041 | ARcpr5oldR_c000010 | ARcpr5oldR_00001019 | 235 |
| 518 | 3300000042 | ARSoilYngRDRAFT_c00060 | ARSoilYngRDRAFT_0006013 | 235 |
| 519 | 3300000043 | ARcpr5yngRDRAFT_c000016 | ARcpr5yngRDRAFT_0000168 | 235 |
| 520 | 3300000044 | ARSoilOldRDRAFT_c000011 | ARSoilOldRDRAFT_00001125 | 235 |
| 521 | 3300000045 | ARCol0oldRDRAFT_c00012 | ARCol0oldRDRAFT_000128 | 235 |
| 522 | 3300000652 | ARCol0yngRDRAFT_1000018 | ARCol0yngRDRAFT_100001825 | 235 |
| 523 | 3300002070 | JGI24750J21931_1000096 | JGI24750J21931_10000963 | 235 |
| 524 | 3300002074 | JGI24748J21848_1000302 | JGI24748J21848_10003022 | 235 |
| 525 | 3300002075 | JGI24738J21930_10000997 | JGI24738J21930_100009973 | 235 |
| 526 | 3300002155 | JGI24033J26618_1000471 | JGI24033J26618_10004713 | 235 |
| 527 | 3300002244 | JGI24742J22300_10003081 | JGI24742J22300_100030812 | 235 |
| 528 | 3300005277 | Ga0065716_1001756 | Ga0065716_10017561 | 235 |
| 529 | 3300005289 | Ga0065704_10080159 | Ga0065704_100801593 | 235 |
| 530 | 3300005290 | Ga0065712_10075299 | Ga0065712_100752993 | 235 |
| 531 | 3300005293 | Ga0065715_10007070 | Ga0065715_100070704 | 235 |
| 532 | 3300005293 | Ga0065715_10099107 | Ga0065715_100991073 | 235 |
| 533 | 3300005293 | Ga0065715_10136801 | Ga0065715_101368012 | 235 |
| 534 | 3300005295 | Ga0065707_10174416 | Ga0065707_101744161 | 235 |
| 535 | 3300005328 | Ga0070676_10000506 | Ga0070676_100005069 | 235 |
| 536 | 3300005328 | Ga0070676_10112545 | Ga0070676_101125452 | 235 |
| 537 | 3300005329 | Ga0070683_100014228 | Ga0070683_1000142284 | 235 |
| 538 | 3300005330 | Ga0070690_100007842 | Ga0070690_1000078421 | 235 |
| 539 | 3300005330 | Ga0070690_100174897 | Ga0070690_1001748972 | 235 |
| 540 | 3300005331 | Ga0070670_100004573 | Ga0070670_1000045738 | 235 |
| 541 | 3300005333 | Ga0070677_10000227 | Ga0070677_1000022719 | 235 |
| 542 | 3300005334 | Ga0068869_100001832 | Ga0068869_1000018323 | 235 |
| 543 | 3300005335 | Ga0070666_10036086 | Ga0070666_100360862 | 235 |
| 544 | 3300005336 | Ga0070680_100003424 | Ga0070680_1000034242 | 235 |
| 545 | 3300005336 | Ga0070680_100063627 | Ga0070680_1000636272 | 235 |
| 546 | 3300005336 | Ga0070680_100462824 | Ga0070680_1004628242 | 235 |
| 547 | 3300005337 | Ga0070682_100001699 | Ga0070682_1000016992 | 235 |
| 548 | 3300005338 | Ga0068868_100012331 | Ga0068868_1000123316 | 235 |
| 549 | 3300005339 | Ga0070660_100038742 | Ga0070660_1000387424 | 235 |
| 550 | 3300005340 | Ga0070689_100000668 | Ga0070689_10000066812 | 235 |
| 551 | 3300005343 | Ga0070687_100000527 | Ga0070687_1000005273 | 235 |
| 552 | 3300005343 | Ga0070687_100228897 | Ga0070687_1002288972 | 235 |
| 553 | 3300005345 | Ga0070692_10001083 | Ga0070692_100010833 | 235 |
| 554 | 3300005347 | Ga0070668_100003117 | Ga0070668_10000311712 | 235 |
| 555 | 3300005354 | Ga0070675_100002954 | Ga0070675_1000029543 | 235 |
| 556 | 3300005354 | Ga0070675_100366607 | Ga0070675_1003666072 | 235 |
| 557 | 3300005355 | Ga0070671_100003210 | Ga0070671_1000032103 | 235 |
| 558 | 3300005355 | Ga0070671_100038884 | Ga0070671_1000388844 | 235 |
| 559 | 3300005355 | Ga0070671_100172776 | Ga0070671_1001727762 | 235 |
| 560 | 3300005364 | Ga0070673_100001477 | Ga0070673_10000147712 | 235 |
| 561 | 3300005365 | Ga0070688_100001239 | Ga0070688_10000123912 | 235 |
| 562 | 3300005365 | Ga0070688_100017884 | Ga0070688_1000178844 | 235 |
| 563 | 3300005365 | Ga0070688_100069139 | Ga0070688_1000691392 | 235 |
| 564 | 3300005367 | Ga0070667_100022264 | Ga0070667_1000222645 | 235 |
| 565 | 3300005367 | Ga0070667_100089271 | Ga0070667_1000892713 | 235 |
| 566 | 3300005434 | Ga0070709_10019255 | Ga0070709_100192554 | 235 |
| 567 | 3300005436 | Ga0070713_100029883 | Ga0070713_1000298833 | 235 |
| 568 | 3300005438 | Ga0070701_10070848 | Ga0070701_100708483 | 235 |
| 569 | 3300005439 | Ga0070711_100025583 | Ga0070711_1000255834 | 235 |
| 570 | 3300005439 | Ga0070711_100064990 | Ga0070711_1000649902 | 235 |
| 571 | 3300005440 | Ga0070705_100001458 | Ga0070705_1000014583 | 235 |
| 572 | 3300005441 | Ga0070700_100001211 | Ga0070700_1000012113 | 235 |
| 573 | 3300005444 | Ga0070694_100001764 | Ga0070694_1000017643 | 235 |
| 574 | 3300005445 | Ga0070708_100036600 | Ga0070708_1000366002 | 235 |
| 575 | 3300005455 | Ga0070663_100198516 | Ga0070663_1001985162 | 235 |
| 576 | 3300005456 | Ga0070678_100000525 | Ga0070678_10000052517 | 235 |
| 577 | 3300005456 | Ga0070678_100114733 | Ga0070678_1001147332 | 235 |
| 578 | 3300005457 | Ga0070662_100002968 | Ga0070662_10000296810 | 235 |
| 579 | 3300005457 | Ga0070662_100233026 | Ga0070662_1002330262 | 235 |
| 580 | 3300005458 | Ga0070681_10102104 | Ga0070681_101021043 | 235 |
| 581 | 3300005459 | Ga0068867_100002950 | Ga0068867_10000295013 | 235 |
| 582 | 3300005466 | Ga0070685_10003505 | Ga0070685_100035055 | 235 |
| 583 | 3300005467 | Ga0070706_100290798 | Ga0070706_1002907981 | 235 |
| 584 | 3300005530 | Ga0070679_100015045 | Ga0070679_1000150453 | 235 |
| 585 | 3300005530 | Ga0070679_100034800 | Ga0070679_1000348001 | 235 |
| 586 | 3300005535 | Ga0070684_100052856 | Ga0070684_1000528563 | 235 |
| 587 | 3300005544 | Ga0070686_100001573 | Ga0070686_1000015733 | 235 |
| 588 | 3300005547 | Ga0070693_100000880 | Ga0070693_1000008803 | 235 |
| 589 | 3300005548 | Ga0070665_100056009 | Ga0070665_1000560093 | 235 |
| 590 | 3300005548 | Ga0070665_101130573 | Ga0070665_1011305732 | 235 |
| 591 | 3300005549 | Ga0070704_100001917 | Ga0070704_1000019172 | 235 |
| 592 | 3300005549 | Ga0070704_100104467 | Ga0070704_1001044672 | 235 |
| 593 | 3300005564 | Ga0070664_100002934 | Ga0070664_10000293412 | 235 |
| 594 | 3300005564 | Ga0070664_100014397 | Ga0070664_1000143976 | 235 |
| 595 | 3300005564 | Ga0070664_100180771 | Ga0070664_1001807712 | 235 |
| 596 | 3300005577 | Ga0068857_100000358 | Ga0068857_10000035812 | 235 |
| 597 | 3300005578 | Ga0068854_100008663 | Ga0068854_1000086635 | 235 |
| 598 | 3300005578 | Ga0068854_100275369 | Ga0068854_1002753692 | 235 |
| 599 | 3300005614 | Ga0068856_100065255 | Ga0068856_1000652552 | 235 |
| 600 | 3300005614 | Ga0068856_100156786 | Ga0068856_1001567862 | 235 |
| 601 | 3300005617 | Ga0068859_100005591 | Ga0068859_1000055913 | 235 |
| 602 | 3300005617 | Ga0068859_100310219 | Ga0068859_1003102192 | 235 |
| 603 | 3300005618 | Ga0068864_100001988 | Ga0068864_10000198814 | 235 |
| 604 | 3300005718 | Ga0068866_10048931 | Ga0068866_100489313 | 235 |
| 605 | 3300005719 | Ga0068861_100001805 | Ga0068861_1000018054 | 235 |
| 606 | 3300005840 | Ga0068870_10000025 | Ga0068870_1000002525 | 235 |
| 607 | 3300005841 | Ga0068863_100002964 | Ga0068863_10000296411 | 235 |
| 608 | 3300005842 | Ga0068858_100003227 | Ga0068858_10000322712 | 235 |
| 609 | 3300005842 | Ga0068858_100558164 | Ga0068858_1005581641 | 235 |
| 610 | 3300005937 | Ga0081455_10002463 | Ga0081455_1000246313 | 235 |
| 611 | 3300006028 | Ga0070717_10506230 | Ga0070717_105062302 | 235 |
| 612 | 3300006163 | Ga0070715_10094663 | Ga0070715_100946632 | 235 |
| 613 | 3300006163 | Ga0070715_10165699 | Ga0070715_101656992 | 235 |
| 614 | 3300006175 | Ga0070712_100100946 | Ga0070712_1001009462 | 235 |
| 615 | 3300006237 | Ga0097621_100000456 | Ga0097621_10000045611 | 235 |
| 616 | 3300006237 | Ga0097621_100052081 | Ga0097621_1000520814 | 235 |
| 617 | 3300006358 | Ga0068871_100004245 | Ga0068871_1000042459 | 235 |
| 618 | 3300006358 | Ga0068871_100024937 | Ga0068871_1000249374 | 235 |
| 619 | 3300006852 | Ga0075433_10247616 | Ga0075433_102476162 | 235 |
| 620 | 3300006871 | Ga0075434_100004861 | Ga0075434_10000486110 | 235 |
| 621 | 3300006871 | Ga0075434_100105570 | Ga0075434_1001055702 | 235 |
| 622 | 3300006871 | Ga0075434_100143730 | Ga0075434_1001437303 | 235 |
| 623 | 3300006931 | Ga0097620_100005590 | Ga0097620_10000559012 | 235 |
| 624 | 3300006931 | Ga0097620_100310218 | Ga0097620_1003102182 | 235 |
| 625 | 3300007076 | Ga0075435_100050168 | Ga0075435_1000501684 | 235 |
| 626 | 3300007076 | Ga0075435_100079258 | Ga0075435_1000792584 | 235 |
| 627 | 3300009098 | Ga0105245_10224069 | Ga0105245_102240692 | 235 |
| 628 | 3300009101 | Ga0105247_10009563 | Ga0105247_100095637 | 235 |
| 629 | 3300009101 | Ga0105247_10012907 | Ga0105247_100129074 | 235 |
| 630 | 3300009147 | Ga0114129_10271211 | Ga0114129_102712113 | 235 |
| 631 | 3300009176 | Ga0105242_10081550 | Ga0105242_100815503 | 235 |
| 632 | 3300009177 | Ga0105248_10039630 | Ga0105248_100396305 | 235 |
| 633 | 3300009177 | Ga0105248_10554388 | Ga0105248_105543882 | 235 |
| 634 | 3300009551 | Ga0105238_10288067 | Ga0105238_102880673 | 235 |
| 635 | 3300009553 | Ga0105249_10135144 | Ga0105249_101351443 | 235 |
| 636 | 3300010375 | Ga0105239_10124653 | Ga0105239_101246532 | 235 |
| 637 | 3300013102 | Ga0157371_10089641 | Ga0157371_100896413 | 235 |
| 638 | 3300013105 | Ga0157369_10182437 | Ga0157369_101824373 | 235 |
| 639 | 3300013296 | Ga0157374_10113975 | Ga0157374_101139753 | 235 |
| 640 | 3300013297 | Ga0157378_10317747 | Ga0157378_103177472 | 235 |
| 641 | 3300013306 | Ga0163162_10320702 | Ga0163162_103207022 | 235 |
| 642 | 3300013308 | Ga0157375_10076811 | Ga0157375_100768113 | 235 |
| 643 | 3300014325 | Ga0163163_10001239 | Ga0163163_1000123913 | 235 |
| 644 | 3300014968 | Ga0157379_10004577 | Ga0157379_100045773 | 235 |
| 645 | 3300014968 | Ga0157379_10033161 | Ga0157379_100331615 | 235 |
| 646 | 3300014969 | Ga0157376_10028988 | Ga0157376_100289885 | 235 |
| 647 | 3300017792 | Ga0163161_10001492 | Ga0163161_100014923 | 235 |
| 648 | 3300025271 | Ga0207666_1000140 | Ga0207666_10001403 | 235 |
| 649 | 3300025290 | Ga0207673_1000714 | Ga0207673_10007142 | 235 |
| 650 | 3300025893 | Ga0207682_10000062 | Ga0207682_100000623 | 235 |
| 651 | 3300025898 | Ga0207692_10224337 | Ga0207692_102243371 | 235 |
| 652 | 3300025900 | Ga0207710_10004068 | Ga0207710_100040683 | 235 |
| 653 | 3300025900 | Ga0207710_10024743 | Ga0207710_100247432 | 235 |
| 654 | 3300025900 | Ga0207710_10264788 | Ga0207710_102647881 | 235 |
| 655 | 3300025903 | Ga0207680_10155059 | Ga0207680_101550592 | 235 |
| 656 | 3300025904 | Ga0207647_10003504 | Ga0207647_1000350412 | 235 |
| 657 | 3300025905 | Ga0207685_10125361 | Ga0207685_101253612 | 235 |
| 658 | 3300025907 | Ga0207645_10000248 | Ga0207645_100002482 | 235 |
| 659 | 3300025907 | Ga0207645_10049727 | Ga0207645_100497272 | 235 |
| 660 | 3300025908 | Ga0207643_10000064 | Ga0207643_1000006463 | 235 |
| 661 | 3300025911 | Ga0207654_10001623 | Ga0207654_100016232 | 235 |
| 662 | 3300025914 | Ga0207671_10007347 | Ga0207671_100073474 | 235 |
| 663 | 3300025915 | Ga0207693_10030951 | Ga0207693_100309513 | 235 |
| 664 | 3300025916 | Ga0207663_10018380 | Ga0207663_100183804 | 235 |
| 665 | 3300025916 | Ga0207663_10050733 | Ga0207663_100507333 | 235 |
| 666 | 3300025917 | Ga0207660_10000194 | Ga0207660_1000019438 | 235 |
| 667 | 3300025919 | Ga0207657_10006919 | Ga0207657_1000691912 | 235 |
| 668 | 3300025919 | Ga0207657_10033938 | Ga0207657_100339384 | 235 |
| 669 | 3300025920 | Ga0207649_10000234 | Ga0207649_100002347 | 235 |
| 670 | 3300025921 | Ga0207652_10001613 | Ga0207652_1000161321 | 235 |
| 671 | 3300025922 | Ga0207646_10560944 | Ga0207646_105609442 | 235 |
| 672 | 3300025923 | Ga0207681_10000794 | Ga0207681_100007943 | 235 |
| 673 | 3300025924 | Ga0207694_10733360 | Ga0207694_107333602 | 235 |
| 674 | 3300025925 | Ga0207650_10056285 | Ga0207650_100562853 | 235 |
| 675 | 3300025926 | Ga0207659_10000172 | Ga0207659_100001727 | 235 |
| 676 | 3300025927 | Ga0207687_10008699 | Ga0207687_100086998 | 235 |
| 677 | 3300025927 | Ga0207687_10024271 | Ga0207687_100242714 | 235 |
| 678 | 3300025928 | Ga0207700_10148256 | Ga0207700_101482563 | 235 |
| 679 | 3300025929 | Ga0207664_10021143 | Ga0207664_100211432 | 235 |
| 680 | 3300025931 | Ga0207644_10000439 | Ga0207644_1000043912 | 235 |
| 681 | 3300025931 | Ga0207644_10075967 | Ga0207644_100759672 | 235 |
| 682 | 3300025932 | Ga0207690_10000796 | Ga0207690_100007963 | 235 |
| 683 | 3300025933 | Ga0207706_10005059 | Ga0207706_100050592 | 235 |
| 684 | 3300025934 | Ga0207686_10001093 | Ga0207686_100010932 | 235 |
| 685 | 3300025934 | Ga0207686_10117395 | Ga0207686_101173952 | 235 |
| 686 | 3300025935 | Ga0207709_10001438 | Ga0207709_100014383 | 235 |
| 687 | 3300025936 | Ga0207670_10000807 | Ga0207670_1000080717 | 235 |
| 688 | 3300025936 | Ga0207670_10104223 | Ga0207670_101042231 | 235 |
| 689 | 3300025937 | Ga0207669_10000141 | Ga0207669_1000014134 | 235 |
| 690 | 3300025938 | Ga0207704_10000755 | Ga0207704_1000075516 | 235 |
| 691 | 3300025938 | Ga0207704_10487023 | Ga0207704_104870231 | 235 |
| 692 | 3300025941 | Ga0207711_10006747 | Ga0207711_100067472 | 235 |
| 693 | 3300025941 | Ga0207711_10071197 | Ga0207711_100711972 | 235 |
| 694 | 3300025941 | Ga0207711_10461921 | Ga0207711_104619212 | 235 |
| 695 | 3300025942 | Ga0207689_10004430 | Ga0207689_100044303 | 235 |
| 696 | 3300025944 | Ga0207661_10000098 | Ga0207661_100000989 | 235 |
| 697 | 3300025945 | Ga0207679_10000174 | Ga0207679_1000017410 | 235 |
| 698 | 3300025945 | Ga0207679_10166636 | Ga0207679_101666361 | 235 |
| 699 | 3300025960 | Ga0207651_10000782 | Ga0207651_100007824 | 235 |
| 700 | 3300025961 | Ga0207712_10000659 | Ga0207712_1000065912 | 235 |
| 701 | 3300025961 | Ga0207712_10781975 | Ga0207712_107819751 | 235 |
| 702 | 3300025972 | Ga0207668_10001107 | Ga0207668_100011072 | 235 |
| 703 | 3300025981 | Ga0207640_10000846 | Ga0207640_100008462 | 235 |
| 704 | 3300025986 | Ga0207658_10186912 | Ga0207658_101869122 | 235 |
| 705 | 3300026023 | Ga0207677_10031190 | Ga0207677_100311904 | 235 |
| 706 | 3300026035 | Ga0207703_10002433 | Ga0207703_1000243312 | 235 |
| 707 | 3300026067 | Ga0207678_10001059 | Ga0207678_1000105912 | 235 |
| 708 | 3300026067 | Ga0207678_10236838 | Ga0207678_102368382 | 235 |
| 709 | 3300026075 | Ga0207708_10002793 | Ga0207708_1000279312 | 235 |
| 710 | 3300026078 | Ga0207702_10089635 | Ga0207702_100896352 | 235 |
| 711 | 3300026078 | Ga0207702_10241850 | Ga0207702_102418502 | 235 |
| 712 | 3300026088 | Ga0207641_10000622 | Ga0207641_100006227 | 235 |
| 713 | 3300026089 | Ga0207648_10031513 | Ga0207648_100315135 | 235 |
| 714 | 3300026089 | Ga0207648_10118031 | Ga0207648_101180313 | 235 |
| 715 | 3300026095 | Ga0207676_10002696 | Ga0207676_1000269613 | 235 |
| 716 | 3300026116 | Ga0207674_10001342 | Ga0207674_1000134212 | 235 |
| 717 | 3300026121 | Ga0207683_10001193 | Ga0207683_1000119314 | 235 |
| 718 | 3300026121 | Ga0207683_10039243 | Ga0207683_100392432 | 235 |
| 719 | 3300026142 | Ga0207698_10016429 | Ga0207698_100164295 | 235 |
| 720 | 3300027543 | Ga0209999_1006731 | Ga0209999_10067313 | 235 |
| 721 | 3300027614 | Ga0209970_1007996 | Ga0209970_10079962 | 235 |
| 722 | 3300027617 | Ga0210002_1021945 | Ga0210002_10219452 | 235 |
| 723 | 3300027665 | Ga0209983_1024340 | Ga0209983_10243402 | 235 |
| 724 | 3300027682 | Ga0209971_1000957 | Ga0209971_10009577 | 235 |
| 725 | 3300027695 | Ga0209966_1008911 | Ga0209966_10089112 | 235 |
| 726 | 3300027907 | Ga0207428_10000513 | Ga0207428_1000051344 | 235 |
| 727 | 3300027907 | Ga0207428_10000626 | Ga0207428_1000062629 | 235 |
| 728 | 3300027907 | Ga0207428_10236088 | Ga0207428_102360882 | 235 |
| 729 | 3300028379 | Ga0268266_10071484 | Ga0268266_100714843 | 235 |
| 730 | 3300028380 | Ga0268265_10002370 | Ga0268265_1000237016 | 235 |
| 731 | 3300028381 | Ga0268264_10004444 | Ga0268264_1000444412 | 235 |
| 732 | 3300031249 | Ga0265339_10054727 | Ga0265339_100547273 | 235 |
| 733 | 3300031595 | Ga0265313_10018002 | Ga0265313_100180023 | 235 |
| 734 | 3300034816 | Ga0373930_0000172 | Ga0373930_0000172_4474_5181 | 235 |
| 735 | 3300034816 | Ga0373930_0043872 | Ga0373930_0043872_10_720 | 235 |
| 736 | 3300034817 | Ga0373948_0000049 | Ga0373948_0000049_12203_12910 | 235 |
| 737 | 3300034820 | Ga0373959_0004938 | Ga0373959_0004938_1167_1874 | 235 |
| 738 | 3300034957 | Ga0373938_0000119 | Ga0373938_0000119_8562_9269 | 235 |
| 739 | 3300035083 | Ga0373926_0059986 | Ga0373926_0059986_132_839 | 235 |
| 740 | 3300035084 | Ga0373928_0000148 | Ga0373928_0000148_3489_4196 | 235 |
| 741 | 3300035085 | Ga0373929_0001447 | Ga0373929_0001447_254_961 | 235 |
| 742 | 3300035086 | Ga0373934_0005597 | Ga0373934_0005597_3508_4245 | 235 |
| 743 | 3300035086 | Ga0373934_0011264 | Ga0373934_0011264_2272_2979 | 235 |
| 744 | 3300035088 | Ga0373940_0001153 | Ga0373940_0001153_353_1060 | 235 |
| 745 | 3300035090 | Ga0373949_0000443 | Ga0373949_0000443_13095_13802 | 235 |
| 746 | 3300035091 | Ga0373951_0000403 | Ga0373951_0000403_8690_9397 | 235 |
| 747 | 3300035092 | Ga0373952_0002943 | Ga0373952_0002943_1843_2550 | 235 |
| 748 | 3300035111 | Ga0373923_0052325 | Ga0373923_0052325_852_1559 | 235 |
| 749 | 3300035111 | Ga0373923_0061558 | Ga0373923_0061558_415_1152 | 235 |
| 750 | 3300035115 | Ga0373941_0000259 | Ga0373941_0000259_1606_2313 | 235 |
| 751 | 3300035116 | Ga0373945_0129330 | Ga0373945_0129330_224_931 | 235 |
| 752 | 3300035117 | Ga0373953_0000832 | Ga0373953_0000832_3581_4288 | 235 |
| 753 | 3300035117 | Ga0373953_0193681 | Ga0373953_0193681_96_833 | 235 |
| 754 | 3300035118 | Ga0373954_0006437 | Ga0373954_0006437_2883_3590 | 235 |
| 755 | 3300035119 | Ga0373956_0002668 | Ga0373956_0002668_2496_3203 | 235 |
| 756 | 3300035120 | Ga0373957_0046077 | Ga0373957_0046077_811_1548 | 235 |
| 757 | 3300035170 | Ga0373943_0015417 | Ga0373943_0015417_1564_2301 | 235 |
| 758 | 3300035170 | Ga0373943_0035562 | Ga0373943_0035562_575_1282 | 235 |
| 759 | 3300035171 | Ga0373946_0034727 | Ga0373946_0034727_703_1410 | 235 |
| 760 | 3300035172 | Ga0373955_0002931 | Ga0373955_0002931_383_1120 | 235 |
| 761 | 3300035172 | Ga0373955_0003085 | Ga0373955_0003085_1639_2346 | 235 |
| 762 | 3300035207 | Ga0373942_0003780 | Ga0373942_0003780_974_1684 | 235 |
| 763 | 3300035241 | Ga0373961_0008049 | Ga0373961_0008049_686_1393 | 235 |
| 764 | 3300035242 | Ga0373962_0005737 | Ga0373962_0005737_301_1008 | 235 |
| 765 | 3300035410 | Ga0373924_0010074 | Ga0373924_0010074_344_1081 | 235 |
| 766 | 3300035410 | Ga0373924_0142968 | Ga0373924_0142968_175_882 | 235 |
| 767 | 3300035692 | Ga0373935_0041739 | Ga0373935_0041739_656_1393 | 235 |
| 768 | 3300035692 | Ga0373935_0053048 | Ga0373935_0053048_109_816 | 235 |
| 769 | 3300035692 | Ga0373935_0276952 | Ga0373935_0276952_250_957 | 235 |
| 770 | 3300035695 | Ga0373927_0065939 | Ga0373927_0065939_1273_1980 | 235 |
| 771 | 3300035724 | Ga0373933_0001174 | Ga0373933_0001174_309_1046 | 235 |
| 772 | 3300035724 | Ga0373933_0011554 | Ga0373933_0011554_2435_3142 | 235 |
| 773 | 3300035725 | Ga0373947_0099621 | Ga0373947_0099621_465_1172 | 235 |
| 774 | 3300036401 | Ga0373937_0000887 | Ga0373937_0000887_7496_8233 | 235 |
| 775 | 3300036401 | Ga0373937_0004926 | Ga0373937_0004926_3033_3740 | 235 |
| 776 | 3300037068 | Ga0373925_0113397 | Ga0373925_0113397_1273_1980 | 235 |
| 777 | 3300041408 | Ga0439453_0006113 | Ga0439453_0006113_555_1262 | 235 |
| 778 | 3300042008 | Ga0439450_004177 | Ga0439450_004177_614_1321 | 235 |
| 779 | 3300042012 | Ga0439455_0047916 | Ga0439455_0047916_382_1089 | 235 |
| 780 | 3300042439 | Ga0439464_0019328 | Ga0439464_0019328_615_1322 | 235 |
| 781 | 3300042461 | Ga0439460_0036225 | Ga0439460_0036225_211_918 | 235 |
| 782 | 3300044712 | Ga0453684_0067523 | Ga0453684_0067523_1741_2448 | 235 |
| 783 | 3300046454 | Ga0495592_0012894 | Ga0495592_0012894_669_1376 | 235 |
| 784 | 3300046459 | Ga0495629_0014928 | Ga0495629_0014928_1395_2132 | 235 |
| 785 | 3300046462 | Ga0495651_0000419 | Ga0495651_0000419_20550_21287 | 235 |
| 786 | 3300046462 | Ga0495651_0016376 | Ga0495651_0016376_2348_3055 | 235 |
| 787 | 3300046463 | Ga0495653_0006076 | Ga0495653_0006076_1211_1918 | 235 |
| 788 | 3300046472 | Ga0495580_0112900 | Ga0495580_0112900_109_816 | 235 |
| 789 | 3300046476 | Ga0495662_0029468 | Ga0495662_0029468_1765_2502 | 235 |
| 790 | 3300046477 | Ga0495664_0079552 | Ga0495664_0079552_706_1413 | 235 |
| 791 | 3300046511 | Ga0495608_0000557 | Ga0495608_0000557_6341_7048 | 235 |
| 792 | 3300046511 | Ga0495608_0003247 | Ga0495608_0003247_1690_2427 | 235 |
| 793 | 3300046514 | Ga0495618_0022293 | Ga0495618_0022293_2827_3534 | 235 |
| 794 | 3300046514 | Ga0495618_0110801 | Ga0495618_0110801_889_1596 | 235 |
| 795 | 3300046516 | Ga0495628_0064458 | Ga0495628_0064458_1493_2200 | 235 |
| 796 | 3300046517 | Ga0495630_0129581 | Ga0495630_0129581_105_812 | 235 |
| 797 | 3300046517 | Ga0495630_0400518 | Ga0495630_0400518_90_797 | 235 |
| 798 | 3300046529 | Ga0495652_0004247 | Ga0495652_0004247_8206_8913 | 235 |
| 799 | 3300046529 | Ga0495652_0427069 | Ga0495652_0427069_149_856 | 235 |
| 800 | 3300046531 | Ga0495665_0094704 | Ga0495665_0094704_429_1136 | 235 |
| 801 | 3300046533 | Ga0495640_0004068 | Ga0495640_0004068_10213_10950 | 235 |
| 802 | 3300046533 | Ga0495640_0006625 | Ga0495640_0006625_6388_7095 | 235 |
| 803 | 3300046535 | Ga0495586_0013094 | Ga0495586_0013094_3207_3914 | 235 |
| 804 | 3300046536 | Ga0495587_0000884 | Ga0495587_0000884_18763_19500 | 235 |
| 805 | 3300046536 | Ga0495587_0004155 | Ga0495587_0004155_6078_6785 | 235 |
| 806 | 3300046543 | Ga0495645_0002731 | Ga0495645_0002731_8080_8787 | 235 |
| 807 | 3300046543 | Ga0495645_0008028 | Ga0495645_0008028_733_1470 | 235 |
| 808 | 3300046559 | Ga0495667_0001476 | Ga0495667_0001476_12197_12934 | 235 |
| 809 | 3300046559 | Ga0495667_0002899 | Ga0495667_0002899_4709_5416 | 235 |
| 810 | 3300046642 | Ga0495634_0000880 | Ga0495634_0000880_11325_12062 | 235 |
| 811 | 3300046642 | Ga0495634_0033896 | Ga0495634_0033896_2014_2721 | 235 |
| 812 | 3300046663 | Ga0495635_0007077 | Ga0495635_0007077_4077_4784 | 235 |
| 813 | 3300046675 | Ga0495657_0006177 | Ga0495657_0006177_3890_4597 | 235 |
| 814 | 3300046678 | Ga0495599_0003181 | Ga0495599_0003181_7918_8655 | 235 |
| 815 | 3300046678 | Ga0495599_0020964 | Ga0495599_0020964_2699_3406 | 235 |
| 816 | 3300046679 | Ga0495623_0001616 | Ga0495623_0001616_6569_7276 | 235 |
| 817 | 3300046679 | Ga0495623_0004039 | Ga0495623_0004039_8655_9392 | 235 |
| 818 | 3300046680 | Ga0495646_0001738 | Ga0495646_0001738_1407_2144 | 235 |
| 819 | 3300046680 | Ga0495646_0005955 | Ga0495646_0005955_5117_5824 | 235 |
| 820 | 3300046681 | Ga0495647_0176918 | Ga0495647_0176918_132_839 | 235 |
| 821 | 3300046689 | Ga0495613_0044676 | Ga0495613_0044676_2042_2749 | 235 |
| 822 | 3300046690 | Ga0495624_0065820 | Ga0495624_0065820_954_1661 | 235 |
| 823 | 3300046809 | Ga0495600_0001126 | Ga0495600_0001126_12451_13188 | 235 |
| 824 | 3300046809 | Ga0495600_0061021 | Ga0495600_0061021_683_1390 | 235 |
| 825 | 3300047315 | Ga0495581_0170358 | Ga0495581_0170358_319_1026 | 235 |
| 826 | 3300047317 | Ga0495604_0000388 | Ga0495604_0000388_26315_27052 | 235 |
| 827 | 3300047317 | Ga0495604_0003734 | Ga0495604_0003734_5835_6542 | 235 |
| 828 | 3300047319 | Ga0495674_0003431 | Ga0495674_0003431_6541_7278 | 235 |
| 829 | 3300047319 | Ga0495674_0025645 | Ga0495674_0025645_1996_2703 | 235 |
| 830 | 3300047322 | Ga0495680_0016395 | Ga0495680_0016395_2141_2878 | 235 |
| 831 | 3300047322 | Ga0495680_0040619 | Ga0495680_0040619_132_839 | 235 |
| 832 | 3300047444 | Ga0495675_0000740 | Ga0495675_0000740_3033_3740 | 235 |
| 833 | 3300047444 | Ga0495675_0001614 | Ga0495675_0001614_11823_12560 | 235 |
| 834 | 3300047471 | Ga0495684_0003551 | Ga0495684_0003551_3148_3885 | 235 |
| 835 | 3300047471 | Ga0495684_0021577 | Ga0495684_0021577_4016_4723 | 235 |
| 836 | 3300047471 | Ga0495684_0478386 | Ga0495684_0478386_48_755 | 235 |
| 837 | 3300048088 | Ga0495602_0002218 | Ga0495602_0002218_17346_18053 | 235 |
| 838 | 3300048088 | Ga0495602_0011547 | Ga0495602_0011547_6001_6738 | 235 |
| 839 | 3300048089 | Ga0495614_0151859 | Ga0495614_0151859_109_816 | 235 |
| 840 | 3300048903 | Ga0496100_0024478 | Ga0496100_0024478_1418_2125 | 235 |
| 841 | 3300048905 | Ga0496102_0040672 | Ga0496102_0040672_1235_1942 | 235 |
| 842 | 3300048907 | Ga0496104_0062693 | Ga0496104_0062693_296_1003 | 235 |
| 843 | 3300048907 | Ga0496104_0642819 | Ga0496104_0642819_46_753 | 235 |
| 844 | 3300048908 | Ga0496105_0115477 | Ga0496105_0115477_366_1073 | 235 |
| 845 | 3300048909 | Ga0496106_0023808 | Ga0496106_0023808_2715_3422 | 235 |
| 846 | 3300048909 | Ga0496106_0101982 | Ga0496106_0101982_492_1202 | 235 |
| 847 | 3300048909 | Ga0496106_0115921 | Ga0496106_0115921_739_1446 | 235 |
| 848 | 3300048910 | Ga0496107_0013175 | Ga0496107_0013175_1876_2583 | 235 |
| 849 | 3300048910 | Ga0496107_0040023 | Ga0496107_0040023_1360_2070 | 235 |
| 850 | 3300048911 | Ga0496108_0008033 | Ga0496108_0008033_5460_6170 | 235 |
| 851 | 3300048912 | Ga0496109_0005044 | Ga0496109_0005044_421_1128 | 235 |
| 852 | 3300048913 | Ga0496110_0108269 | Ga0496110_0108269_1307_2014 | 235 |
| 853 | 3300048913 | Ga0496110_0127504 | Ga0496110_0127504_324_1034 | 235 |
| 854 | 3300048917 | Ga0496114_0030068 | Ga0496114_0030068_1065_1772 | 235 |
| 855 | 3300048918 | Ga0496115_0089728 | Ga0496115_0089728_265_972 | 235 |
| 856 | 3300049571 | Ga0501034_0293529 | Ga0501034_0293529_187_900 | 235 |
| 857 | 3300049571 | Ga0501034_0380635 | Ga0501034_0380635_172_888 | 235 |
| 858 | 3300049574 | Ga0501038_0569430 | Ga0501038_0569430_81_788 | 235 |
| 859 | 3300049586 | Ga0501070_0214907 | Ga0501070_0214907_571_1284 | 235 |
| 860 | 3300050490 | nmdc:mga03n38_82410_c1 | nmdc:mga03n38_82410_c1_789_1496 | 235 |
| 861 | 3300050507 | nmdc:mga05p37_227168_c1 | nmdc:mga05p37_227168_c1_1249_1974 | 235 |
| 862 | 3300050512 | nmdc:mga0n895_334522_c1 | nmdc:mga0n895_334522_c1_609_1316 | 235 |
| 863 | 3300050512 | nmdc:mga0n895_4199_c1 | nmdc:mga0n895_4199_c1_528_1241 | 235 |
| 864 | 3300050512 | nmdc:mga0n895_75564_c1 | nmdc:mga0n895_75564_c1_1978_2688 | 235 |
| 865 | 3300050512 | nmdc:mga0n895_824194_c1 | nmdc:mga0n895_824194_c1_172_882 | 235 |
| 866 | 3300050513 | nmdc:mga0rr50_217615_c1 | nmdc:mga0rr50_217615_c1_112_822 | 235 |
| 867 | 3300050515 | nmdc:mga0a205_14086_c1 | nmdc:mga0a205_14086_c1_4490_5203 | 235 |
| 868 | 3300053077 | Ga0495601_0017682 | Ga0495601_0017682_2827_3534 | 235 |
| 869 | 3300053077 | Ga0495601_0069786 | Ga0495601_0069786_657_1394 | 235 |
| 870 | 3300053078 | Ga0495612_0004845 | Ga0495612_0004845_797_1504 | 235 |
| 871 | 3300053078 | Ga0495612_0008244 | Ga0495612_0008244_2528_3265 | 235 |
| 872 | 3300053084 | Ga0495595_0000976 | Ga0495595_0000976_6087_6794 | 235 |
| 873 | 3300053084 | Ga0495595_0021904 | Ga0495595_0021904_1801_2538 | 235 |
| 874 | 3300053085 | Ga0495619_0011111 | Ga0495619_0011111_3490_4227 | 235 |
| 875 | 3300053085 | Ga0495619_0012012 | Ga0495619_0012012_1138_1845 | 235 |
| 876 | 3300053085 | Ga0495619_0036703 | Ga0495619_0036703_237_944 | 235 |
| 877 | 3300053096 | Ga0500641_0008962 | Ga0500641_0008962_1585_2298 | 235 |
| 878 | 3300054114 | Ga0501084_0140956 | Ga0501084_0140956_1060_1767 | 235 |
| 879 | 3300060353 | Ga0501082_0053986 | Ga0501082_0053986_370_1083 | 235 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ef7-assembly1.cif.gz_A | crystal structure of xanthosine monophosphate phosphatase complex with xmp | 0.8795 | 15 | 233 |
| 7ef6-assembly1.cif.gz_A | crystal structure of xanthosine monophosphate phosphatase in the unliganded state | 0.8638 | 15 | 234 |
| 3onn-assembly1.cif.gz_A | crystal structure of 5'-nucleotidase sdt1 from saccharomyces cerevisiae | 0.8539 | 8 | 233 |
| 3opx-assembly1.cif.gz_A | crystal structure of pyrimidine 5 -nucleotidase sdt1 from saccharomyces cerevisiae complexed with uridine 5'-monophosphate | 0.8205 | 8 | 233 |
| 3onn-assembly1.cif.gz_A | crystal structure of 5'-nucleotidase sdt1 from saccharomyces cerevisiae | 0.8192 | 8 | 233 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3opxA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; | 0.9143 | 30 | 95 | 1.10.150.450 |
| af_K7KDK8_16_102_3.30.70.1620 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9138 | 20 | 97 | 3.30.70.1620 |
| af_Q4E4C3_1_85_1.10.150.450 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; | 0.8905 | 21 | 90 | 1.10.150.450 |
| af_Q54B74_103_232_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8798 | 97 | 235 | 3.40.50.1000 |
| af_P53078_30_280_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8604 | 8 | 232 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0N8PS06-F1-model_v4 | Pyrimidine 5'-nucleotidase | 0.9852 | 15 | 174 |
GO:0006206
GO:0008252 GO:0009166 |
| AF-A0A383DXP7-F1-model_v4 | Pyrimidine 5'-nucleotidase | 0.9843 | 12 | 151 |
|
| AF-A0A3S1WCW2-F1-model_v4 | deleted | 0.9831 | 12 | 194 |
|
| AF-A0A7W5Z492-F1-model_v4 | Putative hydrolase of the HAD superfamily | 0.982 | 12 | 232 |
GO:0016787
|
| AF-A0A530AQA5-F1-model_v4 | Pyrimidine 5'-nucleotidase | 0.9814 | 12 | 165 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar