F484443

General Info

Members Datasets Scaffolds Average Seq Length
879 415 872 234

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100462824|Ga0070680_1004628242
Length 258
Sequence MNRPRPRCDAAIAPSPRSSALTSSHRSRRGFGHVETWVFDLDNTLYPHHLNLWQQVDERIRSYVAEFLKVSKDEAFRVQKDYYRRYGTTMRGLMTEHGLKPDDYLEYVHQIDHSPLTPDPALGDALEKLPGRKLILTNGTRKHAEAVMARLEIDRHFEDVFDIAAADLDPKPLPQVYQRFLALHQVDPAKAAMFEDLARNLEVPHALGMTTVLVVPHGQREVFREGWELEGRDAPHVDHVTDDLAGYLRDIVRPAAPG

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
3 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
6 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
7 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
8 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
9 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
10 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
13 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
14 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
15 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
16 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
17 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
18 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
19 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
20 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
21 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
93 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
96 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
97 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
98 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
106 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
107 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
108 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
109 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
110 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
111 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
114 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
115 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
116 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
121 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
124 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
125 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
126 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
127 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
128 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
129 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
133 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
134 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
135 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
136 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
141 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
142 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
143 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
144 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
148 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
149 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
151 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
210 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
211 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
212 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
220 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
224 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
225 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
226 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
227 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
228 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
229 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
230 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
231 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
232 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
233 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
234 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
235 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
236 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
237 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
238 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
239 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
241 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
242 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
243 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
244 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
245 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
246 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
247 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
248 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
249 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
250 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
251 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
252 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
253 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
254 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
255 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
256 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
257 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
258 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
259 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
260 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
261 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
262 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
265 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
266 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
267 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
268 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
269 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
270 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
271 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
272 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
273 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
274 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
275 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
276 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
277 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
278 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
279 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
280 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
281 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
282 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
283 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
284 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
285 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
286 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
287 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
288 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
289 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
290 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
291 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
292 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
293 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
294 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
295 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
296 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
297 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
298 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
299 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
300 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
301 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
302 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
303 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
304 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
305 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
306 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
307 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
308 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
309 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
310 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
311 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
312 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
313 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
314 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
315 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
316 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
317 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
318 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
319 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
320 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
321 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
322 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
323 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
324 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
325 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
326 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
327 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
328 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
329 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
330 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
331 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
332 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
333 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
334 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
335 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
336 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
337 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
338 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
339 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
340 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
341 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
342 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
343 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
348 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
349 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
350 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
351 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
352 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
353 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
354 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
355 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
356 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
357 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
358 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
359 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
367 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
368 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
369 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
370 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
371 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
372 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
373 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
374 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
376 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
377 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
378 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
379 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
380 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
381 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
382 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
383 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
384 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
385 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
386 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
387 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
388 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
389 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
390 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
391 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
392 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
393 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
394 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
395 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
396 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
397 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
398 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
399 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
400 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
401 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
402 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
403 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
404 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
405 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
406 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
407 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
408 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
409 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
410 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
411 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
412 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
413 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
414 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
415 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0.11
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.21
Nodule 1.14
Rhizoplane 5.8
Rhizosphere 87.37
Stem 0
Stem Tuber 0
Unclassified 1.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214828534 2209111006 Bacteria 9441
2 ARcpr5oldR_c000010 3300000041 Bacteria 39074
3 ARSoilYngRDRAFT_c00060 3300000042 Bacteria 17969
4 ARcpr5yngRDRAFT_c000016 3300000043 Bacteria 29226
5 ARSoilOldRDRAFT_c000011 3300000044 Bacteria 42914
6 ARCol0oldRDRAFT_c00012 3300000045 Bacteria 14081
7 ARCol0yngRDRAFT_1000018 3300000652 Bacteria 30924
8 JGI24746J21847_1007946 3300001977 Bacteria 1610
9 JGI24739J22299_10059068 3300001989 Bacteria 1216
10 JGI24743J22301_10024590 3300001991 Bacteria 1164
11 JGI24750J21931_1000096 3300002070 Bacteria 13445
12 JGI24750J21931_1005344 3300002070 Bacteria 1579
13 JGI24748J21848_1000302 3300002074 Bacteria 5782
14 JGI24738J21930_10000997 3300002075 Bacteria 8121
15 JGI24738J21930_10015540 3300002075 Bacteria 1617
16 JGI24749J21850_1001768 3300002076 Bacteria 3058
17 JGI24744J21845_10001649 3300002077 Bacteria 4465
18 JGI24033J26618_1000471 3300002155 Bacteria 3965
19 JGI24742J22300_10000916 3300002244 Bacteria 4501
20 JGI24742J22300_10003081 3300002244 Bacteria 2697
21 JGI24751J29686_10007269 3300002459 Bacteria 2262
22 Ga0065716_1001756 3300005277 Bacteria 3560
23 Ga0065704_10080159 3300005289 Bacteria 3999
24 Ga0065712_10075299 3300005290 Bacteria 3891
25 Ga0065715_10007070 3300005293 Bacteria 5698
26 Ga0065715_10099107 3300005293 Bacteria 3453
27 Ga0065715_10136801 3300005293 Bacteria 1917
28 Ga0065707_10174416 3300005295 Bacteria 1461
29 Ga0070676_10000506 3300005328 Bacteria 18658
30 Ga0070676_10112545 3300005328 Bacteria 1697
31 Ga0070683_100014228 3300005329 Bacteria 6954
32 Ga0070690_100007842 3300005330 Bacteria 6123
33 Ga0070690_100010449 3300005330 Bacteria 5404
34 Ga0070690_100174897 3300005330 Bacteria 1480
35 Ga0070670_100004573 3300005331 Bacteria 11607
36 Ga0070670_100034128 3300005331 Bacteria 4379
37 Ga0070677_10000227 3300005333 Bacteria 19393
38 Ga0068869_100001832 3300005334 Bacteria 12767
39 Ga0068869_100007353 3300005334 Bacteria 7029
40 Ga0070666_10006992 3300005335 Bacteria 6955
41 Ga0070666_10036086 3300005335 Bacteria 3279
42 Ga0070680_100003424 3300005336 Bacteria 11842
43 Ga0070680_100063627 3300005336 Bacteria 3022
44 Ga0070680_100462824 3300005336 Bacteria 1083
45 Ga0070682_100001699 3300005337 Bacteria 12232
46 Ga0070682_100050082 3300005337 Bacteria 2606
47 Ga0068868_100011853 3300005338 Bacteria 6357
48 Ga0068868_100012331 3300005338 Bacteria 6246
49 Ga0068868_100065314 3300005338 Bacteria 2890
50 Ga0070660_100038742 3300005339 Bacteria 3619
51 Ga0070689_100000668 3300005340 Bacteria 20748
52 Ga0070689_100088514 3300005340 Bacteria 2437
53 Ga0070689_100127239 3300005340 Bacteria 2040
54 Ga0070691_10014701 3300005341 Bacteria 3592
55 Ga0070687_100000527 3300005343 Bacteria 12848
56 Ga0070687_100038150 3300005343 Bacteria 2406
57 Ga0070687_100228897 3300005343 Bacteria 1143
58 Ga0070692_10001083 3300005345 Bacteria 9454
59 Ga0070692_10014018 3300005345 Bacteria 3752
60 Ga0070668_100003117 3300005347 Bacteria 12247
61 Ga0070669_100224679 3300005353 Bacteria 1486
62 Ga0070675_100002954 3300005354 Bacteria 12826
63 Ga0070675_100020637 3300005354 Bacteria 5257
64 Ga0070675_100366607 3300005354 Bacteria 1280
65 Ga0070671_100003210 3300005355 Bacteria 12748
66 Ga0070671_100026233 3300005355 Bacteria 4787
67 Ga0070671_100038884 3300005355 Bacteria 3949
68 Ga0070671_100052167 3300005355 Bacteria 3401
69 Ga0070671_100172776 3300005355 Bacteria 1828
70 Ga0070674_100009633 3300005356 Bacteria 5793
71 Ga0070673_100001477 3300005364 Bacteria 13763
72 Ga0070673_100008698 3300005364 Bacteria 6770
73 Ga0070673_100222991 3300005364 Bacteria 1632
74 Ga0070688_100001239 3300005365 Bacteria 12735
75 Ga0070688_100012611 3300005365 Bacteria 4738
76 Ga0070688_100017884 3300005365 Bacteria 4077
77 Ga0070688_100069139 3300005365 Bacteria 2254
78 Ga0070688_100073957 3300005365 Bacteria 2187
79 Ga0070659_100023902 3300005366 Bacteria 4681
80 Ga0070659_100233962 3300005366 Bacteria 1519
81 Ga0070667_100022264 3300005367 Bacteria 5258
82 Ga0070667_100089271 3300005367 Bacteria 2648
83 Ga0070709_10019255 3300005434 Bacteria 3944
84 Ga0070709_10234450 3300005434 Bacteria 1315
85 Ga0070714_100074119 3300005435 Bacteria 2950
86 Ga0070713_100029883 3300005436 Bacteria 4321
87 Ga0070713_100071863 3300005436 Bacteria 2925
88 Ga0070713_100251269 3300005436 Bacteria 1613
89 Ga0070710_10069603 3300005437 Bacteria 2025
90 Ga0070701_10070848 3300005438 Bacteria 1863
91 Ga0070711_100025583 3300005439 Bacteria 3864
92 Ga0070711_100064990 3300005439 Bacteria 2550
93 Ga0070705_100001458 3300005440 Bacteria 12507
94 Ga0070700_100001211 3300005441 Bacteria 12787
95 Ga0070700_100002278 3300005441 Bacteria 9750
96 Ga0070694_100001764 3300005444 Bacteria 12786
97 Ga0070694_100107362 3300005444 Bacteria 1984
98 Ga0070708_100036600 3300005445 Bacteria 4281
99 Ga0070663_100065868 3300005455 Bacteria 2623
100 Ga0070663_100198516 3300005455 Bacteria 1564
101 Ga0070678_100000525 3300005456 Bacteria 18583
102 Ga0070678_100114733 3300005456 Bacteria 2114
103 Ga0070662_100002968 3300005457 Bacteria 10539
104 Ga0070662_100029329 3300005457 Bacteria 3839
105 Ga0070662_100233026 3300005457 Bacteria 1474
106 Ga0070681_10102104 3300005458 Bacteria 2813
107 Ga0068867_100002950 3300005459 Bacteria 11984
108 Ga0068867_100003711 3300005459 Bacteria 10742
109 Ga0070685_10003505 3300005466 Bacteria 7982
110 Ga0070685_10143393 3300005466 Bacteria 1506
111 Ga0070706_100290798 3300005467 Bacteria 1525
112 Ga0070679_100015045 3300005530 Bacteria 7434
113 Ga0070679_100034800 3300005530 Bacteria 4995
114 Ga0070679_100487804 3300005530 Bacteria 1176
115 Ga0070684_100020944 3300005535 Bacteria 5429
116 Ga0070684_100052856 3300005535 Bacteria 3534
117 Ga0070684_100095217 3300005535 Bacteria 2652
118 Ga0068853_100045084 3300005539 Bacteria 3776
119 Ga0070672_100006952 3300005543 Bacteria 7653
120 Ga0070686_100001573 3300005544 Bacteria 12811
121 Ga0070686_100068268 3300005544 Bacteria 2318
122 Ga0070696_100030640 3300005546 Bacteria 3685
123 Ga0070693_100000880 3300005547 Bacteria 13363
124 Ga0070665_100056009 3300005548 Bacteria 3954
125 Ga0070665_100146697 3300005548 Bacteria 2362
126 Ga0070665_100175390 3300005548 Bacteria 2144
127 Ga0070665_101130573 3300005548 Bacteria 794
128 Ga0070704_100001917 3300005549 Bacteria 11493
129 Ga0070704_100104467 3300005549 Bacteria 2142
130 Ga0068855_100592098 3300005563 Bacteria 1197
131 Ga0070664_100002934 3300005564 Bacteria 13792
132 Ga0070664_100014397 3300005564 Bacteria 6450
133 Ga0070664_100153442 3300005564 Bacteria 2034
134 Ga0070664_100180771 3300005564 Bacteria 1874
135 Ga0068857_100000358 3300005577 Bacteria 31869
136 Ga0068857_100376240 3300005577 Bacteria 1318
137 Ga0068854_100008663 3300005578 Bacteria 6548
138 Ga0068854_100275369 3300005578 Bacteria 1353
139 Ga0068856_100065255 3300005614 Bacteria 3597
140 Ga0068856_100119127 3300005614 Bacteria 2641
141 Ga0068856_100156786 3300005614 Bacteria 2287
142 Ga0070702_100013601 3300005615 Bacteria 4112
143 Ga0068852_100021772 3300005616 Bacteria 5127
144 Ga0068859_100005591 3300005617 Bacteria 12805
145 Ga0068859_100018152 3300005617 Bacteria 7070
146 Ga0068859_100310219 3300005617 Bacteria 1671
147 Ga0068864_100001988 3300005618 Bacteria 16835
148 Ga0068864_100044813 3300005618 Bacteria 3793
149 Ga0068866_10048931 3300005718 Bacteria 2139
150 Ga0068861_100001805 3300005719 Bacteria 13785
151 Ga0068861_100028834 3300005719 Bacteria 4053
152 Ga0068870_10000025 3300005840 Bacteria 46848
153 Ga0068870_10008401 3300005840 Bacteria 4643
154 Ga0068863_100002964 3300005841 Bacteria 16783
155 Ga0068863_100003083 3300005841 Bacteria 16468
156 Ga0068858_100003227 3300005842 Bacteria 16273
157 Ga0068858_100026853 3300005842 Bacteria 5348
158 Ga0068858_100432981 3300005842 Bacteria 1266
159 Ga0068858_100558164 3300005842 Bacteria 1109
160 Ga0068860_100013320 3300005843 Bacteria 8062
161 Ga0068860_100588190 3300005843 Bacteria 1118
162 Ga0068862_100243383 3300005844 Bacteria 1636
163 Ga0081455_10000276 3300005937 Bacteria 68055
164 Ga0081455_10002463 3300005937 Bacteria 22024
165 Ga0081455_10023997 3300005937 Bacteria 5660
166 Ga0081455_10030467 3300005937 Bacteria 4899
167 Ga0081540_1003744 3300005983 Bacteria 11917
168 Ga0081540_1039896 3300005983 Bacteria 2455
169 Ga0070717_10071648 3300006028 Bacteria 2892
170 Ga0070717_10148248 3300006028 Bacteria 2028
171 Ga0070717_10506230 3300006028 Bacteria 1092
172 Ga0075365_10084204 3300006038 Bacteria 2158
173 Ga0075368_10013700 3300006042 Bacteria 2981
174 Ga0075368_10028565 3300006042 Bacteria 2155
175 Ga0075368_10037514 3300006042 Bacteria 1895
176 Ga0075364_10088279 3300006051 Bacteria 2056
177 Ga0075364_10094554 3300006051 Bacteria 1986
178 Ga0070715_10094663 3300006163 Bacteria 1381
179 Ga0070715_10165699 3300006163 Bacteria 1096
180 Ga0070712_100033595 3300006175 Bacteria 3472
181 Ga0070712_100100946 3300006175 Bacteria 2133
182 Ga0070712_100230769 3300006175 Bacteria 1470
183 Ga0075362_10022833 3300006177 Bacteria 2640
184 Ga0075362_10158854 3300006177 Bacteria 1087
185 Ga0075367_10079141 3300006178 Bacteria 1986
186 Ga0075367_10156249 3300006178 Bacteria 1417
187 Ga0097621_100000456 3300006237 Bacteria 28666
188 Ga0097621_100037929 3300006237 Bacteria 3865
189 Ga0097621_100052081 3300006237 Bacteria 3333
190 Ga0075370_10058511 3300006353 Bacteria 2192
191 Ga0068871_100004245 3300006358 Bacteria 9933
192 Ga0068871_100020804 3300006358 Bacteria 5032
193 Ga0068871_100024937 3300006358 Bacteria 4645
194 Ga0075428_100268105 3300006844 Bacteria 1837
195 Ga0075430_100042214 3300006846 Bacteria 3857
196 Ga0075430_100236559 3300006846 Bacteria 1514
197 Ga0075431_100094786 3300006847 Bacteria 3081
198 Ga0075431_100173127 3300006847 Bacteria 2218
199 Ga0075433_10247616 3300006852 Bacteria 1581
200 Ga0075434_100004861 3300006871 Bacteria 12175
201 Ga0075434_100105570 3300006871 Bacteria 2827
202 Ga0075434_100143730 3300006871 Bacteria 2406
203 Ga0075429_100572698 3300006880 Bacteria 989
204 Ga0075429_100607676 3300006880 Bacteria 958
205 Ga0068865_100019723 3300006881 Bacteria 4366
206 Ga0097620_100005590 3300006931 Bacteria 12805
207 Ga0097620_100018152 3300006931 Bacteria 7070
208 Ga0097620_100310218 3300006931 Bacteria 1671
209 Ga0075435_100050168 3300007076 Bacteria 3358
210 Ga0075435_100079258 3300007076 Bacteria 2695
211 Ga0099795_10005314 3300007788 Bacteria 3412
212 Ga0105244_10032578 3300009036 Bacteria 2757
213 Ga0105250_10089502 3300009092 Bacteria 1251
214 Ga0105240_10111998 3300009093 Bacteria 3300
215 Ga0105240_10230582 3300009093 Bacteria 2152
216 Ga0111539_10003331 3300009094 Bacteria 21223
217 Ga0111539_10007321 3300009094 Bacteria 14133
218 Ga0105245_10000183 3300009098 Bacteria 59105
219 Ga0105245_10038415 3300009098 Bacteria 4259
220 Ga0105245_10130624 3300009098 Bacteria 2356
221 Ga0105245_10224069 3300009098 Bacteria 1816
222 Ga0105247_10009563 3300009101 Bacteria 5882
223 Ga0105247_10012907 3300009101 Bacteria 5011
224 Ga0105247_10019428 3300009101 Bacteria 4079
225 Ga0114129_10001218 3300009147 Bacteria 34180
226 Ga0114129_10143612 3300009147 Bacteria 3270
227 Ga0114129_10271211 3300009147 Bacteria 2270
228 Ga0105243_10001561 3300009148 Bacteria 20018
229 Ga0105241_10003567 3300009174 Bacteria 11569
230 Ga0105242_10000701 3300009176 Bacteria 26184
231 Ga0105242_10081550 3300009176 Bacteria 2705
232 Ga0105248_10010394 3300009177 Bacteria 10250
233 Ga0105248_10039630 3300009177 Bacteria 5279
234 Ga0105248_10150227 3300009177 Bacteria 2628
235 Ga0105248_10438683 3300009177 Bacteria 1471
236 Ga0105248_10554388 3300009177 Bacteria 1297
237 Ga0105237_10081640 3300009545 Bacteria 3224
238 Ga0105237_10369590 3300009545 Bacteria 1439
239 Ga0105238_10137275 3300009551 Bacteria 2423
240 Ga0105238_10198677 3300009551 Bacteria 1980
241 Ga0105238_10237032 3300009551 Bacteria 1802
242 Ga0105238_10288067 3300009551 Bacteria 1624
243 Ga0105249_10061656 3300009553 Bacteria 3442
244 Ga0105249_10135144 3300009553 Bacteria 2359
245 Ga0099796_10001281 3300010159 Bacteria 4957
246 Ga0099796_10095590 3300010159 Bacteria 1110
247 Ga0105239_10007315 3300010375 Bacteria 12675
248 Ga0105239_10075680 3300010375 Bacteria 3702
249 Ga0105239_10109477 3300010375 Bacteria 3062
250 Ga0105239_10124653 3300010375 Bacteria 2862
251 Ga0105239_10222955 3300010375 Bacteria 2115
252 Ga0105239_10733186 3300010375 Bacteria 1131
253 Ga0105246_10040206 3300011119 Bacteria 3155
254 Ga0157313_1001654 3300012503 Bacteria 1236
255 Ga0157338_1001595 3300012515 Bacteria 1651
256 Ga0157371_10089641 3300013102 Bacteria 2178
257 Ga0157371_10198437 3300013102 Bacteria 1438
258 Ga0157369_10182437 3300013105 Bacteria 2208
259 Ga0157369_10354496 3300013105 Bacteria 1524
260 Ga0157374_10000463 3300013296 Bacteria 36848
261 Ga0157374_10005521 3300013296 Bacteria 10633
262 Ga0157374_10113975 3300013296 Bacteria 2602
263 Ga0157378_10000613 3300013297 Bacteria 33512
264 Ga0157378_10078613 3300013297 Bacteria 2976
265 Ga0157378_10317747 3300013297 Bacteria 1512
266 Ga0163162_10005908 3300013306 Bacteria 11842
267 Ga0163162_10112257 3300013306 Bacteria 2824
268 Ga0163162_10320702 3300013306 Bacteria 1682
269 Ga0157375_10004786 3300013308 Bacteria 11768
270 Ga0157375_10076811 3300013308 Bacteria 3368
271 Ga0157375_10514386 3300013308 Bacteria 1361
272 Ga0163163_10001239 3300014325 Bacteria 21547
273 Ga0163163_10025813 3300014325 Bacteria 5604
274 Ga0163163_10096112 3300014325 Bacteria 2983
275 Ga0163163_10323863 3300014325 Bacteria 1595
276 Ga0157380_10004641 3300014326 Bacteria 9554
277 Ga0157377_10001711 3300014745 Bacteria 9575
278 Ga0157377_10021447 3300014745 Bacteria 3398
279 Ga0157379_10003902 3300014968 Bacteria 12714
280 Ga0157379_10004577 3300014968 Bacteria 11866
281 Ga0157379_10033161 3300014968 Bacteria 4605
282 Ga0157376_10003730 3300014969 Bacteria 10526
283 Ga0157376_10028988 3300014969 Bacteria 4407
284 Ga0157376_10046136 3300014969 Bacteria 3592
285 Ga0163161_10001492 3300017792 Bacteria 17279
286 Ga0206353_11182671 3300020082 Bacteria 1787
287 Ga0213876_10076060 3300021384 Bacteria 1773
288 Ga0213876_10164681 3300021384 Bacteria 1180
289 Ga0213875_10000011 3300021388 Bacteria 332447
290 Ga0207666_1000140 3300025271 Bacteria 11329
291 Ga0207673_1000714 3300025290 Bacteria 3557
292 Ga0207682_10000062 3300025893 Bacteria 46841
293 Ga0207692_10224337 3300025898 Bacteria 1115
294 Ga0207710_10004068 3300025900 Bacteria 6431
295 Ga0207710_10016736 3300025900 Bacteria 3104
296 Ga0207710_10024743 3300025900 Bacteria 2588
297 Ga0207710_10264788 3300025900 Bacteria 862
298 Ga0207688_10001290 3300025901 Bacteria 12987
299 Ga0207680_10005019 3300025903 Bacteria 6305
300 Ga0207680_10155059 3300025903 Bacteria 1530
301 Ga0207647_10003504 3300025904 Bacteria 11767
302 Ga0207647_10017409 3300025904 Bacteria 4884
303 Ga0207685_10058088 3300025905 Bacteria 1521
304 Ga0207685_10125361 3300025905 Bacteria 1133
305 Ga0207699_10115923 3300025906 Bacteria 1724
306 Ga0207699_10157162 3300025906 Bacteria 1510
307 Ga0207645_10000248 3300025907 Bacteria 44949
308 Ga0207645_10049727 3300025907 Bacteria 2677
309 Ga0207645_10094260 3300025907 Bacteria 1927
310 Ga0207643_10000064 3300025908 Bacteria 70490
311 Ga0207643_10009464 3300025908 Bacteria 5233
312 Ga0207654_10001623 3300025911 Bacteria 11742
313 Ga0207654_10140118 3300025911 Bacteria 1541
314 Ga0207671_10007347 3300025914 Bacteria 9567
315 Ga0207671_10116264 3300025914 Bacteria 2040
316 Ga0207693_10028571 3300025915 Bacteria 4407
317 Ga0207693_10030951 3300025915 Bacteria 4227
318 Ga0207693_10039913 3300025915 Bacteria 3696
319 Ga0207693_10147608 3300025915 Bacteria 1849
320 Ga0207663_10014105 3300025916 Bacteria 4366
321 Ga0207663_10018380 3300025916 Bacteria 3918
322 Ga0207663_10050733 3300025916 Bacteria 2580
323 Ga0207660_10000194 3300025917 Bacteria 38742
324 Ga0207662_10004066 3300025918 Bacteria 7635
325 Ga0207657_10006919 3300025919 Bacteria 11695
326 Ga0207657_10033938 3300025919 Bacteria 4595
327 Ga0207649_10000234 3300025920 Bacteria 45397
328 Ga0207652_10001613 3300025921 Bacteria 19823
329 Ga0207646_10560944 3300025922 Bacteria 1026
330 Ga0207681_10000794 3300025923 Bacteria 20828
331 Ga0207681_10013919 3300025923 Bacteria 4984
332 Ga0207694_10733360 3300025924 Bacteria 834
333 Ga0207650_10009594 3300025925 Bacteria 6619
334 Ga0207650_10021193 3300025925 Bacteria 4595
335 Ga0207650_10056285 3300025925 Bacteria 2922
336 Ga0207659_10000172 3300025926 Bacteria 38725
337 Ga0207659_10005666 3300025926 Bacteria 7599
338 Ga0207687_10008699 3300025927 Bacteria 6631
339 Ga0207687_10024271 3300025927 Bacteria 4049
340 Ga0207687_10056318 3300025927 Bacteria 2758
341 Ga0207700_10148256 3300025928 Bacteria 1936
342 Ga0207664_10021143 3300025929 Bacteria 4833
343 Ga0207664_10113715 3300025929 Bacteria 2254
344 Ga0207664_10766688 3300025929 Bacteria 868
345 Ga0207644_10000439 3300025931 Bacteria 26923
346 Ga0207644_10024988 3300025931 Bacteria 4104
347 Ga0207644_10060993 3300025931 Bacteria 2730
348 Ga0207644_10075967 3300025931 Bacteria 2470
349 Ga0207690_10000796 3300025932 Bacteria 20342
350 Ga0207690_10025613 3300025932 Bacteria 3706
351 Ga0207706_10004291 3300025933 Bacteria 13400
352 Ga0207706_10005059 3300025933 Bacteria 12314
353 Ga0207686_10001093 3300025934 Bacteria 15891
354 Ga0207686_10044339 3300025934 Bacteria 2730
355 Ga0207686_10117395 3300025934 Bacteria 1805
356 Ga0207709_10001438 3300025935 Bacteria 16619
357 Ga0207709_10043780 3300025935 Bacteria 2701
358 Ga0207670_10000807 3300025936 Bacteria 16336
359 Ga0207670_10030728 3300025936 Bacteria 3433
360 Ga0207670_10104223 3300025936 Bacteria 2031
361 Ga0207670_10104583 3300025936 Bacteria 2028
362 Ga0207669_10000141 3300025937 Bacteria 34618
363 Ga0207669_10010680 3300025937 Bacteria 4430
364 Ga0207704_10000755 3300025938 Bacteria 14264
365 Ga0207704_10004770 3300025938 Bacteria 6225
366 Ga0207704_10487023 3300025938 Bacteria 991
367 Ga0207665_10203496 3300025939 Bacteria 1443
368 Ga0207665_10395219 3300025939 Bacteria 1052
369 Ga0207711_10006747 3300025941 Bacteria 9652
370 Ga0207711_10071197 3300025941 Bacteria 3017
371 Ga0207711_10461921 3300025941 Bacteria 1182
372 Ga0207689_10004430 3300025942 Bacteria 12738
373 Ga0207689_10029667 3300025942 Bacteria 4565
374 Ga0207661_10000098 3300025944 Bacteria 55518
375 Ga0207679_10000174 3300025945 Bacteria 53051
376 Ga0207679_10073705 3300025945 Bacteria 2584
377 Ga0207679_10166636 3300025945 Bacteria 1810
378 Ga0207651_10000782 3300025960 Bacteria 13684
379 Ga0207651_10011899 3300025960 Bacteria 4891
380 Ga0207651_10027084 3300025960 Bacteria 3595
381 Ga0207712_10000659 3300025961 Bacteria 26800
382 Ga0207712_10067484 3300025961 Bacteria 2560
383 Ga0207712_10781975 3300025961 Bacteria 838
384 Ga0207668_10001107 3300025972 Bacteria 16030
385 Ga0207668_10015312 3300025972 Bacteria 4761
386 Ga0207640_10000846 3300025981 Bacteria 17376
387 Ga0207640_10062755 3300025981 Bacteria 2467
388 Ga0207658_10186912 3300025986 Bacteria 1719
389 Ga0207677_10031190 3300026023 Bacteria 3412
390 Ga0207677_10337358 3300026023 Bacteria 1258
391 Ga0207703_10002433 3300026035 Bacteria 16135
392 Ga0207703_10010252 3300026035 Bacteria 7340
393 Ga0207703_10355064 3300026035 Bacteria 1351
394 Ga0207639_10249017 3300026041 Bacteria 1548
395 Ga0207678_10001059 3300026067 Bacteria 25176
396 Ga0207678_10236838 3300026067 Bacteria 1563
397 Ga0207708_10002793 3300026075 Bacteria 12833
398 Ga0207708_10006968 3300026075 Bacteria 8358
399 Ga0207702_10089635 3300026078 Bacteria 2690
400 Ga0207702_10241850 3300026078 Bacteria 1691
401 Ga0207641_10000622 3300026088 Bacteria 38657
402 Ga0207641_10020383 3300026088 Bacteria 5445
403 Ga0207648_10002750 3300026089 Bacteria 18697
404 Ga0207648_10031513 3300026089 Bacteria 4688
405 Ga0207648_10118031 3300026089 Bacteria 2331
406 Ga0207676_10002696 3300026095 Bacteria 12630
407 Ga0207676_10006905 3300026095 Bacteria 8046
408 Ga0207674_10001342 3300026116 Bacteria 31848
409 Ga0207674_10312762 3300026116 Bacteria 1520
410 Ga0207674_10365561 3300026116 Bacteria 1395
411 Ga0207675_100110796 3300026118 Bacteria 2590
412 Ga0207683_10001193 3300026121 Bacteria 23509
413 Ga0207683_10031134 3300026121 Bacteria 4629
414 Ga0207683_10039243 3300026121 Bacteria 4130
415 Ga0207698_10016429 3300026142 Bacteria 4988
416 Ga0207698_10340025 3300026142 Bacteria 1413
417 Ga0209589_1000017 3300027357 Bacteria 215546
418 Ga0209489_100018 3300027361 Bacteria 215546
419 Ga0209700_100028 3300027363 Bacteria 215546
420 Ga0209179_1016890 3300027512 Bacteria 1374
421 Ga0209999_1006731 3300027543 Bacteria 2068
422 Ga0209970_1007996 3300027614 Bacteria 1736
423 Ga0210002_1021945 3300027617 Bacteria 1034
424 Ga0209983_1024340 3300027665 Bacteria 1274
425 Ga0209971_1000957 3300027682 Bacteria 7413
426 Ga0209966_1008911 3300027695 Bacteria 1787
427 Ga0207428_10000513 3300027907 Bacteria 46311
428 Ga0207428_10000626 3300027907 Bacteria 41522
429 Ga0207428_10001020 3300027907 Bacteria 31018
430 Ga0207428_10202037 3300027907 Bacteria 1495
431 Ga0207428_10236088 3300027907 Bacteria 1367
432 Ga0268266_10071484 3300028379 Bacteria 3007
433 Ga0268266_10174688 3300028379 Bacteria 1952
434 Ga0268265_10002370 3300028380 Bacteria 14256
435 Ga0268265_10144309 3300028380 Bacteria 1997
436 Ga0268264_10004444 3300028381 Bacteria 11961
437 Ga0268264_10021393 3300028381 Bacteria 5282
438 Ga0265339_10054727 3300031249 Bacteria 2166
439 Ga0265313_10018002 3300031595 Bacteria 3985
440 Ga0265314_10006316 3300031711 Bacteria 10511
441 Ga0373930_0000172 3300034816 Bacteria 7575
442 Ga0373930_0043872 3300034816 Bacteria 960
443 Ga0373948_0000049 3300034817 Bacteria 12986
444 Ga0373958_0004863 3300034819 Bacteria 2010
445 Ga0373959_0004938 3300034820 Bacteria 2173
446 Ga0373938_0000119 3300034957 Bacteria 10987
447 Ga0373938_0004504 3300034957 Bacteria 2331
448 Ga0373926_0031660 3300035083 Bacteria 1866
449 Ga0373926_0044087 3300035083 Bacteria 1597
450 Ga0373926_0059986 3300035083 Bacteria 1385
451 Ga0373928_0000148 3300035084 Bacteria 13499
452 Ga0373929_0001447 3300035085 Bacteria 4530
453 Ga0373934_0005597 3300035086 Bacteria 4652
454 Ga0373934_0011264 3300035086 Bacteria 3365
455 Ga0373940_0001153 3300035088 Bacteria 4629
456 Ga0373949_0000443 3300035090 Bacteria 14272
457 Ga0373949_0005247 3300035090 Bacteria 2900
458 Ga0373951_0000403 3300035091 Bacteria 12758
459 Ga0373952_0002943 3300035092 Bacteria 3074
460 Ga0373923_0003390 3300035111 Bacteria 5101
461 Ga0373923_0052325 3300035111 Bacteria 1715
462 Ga0373923_0061558 3300035111 Bacteria 1595
463 Ga0373923_0076444 3300035111 Bacteria 1446
464 Ga0373932_0000822 3300035112 Bacteria 9175
465 Ga0373936_0013078 3300035113 Bacteria 3166
466 Ga0373936_0088512 3300035113 Bacteria 1296
467 Ga0373939_0001066 3300035114 Bacteria 6756
468 Ga0373941_0000259 3300035115 Bacteria 10177
469 Ga0373941_0016607 3300035115 Bacteria 2004
470 Ga0373945_0129330 3300035116 Bacteria 1010
471 Ga0373953_0000832 3300035117 Bacteria 8634
472 Ga0373953_0001693 3300035117 Bacteria 6486
473 Ga0373953_0193681 3300035117 Bacteria 878
474 Ga0373954_0006437 3300035118 Bacteria 5121
475 Ga0373954_0012278 3300035118 Bacteria 3807
476 Ga0373954_0012732 3300035118 Bacteria 3744
477 Ga0373954_0127673 3300035118 Bacteria 1237
478 Ga0373956_0002668 3300035119 Bacteria 7215
479 Ga0373957_0046077 3300035120 Bacteria 1654
480 Ga0373960_0000277 3300035121 Bacteria 9832
481 Ga0373960_0003722 3300035121 Bacteria 3465
482 Ga0373943_0002631 3300035170 Bacteria 8167
483 Ga0373943_0012624 3300035170 Bacteria 3807
484 Ga0373943_0015417 3300035170 Bacteria 3471
485 Ga0373943_0035562 3300035170 Bacteria 2381
486 Ga0373943_0194294 3300035170 Bacteria 1121
487 Ga0373946_0002013 3300035171 Bacteria 7119
488 Ga0373946_0028788 3300035171 Bacteria 2206
489 Ga0373946_0034727 3300035171 Bacteria 2037
490 Ga0373955_0000084 3300035172 Bacteria 38310
491 Ga0373955_0002931 3300035172 Bacteria 7483
492 Ga0373955_0003085 3300035172 Bacteria 7290
493 Ga0373942_0001742 3300035207 Bacteria 5518
494 Ga0373942_0003780 3300035207 Bacteria 3543
495 Ga0373961_0008049 3300035241 Bacteria 2559
496 Ga0373962_0005737 3300035242 Bacteria 2998
497 Ga0373924_0000855 3300035410 Bacteria 9580
498 Ga0373924_0010074 3300035410 Bacteria 3480
499 Ga0373924_0015332 3300035410 Bacteria 2913
500 Ga0373924_0142968 3300035410 Bacteria 1044
501 Ga0373931_0020016 3300035691 Bacteria 3345
502 Ga0373931_0044941 3300035691 Bacteria 2330
503 Ga0373935_0000285 3300035692 Bacteria 24974
504 Ga0373935_0041739 3300035692 Bacteria 2883
505 Ga0373935_0053048 3300035692 Bacteria 2579
506 Ga0373935_0056303 3300035692 Bacteria 2507
507 Ga0373935_0089396 3300035692 Bacteria 2014
508 Ga0373935_0276952 3300035692 Bacteria 1180
509 Ga0373927_0046507 3300035695 Bacteria 2807
510 Ga0373927_0065939 3300035695 Bacteria 2341
511 Ga0373927_0116718 3300035695 Bacteria 1741
512 Ga0373933_0001174 3300035724 Bacteria 15531
513 Ga0373933_0003452 3300035724 Bacteria 8794
514 Ga0373933_0011554 3300035724 Bacteria 4872
515 Ga0373947_0013785 3300035725 Bacteria 4634
516 Ga0373947_0029806 3300035725 Bacteria 3203
517 Ga0373947_0040236 3300035725 Bacteria 2784
518 Ga0373947_0069276 3300035725 Bacteria 2159
519 Ga0373947_0099621 3300035725 Bacteria 1824
520 Ga0373937_0000006 3300036401 Bacteria 194781
521 Ga0373937_0000887 3300036401 Bacteria 25651
522 Ga0373937_0004926 3300036401 Bacteria 11347
523 Ga0373937_0016095 3300036401 Bacteria 6634
524 Ga0373925_0000002 3300037068 Bacteria 368879
525 Ga0373925_0113397 3300037068 Bacteria 2096
526 Ga0395899_0006286 3300037312 Bacteria 9196
527 Ga0395899_0161232 3300037312 Bacteria 1584
528 Ga0395900_0004809 3300037418 Bacteria 14227
529 Ga0395898_0002323 3300037466 Bacteria 22720
530 Ga0395898_0015089 3300037466 Bacteria 7930
531 Ga0395898_0069464 3300037466 Bacteria 3408
532 Ga0436364_0728139 3300037853 Bacteria 64829
533 Ga0436364_0828220 3300037853 Bacteria 1584
534 Ga0436364_0840315 3300037853 Bacteria 2204
535 Ga0436364_1112770 3300037853 Bacteria 981
536 Ga0436364_1478908 3300037853 Bacteria 3559
537 Ga0395901_0042160 3300038443 Bacteria 4731
538 Ga0395901_0098476 3300038443 Bacteria 3066
539 Ga0242420_029371 3300038996 Bacteria 1014
540 Ga0436365_0229718 3300039437 Bacteria 2717
541 Ga0436365_0560971 3300039437 Bacteria 2412
542 Ga0436365_1263360 3300039437 Bacteria 4996
543 Ga0436365_1905431 3300039437 Bacteria 904
544 Ga0436361_0074879 3300039447 Bacteria 1455
545 Ga0436362_1216740 3300039453 Bacteria 911
546 Ga0439453_0006113 3300041408 Bacteria 1862
547 Ga0439450_004177 3300042008 Bacteria 2449
548 Ga0439455_0047916 3300042012 Bacteria 1110
549 Ga0439464_0019328 3300042439 Bacteria 1859
550 Ga0439460_0036225 3300042461 Bacteria 1430
551 Ga0439460_0083476 3300042461 Bacteria 1006
552 Ga0466963_0032994 3300044694 Bacteria 3357
553 Ga0466963_0120790 3300044694 Bacteria 1803
554 Ga0453684_0067523 3300044712 Bacteria 4547
555 Ga0466971_0221586 3300044719 Bacteria 897
556 Ga0466958_0114627 3300045836 Bacteria 1684
557 Ga0466967_0093846 3300045976 Bacteria 2731
558 Ga0495592_0000039 3300046454 Bacteria 124471
559 Ga0495592_0012894 3300046454 Bacteria 6353
560 Ga0495592_0220152 3300046454 Bacteria 1270
561 Ga0495592_0286490 3300046454 Bacteria 1075
562 Ga0495603_0008468 3300046455 Bacteria 6212
563 Ga0495629_0014928 3300046459 Bacteria 5582
564 Ga0495629_0096408 3300046459 Bacteria 2063
565 Ga0495641_0051382 3300046461 Bacteria 1882
566 Ga0495641_0055219 3300046461 Bacteria 1803
567 Ga0495651_0000419 3300046462 Bacteria 32901
568 Ga0495651_0002460 3300046462 Bacteria 14317
569 Ga0495651_0016376 3300046462 Bacteria 5741
570 Ga0495653_0000006 3300046463 Bacteria 363285
571 Ga0495653_0006076 3300046463 Bacteria 9893
572 Ga0495653_0033111 3300046463 Bacteria 4096
573 Ga0495580_0112900 3300046472 Bacteria 1887
574 Ga0495580_0132656 3300046472 Bacteria 1727
575 Ga0495580_0200598 3300046472 Bacteria 1374
576 Ga0495582_0024567 3300046473 Bacteria 3298
577 Ga0495582_0141623 3300046473 Bacteria 1363
578 Ga0495639_0089627 3300046475 Bacteria 1441
579 Ga0495639_0093452 3300046475 Bacteria 1413
580 Ga0495662_0000905 3300046476 Bacteria 14495
581 Ga0495662_0021205 3300046476 Bacteria 3142
582 Ga0495662_0029468 3300046476 Bacteria 2651
583 Ga0495662_0047662 3300046476 Bacteria 2069
584 Ga0495664_0000002 3300046477 Bacteria 625183
585 Ga0495664_0079552 3300046477 Bacteria 1964
586 Ga0495584_0002534 3300046491 Bacteria 10334
587 Ga0495584_0039375 3300046491 Bacteria 2388
588 Ga0495584_0051186 3300046491 Bacteria 2080
589 Ga0495585_0000546 3300046492 Bacteria 35582
590 Ga0495607_0002967 3300046501 Bacteria 13310
591 Ga0495608_0000009 3300046511 Bacteria 266614
592 Ga0495608_0000557 3300046511 Bacteria 25706
593 Ga0495608_0003247 3300046511 Bacteria 11627
594 Ga0495608_0019871 3300046511 Bacteria 4619
595 Ga0495618_0000005 3300046514 Bacteria 230421
596 Ga0495618_0022293 3300046514 Bacteria 3911
597 Ga0495618_0110801 3300046514 Bacteria 1757
598 Ga0495628_0000002 3300046516 Bacteria 589399
599 Ga0495628_0064458 3300046516 Bacteria 2868
600 Ga0495630_0001565 3300046517 Bacteria 15914
601 Ga0495630_0014783 3300046517 Bacteria 5692
602 Ga0495630_0129073 3300046517 Bacteria 1919
603 Ga0495630_0129581 3300046517 Bacteria 1915
604 Ga0495630_0400518 3300046517 Bacteria 1051
605 Ga0495630_0609976 3300046517 Bacteria 836
606 Ga0495637_0040739 3300046520 Bacteria 1998
607 Ga0495652_0000004 3300046529 Bacteria 588877
608 Ga0495652_0004247 3300046529 Bacteria 13763
609 Ga0495652_0181958 3300046529 Bacteria 1612
610 Ga0495652_0427069 3300046529 Bacteria 932
611 Ga0495665_0025722 3300046531 Bacteria 3160
612 Ga0495665_0094704 3300046531 Bacteria 1568
613 Ga0495665_0175419 3300046531 Bacteria 1115
614 Ga0495640_0000005 3300046533 Bacteria 318271
615 Ga0495640_0004068 3300046533 Bacteria 11704
616 Ga0495640_0006625 3300046533 Bacteria 9136
617 Ga0495640_0221237 3300046533 Bacteria 1194
618 Ga0495640_0377545 3300046533 Bacteria 872
619 Ga0495586_0006325 3300046535 Bacteria 6327
620 Ga0495586_0013094 3300046535 Bacteria 4396
621 Ga0495587_0000007 3300046536 Bacteria 290788
622 Ga0495587_0000884 3300046536 Bacteria 19811
623 Ga0495587_0004155 3300046536 Bacteria 9581
624 Ga0495587_0038364 3300046536 Bacteria 2873
625 Ga0495598_0011961 3300046537 Bacteria 2116
626 Ga0495645_0000003 3300046543 Bacteria 570133
627 Ga0495645_0002731 3300046543 Bacteria 11976
628 Ga0495645_0008028 3300046543 Bacteria 7350
629 Ga0495645_0052708 3300046543 Bacteria 2959
630 Ga0495633_0203445 3300046558 Bacteria 908
631 Ga0495667_0000002 3300046559 Bacteria 437535
632 Ga0495667_0001476 3300046559 Bacteria 15495
633 Ga0495667_0002899 3300046559 Bacteria 11503
634 Ga0495667_0011622 3300046559 Bacteria 5961
635 Ga0495656_0063131 3300046615 Bacteria 1622
636 Ga0495634_0000022 3300046642 Bacteria 118988
637 Ga0495634_0000880 3300046642 Bacteria 28844
638 Ga0495634_0018294 3300046642 Bacteria 4990
639 Ga0495634_0033896 3300046642 Bacteria 3505
640 Ga0495611_0024465 3300046648 Bacteria 2627
641 Ga0495635_0000020 3300046663 Bacteria 189698
642 Ga0495635_0007077 3300046663 Bacteria 7843
643 Ga0495635_0153782 3300046663 Bacteria 1566
644 Ga0495659_0000633 3300046664 Bacteria 12802
645 Ga0495659_0042944 3300046664 Bacteria 1620
646 Ga0495657_0000435 3300046675 Bacteria 38963
647 Ga0495657_0006177 3300046675 Bacteria 9391
648 Ga0495599_0000001 3300046678 Bacteria 537563
649 Ga0495599_0003181 3300046678 Bacteria 9567
650 Ga0495599_0020964 3300046678 Bacteria 4074
651 Ga0495623_0000001 3300046679 Bacteria 313861
652 Ga0495623_0001616 3300046679 Bacteria 15135
653 Ga0495623_0004039 3300046679 Bacteria 9663
654 Ga0495646_0000014 3300046680 Bacteria 143781
655 Ga0495646_0001738 3300046680 Bacteria 13068
656 Ga0495646_0005955 3300046680 Bacteria 7729
657 Ga0495647_0176918 3300046681 Bacteria 927
658 Ga0495658_0191340 3300046683 Bacteria 1272
659 Ga0495658_0524663 3300046683 Bacteria 758
660 Ga0495669_0082759 3300046684 Bacteria 1475
661 Ga0495613_0044676 3300046689 Bacteria 3276
662 Ga0495613_0064793 3300046689 Bacteria 2672
663 Ga0495613_0113546 3300046689 Bacteria 1950
664 Ga0495624_0010998 3300046690 Bacteria 6232
665 Ga0495624_0051510 3300046690 Bacteria 2604
666 Ga0495624_0065820 3300046690 Bacteria 2263
667 Ga0495624_0116189 3300046690 Bacteria 1644
668 Ga0495670_0034778 3300046691 Bacteria 2511
669 Ga0495670_0152633 3300046691 Bacteria 1211
670 Ga0495671_0057604 3300046692 Bacteria 1923
671 Ga0495649_0168163 3300046694 Bacteria 1148
672 Ga0495589_0006699 3300046794 Bacteria 6067
673 Ga0495589_0140245 3300046794 Bacteria 1158
674 Ga0495600_0000006 3300046809 Bacteria 151916
675 Ga0495600_0001126 3300046809 Bacteria 14581
676 Ga0495600_0061021 3300046809 Bacteria 2462
677 Ga0495600_0080530 3300046809 Bacteria 2126
678 Ga0495581_0013446 3300047315 Bacteria 4746
679 Ga0495581_0170358 3300047315 Bacteria 1273
680 Ga0495604_0000005 3300047317 Bacteria 424516
681 Ga0495604_0000388 3300047317 Bacteria 39748
682 Ga0495604_0003734 3300047317 Bacteria 12126
683 Ga0495674_0000003 3300047319 Bacteria 562126
684 Ga0495674_0003431 3300047319 Bacteria 15402
685 Ga0495674_0025645 3300047319 Bacteria 5401
686 Ga0495674_0044184 3300047319 Bacteria 3962
687 Ga0495674_0418186 3300047319 Bacteria 1080
688 Ga0495676_0111462 3300047321 Bacteria 2006
689 Ga0495680_0000002 3300047322 Bacteria 197533
690 Ga0495680_0016395 3300047322 Bacteria 6367
691 Ga0495680_0040619 3300047322 Bacteria 3705
692 Ga0495680_0150939 3300047322 Bacteria 1694
693 Ga0495675_0000010 3300047444 Bacteria 153375
694 Ga0495675_0000740 3300047444 Bacteria 20363
695 Ga0495675_0001614 3300047444 Bacteria 13543
696 Ga0495675_0064098 3300047444 Bacteria 2325
697 Ga0495679_080326 3300047446 Bacteria 927
698 Ga0495681_0077249 3300047470 Bacteria 1495
699 Ga0495681_0116549 3300047470 Bacteria 1151
700 Ga0495684_0000028 3300047471 Bacteria 123549
701 Ga0495684_0003551 3300047471 Bacteria 12183
702 Ga0495684_0021577 3300047471 Bacteria 4958
703 Ga0495684_0051579 3300047471 Bacteria 3139
704 Ga0495684_0478386 3300047471 Bacteria 860
705 Ga0495684_0554604 3300047471 Bacteria 782
706 Ga0495593_0001612 3300047673 Bacteria 13339
707 Ga0495593_0004471 3300047673 Bacteria 8308
708 Ga0495593_0169985 3300047673 Bacteria 1099
709 Ga0495602_0000054 3300048088 Bacteria 111411
710 Ga0495602_0002218 3300048088 Bacteria 19614
711 Ga0495602_0011547 3300048088 Bacteria 9127
712 Ga0495602_0040529 3300048088 Bacteria 4268
713 Ga0495614_0090871 3300048089 Bacteria 1328
714 Ga0495614_0151859 3300048089 Bacteria 1033
715 Ga0496100_0000447 3300048903 Bacteria 19924
716 Ga0496100_0017409 3300048903 Bacteria 4241
717 Ga0496100_0024478 3300048903 Bacteria 3683
718 Ga0496100_0047104 3300048903 Bacteria 2776
719 Ga0496100_0225085 3300048903 Bacteria 1378
720 Ga0496101_0012092 3300048904 Bacteria 5752
721 Ga0496101_0053265 3300048904 Bacteria 2918
722 Ga0496102_0002354 3300048905 Bacteria 16125
723 Ga0496102_0014509 3300048905 Bacteria 6845
724 Ga0496102_0040672 3300048905 Bacteria 4206
725 Ga0496103_0000837 3300048906 Bacteria 22480
726 Ga0496103_0007675 3300048906 Bacteria 6415
727 Ga0496104_0035330 3300048907 Bacteria 4666
728 Ga0496104_0062693 3300048907 Bacteria 3525
729 Ga0496104_0642819 3300048907 Bacteria 970
730 Ga0496105_0007075 3300048908 Bacteria 8647
731 Ga0496105_0115477 3300048908 Bacteria 2214
732 Ga0496106_0001351 3300048909 Bacteria 18370
733 Ga0496106_0022736 3300048909 Bacteria 4659
734 Ga0496106_0023808 3300048909 Bacteria 4551
735 Ga0496106_0101982 3300048909 Bacteria 2226
736 Ga0496106_0115921 3300048909 Bacteria 2089
737 Ga0496107_0001211 3300048910 Bacteria 15713
738 Ga0496107_0013175 3300048910 Bacteria 5777
739 Ga0496107_0040023 3300048910 Bacteria 3363
740 Ga0496107_0041357 3300048910 Bacteria 3309
741 Ga0496107_0130955 3300048910 Bacteria 1852
742 Ga0496108_0008033 3300048911 Bacteria 8566
743 Ga0496108_0031743 3300048911 Bacteria 4384
744 Ga0496108_0043391 3300048911 Bacteria 3756
745 Ga0496109_0000188 3300048912 Bacteria 61633
746 Ga0496109_0002868 3300048912 Bacteria 14419
747 Ga0496109_0005044 3300048912 Bacteria 11034
748 Ga0496109_0065905 3300048912 Bacteria 3315
749 Ga0496110_0016529 3300048913 Bacteria 6160
750 Ga0496110_0108269 3300048913 Bacteria 2495
751 Ga0496110_0127504 3300048913 Bacteria 2296
752 Ga0496111_0010895 3300048914 Bacteria 6116
753 Ga0496111_0091948 3300048914 Bacteria 2224
754 Ga0496112_0004798 3300048915 Bacteria 11537
755 Ga0496112_0007486 3300048915 Bacteria 9693
756 Ga0496112_0093926 3300048915 Bacteria 2970
757 Ga0496113_0000496 3300048916 Bacteria 19347
758 Ga0496114_0001734 3300048917 Bacteria 16551
759 Ga0496114_0030068 3300048917 Bacteria 4466
760 Ga0496114_0034378 3300048917 Bacteria 4181
761 Ga0496114_0242151 3300048917 Bacteria 1586
762 Ga0496114_0262248 3300048917 Bacteria 1521
763 Ga0496115_0000592 3300048918 Bacteria 27769
764 Ga0496115_0007067 3300048918 Bacteria 8247
765 Ga0496115_0089728 3300048918 Bacteria 2510
766 Ga0496126_0003899 3300048929 Bacteria 18338
767 Ga0501031_0151647 3300049568 Bacteria 1515
768 Ga0501032_0110350 3300049569 Bacteria 1821
769 Ga0501034_0023811 3300049571 Bacteria 6236
770 Ga0501034_0293529 3300049571 Bacteria 1563
771 Ga0501034_0380635 3300049571 Bacteria 1336
772 Ga0501034_0487164 3300049571 Bacteria 1148
773 Ga0501037_0305979 3300049573 Bacteria 1103
774 Ga0501038_0569430 3300049574 Bacteria 860
775 Ga0501039_0055753 3300049575 Bacteria 3061
776 Ga0501039_0215510 3300049575 Bacteria 1510
777 Ga0501047_0279597 3300049581 Bacteria 1514
778 Ga0501069_0063843 3300049585 Bacteria 2057
779 Ga0501069_0159532 3300049585 Bacteria 1298
780 Ga0501070_0043799 3300049586 Bacteria 3724
781 Ga0501070_0143788 3300049586 Bacteria 1969
782 Ga0501070_0214907 3300049586 Bacteria 1578
783 Ga0501073_0131591 3300049589 Bacteria 1734
784 Ga0501074_0433129 3300049590 Bacteria 933
785 Ga0501075_0250208 3300049591 Bacteria 1351
786 Ga0501076_0050146 3300049592 Bacteria 3302
787 Ga0501080_0201546 3300049742 Bacteria 1827
788 Ga0501083_0030084 3300049744 Bacteria 3731
789 Ga0501035_0031991 3300049822 Bacteria 4790
790 Ga0501044_0259155 3300049823 Bacteria 1678
791 nmdc:mga03n38_82410_c1 3300050490 Bacteria 1514
792 nmdc:mga00v17_119195_c1 3300050491 Bacteria 1679
793 nmdc:mga0yw44_12231_c1 3300050492 Bacteria 4466
794 nmdc:mga0yw44_72984_c2 3300050492 Bacteria 1702
795 nmdc:mga06z11_168572_c1 3300050494 Bacteria 1256
796 nmdc:mga06z11_57924_c1 3300050494 Bacteria 2009
797 nmdc:mga06z11_59561_c1 3300050494 Bacteria 1985
798 nmdc:mga06z11_88037_c1 3300050494 Bacteria 1681
799 nmdc:mga04h51_118721_c1 3300050495 Bacteria 983
800 nmdc:mga07m45_21722_c1 3300050496 Bacteria 3498
801 nmdc:mga07m45_58611_c1 3300050496 Bacteria 2179
802 nmdc:mga05p37_1114_c1 3300050507 Bacteria 30870
803 nmdc:mga05p37_227168_c1 3300050507 Bacteria 2250
804 nmdc:mga05p37_502234_c1 3300050507 Bacteria 1391
805 nmdc:mga09592_1302_c1 3300050508 Bacteria 20054
806 nmdc:mga09592_377475_c1 3300050508 Bacteria 1226
807 nmdc:mga0qj67_30519_c1 3300050509 Bacteria 4198
808 nmdc:mga06r32_102341_c1 3300050510 Bacteria 2812
809 nmdc:mga06r32_314991_c1 3300050510 Bacteria 1550
810 nmdc:mga06r32_506271_c1 3300050510 Bacteria 1184
811 nmdc:mga06r32_533222_c1 3300050510 Bacteria 1149
812 nmdc:mga06r32_839005_c1 3300050510 Bacteria 878
813 nmdc:mga06r32_95767_c1 3300050510 Bacteria 2906
814 nmdc:mga08y16_52239_c1 3300050511 Bacteria 4276
815 nmdc:mga08y16_7407_c1 3300050511 Bacteria 11499
816 nmdc:mga08y16_8501_c1 3300050511 Bacteria 10750
817 nmdc:mga08y16_8959_c1 3300050511 Bacteria 10509
818 nmdc:mga0n895_334522_c1 3300050512 Bacteria 1534
819 nmdc:mga0n895_3698_c1 3300050512 Bacteria 12366
820 nmdc:mga0n895_4199_c1 3300050512 Bacteria 7300
821 nmdc:mga0n895_651_c1 3300050512 Bacteria 24245
822 nmdc:mga0n895_75564_c1 3300050512 Bacteria 3349
823 nmdc:mga0n895_824194_c1 3300050512 Bacteria 917
824 nmdc:mga0n895_851556_c1 3300050512 Bacteria 899
825 nmdc:mga0rr50_20997_c1 3300050513 Bacteria 4449
826 nmdc:mga0rr50_217615_c1 3300050513 Bacteria 1576
827 nmdc:mga0rr50_46463_c1 3300050513 Bacteria 3197
828 nmdc:mga0a205_14086_c1 3300050515 Bacteria 7461
829 nmdc:mga0a205_63855_c1 3300050515 Bacteria 3557
830 nmdc:mga0a205_64850_c1 3300050515 Bacteria 3528
831 nmdc:mga0a205_80131_c1 3300050515 Bacteria 3155
832 nmdc:mga0sz30_132340_c1 3300050516 Bacteria 1099
833 Ga0495601_0000008 3300053077 Bacteria 362152
834 Ga0495601_0001082 3300053077 Bacteria 14935
835 Ga0495601_0017682 3300053077 Bacteria 4330
836 Ga0495601_0052190 3300053077 Bacteria 2581
837 Ga0495601_0069786 3300053077 Bacteria 2241
838 Ga0495612_0000002 3300053078 Bacteria 310466
839 Ga0495612_0004845 3300053078 Bacteria 5572
840 Ga0495612_0008244 3300053078 Bacteria 4232
841 Ga0495612_0077205 3300053078 Bacteria 1396
842 Ga0495655_0012868 3300053083 Bacteria 1715
843 Ga0495595_0000008 3300053084 Bacteria 196206
844 Ga0495595_0000976 3300053084 Bacteria 11021
845 Ga0495595_0010760 3300053084 Bacteria 3811
846 Ga0495595_0021904 3300053084 Bacteria 2798
847 Ga0495595_0144088 3300053084 Bacteria 1170
848 Ga0495595_0274133 3300053084 Bacteria 846
849 Ga0495619_0000002 3300053085 Bacteria 530226
850 Ga0495619_0004422 3300053085 Bacteria 8963
851 Ga0495619_0011111 3300053085 Bacteria 5662
852 Ga0495619_0012012 3300053085 Bacteria 5456
853 Ga0495619_0036703 3300053085 Bacteria 3192
854 Ga0495619_0145705 3300053085 Bacteria 1632
855 Ga0500643_009800 3300053087 Bacteria 3627
856 Ga0500644_0059035 3300053088 Bacteria 1344
857 Ga0500566_0057455 3300053094 Bacteria 2210
858 Ga0500641_0008962 3300053096 Bacteria 3586
859 Ga0500562_082389 3300053108 Bacteria 871
860 Ga0500593_001757 3300053117 Bacteria 7804
861 Ga0500594_0057298 3300053118 Bacteria 1114
862 Ga0500595_000010 3300053119 Bacteria 275806
863 Ga0500595_015011 3300053119 Bacteria 2921
864 Ga0500658_0163472 3300053134 Bacteria 1009
865 Ga0500568_0000002 3300053139 Bacteria 880601
866 Ga0500616_0000001 3300053153 Bacteria 1986011
867 Ga0500616_0032210 3300053153 Bacteria 2866
868 Ga0500645_000469 3300053730 Bacteria 27530
869 Ga0501084_0140956 3300054114 Bacteria 2030
870 Ga0501082_0053986 3300060353 Bacteria 3464
871 Ga0501082_0441402 3300060353 Bacteria 1137
872 Ga0530510_0296131 3300061734 Bacteria 1210

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035118 Ga0373954_0127673 Ga0373954_0127673_515_1210 209
2 3300037853 Ga0436364_1112770 Ga0436364_1112770_300_971 216
3 3300053153 Ga0500616_0032210 Ga0500616_0032210_768_1430 216
4 3300053730 Ga0500645_000469 Ga0500645_000469_11469_12125 216
5 3300009036 Ga0105244_10032578 Ga0105244_100325784 217
6 3300009093 Ga0105240_10111998 Ga0105240_101119983 217
7 3300009094 Ga0111539_10003331 Ga0111539_1000333110 217
8 3300009094 Ga0111539_10007321 Ga0111539_1000732112 217
9 3300009098 Ga0105245_10000183 Ga0105245_1000018344 217
10 3300009147 Ga0114129_10001218 Ga0114129_1000121830 217
11 3300009148 Ga0105243_10001561 Ga0105243_100015613 217
12 3300009174 Ga0105241_10003567 Ga0105241_100035672 217
13 3300009176 Ga0105242_10000701 Ga0105242_100007013 217
14 3300009177 Ga0105248_10010394 Ga0105248_1001039410 217
15 3300009551 Ga0105238_10137275 Ga0105238_101372752 217
16 3300010375 Ga0105239_10007315 Ga0105239_100073153 217
17 3300010375 Ga0105239_10733186 Ga0105239_107331862 217
18 3300012503 Ga0157313_1001654 Ga0157313_10016542 217
19 3300012515 Ga0157338_1001595 Ga0157338_10015952 217
20 3300013296 Ga0157374_10000463 Ga0157374_100004637 217
21 3300013297 Ga0157378_10000613 Ga0157378_100006133 217
22 3300013306 Ga0163162_10005908 Ga0163162_1000590812 217
23 3300013308 Ga0157375_10004786 Ga0157375_100047862 217
24 3300013308 Ga0157375_10514386 Ga0157375_105143862 217
25 3300014325 Ga0163163_10025813 Ga0163163_100258134 217
26 3300014326 Ga0157380_10004641 Ga0157380_1000464110 217
27 3300014745 Ga0157377_10021447 Ga0157377_100214473 217
28 3300014968 Ga0157379_10003902 Ga0157379_100039023 217
29 3300014969 Ga0157376_10003730 Ga0157376_100037302 217
30 3300020082 Ga0206353_11182671 Ga0206353_111826712 217
31 3300025906 Ga0207699_10157162 Ga0207699_101571622 217
32 3300034819 Ga0373958_0004863 Ga0373958_0004863_350_1003 217
33 3300034957 Ga0373938_0004504 Ga0373938_0004504_536_1189 217
34 3300035090 Ga0373949_0005247 Ga0373949_0005247_1801_2454 217
35 3300035112 Ga0373932_0000822 Ga0373932_0000822_8437_9090 217
36 3300035115 Ga0373941_0016607 Ga0373941_0016607_227_880 217
37 3300035121 Ga0373960_0000277 Ga0373960_0000277_393_1046 217
38 3300035121 Ga0373960_0003722 Ga0373960_0003722_1923_2576 217
39 3300035207 Ga0373942_0001742 Ga0373942_0001742_2980_3633 217
40 3300035691 Ga0373931_0020016 Ga0373931_0020016_468_1121 217
41 3300035691 Ga0373931_0044941 Ga0373931_0044941_1451_2104 217
42 3300038996 Ga0242420_029371 Ga0242420_029371_51_704 217
43 3300046454 Ga0495592_0220152 Ga0495592_0220152_11_685 217
44 3300046491 Ga0495584_0039375 Ga0495584_0039375_1609_2262 217
45 3300046517 Ga0495630_0014783 Ga0495630_0014783_5007_5681 217
46 3300047322 Ga0495680_0150939 Ga0495680_0150939_287_940 217
47 3300048903 Ga0496100_0000447 Ga0496100_0000447_18921_19574 217
48 3300048904 Ga0496101_0053265 Ga0496101_0053265_537_1190 217
49 3300048905 Ga0496102_0002354 Ga0496102_0002354_15122_15775 217
50 3300048906 Ga0496103_0000837 Ga0496103_0000837_14067_14720 217
51 3300048909 Ga0496106_0001351 Ga0496106_0001351_9733_10386 217
52 3300048910 Ga0496107_0001211 Ga0496107_0001211_850_1503 217
53 3300048911 Ga0496108_0031743 Ga0496108_0031743_3036_3689 217
54 3300048912 Ga0496109_0000188 Ga0496109_0000188_10618_11271 217
55 3300048912 Ga0496109_0002868 Ga0496109_0002868_8799_9455 217
56 3300048914 Ga0496111_0091948 Ga0496111_0091948_1136_1789 217
57 3300048915 Ga0496112_0004798 Ga0496112_0004798_5553_6209 217
58 3300048915 Ga0496112_0093926 Ga0496112_0093926_2233_2886 217
59 3300048917 Ga0496114_0001734 Ga0496114_0001734_14771_15424 217
60 3300048918 Ga0496115_0000592 Ga0496115_0000592_14659_15312 217
61 3300049581 Ga0501047_0279597 Ga0501047_0279597_11_667 217
62 3300049592 Ga0501076_0050146 Ga0501076_0050146_907_1560 217
63 3300050494 nmdc:mga06z11_168572_c1 nmdc:mga06z11_168572_c1_545_1198 217
64 3300050507 nmdc:mga05p37_1114_c1 nmdc:mga05p37_1114_c1_20537_21190 217
65 3300050508 nmdc:mga09592_1302_c1 nmdc:mga09592_1302_c1_17781_18434 217
66 3300050509 nmdc:mga0qj67_30519_c1 nmdc:mga0qj67_30519_c1_1130_1783 217
67 3300050510 nmdc:mga06r32_95767_c1 nmdc:mga06r32_95767_c1_633_1286 217
68 3300050511 nmdc:mga08y16_7407_c1 nmdc:mga08y16_7407_c1_6923_7576 217
69 3300050511 nmdc:mga08y16_8501_c1 nmdc:mga08y16_8501_c1_633_1286 217
70 3300050511 nmdc:mga08y16_8959_c1 nmdc:mga08y16_8959_c1_2837_3490 217
71 3300050512 nmdc:mga0n895_3698_c1 nmdc:mga0n895_3698_c1_1201_1854 217
72 3300050512 nmdc:mga0n895_651_c1 nmdc:mga0n895_651_c1_11810_12463 217
73 3300050513 nmdc:mga0rr50_20997_c1 nmdc:mga0rr50_20997_c1_2159_2812 217
74 3300050513 nmdc:mga0rr50_46463_c1 nmdc:mga0rr50_46463_c1_2086_2739 217
75 3300050515 nmdc:mga0a205_63855_c1 nmdc:mga0a205_63855_c1_2416_3069 217
76 3300050515 nmdc:mga0a205_64850_c1 nmdc:mga0a205_64850_c1_1648_2301 217
77 3300060353 Ga0501082_0441402 Ga0501082_0441402_414_1067 217
78 3300046459 Ga0495629_0096408 Ga0495629_0096408_846_1502 218
79 3300046475 Ga0495639_0089627 Ga0495639_0089627_576_1232 218
80 3300053117 Ga0500593_001757 Ga0500593_001757_6872_7561 223
81 3300053139 Ga0500568_0000002 Ga0500568_0000002_493014_493703 223
82 iso_pu_bacteria 2515154112 2515624142 226
83 iso_pu_bacteria 2935975950 2935982334 226
84 iso_pu_bacteria 8019629233 8019638642 226
85 iso_pu_bacteria 8019638758 8019641096 226
86 iso_pu_bacteria 8019659431 8019666444 226
87 iso_pu_bacteria 8019668869 8019676105 226
88 iso_pu_bacteria 8019678201 8019679880 226
89 3300005436 Ga0070713_100251269 Ga0070713_1002512692 227
90 3300049571 Ga0501034_0023811 Ga0501034_0023811_4282_4989 227
91 3300049742 Ga0501080_0201546 Ga0501080_0201546_375_1061 227
92 3300053134 Ga0500658_0163472 Ga0500658_0163472_139_843 227
93 3300049822 Ga0501035_0031991 Ga0501035_0031991_534_1223 228
94 3300053087 Ga0500643_009800 Ga0500643_009800_1185_1877 228
95 3300053088 Ga0500644_0059035 Ga0500644_0059035_255_947 228
96 3300053094 Ga0500566_0057455 Ga0500566_0057455_289_981 228
97 3300053118 Ga0500594_0057298 Ga0500594_0057298_151_843 228
98 3300053119 Ga0500595_000010 Ga0500595_000010_244687_245379 228
99 3300053153 Ga0500616_0000001 Ga0500616_0000001_580241_580939 228
100 3300021384 Ga0213876_10076060 Ga0213876_100760602 229
101 3300021384 Ga0213876_10164681 Ga0213876_101646812 229
102 3300021388 Ga0213875_10000011 Ga0213875_10000011161 229
103 3300035111 Ga0373923_0076444 Ga0373923_0076444_203_901 229
104 3300035118 Ga0373954_0012732 Ga0373954_0012732_804_1502 229
105 3300035410 Ga0373924_0015332 Ga0373924_0015332_2184_2882 229
106 3300035724 Ga0373933_0003452 Ga0373933_0003452_2020_2718 229
107 3300036401 Ga0373937_0016095 Ga0373937_0016095_3824_4522 229
108 3300037853 Ga0436364_0728139 Ga0436364_0728139_18969_19703 229
109 3300037853 Ga0436364_0828220 Ga0436364_0828220_853_1557 229
110 3300037853 Ga0436364_1478908 Ga0436364_1478908_2388_3092 229
111 3300039437 Ga0436365_1263360 Ga0436365_1263360_2163_2867 229
112 3300039437 Ga0436365_1905431 Ga0436365_1905431_78_782 229
113 3300039453 Ga0436362_1216740 Ga0436362_1216740_29_733 229
114 3300046529 Ga0495652_0181958 Ga0495652_0181958_446_1144 229
115 3300046536 Ga0495587_0038364 Ga0495587_0038364_638_1336 229
116 3300046559 Ga0495667_0011622 Ga0495667_0011622_2899_3597 229
117 3300046663 Ga0495635_0153782 Ga0495635_0153782_703_1410 229
118 3300046809 Ga0495600_0080530 Ga0495600_0080530_73_771 229
119 3300047444 Ga0495675_0064098 Ga0495675_0064098_760_1458 229
120 3300048088 Ga0495602_0040529 Ga0495602_0040529_2357_3055 229
121 3300049585 Ga0501069_0159532 Ga0501069_0159532_552_1241 229
122 3300053077 Ga0495601_0052190 Ga0495601_0052190_133_831 229
123 3300053084 Ga0495595_0144088 Ga0495595_0144088_135_839 229
124 3300053085 Ga0495619_0004422 Ga0495619_0004422_3035_3742 229
125 3300048929 Ga0496126_0003899 Ga0496126_0003899_5376_6068 230
126 3300049575 Ga0501039_0055753 Ga0501039_0055753_1672_2364 230
127 3300049585 Ga0501069_0063843 Ga0501069_0063843_550_1245 230
128 3300049586 Ga0501070_0043799 Ga0501070_0043799_2969_3664 230
129 3300049586 Ga0501070_0143788 Ga0501070_0143788_901_1599 230
130 3300005338 Ga0068868_100011853 Ga0068868_1000118532 231
131 3300005937 Ga0081455_10000276 Ga0081455_1000027654 231
132 3300006042 Ga0075368_10013700 Ga0075368_100137003 231
133 3300006042 Ga0075368_10028565 Ga0075368_100285652 231
134 3300006051 Ga0075364_10094554 Ga0075364_100945542 231
135 3300006177 Ga0075362_10158854 Ga0075362_101588542 231
136 3300006178 Ga0075367_10079141 Ga0075367_100791412 231
137 3300006353 Ga0075370_10058511 Ga0075370_100585112 231
138 3300009093 Ga0105240_10230582 Ga0105240_102305823 231
139 3300009545 Ga0105237_10369590 Ga0105237_103695902 231
140 3300027357 Ga0209589_1000017 Ga0209589_1000017155 231
141 3300027361 Ga0209489_100018 Ga0209489_100018155 231
142 3300027363 Ga0209700_100028 Ga0209700_100028155 231
143 3300035113 Ga0373936_0088512 Ga0373936_0088512_97_798 231
144 3300037312 Ga0395899_0006286 Ga0395899_0006286_2834_3544 231
145 3300037312 Ga0395899_0161232 Ga0395899_0161232_752_1462 231
146 3300037418 Ga0395900_0004809 Ga0395900_0004809_10497_11207 231
147 3300037466 Ga0395898_0002323 Ga0395898_0002323_17043_17753 231
148 3300037466 Ga0395898_0015089 Ga0395898_0015089_5538_6248 231
149 3300037466 Ga0395898_0069464 Ga0395898_0069464_913_1617 231
150 3300037853 Ga0436364_0840315 Ga0436364_0840315_155_856 231
151 3300038443 Ga0395901_0042160 Ga0395901_0042160_1945_2655 231
152 3300038443 Ga0395901_0098476 Ga0395901_0098476_366_1070 231
153 3300039437 Ga0436365_0229718 Ga0436365_0229718_731_1432 231
154 3300039437 Ga0436365_0560971 Ga0436365_0560971_963_1670 231
155 3300044719 Ga0466971_0221586 Ga0466971_0221586_123_824 231
156 3300048903 Ga0496100_0225085 Ga0496100_0225085_532_1233 231
157 3300048910 Ga0496107_0130955 Ga0496107_0130955_563_1264 231
158 3300050494 nmdc:mga06z11_57924_c1 nmdc:mga06z11_57924_c1_131_835 231
159 3300050494 nmdc:mga06z11_88037_c1 nmdc:mga06z11_88037_c1_165_866 231
160 3300050496 nmdc:mga07m45_21722_c1 nmdc:mga07m45_21722_c1_710_1411 231
161 3300050496 nmdc:mga07m45_58611_c1 nmdc:mga07m45_58611_c1_1078_1782 231
162 3300050510 nmdc:mga06r32_839005_c1 nmdc:mga06r32_839005_c1_153_857 231
163 3300053108 Ga0500562_082389 Ga0500562_082389_59_760 231
164 3300053119 Ga0500595_015011 Ga0500595_015011_1250_1951 231
165 3300005340 Ga0070689_100127239 Ga0070689_1001272392 232
166 3300005355 Ga0070671_100052167 Ga0070671_1000521675 232
167 3300005364 Ga0070673_100008698 Ga0070673_1000086986 232
168 3300005365 Ga0070688_100073957 Ga0070688_1000739571 232
169 3300005366 Ga0070659_100233962 Ga0070659_1002339621 232
170 3300005434 Ga0070709_10234450 Ga0070709_102344502 232
171 3300005530 Ga0070679_100487804 Ga0070679_1004878042 232
172 3300005842 Ga0068858_100432981 Ga0068858_1004329812 232
173 3300005843 Ga0068860_100588190 Ga0068860_1005881902 232
174 3300005937 Ga0081455_10023997 Ga0081455_100239978 232
175 3300005937 Ga0081455_10030467 Ga0081455_100304674 232
176 3300005983 Ga0081540_1039896 Ga0081540_10398962 232
177 3300006028 Ga0070717_10071648 Ga0070717_100716482 232
178 3300006028 Ga0070717_10148248 Ga0070717_101482484 232
179 3300006051 Ga0075364_10088279 Ga0075364_100882792 232
180 3300006175 Ga0070712_100230769 Ga0070712_1002307692 232
181 3300006177 Ga0075362_10022833 Ga0075362_100228332 232
182 3300006844 Ga0075428_100268105 Ga0075428_1002681052 232
183 3300006846 Ga0075430_100236559 Ga0075430_1002365592 232
184 3300006847 Ga0075431_100094786 Ga0075431_1000947863 232
185 3300006880 Ga0075429_100572698 Ga0075429_1005726982 232
186 3300006880 Ga0075429_100607676 Ga0075429_1006076761 232
187 3300007788 Ga0099795_10005314 Ga0099795_100053144 232
188 3300009098 Ga0105245_10130624 Ga0105245_101306244 232
189 3300009147 Ga0114129_10143612 Ga0114129_101436122 232
190 3300009177 Ga0105248_10438683 Ga0105248_104386833 232
191 3300010159 Ga0099796_10001281 Ga0099796_100012811 232
192 3300010375 Ga0105239_10109477 Ga0105239_101094775 232
193 3300014325 Ga0163163_10323863 Ga0163163_103238632 232
194 3300014969 Ga0157376_10046136 Ga0157376_100461366 232
195 3300025905 Ga0207685_10058088 Ga0207685_100580882 232
196 3300025906 Ga0207699_10115923 Ga0207699_101159232 232
197 3300025915 Ga0207693_10039913 Ga0207693_100399135 232
198 3300025915 Ga0207693_10147608 Ga0207693_101476082 232
199 3300025925 Ga0207650_10021193 Ga0207650_100211936 232
200 3300025929 Ga0207664_10113715 Ga0207664_101137151 232
201 3300025929 Ga0207664_10766688 Ga0207664_107666881 232
202 3300025931 Ga0207644_10060993 Ga0207644_100609931 232
203 3300025936 Ga0207670_10104583 Ga0207670_101045834 232
204 3300025939 Ga0207665_10203496 Ga0207665_102034962 232
205 3300025939 Ga0207665_10395219 Ga0207665_103952192 232
206 3300025960 Ga0207651_10027084 Ga0207651_100270842 232
207 3300026035 Ga0207703_10355064 Ga0207703_103550642 232
208 3300027512 Ga0209179_1016890 Ga0209179_10168902 232
209 3300028379 Ga0268266_10174688 Ga0268266_101746884 232
210 3300035083 Ga0373926_0044087 Ga0373926_0044087_248_949 232
211 3300035111 Ga0373923_0003390 Ga0373923_0003390_2800_3507 232
212 3300035113 Ga0373936_0013078 Ga0373936_0013078_472_1179 232
213 3300035114 Ga0373939_0001066 Ga0373939_0001066_1733_2437 232
214 3300035117 Ga0373953_0001693 Ga0373953_0001693_32_739 232
215 3300035118 Ga0373954_0012278 Ga0373954_0012278_1665_2372 232
216 3300035170 Ga0373943_0002631 Ga0373943_0002631_7087_7794 232
217 3300035171 Ga0373946_0002013 Ga0373946_0002013_4888_5595 232
218 3300035171 Ga0373946_0028788 Ga0373946_0028788_1372_2091 232
219 3300035172 Ga0373955_0000084 Ga0373955_0000084_31612_32319 232
220 3300035410 Ga0373924_0000855 Ga0373924_0000855_3624_4331 232
221 3300035692 Ga0373935_0000285 Ga0373935_0000285_6011_6718 232
222 3300035692 Ga0373935_0056303 Ga0373935_0056303_566_1285 232
223 3300035695 Ga0373927_0046507 Ga0373927_0046507_1412_2119 232
224 3300035725 Ga0373947_0013785 Ga0373947_0013785_2855_3574 232
225 3300035725 Ga0373947_0029806 Ga0373947_0029806_1742_2449 232
226 3300035725 Ga0373947_0069276 Ga0373947_0069276_748_1455 232
227 3300036401 Ga0373937_0000006 Ga0373937_0000006_76813_77520 232
228 3300037068 Ga0373925_0000002 Ga0373925_0000002_208389_209096 232
229 3300042461 Ga0439460_0083476 Ga0439460_0083476_277_987 232
230 3300044694 Ga0466963_0032994 Ga0466963_0032994_1506_2213 232
231 3300044694 Ga0466963_0120790 Ga0466963_0120790_885_1592 232
232 3300045836 Ga0466958_0114627 Ga0466958_0114627_79_786 232
233 3300045976 Ga0466967_0093846 Ga0466967_0093846_519_1226 232
234 3300046454 Ga0495592_0000039 Ga0495592_0000039_81635_82342 232
235 3300046454 Ga0495592_0286490 Ga0495592_0286490_57_758 232
236 3300046461 Ga0495641_0055219 Ga0495641_0055219_664_1365 232
237 3300046462 Ga0495651_0002460 Ga0495651_0002460_1188_1895 232
238 3300046463 Ga0495653_0000006 Ga0495653_0000006_208537_209244 232
239 3300046463 Ga0495653_0033111 Ga0495653_0033111_578_1279 232
240 3300046472 Ga0495580_0200598 Ga0495580_0200598_375_1076 232
241 3300046473 Ga0495582_0024567 Ga0495582_0024567_2329_3030 232
242 3300046473 Ga0495582_0141623 Ga0495582_0141623_46_753 232
243 3300046475 Ga0495639_0093452 Ga0495639_0093452_670_1371 232
244 3300046476 Ga0495662_0000905 Ga0495662_0000905_12919_13626 232
245 3300046476 Ga0495662_0021205 Ga0495662_0021205_2391_3098 232
246 3300046477 Ga0495664_0000002 Ga0495664_0000002_244171_244878 232
247 3300046492 Ga0495585_0000546 Ga0495585_0000546_32473_33174 232
248 3300046501 Ga0495607_0002967 Ga0495607_0002967_9814_10515 232
249 3300046511 Ga0495608_0000009 Ga0495608_0000009_235557_236264 232
250 3300046511 Ga0495608_0019871 Ga0495608_0019871_2934_3635 232
251 3300046514 Ga0495618_0000005 Ga0495618_0000005_21530_22237 232
252 3300046516 Ga0495628_0000002 Ga0495628_0000002_208556_209263 232
253 3300046517 Ga0495630_0001565 Ga0495630_0001565_3237_3944 232
254 3300046517 Ga0495630_0129073 Ga0495630_0129073_11_712 232
255 3300046529 Ga0495652_0000004 Ga0495652_0000004_379620_380327 232
256 3300046531 Ga0495665_0025722 Ga0495665_0025722_853_1560 232
257 3300046531 Ga0495665_0175419 Ga0495665_0175419_259_966 232
258 3300046533 Ga0495640_0000005 Ga0495640_0000005_235572_236279 232
259 3300046533 Ga0495640_0221237 Ga0495640_0221237_186_905 232
260 3300046533 Ga0495640_0377545 Ga0495640_0377545_92_799 232
261 3300046535 Ga0495586_0006325 Ga0495586_0006325_2112_2813 232
262 3300046536 Ga0495587_0000007 Ga0495587_0000007_81963_82670 232
263 3300046537 Ga0495598_0011961 Ga0495598_0011961_394_1095 232
264 3300046543 Ga0495645_0000003 Ga0495645_0000003_189807_190514 232
265 3300046543 Ga0495645_0052708 Ga0495645_0052708_708_1409 232
266 3300046558 Ga0495633_0203445 Ga0495633_0203445_124_825 232
267 3300046559 Ga0495667_0000002 Ga0495667_0000002_228460_229167 232
268 3300046642 Ga0495634_0000022 Ga0495634_0000022_72776_73483 232
269 3300046642 Ga0495634_0018294 Ga0495634_0018294_869_1588 232
270 3300046648 Ga0495611_0024465 Ga0495611_0024465_1774_2475 232
271 3300046663 Ga0495635_0000020 Ga0495635_0000020_17929_18636 232
272 3300046664 Ga0495659_0000633 Ga0495659_0000633_40_741 232
273 3300046675 Ga0495657_0000435 Ga0495657_0000435_29124_29831 232
274 3300046678 Ga0495599_0000001 Ga0495599_0000001_347234_347941 232
275 3300046679 Ga0495623_0000001 Ga0495623_0000001_116179_116886 232
276 3300046680 Ga0495646_0000014 Ga0495646_0000014_110583_111290 232
277 3300046683 Ga0495658_0524663 Ga0495658_0524663_32_739 232
278 3300046689 Ga0495613_0064793 Ga0495613_0064793_217_936 232
279 3300046690 Ga0495624_0010998 Ga0495624_0010998_460_1161 232
280 3300046690 Ga0495624_0116189 Ga0495624_0116189_338_1045 232
281 3300046691 Ga0495670_0152633 Ga0495670_0152633_268_969 232
282 3300046794 Ga0495589_0006699 Ga0495589_0006699_3667_4368 232
283 3300046809 Ga0495600_0000006 Ga0495600_0000006_77714_78421 232
284 3300047315 Ga0495581_0013446 Ga0495581_0013446_2568_3275 232
285 3300047317 Ga0495604_0000005 Ga0495604_0000005_234200_234907 232
286 3300047319 Ga0495674_0000003 Ga0495674_0000003_352863_353570 232
287 3300047319 Ga0495674_0044184 Ga0495674_0044184_2250_2969 232
288 3300047319 Ga0495674_0418186 Ga0495674_0418186_212_919 232
289 3300047322 Ga0495680_0000002 Ga0495680_0000002_11623_12330 232
290 3300047444 Ga0495675_0000010 Ga0495675_0000010_107724_108431 232
291 3300047470 Ga0495681_0116549 Ga0495681_0116549_24_725 232
292 3300047471 Ga0495684_0000028 Ga0495684_0000028_41015_41722 232
293 3300047471 Ga0495684_0051579 Ga0495684_0051579_1576_2277 232
294 3300047471 Ga0495684_0554604 Ga0495684_0554604_19_726 232
295 3300047673 Ga0495593_0001612 Ga0495593_0001612_6167_6874 232
296 3300047673 Ga0495593_0004471 Ga0495593_0004471_2942_3643 232
297 3300048088 Ga0495602_0000054 Ga0495602_0000054_47400_48107 232
298 3300049568 Ga0501031_0151647 Ga0501031_0151647_549_1256 232
299 3300049569 Ga0501032_0110350 Ga0501032_0110350_131_838 232
300 3300049571 Ga0501034_0487164 Ga0501034_0487164_405_1112 232
301 3300049575 Ga0501039_0215510 Ga0501039_0215510_579_1286 232
302 3300049589 Ga0501073_0131591 Ga0501073_0131591_425_1132 232
303 3300049590 Ga0501074_0433129 Ga0501074_0433129_19_726 232
304 3300049744 Ga0501083_0030084 Ga0501083_0030084_2368_3075 232
305 3300050491 nmdc:mga00v17_119195_c1 nmdc:mga00v17_119195_c1_448_1152 232
306 3300050508 nmdc:mga09592_377475_c1 nmdc:mga09592_377475_c1_108_806 232
307 3300050510 nmdc:mga06r32_102341_c1 nmdc:mga06r32_102341_c1_984_1682 232
308 3300050510 nmdc:mga06r32_314991_c1 nmdc:mga06r32_314991_c1_164_862 232
309 3300050510 nmdc:mga06r32_533222_c1 nmdc:mga06r32_533222_c1_279_983 232
310 3300050512 nmdc:mga0n895_851556_c1 nmdc:mga0n895_851556_c1_65_793 232
311 3300053077 Ga0495601_0000008 Ga0495601_0000008_113479_114186 232
312 3300053077 Ga0495601_0001082 Ga0495601_0001082_3550_4269 232
313 3300053078 Ga0495612_0000002 Ga0495612_0000002_120152_120859 232
314 3300053078 Ga0495612_0077205 Ga0495612_0077205_161_862 232
315 3300053084 Ga0495595_0000008 Ga0495595_0000008_113607_114314 232
316 3300053084 Ga0495595_0010760 Ga0495595_0010760_1407_2108 232
317 3300053085 Ga0495619_0000002 Ga0495619_0000002_208559_209266 232
318 3300053085 Ga0495619_0145705 Ga0495619_0145705_11_712 232
319 3300061734 Ga0530510_0296131 Ga0530510_0296131_459_1187 232
320 3300001977 JGI24746J21847_1007946 JGI24746J21847_10079462 233
321 3300001989 JGI24739J22299_10059068 JGI24739J22299_100590681 233
322 3300001991 JGI24743J22301_10024590 JGI24743J22301_100245901 233
323 3300002070 JGI24750J21931_1005344 JGI24750J21931_10053442 233
324 3300002075 JGI24738J21930_10015540 JGI24738J21930_100155402 233
325 3300002076 JGI24749J21850_1001768 JGI24749J21850_10017682 233
326 3300002077 JGI24744J21845_10001649 JGI24744J21845_100016493 233
327 3300002244 JGI24742J22300_10000916 JGI24742J22300_100009164 233
328 3300002459 JGI24751J29686_10007269 JGI24751J29686_100072692 233
329 3300005330 Ga0070690_100010449 Ga0070690_1000104494 233
330 3300005331 Ga0070670_100034128 Ga0070670_1000341283 233
331 3300005334 Ga0068869_100007353 Ga0068869_1000073537 233
332 3300005335 Ga0070666_10006992 Ga0070666_100069922 233
333 3300005337 Ga0070682_100050082 Ga0070682_1000500822 233
334 3300005338 Ga0068868_100065314 Ga0068868_1000653142 233
335 3300005340 Ga0070689_100088514 Ga0070689_1000885142 233
336 3300005341 Ga0070691_10014701 Ga0070691_100147012 233
337 3300005343 Ga0070687_100038150 Ga0070687_1000381503 233
338 3300005345 Ga0070692_10014018 Ga0070692_100140182 233
339 3300005353 Ga0070669_100224679 Ga0070669_1002246792 233
340 3300005354 Ga0070675_100020637 Ga0070675_1000206374 233
341 3300005355 Ga0070671_100026233 Ga0070671_1000262334 233
342 3300005356 Ga0070674_100009633 Ga0070674_1000096332 233
343 3300005364 Ga0070673_100222991 Ga0070673_1002229912 233
344 3300005365 Ga0070688_100012611 Ga0070688_1000126114 233
345 3300005366 Ga0070659_100023902 Ga0070659_1000239022 233
346 3300005436 Ga0070713_100071863 Ga0070713_1000718633 233
347 3300005437 Ga0070710_10069603 Ga0070710_100696032 233
348 3300005441 Ga0070700_100002278 Ga0070700_1000022786 233
349 3300005444 Ga0070694_100107362 Ga0070694_1001073621 233
350 3300005455 Ga0070663_100065868 Ga0070663_1000658683 233
351 3300005457 Ga0070662_100029329 Ga0070662_1000293294 233
352 3300005459 Ga0068867_100003711 Ga0068867_1000037112 233
353 3300005466 Ga0070685_10143393 Ga0070685_101433932 233
354 3300005535 Ga0070684_100020944 Ga0070684_1000209444 233
355 3300005539 Ga0068853_100045084 Ga0068853_1000450842 233
356 3300005543 Ga0070672_100006952 Ga0070672_1000069526 233
357 3300005544 Ga0070686_100068268 Ga0070686_1000682682 233
358 3300005546 Ga0070696_100030640 Ga0070696_1000306403 233
359 3300005548 Ga0070665_100146697 Ga0070665_1001466972 233
360 3300005548 Ga0070665_100175390 Ga0070665_1001753902 233
361 3300005563 Ga0068855_100592098 Ga0068855_1005920982 233
362 3300005564 Ga0070664_100153442 Ga0070664_1001534422 233
363 3300005577 Ga0068857_100376240 Ga0068857_1003762402 233
364 3300005614 Ga0068856_100119127 Ga0068856_1001191273 233
365 3300005615 Ga0070702_100013601 Ga0070702_1000136014 233
366 3300005616 Ga0068852_100021772 Ga0068852_1000217723 233
367 3300005617 Ga0068859_100018152 Ga0068859_1000181526 233
368 3300005618 Ga0068864_100044813 Ga0068864_1000448133 233
369 3300005719 Ga0068861_100028834 Ga0068861_1000288342 233
370 3300005840 Ga0068870_10008401 Ga0068870_100084013 233
371 3300005841 Ga0068863_100003083 Ga0068863_1000030833 233
372 3300005842 Ga0068858_100026853 Ga0068858_1000268533 233
373 3300005843 Ga0068860_100013320 Ga0068860_1000133209 233
374 3300005844 Ga0068862_100243383 Ga0068862_1002433832 233
375 3300006038 Ga0075365_10084204 Ga0075365_100842042 233
376 3300006042 Ga0075368_10037514 Ga0075368_100375142 233
377 3300006175 Ga0070712_100033595 Ga0070712_1000335953 233
378 3300006178 Ga0075367_10156249 Ga0075367_101562492 233
379 3300006237 Ga0097621_100037929 Ga0097621_1000379294 233
380 3300006358 Ga0068871_100020804 Ga0068871_1000208042 233
381 3300006846 Ga0075430_100042214 Ga0075430_1000422143 233
382 3300006847 Ga0075431_100173127 Ga0075431_1001731271 233
383 3300006881 Ga0068865_100019723 Ga0068865_1000197234 233
384 3300006931 Ga0097620_100018152 Ga0097620_1000181523 233
385 3300009092 Ga0105250_10089502 Ga0105250_100895022 233
386 3300009098 Ga0105245_10038415 Ga0105245_100384152 233
387 3300009101 Ga0105247_10019428 Ga0105247_100194282 233
388 3300009177 Ga0105248_10150227 Ga0105248_101502272 233
389 3300009545 Ga0105237_10081640 Ga0105237_100816403 233
390 3300009551 Ga0105238_10237032 Ga0105238_102370322 233
391 3300009553 Ga0105249_10061656 Ga0105249_100616562 233
392 3300010159 Ga0099796_10095590 Ga0099796_100955901 233
393 3300010375 Ga0105239_10075680 Ga0105239_100756803 233
394 3300010375 Ga0105239_10222955 Ga0105239_102229552 233
395 3300011119 Ga0105246_10040206 Ga0105246_100402062 233
396 3300013296 Ga0157374_10005521 Ga0157374_100055216 233
397 3300013297 Ga0157378_10078613 Ga0157378_100786132 233
398 3300013306 Ga0163162_10112257 Ga0163162_101122572 233
399 3300014325 Ga0163163_10096112 Ga0163163_100961122 233
400 3300014745 Ga0157377_10001711 Ga0157377_100017114 233
401 3300025900 Ga0207710_10016736 Ga0207710_100167363 233
402 3300025901 Ga0207688_10001290 Ga0207688_1000129011 233
403 3300025903 Ga0207680_10005019 Ga0207680_100050194 233
404 3300025904 Ga0207647_10017409 Ga0207647_100174094 233
405 3300025907 Ga0207645_10094260 Ga0207645_100942602 233
406 3300025908 Ga0207643_10009464 Ga0207643_100094643 233
407 3300025911 Ga0207654_10140118 Ga0207654_101401182 233
408 3300025914 Ga0207671_10116264 Ga0207671_101162642 233
409 3300025915 Ga0207693_10028571 Ga0207693_100285714 233
410 3300025916 Ga0207663_10014105 Ga0207663_100141054 233
411 3300025918 Ga0207662_10004066 Ga0207662_100040666 233
412 3300025923 Ga0207681_10013919 Ga0207681_100139192 233
413 3300025925 Ga0207650_10009594 Ga0207650_100095943 233
414 3300025926 Ga0207659_10005666 Ga0207659_100056662 233
415 3300025927 Ga0207687_10056318 Ga0207687_100563182 233
416 3300025931 Ga0207644_10024988 Ga0207644_100249883 233
417 3300025932 Ga0207690_10025613 Ga0207690_100256133 233
418 3300025933 Ga0207706_10004291 Ga0207706_1000429114 233
419 3300025934 Ga0207686_10044339 Ga0207686_100443392 233
420 3300025935 Ga0207709_10043780 Ga0207709_100437803 233
421 3300025936 Ga0207670_10030728 Ga0207670_100307282 233
422 3300025937 Ga0207669_10010680 Ga0207669_100106803 233
423 3300025938 Ga0207704_10004770 Ga0207704_100047702 233
424 3300025942 Ga0207689_10029667 Ga0207689_100296674 233
425 3300025945 Ga0207679_10073705 Ga0207679_100737052 233
426 3300025960 Ga0207651_10011899 Ga0207651_100118994 233
427 3300025961 Ga0207712_10067484 Ga0207712_100674842 233
428 3300025972 Ga0207668_10015312 Ga0207668_100153124 233
429 3300025981 Ga0207640_10062755 Ga0207640_100627552 233
430 3300026023 Ga0207677_10337358 Ga0207677_103373582 233
431 3300026035 Ga0207703_10010252 Ga0207703_100102526 233
432 3300026041 Ga0207639_10249017 Ga0207639_102490172 233
433 3300026075 Ga0207708_10006968 Ga0207708_100069682 233
434 3300026088 Ga0207641_10020383 Ga0207641_100203834 233
435 3300026089 Ga0207648_10002750 Ga0207648_1000275017 233
436 3300026095 Ga0207676_10006905 Ga0207676_100069054 233
437 3300026116 Ga0207674_10312762 Ga0207674_103127621 233
438 3300026116 Ga0207674_10365561 Ga0207674_103655612 233
439 3300026118 Ga0207675_100110796 Ga0207675_1001107962 233
440 3300026121 Ga0207683_10031134 Ga0207683_100311342 233
441 3300026142 Ga0207698_10340025 Ga0207698_103400252 233
442 3300027907 Ga0207428_10202037 Ga0207428_102020372 233
443 3300028380 Ga0268265_10144309 Ga0268265_101443092 233
444 3300028381 Ga0268264_10021393 Ga0268264_100213934 233
445 3300035083 Ga0373926_0031660 Ga0373926_0031660_403_1110 233
446 3300035170 Ga0373943_0012624 Ga0373943_0012624_2069_2776 233
447 3300035695 Ga0373927_0116718 Ga0373927_0116718_989_1696 233
448 3300039447 Ga0436361_0074879 Ga0436361_0074879_15_722 233
449 3300046455 Ga0495603_0008468 Ga0495603_0008468_3217_3924 233
450 3300046461 Ga0495641_0051382 Ga0495641_0051382_422_1129 233
451 3300046472 Ga0495580_0132656 Ga0495580_0132656_702_1409 233
452 3300046476 Ga0495662_0047662 Ga0495662_0047662_1178_1885 233
453 3300046491 Ga0495584_0002534 Ga0495584_0002534_8474_9184 233
454 3300046491 Ga0495584_0051186 Ga0495584_0051186_133_840 233
455 3300046517 Ga0495630_0609976 Ga0495630_0609976_16_723 233
456 3300046520 Ga0495637_0040739 Ga0495637_0040739_151_858 233
457 3300046615 Ga0495656_0063131 Ga0495656_0063131_311_1018 233
458 3300046664 Ga0495659_0042944 Ga0495659_0042944_200_907 233
459 3300046683 Ga0495658_0191340 Ga0495658_0191340_421_1128 233
460 3300046684 Ga0495669_0082759 Ga0495669_0082759_686_1393 233
461 3300046689 Ga0495613_0113546 Ga0495613_0113546_712_1419 233
462 3300046690 Ga0495624_0051510 Ga0495624_0051510_883_1590 233
463 3300046691 Ga0495670_0034778 Ga0495670_0034778_677_1384 233
464 3300046692 Ga0495671_0057604 Ga0495671_0057604_1002_1709 233
465 3300046694 Ga0495649_0168163 Ga0495649_0168163_195_902 233
466 3300046794 Ga0495589_0140245 Ga0495589_0140245_58_765 233
467 3300047321 Ga0495676_0111462 Ga0495676_0111462_876_1583 233
468 3300047446 Ga0495679_080326 Ga0495679_080326_157_864 233
469 3300047470 Ga0495681_0077249 Ga0495681_0077249_247_954 233
470 3300047673 Ga0495593_0169985 Ga0495593_0169985_152_853 233
471 3300048089 Ga0495614_0090871 Ga0495614_0090871_607_1314 233
472 3300048903 Ga0496100_0017409 Ga0496100_0017409_1678_2385 233
473 3300048903 Ga0496100_0047104 Ga0496100_0047104_2036_2743 233
474 3300048904 Ga0496101_0012092 Ga0496101_0012092_3392_4099 233
475 3300048905 Ga0496102_0014509 Ga0496102_0014509_4123_4830 233
476 3300048906 Ga0496103_0007675 Ga0496103_0007675_1048_1755 233
477 3300048907 Ga0496104_0035330 Ga0496104_0035330_3264_3971 233
478 3300048908 Ga0496105_0007075 Ga0496105_0007075_3868_4575 233
479 3300048909 Ga0496106_0022736 Ga0496106_0022736_1835_2542 233
480 3300048910 Ga0496107_0041357 Ga0496107_0041357_500_1207 233
481 3300048911 Ga0496108_0043391 Ga0496108_0043391_1239_1946 233
482 3300048912 Ga0496109_0065905 Ga0496109_0065905_363_1070 233
483 3300048913 Ga0496110_0016529 Ga0496110_0016529_2926_3633 233
484 3300048914 Ga0496111_0010895 Ga0496111_0010895_3867_4574 233
485 3300048915 Ga0496112_0007486 Ga0496112_0007486_2400_3107 233
486 3300048916 Ga0496113_0000496 Ga0496113_0000496_14030_14737 233
487 3300048917 Ga0496114_0034378 Ga0496114_0034378_824_1531 233
488 3300048917 Ga0496114_0242151 Ga0496114_0242151_711_1418 233
489 3300048917 Ga0496114_0262248 Ga0496114_0262248_140_847 233
490 3300048918 Ga0496115_0007067 Ga0496115_0007067_4493_5200 233
491 3300049573 Ga0501037_0305979 Ga0501037_0305979_333_1049 233
492 3300049591 Ga0501075_0250208 Ga0501075_0250208_554_1267 233
493 3300050492 nmdc:mga0yw44_12231_c1 nmdc:mga0yw44_12231_c1_2465_3172 233
494 3300050492 nmdc:mga0yw44_72984_c2 nmdc:mga0yw44_72984_c2_169_882 233
495 3300050494 nmdc:mga06z11_59561_c1 nmdc:mga06z11_59561_c1_1019_1726 233
496 3300050495 nmdc:mga04h51_118721_c1 nmdc:mga04h51_118721_c1_41_748 233
497 3300050510 nmdc:mga06r32_506271_c1 nmdc:mga06r32_506271_c1_90_797 233
498 3300050511 nmdc:mga08y16_52239_c1 nmdc:mga08y16_52239_c1_519_1226 233
499 3300050515 nmdc:mga0a205_80131_c1 nmdc:mga0a205_80131_c1_1400_2107 233
500 3300050516 nmdc:mga0sz30_132340_c1 nmdc:mga0sz30_132340_c1_34_741 233
501 3300053083 Ga0495655_0012868 Ga0495655_0012868_261_968 233
502 3300053084 Ga0495595_0274133 Ga0495595_0274133_108_815 233
503 3300005435 Ga0070714_100074119 Ga0070714_1000741191 234
504 3300005535 Ga0070684_100095217 Ga0070684_1000952171 234
505 3300005983 Ga0081540_1003744 Ga0081540_100374412 234
506 3300009551 Ga0105238_10198677 Ga0105238_101986772 234
507 3300013102 Ga0157371_10198437 Ga0157371_101984372 234
508 3300013105 Ga0157369_10354496 Ga0157369_103544962 234
509 3300027907 Ga0207428_10001020 Ga0207428_1000102024 234
510 3300031711 Ga0265314_10006316 Ga0265314_1000631612 234
511 3300035170 Ga0373943_0194294 Ga0373943_0194294_401_1111 234
512 3300035692 Ga0373935_0089396 Ga0373935_0089396_681_1394 234
513 3300035725 Ga0373947_0040236 Ga0373947_0040236_467_1180 234
514 3300049823 Ga0501044_0259155 Ga0501044_0259155_684_1397 234
515 3300050507 nmdc:mga05p37_502234_c1 nmdc:mga05p37_502234_c1_283_996 234
516 2209111006 2214828534 2213866799 235
517 3300000041 ARcpr5oldR_c000010 ARcpr5oldR_00001019 235
518 3300000042 ARSoilYngRDRAFT_c00060 ARSoilYngRDRAFT_0006013 235
519 3300000043 ARcpr5yngRDRAFT_c000016 ARcpr5yngRDRAFT_0000168 235
520 3300000044 ARSoilOldRDRAFT_c000011 ARSoilOldRDRAFT_00001125 235
521 3300000045 ARCol0oldRDRAFT_c00012 ARCol0oldRDRAFT_000128 235
522 3300000652 ARCol0yngRDRAFT_1000018 ARCol0yngRDRAFT_100001825 235
523 3300002070 JGI24750J21931_1000096 JGI24750J21931_10000963 235
524 3300002074 JGI24748J21848_1000302 JGI24748J21848_10003022 235
525 3300002075 JGI24738J21930_10000997 JGI24738J21930_100009973 235
526 3300002155 JGI24033J26618_1000471 JGI24033J26618_10004713 235
527 3300002244 JGI24742J22300_10003081 JGI24742J22300_100030812 235
528 3300005277 Ga0065716_1001756 Ga0065716_10017561 235
529 3300005289 Ga0065704_10080159 Ga0065704_100801593 235
530 3300005290 Ga0065712_10075299 Ga0065712_100752993 235
531 3300005293 Ga0065715_10007070 Ga0065715_100070704 235
532 3300005293 Ga0065715_10099107 Ga0065715_100991073 235
533 3300005293 Ga0065715_10136801 Ga0065715_101368012 235
534 3300005295 Ga0065707_10174416 Ga0065707_101744161 235
535 3300005328 Ga0070676_10000506 Ga0070676_100005069 235
536 3300005328 Ga0070676_10112545 Ga0070676_101125452 235
537 3300005329 Ga0070683_100014228 Ga0070683_1000142284 235
538 3300005330 Ga0070690_100007842 Ga0070690_1000078421 235
539 3300005330 Ga0070690_100174897 Ga0070690_1001748972 235
540 3300005331 Ga0070670_100004573 Ga0070670_1000045738 235
541 3300005333 Ga0070677_10000227 Ga0070677_1000022719 235
542 3300005334 Ga0068869_100001832 Ga0068869_1000018323 235
543 3300005335 Ga0070666_10036086 Ga0070666_100360862 235
544 3300005336 Ga0070680_100003424 Ga0070680_1000034242 235
545 3300005336 Ga0070680_100063627 Ga0070680_1000636272 235
546 3300005336 Ga0070680_100462824 Ga0070680_1004628242 235
547 3300005337 Ga0070682_100001699 Ga0070682_1000016992 235
548 3300005338 Ga0068868_100012331 Ga0068868_1000123316 235
549 3300005339 Ga0070660_100038742 Ga0070660_1000387424 235
550 3300005340 Ga0070689_100000668 Ga0070689_10000066812 235
551 3300005343 Ga0070687_100000527 Ga0070687_1000005273 235
552 3300005343 Ga0070687_100228897 Ga0070687_1002288972 235
553 3300005345 Ga0070692_10001083 Ga0070692_100010833 235
554 3300005347 Ga0070668_100003117 Ga0070668_10000311712 235
555 3300005354 Ga0070675_100002954 Ga0070675_1000029543 235
556 3300005354 Ga0070675_100366607 Ga0070675_1003666072 235
557 3300005355 Ga0070671_100003210 Ga0070671_1000032103 235
558 3300005355 Ga0070671_100038884 Ga0070671_1000388844 235
559 3300005355 Ga0070671_100172776 Ga0070671_1001727762 235
560 3300005364 Ga0070673_100001477 Ga0070673_10000147712 235
561 3300005365 Ga0070688_100001239 Ga0070688_10000123912 235
562 3300005365 Ga0070688_100017884 Ga0070688_1000178844 235
563 3300005365 Ga0070688_100069139 Ga0070688_1000691392 235
564 3300005367 Ga0070667_100022264 Ga0070667_1000222645 235
565 3300005367 Ga0070667_100089271 Ga0070667_1000892713 235
566 3300005434 Ga0070709_10019255 Ga0070709_100192554 235
567 3300005436 Ga0070713_100029883 Ga0070713_1000298833 235
568 3300005438 Ga0070701_10070848 Ga0070701_100708483 235
569 3300005439 Ga0070711_100025583 Ga0070711_1000255834 235
570 3300005439 Ga0070711_100064990 Ga0070711_1000649902 235
571 3300005440 Ga0070705_100001458 Ga0070705_1000014583 235
572 3300005441 Ga0070700_100001211 Ga0070700_1000012113 235
573 3300005444 Ga0070694_100001764 Ga0070694_1000017643 235
574 3300005445 Ga0070708_100036600 Ga0070708_1000366002 235
575 3300005455 Ga0070663_100198516 Ga0070663_1001985162 235
576 3300005456 Ga0070678_100000525 Ga0070678_10000052517 235
577 3300005456 Ga0070678_100114733 Ga0070678_1001147332 235
578 3300005457 Ga0070662_100002968 Ga0070662_10000296810 235
579 3300005457 Ga0070662_100233026 Ga0070662_1002330262 235
580 3300005458 Ga0070681_10102104 Ga0070681_101021043 235
581 3300005459 Ga0068867_100002950 Ga0068867_10000295013 235
582 3300005466 Ga0070685_10003505 Ga0070685_100035055 235
583 3300005467 Ga0070706_100290798 Ga0070706_1002907981 235
584 3300005530 Ga0070679_100015045 Ga0070679_1000150453 235
585 3300005530 Ga0070679_100034800 Ga0070679_1000348001 235
586 3300005535 Ga0070684_100052856 Ga0070684_1000528563 235
587 3300005544 Ga0070686_100001573 Ga0070686_1000015733 235
588 3300005547 Ga0070693_100000880 Ga0070693_1000008803 235
589 3300005548 Ga0070665_100056009 Ga0070665_1000560093 235
590 3300005548 Ga0070665_101130573 Ga0070665_1011305732 235
591 3300005549 Ga0070704_100001917 Ga0070704_1000019172 235
592 3300005549 Ga0070704_100104467 Ga0070704_1001044672 235
593 3300005564 Ga0070664_100002934 Ga0070664_10000293412 235
594 3300005564 Ga0070664_100014397 Ga0070664_1000143976 235
595 3300005564 Ga0070664_100180771 Ga0070664_1001807712 235
596 3300005577 Ga0068857_100000358 Ga0068857_10000035812 235
597 3300005578 Ga0068854_100008663 Ga0068854_1000086635 235
598 3300005578 Ga0068854_100275369 Ga0068854_1002753692 235
599 3300005614 Ga0068856_100065255 Ga0068856_1000652552 235
600 3300005614 Ga0068856_100156786 Ga0068856_1001567862 235
601 3300005617 Ga0068859_100005591 Ga0068859_1000055913 235
602 3300005617 Ga0068859_100310219 Ga0068859_1003102192 235
603 3300005618 Ga0068864_100001988 Ga0068864_10000198814 235
604 3300005718 Ga0068866_10048931 Ga0068866_100489313 235
605 3300005719 Ga0068861_100001805 Ga0068861_1000018054 235
606 3300005840 Ga0068870_10000025 Ga0068870_1000002525 235
607 3300005841 Ga0068863_100002964 Ga0068863_10000296411 235
608 3300005842 Ga0068858_100003227 Ga0068858_10000322712 235
609 3300005842 Ga0068858_100558164 Ga0068858_1005581641 235
610 3300005937 Ga0081455_10002463 Ga0081455_1000246313 235
611 3300006028 Ga0070717_10506230 Ga0070717_105062302 235
612 3300006163 Ga0070715_10094663 Ga0070715_100946632 235
613 3300006163 Ga0070715_10165699 Ga0070715_101656992 235
614 3300006175 Ga0070712_100100946 Ga0070712_1001009462 235
615 3300006237 Ga0097621_100000456 Ga0097621_10000045611 235
616 3300006237 Ga0097621_100052081 Ga0097621_1000520814 235
617 3300006358 Ga0068871_100004245 Ga0068871_1000042459 235
618 3300006358 Ga0068871_100024937 Ga0068871_1000249374 235
619 3300006852 Ga0075433_10247616 Ga0075433_102476162 235
620 3300006871 Ga0075434_100004861 Ga0075434_10000486110 235
621 3300006871 Ga0075434_100105570 Ga0075434_1001055702 235
622 3300006871 Ga0075434_100143730 Ga0075434_1001437303 235
623 3300006931 Ga0097620_100005590 Ga0097620_10000559012 235
624 3300006931 Ga0097620_100310218 Ga0097620_1003102182 235
625 3300007076 Ga0075435_100050168 Ga0075435_1000501684 235
626 3300007076 Ga0075435_100079258 Ga0075435_1000792584 235
627 3300009098 Ga0105245_10224069 Ga0105245_102240692 235
628 3300009101 Ga0105247_10009563 Ga0105247_100095637 235
629 3300009101 Ga0105247_10012907 Ga0105247_100129074 235
630 3300009147 Ga0114129_10271211 Ga0114129_102712113 235
631 3300009176 Ga0105242_10081550 Ga0105242_100815503 235
632 3300009177 Ga0105248_10039630 Ga0105248_100396305 235
633 3300009177 Ga0105248_10554388 Ga0105248_105543882 235
634 3300009551 Ga0105238_10288067 Ga0105238_102880673 235
635 3300009553 Ga0105249_10135144 Ga0105249_101351443 235
636 3300010375 Ga0105239_10124653 Ga0105239_101246532 235
637 3300013102 Ga0157371_10089641 Ga0157371_100896413 235
638 3300013105 Ga0157369_10182437 Ga0157369_101824373 235
639 3300013296 Ga0157374_10113975 Ga0157374_101139753 235
640 3300013297 Ga0157378_10317747 Ga0157378_103177472 235
641 3300013306 Ga0163162_10320702 Ga0163162_103207022 235
642 3300013308 Ga0157375_10076811 Ga0157375_100768113 235
643 3300014325 Ga0163163_10001239 Ga0163163_1000123913 235
644 3300014968 Ga0157379_10004577 Ga0157379_100045773 235
645 3300014968 Ga0157379_10033161 Ga0157379_100331615 235
646 3300014969 Ga0157376_10028988 Ga0157376_100289885 235
647 3300017792 Ga0163161_10001492 Ga0163161_100014923 235
648 3300025271 Ga0207666_1000140 Ga0207666_10001403 235
649 3300025290 Ga0207673_1000714 Ga0207673_10007142 235
650 3300025893 Ga0207682_10000062 Ga0207682_100000623 235
651 3300025898 Ga0207692_10224337 Ga0207692_102243371 235
652 3300025900 Ga0207710_10004068 Ga0207710_100040683 235
653 3300025900 Ga0207710_10024743 Ga0207710_100247432 235
654 3300025900 Ga0207710_10264788 Ga0207710_102647881 235
655 3300025903 Ga0207680_10155059 Ga0207680_101550592 235
656 3300025904 Ga0207647_10003504 Ga0207647_1000350412 235
657 3300025905 Ga0207685_10125361 Ga0207685_101253612 235
658 3300025907 Ga0207645_10000248 Ga0207645_100002482 235
659 3300025907 Ga0207645_10049727 Ga0207645_100497272 235
660 3300025908 Ga0207643_10000064 Ga0207643_1000006463 235
661 3300025911 Ga0207654_10001623 Ga0207654_100016232 235
662 3300025914 Ga0207671_10007347 Ga0207671_100073474 235
663 3300025915 Ga0207693_10030951 Ga0207693_100309513 235
664 3300025916 Ga0207663_10018380 Ga0207663_100183804 235
665 3300025916 Ga0207663_10050733 Ga0207663_100507333 235
666 3300025917 Ga0207660_10000194 Ga0207660_1000019438 235
667 3300025919 Ga0207657_10006919 Ga0207657_1000691912 235
668 3300025919 Ga0207657_10033938 Ga0207657_100339384 235
669 3300025920 Ga0207649_10000234 Ga0207649_100002347 235
670 3300025921 Ga0207652_10001613 Ga0207652_1000161321 235
671 3300025922 Ga0207646_10560944 Ga0207646_105609442 235
672 3300025923 Ga0207681_10000794 Ga0207681_100007943 235
673 3300025924 Ga0207694_10733360 Ga0207694_107333602 235
674 3300025925 Ga0207650_10056285 Ga0207650_100562853 235
675 3300025926 Ga0207659_10000172 Ga0207659_100001727 235
676 3300025927 Ga0207687_10008699 Ga0207687_100086998 235
677 3300025927 Ga0207687_10024271 Ga0207687_100242714 235
678 3300025928 Ga0207700_10148256 Ga0207700_101482563 235
679 3300025929 Ga0207664_10021143 Ga0207664_100211432 235
680 3300025931 Ga0207644_10000439 Ga0207644_1000043912 235
681 3300025931 Ga0207644_10075967 Ga0207644_100759672 235
682 3300025932 Ga0207690_10000796 Ga0207690_100007963 235
683 3300025933 Ga0207706_10005059 Ga0207706_100050592 235
684 3300025934 Ga0207686_10001093 Ga0207686_100010932 235
685 3300025934 Ga0207686_10117395 Ga0207686_101173952 235
686 3300025935 Ga0207709_10001438 Ga0207709_100014383 235
687 3300025936 Ga0207670_10000807 Ga0207670_1000080717 235
688 3300025936 Ga0207670_10104223 Ga0207670_101042231 235
689 3300025937 Ga0207669_10000141 Ga0207669_1000014134 235
690 3300025938 Ga0207704_10000755 Ga0207704_1000075516 235
691 3300025938 Ga0207704_10487023 Ga0207704_104870231 235
692 3300025941 Ga0207711_10006747 Ga0207711_100067472 235
693 3300025941 Ga0207711_10071197 Ga0207711_100711972 235
694 3300025941 Ga0207711_10461921 Ga0207711_104619212 235
695 3300025942 Ga0207689_10004430 Ga0207689_100044303 235
696 3300025944 Ga0207661_10000098 Ga0207661_100000989 235
697 3300025945 Ga0207679_10000174 Ga0207679_1000017410 235
698 3300025945 Ga0207679_10166636 Ga0207679_101666361 235
699 3300025960 Ga0207651_10000782 Ga0207651_100007824 235
700 3300025961 Ga0207712_10000659 Ga0207712_1000065912 235
701 3300025961 Ga0207712_10781975 Ga0207712_107819751 235
702 3300025972 Ga0207668_10001107 Ga0207668_100011072 235
703 3300025981 Ga0207640_10000846 Ga0207640_100008462 235
704 3300025986 Ga0207658_10186912 Ga0207658_101869122 235
705 3300026023 Ga0207677_10031190 Ga0207677_100311904 235
706 3300026035 Ga0207703_10002433 Ga0207703_1000243312 235
707 3300026067 Ga0207678_10001059 Ga0207678_1000105912 235
708 3300026067 Ga0207678_10236838 Ga0207678_102368382 235
709 3300026075 Ga0207708_10002793 Ga0207708_1000279312 235
710 3300026078 Ga0207702_10089635 Ga0207702_100896352 235
711 3300026078 Ga0207702_10241850 Ga0207702_102418502 235
712 3300026088 Ga0207641_10000622 Ga0207641_100006227 235
713 3300026089 Ga0207648_10031513 Ga0207648_100315135 235
714 3300026089 Ga0207648_10118031 Ga0207648_101180313 235
715 3300026095 Ga0207676_10002696 Ga0207676_1000269613 235
716 3300026116 Ga0207674_10001342 Ga0207674_1000134212 235
717 3300026121 Ga0207683_10001193 Ga0207683_1000119314 235
718 3300026121 Ga0207683_10039243 Ga0207683_100392432 235
719 3300026142 Ga0207698_10016429 Ga0207698_100164295 235
720 3300027543 Ga0209999_1006731 Ga0209999_10067313 235
721 3300027614 Ga0209970_1007996 Ga0209970_10079962 235
722 3300027617 Ga0210002_1021945 Ga0210002_10219452 235
723 3300027665 Ga0209983_1024340 Ga0209983_10243402 235
724 3300027682 Ga0209971_1000957 Ga0209971_10009577 235
725 3300027695 Ga0209966_1008911 Ga0209966_10089112 235
726 3300027907 Ga0207428_10000513 Ga0207428_1000051344 235
727 3300027907 Ga0207428_10000626 Ga0207428_1000062629 235
728 3300027907 Ga0207428_10236088 Ga0207428_102360882 235
729 3300028379 Ga0268266_10071484 Ga0268266_100714843 235
730 3300028380 Ga0268265_10002370 Ga0268265_1000237016 235
731 3300028381 Ga0268264_10004444 Ga0268264_1000444412 235
732 3300031249 Ga0265339_10054727 Ga0265339_100547273 235
733 3300031595 Ga0265313_10018002 Ga0265313_100180023 235
734 3300034816 Ga0373930_0000172 Ga0373930_0000172_4474_5181 235
735 3300034816 Ga0373930_0043872 Ga0373930_0043872_10_720 235
736 3300034817 Ga0373948_0000049 Ga0373948_0000049_12203_12910 235
737 3300034820 Ga0373959_0004938 Ga0373959_0004938_1167_1874 235
738 3300034957 Ga0373938_0000119 Ga0373938_0000119_8562_9269 235
739 3300035083 Ga0373926_0059986 Ga0373926_0059986_132_839 235
740 3300035084 Ga0373928_0000148 Ga0373928_0000148_3489_4196 235
741 3300035085 Ga0373929_0001447 Ga0373929_0001447_254_961 235
742 3300035086 Ga0373934_0005597 Ga0373934_0005597_3508_4245 235
743 3300035086 Ga0373934_0011264 Ga0373934_0011264_2272_2979 235
744 3300035088 Ga0373940_0001153 Ga0373940_0001153_353_1060 235
745 3300035090 Ga0373949_0000443 Ga0373949_0000443_13095_13802 235
746 3300035091 Ga0373951_0000403 Ga0373951_0000403_8690_9397 235
747 3300035092 Ga0373952_0002943 Ga0373952_0002943_1843_2550 235
748 3300035111 Ga0373923_0052325 Ga0373923_0052325_852_1559 235
749 3300035111 Ga0373923_0061558 Ga0373923_0061558_415_1152 235
750 3300035115 Ga0373941_0000259 Ga0373941_0000259_1606_2313 235
751 3300035116 Ga0373945_0129330 Ga0373945_0129330_224_931 235
752 3300035117 Ga0373953_0000832 Ga0373953_0000832_3581_4288 235
753 3300035117 Ga0373953_0193681 Ga0373953_0193681_96_833 235
754 3300035118 Ga0373954_0006437 Ga0373954_0006437_2883_3590 235
755 3300035119 Ga0373956_0002668 Ga0373956_0002668_2496_3203 235
756 3300035120 Ga0373957_0046077 Ga0373957_0046077_811_1548 235
757 3300035170 Ga0373943_0015417 Ga0373943_0015417_1564_2301 235
758 3300035170 Ga0373943_0035562 Ga0373943_0035562_575_1282 235
759 3300035171 Ga0373946_0034727 Ga0373946_0034727_703_1410 235
760 3300035172 Ga0373955_0002931 Ga0373955_0002931_383_1120 235
761 3300035172 Ga0373955_0003085 Ga0373955_0003085_1639_2346 235
762 3300035207 Ga0373942_0003780 Ga0373942_0003780_974_1684 235
763 3300035241 Ga0373961_0008049 Ga0373961_0008049_686_1393 235
764 3300035242 Ga0373962_0005737 Ga0373962_0005737_301_1008 235
765 3300035410 Ga0373924_0010074 Ga0373924_0010074_344_1081 235
766 3300035410 Ga0373924_0142968 Ga0373924_0142968_175_882 235
767 3300035692 Ga0373935_0041739 Ga0373935_0041739_656_1393 235
768 3300035692 Ga0373935_0053048 Ga0373935_0053048_109_816 235
769 3300035692 Ga0373935_0276952 Ga0373935_0276952_250_957 235
770 3300035695 Ga0373927_0065939 Ga0373927_0065939_1273_1980 235
771 3300035724 Ga0373933_0001174 Ga0373933_0001174_309_1046 235
772 3300035724 Ga0373933_0011554 Ga0373933_0011554_2435_3142 235
773 3300035725 Ga0373947_0099621 Ga0373947_0099621_465_1172 235
774 3300036401 Ga0373937_0000887 Ga0373937_0000887_7496_8233 235
775 3300036401 Ga0373937_0004926 Ga0373937_0004926_3033_3740 235
776 3300037068 Ga0373925_0113397 Ga0373925_0113397_1273_1980 235
777 3300041408 Ga0439453_0006113 Ga0439453_0006113_555_1262 235
778 3300042008 Ga0439450_004177 Ga0439450_004177_614_1321 235
779 3300042012 Ga0439455_0047916 Ga0439455_0047916_382_1089 235
780 3300042439 Ga0439464_0019328 Ga0439464_0019328_615_1322 235
781 3300042461 Ga0439460_0036225 Ga0439460_0036225_211_918 235
782 3300044712 Ga0453684_0067523 Ga0453684_0067523_1741_2448 235
783 3300046454 Ga0495592_0012894 Ga0495592_0012894_669_1376 235
784 3300046459 Ga0495629_0014928 Ga0495629_0014928_1395_2132 235
785 3300046462 Ga0495651_0000419 Ga0495651_0000419_20550_21287 235
786 3300046462 Ga0495651_0016376 Ga0495651_0016376_2348_3055 235
787 3300046463 Ga0495653_0006076 Ga0495653_0006076_1211_1918 235
788 3300046472 Ga0495580_0112900 Ga0495580_0112900_109_816 235
789 3300046476 Ga0495662_0029468 Ga0495662_0029468_1765_2502 235
790 3300046477 Ga0495664_0079552 Ga0495664_0079552_706_1413 235
791 3300046511 Ga0495608_0000557 Ga0495608_0000557_6341_7048 235
792 3300046511 Ga0495608_0003247 Ga0495608_0003247_1690_2427 235
793 3300046514 Ga0495618_0022293 Ga0495618_0022293_2827_3534 235
794 3300046514 Ga0495618_0110801 Ga0495618_0110801_889_1596 235
795 3300046516 Ga0495628_0064458 Ga0495628_0064458_1493_2200 235
796 3300046517 Ga0495630_0129581 Ga0495630_0129581_105_812 235
797 3300046517 Ga0495630_0400518 Ga0495630_0400518_90_797 235
798 3300046529 Ga0495652_0004247 Ga0495652_0004247_8206_8913 235
799 3300046529 Ga0495652_0427069 Ga0495652_0427069_149_856 235
800 3300046531 Ga0495665_0094704 Ga0495665_0094704_429_1136 235
801 3300046533 Ga0495640_0004068 Ga0495640_0004068_10213_10950 235
802 3300046533 Ga0495640_0006625 Ga0495640_0006625_6388_7095 235
803 3300046535 Ga0495586_0013094 Ga0495586_0013094_3207_3914 235
804 3300046536 Ga0495587_0000884 Ga0495587_0000884_18763_19500 235
805 3300046536 Ga0495587_0004155 Ga0495587_0004155_6078_6785 235
806 3300046543 Ga0495645_0002731 Ga0495645_0002731_8080_8787 235
807 3300046543 Ga0495645_0008028 Ga0495645_0008028_733_1470 235
808 3300046559 Ga0495667_0001476 Ga0495667_0001476_12197_12934 235
809 3300046559 Ga0495667_0002899 Ga0495667_0002899_4709_5416 235
810 3300046642 Ga0495634_0000880 Ga0495634_0000880_11325_12062 235
811 3300046642 Ga0495634_0033896 Ga0495634_0033896_2014_2721 235
812 3300046663 Ga0495635_0007077 Ga0495635_0007077_4077_4784 235
813 3300046675 Ga0495657_0006177 Ga0495657_0006177_3890_4597 235
814 3300046678 Ga0495599_0003181 Ga0495599_0003181_7918_8655 235
815 3300046678 Ga0495599_0020964 Ga0495599_0020964_2699_3406 235
816 3300046679 Ga0495623_0001616 Ga0495623_0001616_6569_7276 235
817 3300046679 Ga0495623_0004039 Ga0495623_0004039_8655_9392 235
818 3300046680 Ga0495646_0001738 Ga0495646_0001738_1407_2144 235
819 3300046680 Ga0495646_0005955 Ga0495646_0005955_5117_5824 235
820 3300046681 Ga0495647_0176918 Ga0495647_0176918_132_839 235
821 3300046689 Ga0495613_0044676 Ga0495613_0044676_2042_2749 235
822 3300046690 Ga0495624_0065820 Ga0495624_0065820_954_1661 235
823 3300046809 Ga0495600_0001126 Ga0495600_0001126_12451_13188 235
824 3300046809 Ga0495600_0061021 Ga0495600_0061021_683_1390 235
825 3300047315 Ga0495581_0170358 Ga0495581_0170358_319_1026 235
826 3300047317 Ga0495604_0000388 Ga0495604_0000388_26315_27052 235
827 3300047317 Ga0495604_0003734 Ga0495604_0003734_5835_6542 235
828 3300047319 Ga0495674_0003431 Ga0495674_0003431_6541_7278 235
829 3300047319 Ga0495674_0025645 Ga0495674_0025645_1996_2703 235
830 3300047322 Ga0495680_0016395 Ga0495680_0016395_2141_2878 235
831 3300047322 Ga0495680_0040619 Ga0495680_0040619_132_839 235
832 3300047444 Ga0495675_0000740 Ga0495675_0000740_3033_3740 235
833 3300047444 Ga0495675_0001614 Ga0495675_0001614_11823_12560 235
834 3300047471 Ga0495684_0003551 Ga0495684_0003551_3148_3885 235
835 3300047471 Ga0495684_0021577 Ga0495684_0021577_4016_4723 235
836 3300047471 Ga0495684_0478386 Ga0495684_0478386_48_755 235
837 3300048088 Ga0495602_0002218 Ga0495602_0002218_17346_18053 235
838 3300048088 Ga0495602_0011547 Ga0495602_0011547_6001_6738 235
839 3300048089 Ga0495614_0151859 Ga0495614_0151859_109_816 235
840 3300048903 Ga0496100_0024478 Ga0496100_0024478_1418_2125 235
841 3300048905 Ga0496102_0040672 Ga0496102_0040672_1235_1942 235
842 3300048907 Ga0496104_0062693 Ga0496104_0062693_296_1003 235
843 3300048907 Ga0496104_0642819 Ga0496104_0642819_46_753 235
844 3300048908 Ga0496105_0115477 Ga0496105_0115477_366_1073 235
845 3300048909 Ga0496106_0023808 Ga0496106_0023808_2715_3422 235
846 3300048909 Ga0496106_0101982 Ga0496106_0101982_492_1202 235
847 3300048909 Ga0496106_0115921 Ga0496106_0115921_739_1446 235
848 3300048910 Ga0496107_0013175 Ga0496107_0013175_1876_2583 235
849 3300048910 Ga0496107_0040023 Ga0496107_0040023_1360_2070 235
850 3300048911 Ga0496108_0008033 Ga0496108_0008033_5460_6170 235
851 3300048912 Ga0496109_0005044 Ga0496109_0005044_421_1128 235
852 3300048913 Ga0496110_0108269 Ga0496110_0108269_1307_2014 235
853 3300048913 Ga0496110_0127504 Ga0496110_0127504_324_1034 235
854 3300048917 Ga0496114_0030068 Ga0496114_0030068_1065_1772 235
855 3300048918 Ga0496115_0089728 Ga0496115_0089728_265_972 235
856 3300049571 Ga0501034_0293529 Ga0501034_0293529_187_900 235
857 3300049571 Ga0501034_0380635 Ga0501034_0380635_172_888 235
858 3300049574 Ga0501038_0569430 Ga0501038_0569430_81_788 235
859 3300049586 Ga0501070_0214907 Ga0501070_0214907_571_1284 235
860 3300050490 nmdc:mga03n38_82410_c1 nmdc:mga03n38_82410_c1_789_1496 235
861 3300050507 nmdc:mga05p37_227168_c1 nmdc:mga05p37_227168_c1_1249_1974 235
862 3300050512 nmdc:mga0n895_334522_c1 nmdc:mga0n895_334522_c1_609_1316 235
863 3300050512 nmdc:mga0n895_4199_c1 nmdc:mga0n895_4199_c1_528_1241 235
864 3300050512 nmdc:mga0n895_75564_c1 nmdc:mga0n895_75564_c1_1978_2688 235
865 3300050512 nmdc:mga0n895_824194_c1 nmdc:mga0n895_824194_c1_172_882 235
866 3300050513 nmdc:mga0rr50_217615_c1 nmdc:mga0rr50_217615_c1_112_822 235
867 3300050515 nmdc:mga0a205_14086_c1 nmdc:mga0a205_14086_c1_4490_5203 235
868 3300053077 Ga0495601_0017682 Ga0495601_0017682_2827_3534 235
869 3300053077 Ga0495601_0069786 Ga0495601_0069786_657_1394 235
870 3300053078 Ga0495612_0004845 Ga0495612_0004845_797_1504 235
871 3300053078 Ga0495612_0008244 Ga0495612_0008244_2528_3265 235
872 3300053084 Ga0495595_0000976 Ga0495595_0000976_6087_6794 235
873 3300053084 Ga0495595_0021904 Ga0495595_0021904_1801_2538 235
874 3300053085 Ga0495619_0011111 Ga0495619_0011111_3490_4227 235
875 3300053085 Ga0495619_0012012 Ga0495619_0012012_1138_1845 235
876 3300053085 Ga0495619_0036703 Ga0495619_0036703_237_944 235
877 3300053096 Ga0500641_0008962 Ga0500641_0008962_1585_2298 235
878 3300054114 Ga0501084_0140956 Ga0501084_0140956_1060_1767 235
879 3300060353 Ga0501082_0053986 Ga0501082_0053986_370_1083 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

37

214

0.78

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

34

208

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ef7-assembly1.cif.gz_A crystal structure of xanthosine monophosphate phosphatase complex with xmp 0.8795 15 233
7ef6-assembly1.cif.gz_A crystal structure of xanthosine monophosphate phosphatase in the unliganded state 0.8638 15 234
3onn-assembly1.cif.gz_A crystal structure of 5'-nucleotidase sdt1 from saccharomyces cerevisiae 0.8539 8 233
3opx-assembly1.cif.gz_A crystal structure of pyrimidine 5 -nucleotidase sdt1 from saccharomyces cerevisiae complexed with uridine 5'-monophosphate 0.8205 8 233
3onn-assembly1.cif.gz_A crystal structure of 5'-nucleotidase sdt1 from saccharomyces cerevisiae 0.8192 8 233
ID Description Score Start End Superfamily
3opxA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.9143 30 95 1.10.150.450
af_K7KDK8_16_102_3.30.70.1620 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9138 20 97 3.30.70.1620
af_Q4E4C3_1_85_1.10.150.450 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.8905 21 90 1.10.150.450
af_Q54B74_103_232_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8798 97 235 3.40.50.1000
af_P53078_30_280_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8604 8 232 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A0N8PS06-F1-model_v4 Pyrimidine 5'-nucleotidase 0.9852 15 174 GO:0006206
GO:0008252
GO:0009166
AF-A0A383DXP7-F1-model_v4 Pyrimidine 5'-nucleotidase 0.9843 12 151
AF-A0A3S1WCW2-F1-model_v4 deleted 0.9831 12 194
AF-A0A7W5Z492-F1-model_v4 Putative hydrolase of the HAD superfamily 0.982 12 232 GO:0016787
AF-A0A530AQA5-F1-model_v4 Pyrimidine 5'-nucleotidase 0.9814 12 165

Feature Viewer

pLDDT pTM Quality
91.22 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map