F484459
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 879 | 505 | 1758 | 306 |
Family's Representative Sequence
| Representative Sequence | 3300021377|Ga0213874_10002639|Ga0213874_100026393 |
| Length | 321 |
| Sequence | MCARAGSLGDGRPMPRLSVREMSFAAIIVVALAAALPFFVSDYVLGVLTPGFYIAVFAMAWDLLFGFANEVNFGPTFLIGLGAYAAGIIDNRLGWAIWLCVAAGTAAAVAGGLVLALPALRVRGPYFGLTTLVAVLILSNLIVVFADLTGGEIGLTVPDVISIDAHANYWIALGFMSASGAILFALSRSPMGLILQASGQDAVQAGALGFNVTKHKLAAFTISAFFSGLAGALYVFYLGAASVGTLVDVTVGVQVIIAAVLGGRRTILGAALGAIFLIGATEALRPLGELATLVVSAVALLIVLFFPNGLLALIARIGGRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 2 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 3 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 5 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 52 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 53 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 54 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 55 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 59 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 60 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 66 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 90 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 91 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 92 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 93 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 94 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 145 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 146 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 147 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 148 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 153 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 155 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 156 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 157 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 158 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 159 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 161 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 162 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 164 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 165 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 166 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 167 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 168 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 169 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 170 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 171 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 172 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 174 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 176 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 178 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 182 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 184 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 185 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 186 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 187 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 188 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 189 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 190 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 191 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 192 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 193 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 194 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 195 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 196 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 197 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 198 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 199 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 200 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 201 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 202 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 203 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 204 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 205 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 206 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 253 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 254 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 255 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 258 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 259 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 260 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 261 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 262 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 263 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 264 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 265 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 266 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 267 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 268 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 269 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 270 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 299 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 300 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 301 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 302 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 303 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 304 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 307 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 313 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 314 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 315 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 316 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 317 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 318 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 319 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 320 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 321 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 322 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 323 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 324 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 325 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 326 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 327 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 328 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 329 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 330 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 331 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 332 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 334 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 335 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 336 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 337 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 338 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 339 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 340 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 341 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 342 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 343 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 344 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 345 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 346 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 347 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 348 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 349 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 350 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 351 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 352 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 353 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 354 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 355 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 356 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 357 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 358 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 359 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 360 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 361 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 362 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 363 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 364 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 365 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 366 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 367 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 368 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 369 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 370 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 371 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 372 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 373 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 374 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 375 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 376 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 377 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 378 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 379 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 380 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 381 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 382 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 383 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 384 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 385 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 386 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 387 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 388 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 389 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 390 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 391 | 2904699407 | |||
| 392 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 393 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 394 | 2906610324 | |||
| 395 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 396 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 397 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 398 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 399 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 400 | 2922368715 | |||
| 401 | 2922425934 | |||
| 402 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 403 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 404 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 405 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 406 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 407 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 408 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 409 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 410 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 411 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 412 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 413 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 414 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 415 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 416 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 417 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 418 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 419 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 420 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 421 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 422 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 423 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 424 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 425 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 426 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 427 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 428 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 429 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 430 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 431 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 432 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 433 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 434 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 435 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 436 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 437 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 438 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 439 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 440 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 441 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 442 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 443 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 444 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 445 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 446 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 447 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 448 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 449 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 450 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 451 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 452 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 453 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 454 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 455 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 456 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 457 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 458 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 459 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 460 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 461 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 462 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 463 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 464 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 465 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 466 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 467 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 468 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 469 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 470 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 471 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 472 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 473 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 474 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 475 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 476 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 477 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 478 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 479 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 480 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 481 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 482 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 483 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 484 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 485 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 486 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 487 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 488 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 489 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 490 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 491 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 492 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 493 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 494 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 495 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 496 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 497 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 498 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 499 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 500 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 501 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 502 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 503 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 504 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 505 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.23 |
| Metatranscriptomes | 0.46 |
| Isolates | 19.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.28 |
| Nodule | 16.95 |
| Rhizoplane | 3.64 |
| Rhizosphere | 60.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0213874_10002639 | 3300021377 | Bacteria | 3888 |
| 2 | JGI25165J46597_1006767 | 3300003214 | Bacteria | 1992 |
| 3 | JGI25160J50197_1007582 | 3300003354 | Bacteria | 4232 |
| 4 | Ga0055543_1013756 | 3300004625 | Bacteria | 1592 |
| 5 | Ga0065165_1004374 | 3300005262 | Bacteria | 8825 |
| 6 | Ga0070658_10056239 | 3300005327 | Bacteria | 3197 |
| 7 | Ga0070676_10289184 | 3300005328 | Bacteria | 1107 |
| 8 | Ga0070683_100001891 | 3300005329 | Bacteria | 16357 |
| 9 | Ga0070683_100019924 | 3300005329 | Bacteria | 5963 |
| 10 | Ga0070683_100072047 | 3300005329 | Bacteria | 3225 |
| 11 | Ga0070683_100658453 | 3300005329 | Bacteria | 1003 |
| 12 | Ga0068869_100001186 | 3300005334 | Bacteria | 15287 |
| 13 | Ga0070680_100016775 | 3300005336 | Bacteria | 5763 |
| 14 | Ga0070680_100195987 | 3300005336 | Bacteria | 1703 |
| 15 | Ga0070680_100312437 | 3300005336 | Bacteria | 1334 |
| 16 | Ga0070682_100056630 | 3300005337 | Bacteria | 2466 |
| 17 | Ga0070682_100316334 | 3300005337 | Bacteria | 1151 |
| 18 | Ga0068868_100002380 | 3300005338 | Bacteria | 13017 |
| 19 | Ga0070689_100090026 | 3300005340 | Bacteria | 2417 |
| 20 | Ga0070691_10186651 | 3300005341 | Bacteria | 1082 |
| 21 | Ga0070668_100008952 | 3300005347 | Bacteria | 7432 |
| 22 | Ga0070674_100161557 | 3300005356 | Bacteria | 1700 |
| 23 | Ga0070659_100051334 | 3300005366 | Bacteria | 3243 |
| 24 | Ga0070659_100256937 | 3300005366 | Bacteria | 1449 |
| 25 | Ga0070667_100362682 | 3300005367 | Bacteria | 1314 |
| 26 | Ga0070709_10002013 | 3300005434 | Bacteria | 11043 |
| 27 | Ga0070709_10005865 | 3300005434 | Bacteria | 6660 |
| 28 | Ga0070714_100006313 | 3300005435 | Bacteria | 9137 |
| 29 | Ga0070714_100041770 | 3300005435 | Bacteria | 3872 |
| 30 | Ga0070714_100173398 | 3300005435 | Bacteria | 1958 |
| 31 | Ga0070713_100004655 | 3300005436 | Bacteria | 9259 |
| 32 | Ga0070713_100039500 | 3300005436 | Bacteria | 3831 |
| 33 | Ga0070713_100164699 | 3300005436 | Bacteria | 1982 |
| 34 | Ga0070710_10000896 | 3300005437 | Bacteria | 14247 |
| 35 | Ga0070710_10002832 | 3300005437 | Bacteria | 8268 |
| 36 | Ga0070701_10083906 | 3300005438 | Bacteria | 1731 |
| 37 | Ga0070711_100007213 | 3300005439 | Bacteria | 6752 |
| 38 | Ga0070711_100008957 | 3300005439 | Bacteria | 6142 |
| 39 | Ga0070711_100093101 | 3300005439 | Bacteria | 2175 |
| 40 | Ga0070711_100119075 | 3300005439 | Bacteria | 1950 |
| 41 | Ga0070663_100033127 | 3300005455 | Bacteria | 3567 |
| 42 | Ga0070663_100036834 | 3300005455 | Bacteria | 3401 |
| 43 | Ga0070662_100132585 | 3300005457 | Bacteria | 1923 |
| 44 | Ga0070681_10076300 | 3300005458 | Bacteria | 3310 |
| 45 | Ga0070681_10146085 | 3300005458 | Bacteria | 2294 |
| 46 | Ga0070681_10315190 | 3300005458 | Bacteria | 1473 |
| 47 | Ga0070681_10493869 | 3300005458 | Bacteria | 1137 |
| 48 | Ga0070681_10511038 | 3300005458 | Bacteria | 1115 |
| 49 | Ga0070706_100118744 | 3300005467 | Bacteria | 2464 |
| 50 | Ga0070707_100171685 | 3300005468 | Bacteria | 2113 |
| 51 | Ga0070679_100029796 | 3300005530 | Bacteria | 5384 |
| 52 | Ga0070679_100291008 | 3300005530 | Bacteria | 1585 |
| 53 | Ga0070679_100316505 | 3300005530 | Bacteria | 1510 |
| 54 | Ga0070684_100010920 | 3300005535 | Bacteria | 7217 |
| 55 | Ga0070684_100052866 | 3300005535 | Bacteria | 3534 |
| 56 | Ga0070697_100093961 | 3300005536 | Bacteria | 2484 |
| 57 | Ga0068853_100035551 | 3300005539 | Bacteria | 4232 |
| 58 | Ga0068853_100169342 | 3300005539 | Bacteria | 1975 |
| 59 | Ga0070686_100053425 | 3300005544 | Bacteria | 2580 |
| 60 | Ga0070665_100012340 | 3300005548 | Bacteria | 8611 |
| 61 | Ga0070665_100035823 | 3300005548 | Bacteria | 4992 |
| 62 | Ga0068855_100040104 | 3300005563 | Bacteria | 5558 |
| 63 | Ga0068855_100072657 | 3300005563 | Bacteria | 3998 |
| 64 | Ga0068855_100077687 | 3300005563 | Bacteria | 3852 |
| 65 | Ga0068855_100097896 | 3300005563 | Bacteria | 3379 |
| 66 | Ga0068855_100328828 | 3300005563 | Bacteria | 1688 |
| 67 | Ga0068855_100342315 | 3300005563 | Bacteria | 1649 |
| 68 | Ga0068855_100425519 | 3300005563 | Bacteria | 1452 |
| 69 | Ga0070664_100026724 | 3300005564 | Bacteria | 4791 |
| 70 | Ga0070664_100152168 | 3300005564 | Bacteria | 2043 |
| 71 | Ga0070664_100410739 | 3300005564 | Bacteria | 1239 |
| 72 | Ga0068857_100017610 | 3300005577 | Bacteria | 6264 |
| 73 | Ga0068857_100028282 | 3300005577 | Bacteria | 4946 |
| 74 | Ga0068854_100097839 | 3300005578 | Bacteria | 2194 |
| 75 | Ga0068856_100000183 | 3300005614 | Bacteria | 65005 |
| 76 | Ga0068856_100029563 | 3300005614 | Bacteria | 5352 |
| 77 | Ga0068856_100063430 | 3300005614 | Bacteria | 3651 |
| 78 | Ga0068852_100053488 | 3300005616 | Bacteria | 3475 |
| 79 | Ga0068852_100230989 | 3300005616 | Bacteria | 1763 |
| 80 | Ga0068859_100063595 | 3300005617 | Bacteria | 3721 |
| 81 | Ga0068864_100049226 | 3300005618 | Bacteria | 3625 |
| 82 | Ga0068864_100122039 | 3300005618 | Bacteria | 2331 |
| 83 | Ga0068861_100042059 | 3300005719 | Bacteria | 3424 |
| 84 | Ga0068870_10004287 | 3300005840 | Bacteria | 6137 |
| 85 | Ga0068863_100027853 | 3300005841 | Bacteria | 5394 |
| 86 | Ga0068858_100041385 | 3300005842 | Bacteria | 4272 |
| 87 | Ga0068858_100589553 | 3300005842 | Bacteria | 1078 |
| 88 | Ga0068860_100093295 | 3300005843 | Bacteria | 2869 |
| 89 | Ga0081540_1002227 | 3300005983 | Bacteria | 15974 |
| 90 | Ga0081540_1005198 | 3300005983 | Bacteria | 9740 |
| 91 | Ga0081540_1006571 | 3300005983 | Bacteria | 8437 |
| 92 | Ga0081540_1006785 | 3300005983 | Bacteria | 8274 |
| 93 | Ga0081540_1018573 | 3300005983 | Bacteria | 4259 |
| 94 | Ga0070717_10087311 | 3300006028 | Bacteria | 2627 |
| 95 | Ga0070717_10429945 | 3300006028 | Bacteria | 1188 |
| 96 | Ga0075365_10059561 | 3300006038 | Bacteria | 2545 |
| 97 | Ga0075368_10019062 | 3300006042 | Bacteria | 2587 |
| 98 | Ga0075363_100010158 | 3300006048 | Bacteria | 4453 |
| 99 | Ga0075363_100048514 | 3300006048 | Bacteria | 2258 |
| 100 | Ga0075364_10024619 | 3300006051 | Bacteria | 3824 |
| 101 | Ga0075364_10295801 | 3300006051 | Bacteria | 1102 |
| 102 | Ga0070715_10000456 | 3300006163 | Bacteria | 10562 |
| 103 | Ga0070716_100011137 | 3300006173 | Bacteria | 4526 |
| 104 | Ga0070716_100023798 | 3300006173 | Bacteria | 3253 |
| 105 | Ga0070712_100015504 | 3300006175 | Bacteria | 4912 |
| 106 | Ga0075367_10001130 | 3300006178 | Bacteria | 11093 |
| 107 | Ga0075369_10005353 | 3300006186 | Bacteria | 4787 |
| 108 | Ga0075366_10016316 | 3300006195 | Bacteria | 4268 |
| 109 | Ga0075370_10009564 | 3300006353 | Bacteria | 5039 |
| 110 | Ga0075370_10017687 | 3300006353 | Bacteria | 3854 |
| 111 | Ga0068865_100055253 | 3300006881 | Bacteria | 2762 |
| 112 | Ga0075436_100088588 | 3300006914 | Bacteria | 2150 |
| 113 | Ga0097620_100063592 | 3300006931 | Bacteria | 3721 |
| 114 | Ga0099824_1021709 | 3300006942 | Bacteria | 4410 |
| 115 | Ga0099824_1033210 | 3300006942 | Bacteria | 1768 |
| 116 | Ga0099822_1024226 | 3300006943 | Bacteria | 5463 |
| 117 | Ga0105240_10039694 | 3300009093 | Bacteria | 6026 |
| 118 | Ga0105240_10109427 | 3300009093 | Bacteria | 3346 |
| 119 | Ga0105240_10121920 | 3300009093 | Bacteria | 3138 |
| 120 | Ga0105240_10135701 | 3300009093 | Bacteria | 2947 |
| 121 | Ga0105240_10276799 | 3300009093 | Bacteria | 1930 |
| 122 | Ga0111539_10714684 | 3300009094 | Bacteria | 1166 |
| 123 | Ga0105245_10005441 | 3300009098 | Bacteria | 11187 |
| 124 | Ga0105245_10038994 | 3300009098 | Bacteria | 4228 |
| 125 | Ga0105247_10005785 | 3300009101 | Bacteria | 7742 |
| 126 | Ga0105247_10240256 | 3300009101 | Bacteria | 1234 |
| 127 | Ga0105243_10042185 | 3300009148 | Bacteria | 3571 |
| 128 | Ga0105241_10037493 | 3300009174 | Bacteria | 3652 |
| 129 | Ga0105241_10211105 | 3300009174 | Bacteria | 1626 |
| 130 | Ga0105248_10646336 | 3300009177 | Bacteria | 1193 |
| 131 | Ga0105237_10017339 | 3300009545 | Bacteria | 7466 |
| 132 | Ga0105237_10095319 | 3300009545 | Bacteria | 2965 |
| 133 | Ga0105237_10138567 | 3300009545 | Bacteria | 2427 |
| 134 | Ga0105237_10298145 | 3300009545 | Bacteria | 1615 |
| 135 | Ga0105238_10142049 | 3300009551 | Bacteria | 2377 |
| 136 | Ga0105238_10398268 | 3300009551 | Bacteria | 1370 |
| 137 | Ga0099796_10010555 | 3300010159 | Bacteria | 2543 |
| 138 | Ga0105239_10003963 | 3300010375 | Bacteria | 17936 |
| 139 | Ga0105239_10109809 | 3300010375 | Bacteria | 3057 |
| 140 | Ga0105239_10546926 | 3300010375 | Bacteria | 1318 |
| 141 | Ga0105246_10379968 | 3300011119 | Bacteria | 1167 |
| 142 | Ga0157371_10237967 | 3300013102 | Bacteria | 1309 |
| 143 | Ga0157370_10097584 | 3300013104 | Bacteria | 2756 |
| 144 | Ga0157370_10205900 | 3300013104 | Bacteria | 1824 |
| 145 | Ga0157370_10338421 | 3300013104 | Bacteria | 1387 |
| 146 | Ga0157370_10357736 | 3300013104 | Bacteria | 1345 |
| 147 | Ga0157369_10012373 | 3300013105 | Bacteria | 9688 |
| 148 | Ga0157369_10026071 | 3300013105 | Bacteria | 6485 |
| 149 | Ga0157369_10083698 | 3300013105 | Bacteria | 3411 |
| 150 | Ga0157374_10634738 | 3300013296 | Bacteria | 1079 |
| 151 | Ga0157378_10172127 | 3300013297 | Bacteria | 2031 |
| 152 | Ga0163162_10025402 | 3300013306 | Bacteria | 5853 |
| 153 | Ga0163162_10146465 | 3300013306 | Bacteria | 2478 |
| 154 | Ga0157372_10034737 | 3300013307 | Bacteria | 5546 |
| 155 | Ga0157372_10048052 | 3300013307 | Bacteria | 4743 |
| 156 | Ga0157372_10326057 | 3300013307 | Bacteria | 1788 |
| 157 | Ga0157375_10011636 | 3300013308 | Bacteria | 7774 |
| 158 | Ga0163163_10007610 | 3300014325 | Bacteria | 9569 |
| 159 | Ga0163163_10073797 | 3300014325 | Bacteria | 3403 |
| 160 | Ga0157376_10153431 | 3300014969 | Bacteria | 2080 |
| 161 | Ga0213873_10000846 | 3300021358 | Bacteria | 4931 |
| 162 | Ga0213872_10000429 | 3300021361 | Bacteria | 34403 |
| 163 | Ga0213872_10004083 | 3300021361 | Bacteria | 7859 |
| 164 | Ga0213872_10004694 | 3300021361 | Bacteria | 7180 |
| 165 | Ga0213872_10016051 | 3300021361 | Bacteria | 3478 |
| 166 | Ga0213874_10002580 | 3300021377 | Bacteria | 3917 |
| 167 | Ga0213874_10005128 | 3300021377 | Bacteria | 3035 |
| 168 | Ga0213876_10001306 | 3300021384 | Bacteria | 15675 |
| 169 | Ga0213876_10001630 | 3300021384 | Bacteria | 13688 |
| 170 | Ga0213876_10134690 | 3300021384 | Bacteria | 1314 |
| 171 | Ga0213875_10000030 | 3300021388 | Bacteria | 178500 |
| 172 | Ga0213875_10003482 | 3300021388 | Bacteria | 8959 |
| 173 | Ga0213875_10003821 | 3300021388 | Bacteria | 8464 |
| 174 | Ga0213875_10007291 | 3300021388 | Bacteria | 5723 |
| 175 | Ga0213875_10010083 | 3300021388 | Bacteria | 4749 |
| 176 | Ga0213875_10014477 | 3300021388 | Bacteria | 3848 |
| 177 | Ga0213875_10019616 | 3300021388 | Bacteria | 3252 |
| 178 | Ga0213875_10046437 | 3300021388 | Bacteria | 2038 |
| 179 | Ga0213875_10077961 | 3300021388 | Bacteria | 1546 |
| 180 | Ga0213875_10091232 | 3300021388 | Bacteria | 1421 |
| 181 | Ga0213871_10068475 | 3300021441 | Bacteria | 999 |
| 182 | Ga0209677_100749 | 3300025253 | Bacteria | 16460 |
| 183 | Ga0209148_1000773 | 3300025254 | Bacteria | 23969 |
| 184 | Ga0209233_1003148 | 3300025261 | Bacteria | 5852 |
| 185 | Ga0209233_1004858 | 3300025261 | Bacteria | 4525 |
| 186 | Ga0209233_1005292 | 3300025261 | Bacteria | 4301 |
| 187 | Ga0209233_1005946 | 3300025261 | Bacteria | 3993 |
| 188 | Ga0209455_1001728 | 3300025272 | Bacteria | 9312 |
| 189 | Ga0209455_1008216 | 3300025272 | Bacteria | 2858 |
| 190 | Ga0209564_1003916 | 3300025295 | Bacteria | 9529 |
| 191 | Ga0209758_1000282 | 3300025297 | Bacteria | 100746 |
| 192 | Ga0209758_1004003 | 3300025297 | Bacteria | 12747 |
| 193 | Ga0209758_1027779 | 3300025297 | Bacteria | 2410 |
| 194 | Ga0207426_1000437 | 3300025302 | Bacteria | 67439 |
| 195 | Ga0207426_1001098 | 3300025302 | Bacteria | 24902 |
| 196 | Ga0207426_1012310 | 3300025302 | Bacteria | 3218 |
| 197 | Ga0207692_10002885 | 3300025898 | Bacteria | 6655 |
| 198 | Ga0207692_10005756 | 3300025898 | Bacteria | 4986 |
| 199 | Ga0207692_10009200 | 3300025898 | Bacteria | 4116 |
| 200 | Ga0207710_10018346 | 3300025900 | Bacteria | 2975 |
| 201 | Ga0207688_10019965 | 3300025901 | Bacteria | 3655 |
| 202 | Ga0207685_10000267 | 3300025905 | Bacteria | 8260 |
| 203 | Ga0207699_10002339 | 3300025906 | Bacteria | 8949 |
| 204 | Ga0207699_10003537 | 3300025906 | Bacteria | 7456 |
| 205 | Ga0207643_10025498 | 3300025908 | Bacteria | 3267 |
| 206 | Ga0207705_10082672 | 3300025909 | Bacteria | 2342 |
| 207 | Ga0207654_10021751 | 3300025911 | Bacteria | 3414 |
| 208 | Ga0207654_10029110 | 3300025911 | Bacteria | 3019 |
| 209 | Ga0207707_10018073 | 3300025912 | Bacteria | 6143 |
| 210 | Ga0207695_10000062 | 3300025913 | Bacteria | 351979 |
| 211 | Ga0207695_10019960 | 3300025913 | Bacteria | 7695 |
| 212 | Ga0207695_10078563 | 3300025913 | Bacteria | 3348 |
| 213 | Ga0207695_10133694 | 3300025913 | Bacteria | 2435 |
| 214 | Ga0207695_10251375 | 3300025913 | Bacteria | 1667 |
| 215 | Ga0207671_10008251 | 3300025914 | Bacteria | 8862 |
| 216 | Ga0207671_10051920 | 3300025914 | Bacteria | 3037 |
| 217 | Ga0207671_10092336 | 3300025914 | Bacteria | 2282 |
| 218 | Ga0207671_10139497 | 3300025914 | Bacteria | 1867 |
| 219 | Ga0207671_10223517 | 3300025914 | Bacteria | 1476 |
| 220 | Ga0207693_10000326 | 3300025915 | Bacteria | 44051 |
| 221 | Ga0207693_10003223 | 3300025915 | Bacteria | 14005 |
| 222 | Ga0207693_10015787 | 3300025915 | Bacteria | 6050 |
| 223 | Ga0207663_10000225 | 3300025916 | Bacteria | 25184 |
| 224 | Ga0207663_10009124 | 3300025916 | Bacteria | 5229 |
| 225 | Ga0207663_10096713 | 3300025916 | Bacteria | 1973 |
| 226 | Ga0207663_10116539 | 3300025916 | Bacteria | 1821 |
| 227 | Ga0207663_10132455 | 3300025916 | Bacteria | 1724 |
| 228 | Ga0207660_10228682 | 3300025917 | Bacteria | 1462 |
| 229 | Ga0207657_10004806 | 3300025919 | Bacteria | 14248 |
| 230 | Ga0207649_10102875 | 3300025920 | Bacteria | 1894 |
| 231 | Ga0207652_10013842 | 3300025921 | Bacteria | 6527 |
| 232 | Ga0207652_10023687 | 3300025921 | Bacteria | 5088 |
| 233 | Ga0207652_10084661 | 3300025921 | Bacteria | 2778 |
| 234 | Ga0207652_10525394 | 3300025921 | Bacteria | 1065 |
| 235 | Ga0207694_10132083 | 3300025924 | Bacteria | 2002 |
| 236 | Ga0207694_10525114 | 3300025924 | Bacteria | 992 |
| 237 | Ga0207664_10014435 | 3300025929 | Bacteria | 5704 |
| 238 | Ga0207664_10031784 | 3300025929 | Bacteria | 4042 |
| 239 | Ga0207664_10109709 | 3300025929 | Bacteria | 2293 |
| 240 | Ga0207644_10016717 | 3300025931 | Bacteria | 4940 |
| 241 | Ga0207690_10025298 | 3300025932 | Bacteria | 3725 |
| 242 | Ga0207706_10199961 | 3300025933 | Bacteria | 1753 |
| 243 | Ga0207709_10203375 | 3300025935 | Bacteria | 1416 |
| 244 | Ga0207704_10048142 | 3300025938 | Bacteria | 2554 |
| 245 | Ga0207665_10001364 | 3300025939 | Bacteria | 16457 |
| 246 | Ga0207665_10015528 | 3300025939 | Bacteria | 4997 |
| 247 | Ga0207665_10036269 | 3300025939 | Bacteria | 3278 |
| 248 | Ga0207711_10054778 | 3300025941 | Bacteria | 3423 |
| 249 | Ga0207689_10014080 | 3300025942 | Bacteria | 6807 |
| 250 | Ga0207661_10001182 | 3300025944 | Bacteria | 17455 |
| 251 | Ga0207661_10203221 | 3300025944 | Bacteria | 1743 |
| 252 | Ga0207679_10363881 | 3300025945 | Bacteria | 1264 |
| 253 | Ga0207679_10489006 | 3300025945 | Bacteria | 1097 |
| 254 | Ga0207712_10125479 | 3300025961 | Bacteria | 1948 |
| 255 | Ga0207668_10004125 | 3300025972 | Bacteria | 8524 |
| 256 | Ga0207658_10093472 | 3300025986 | Bacteria | 2338 |
| 257 | Ga0207677_10038130 | 3300026023 | Bacteria | 3148 |
| 258 | Ga0207639_10010102 | 3300026041 | Bacteria | 6528 |
| 259 | Ga0207639_10196860 | 3300026041 | Bacteria | 1725 |
| 260 | Ga0207639_10311422 | 3300026041 | Bacteria | 1395 |
| 261 | Ga0207678_10014454 | 3300026067 | Bacteria | 6941 |
| 262 | Ga0207678_10021795 | 3300026067 | Bacteria | 5619 |
| 263 | Ga0207678_10023002 | 3300026067 | Bacteria | 5454 |
| 264 | Ga0207678_10054764 | 3300026067 | Bacteria | 3436 |
| 265 | Ga0207702_10000197 | 3300026078 | Bacteria | 71667 |
| 266 | Ga0207702_10018501 | 3300026078 | Bacteria | 5764 |
| 267 | Ga0207641_10238720 | 3300026088 | Bacteria | 1693 |
| 268 | Ga0207648_10219239 | 3300026089 | Bacteria | 1690 |
| 269 | Ga0207676_10106108 | 3300026095 | Bacteria | 2340 |
| 270 | Ga0207674_10464147 | 3300026116 | Bacteria | 1224 |
| 271 | Ga0207675_100041364 | 3300026118 | Bacteria | 4304 |
| 272 | Ga0207683_10011087 | 3300026121 | Bacteria | 7681 |
| 273 | Ga0207698_10105090 | 3300026142 | Bacteria | 2352 |
| 274 | Ga0207698_10200930 | 3300026142 | Bacteria | 1785 |
| 275 | Ga0207698_10314938 | 3300026142 | Bacteria | 1463 |
| 276 | Ga0209389_1000004 | 3300027296 | Bacteria | 263759 |
| 277 | Ga0209389_1001618 | 3300027296 | Bacteria | 16174 |
| 278 | Ga0209589_1000010 | 3300027357 | Bacteria | 237657 |
| 279 | Ga0209589_1000014 | 3300027357 | Bacteria | 227996 |
| 280 | Ga0209489_100011 | 3300027361 | Bacteria | 244710 |
| 281 | Ga0209489_100014 | 3300027361 | Bacteria | 227996 |
| 282 | Ga0209489_100777 | 3300027361 | Bacteria | 63061 |
| 283 | Ga0209700_100013 | 3300027363 | Bacteria | 341906 |
| 284 | Ga0209700_100024 | 3300027363 | Bacteria | 227996 |
| 285 | Ga0209813_10002203 | 3300027866 | Bacteria | 4450 |
| 286 | Ga0268266_10001413 | 3300028379 | Bacteria | 28643 |
| 287 | Ga0268266_10087585 | 3300028379 | Bacteria | 2724 |
| 288 | Ga0268264_10062341 | 3300028381 | Bacteria | 3130 |
| 289 | Ga0265334_10054565 | 3300028573 | Bacteria | 1524 |
| 290 | Ga0265770_1014959 | 3300030878 | Bacteria | 1176 |
| 291 | Ga0265773_1001012 | 3300031018 | Bacteria | 1387 |
| 292 | Ga0265760_10051491 | 3300031090 | Bacteria | 1240 |
| 293 | Ga0265330_10035799 | 3300031235 | Bacteria | 2214 |
| 294 | Ga0265325_10012959 | 3300031241 | Bacteria | 4755 |
| 295 | Ga0265340_10011608 | 3300031247 | Bacteria | 4676 |
| 296 | Ga0265339_10000016 | 3300031249 | Bacteria | 185313 |
| 297 | Ga0265339_10006455 | 3300031249 | Bacteria | 7692 |
| 298 | Ga0265339_10016353 | 3300031249 | Bacteria | 4424 |
| 299 | Ga0265339_10110791 | 3300031249 | Bacteria | 1420 |
| 300 | Ga0265316_10387288 | 3300031344 | Bacteria | 1008 |
| 301 | Ga0307513_10018286 | 3300031456 | Bacteria | 8378 |
| 302 | Ga0265313_10000060 | 3300031595 | Bacteria | 107224 |
| 303 | Ga0265314_10016312 | 3300031711 | Bacteria | 5871 |
| 304 | Ga0265314_10069850 | 3300031711 | Bacteria | 2356 |
| 305 | Ga0265342_10010600 | 3300031712 | Bacteria | 6375 |
| 306 | Ga0307516_10092521 | 3300031730 | Bacteria | 2851 |
| 307 | Ga0316583_10027407 | 3300032133 | Bacteria | 2034 |
| 308 | Ga0307510_10019799 | 3300033180 | Bacteria | 7881 |
| 309 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 310 | Ga0316215_1001104 | 3300033544 | Bacteria | 2623 |
| 311 | Ga0373934_0002405 | 3300035086 | Bacteria | 6890 |
| 312 | Ga0373923_0022547 | 3300035111 | Bacteria | 2470 |
| 313 | Ga0373936_0018479 | 3300035113 | Bacteria | 2693 |
| 314 | Ga0373953_0000409 | 3300035117 | Bacteria | 11662 |
| 315 | Ga0373953_0009941 | 3300035117 | Bacteria | 3296 |
| 316 | Ga0373954_0002776 | 3300035118 | Bacteria | 7375 |
| 317 | Ga0373954_0029995 | 3300035118 | Bacteria | 2507 |
| 318 | Ga0373956_0004736 | 3300035119 | Bacteria | 5443 |
| 319 | Ga0373956_0005250 | 3300035119 | Bacteria | 5184 |
| 320 | Ga0373957_0014177 | 3300035120 | Bacteria | 2720 |
| 321 | Ga0373955_0002711 | 3300035172 | Bacteria | 7754 |
| 322 | Ga0373955_0003550 | 3300035172 | Bacteria | 6865 |
| 323 | Ga0373924_0006225 | 3300035410 | Bacteria | 4267 |
| 324 | Ga0373927_0004054 | 3300035695 | Bacteria | 10349 |
| 325 | Ga0373933_0002107 | 3300035724 | Bacteria | 11423 |
| 326 | Ga0373937_0008396 | 3300036401 | Bacteria | 8974 |
| 327 | Ga0373937_0021312 | 3300036401 | Bacteria | 5816 |
| 328 | Ga0373937_0324402 | 3300036401 | Bacteria | 1457 |
| 329 | Ga0372808_001074 | 3300036459 | Bacteria | 2661 |
| 330 | Ga0373925_0024876 | 3300037068 | Bacteria | 4374 |
| 331 | Ga0395899_0122972 | 3300037312 | Bacteria | 1857 |
| 332 | Ga0395900_0000660 | 3300037418 | Bacteria | 46104 |
| 333 | Ga0395900_0002114 | 3300037418 | Bacteria | 22253 |
| 334 | Ga0395900_0008707 | 3300037418 | Bacteria | 10423 |
| 335 | Ga0395900_0199262 | 3300037418 | Bacteria | 2027 |
| 336 | Ga0395900_0378614 | 3300037418 | Bacteria | 1384 |
| 337 | Ga0395898_0003200 | 3300037466 | Bacteria | 18438 |
| 338 | Ga0395898_0006500 | 3300037466 | Bacteria | 12485 |
| 339 | Ga0395898_0007107 | 3300037466 | Bacteria | 11890 |
| 340 | Ga0395898_0064826 | 3300037466 | Bacteria | 3543 |
| 341 | Ga0395905_0021700 | 3300037471 | Bacteria | 6074 |
| 342 | Ga0395905_0259473 | 3300037471 | Bacteria | 1622 |
| 343 | Ga0436364_0051975 | 3300037853 | Bacteria | 3739 |
| 344 | Ga0436364_0102033 | 3300037853 | Bacteria | 1689 |
| 345 | Ga0436364_0134493 | 3300037853 | Bacteria | 6192 |
| 346 | Ga0436364_0178729 | 3300037853 | Bacteria | 19908 |
| 347 | Ga0436364_0240938 | 3300037853 | Bacteria | 2811 |
| 348 | Ga0436364_0294887 | 3300037853 | Bacteria | 20599 |
| 349 | Ga0436364_0330571 | 3300037853 | Bacteria | 2928 |
| 350 | Ga0436364_0341833 | 3300037853 | Bacteria | 5349 |
| 351 | Ga0436364_0425317 | 3300037853 | Bacteria | 2884 |
| 352 | Ga0436364_0480253 | 3300037853 | Bacteria | 2172 |
| 353 | Ga0436364_0629092 | 3300037853 | Bacteria | 6792 |
| 354 | Ga0436364_0654054 | 3300037853 | Bacteria | 1462 |
| 355 | Ga0436364_1015733 | 3300037853 | Bacteria | 2723 |
| 356 | Ga0436364_1040604 | 3300037853 | Bacteria | 60326 |
| 357 | Ga0436364_1401270 | 3300037853 | Bacteria | 10880 |
| 358 | Ga0436364_1503331 | 3300037853 | Bacteria | 31628 |
| 359 | Ga0436364_1527859 | 3300037853 | Bacteria | 20905 |
| 360 | Ga0395901_0034087 | 3300038443 | Bacteria | 5257 |
| 361 | Ga0395901_0063663 | 3300038443 | Bacteria | 3839 |
| 362 | Ga0395901_0101488 | 3300038443 | Bacteria | 3019 |
| 363 | Ga0395901_0437117 | 3300038443 | Bacteria | 1340 |
| 364 | Ga0395901_0515459 | 3300038443 | Bacteria | 1215 |
| 365 | Ga0436365_0151043 | 3300039437 | Bacteria | 1380 |
| 366 | Ga0436365_0159409 | 3300039437 | Bacteria | 2110 |
| 367 | Ga0436365_0459588 | 3300039437 | Bacteria | 1325 |
| 368 | Ga0436365_0510188 | 3300039437 | Bacteria | 12764 |
| 369 | Ga0436365_0697045 | 3300039437 | Bacteria | 35162 |
| 370 | Ga0436365_0917056 | 3300039437 | Bacteria | 16389 |
| 371 | Ga0436365_1047663 | 3300039437 | Bacteria | 2746 |
| 372 | Ga0436360_0202427 | 3300039438 | Bacteria | 4987 |
| 373 | Ga0436360_0480010 | 3300039438 | Bacteria | 3604 |
| 374 | Ga0436360_0545523 | 3300039438 | Bacteria | 2119 |
| 375 | Ga0436360_1060729 | 3300039438 | Bacteria | 1128 |
| 376 | Ga0436360_1101828 | 3300039438 | Bacteria | 2281 |
| 377 | Ga0436361_0200283 | 3300039447 | Bacteria | 2300 |
| 378 | Ga0436361_0512286 | 3300039447 | Bacteria | 5516 |
| 379 | Ga0436361_0638445 | 3300039447 | Bacteria | 9354 |
| 380 | Ga0436361_0838125 | 3300039447 | Bacteria | 5115 |
| 381 | Ga0436361_1054672 | 3300039447 | Bacteria | 3969 |
| 382 | Ga0436361_1159707 | 3300039447 | Bacteria | 1567 |
| 383 | Ga0436363_0121554 | 3300039450 | Bacteria | 5905 |
| 384 | Ga0436363_0274569 | 3300039450 | Bacteria | 2779 |
| 385 | Ga0436363_0454820 | 3300039450 | Bacteria | 3677 |
| 386 | Ga0436363_0627803 | 3300039450 | Bacteria | 1682 |
| 387 | Ga0436363_0700194 | 3300039450 | Bacteria | 1499 |
| 388 | Ga0436363_0761127 | 3300039450 | Bacteria | 1785 |
| 389 | Ga0436363_1022276 | 3300039450 | Bacteria | 10376 |
| 390 | Ga0436363_1499575 | 3300039450 | Bacteria | 4582 |
| 391 | Ga0436362_0278148 | 3300039453 | Bacteria | 2371 |
| 392 | Ga0436362_0842308 | 3300039453 | Bacteria | 1254 |
| 393 | Ga0436362_0895327 | 3300039453 | Bacteria | 9610 |
| 394 | Ga0436362_0983233 | 3300039453 | Bacteria | 2080 |
| 395 | Ga0466969_0100925 | 3300044656 | Bacteria | 1358 |
| 396 | Ga0466972_0000079 | 3300044658 | Bacteria | 90348 |
| 397 | Ga0466972_0004644 | 3300044658 | Bacteria | 6881 |
| 398 | Ga0466966_0001208 | 3300044684 | Bacteria | 16568 |
| 399 | Ga0466966_0006229 | 3300044684 | Bacteria | 7887 |
| 400 | Ga0466961_0000020 | 3300044693 | Bacteria | 107610 |
| 401 | Ga0466961_0039468 | 3300044693 | Bacteria | 3027 |
| 402 | Ga0466961_0049669 | 3300044693 | Bacteria | 2680 |
| 403 | Ga0466963_0031974 | 3300044694 | Bacteria | 3404 |
| 404 | Ga0466963_0209438 | 3300044694 | Bacteria | 1364 |
| 405 | Ga0466971_0051755 | 3300044719 | Bacteria | 1849 |
| 406 | Ga0466968_0011964 | 3300044735 | Bacteria | 3389 |
| 407 | Ga0466970_0026083 | 3300044765 | Bacteria | 3063 |
| 408 | Ga0466970_0087989 | 3300044765 | Bacteria | 1685 |
| 409 | Ga0466957_0041896 | 3300044842 | Bacteria | 2769 |
| 410 | Ga0466957_0165300 | 3300044842 | Bacteria | 1439 |
| 411 | Ga0466960_0000424 | 3300044901 | Bacteria | 14510 |
| 412 | Ga0466959_0004294 | 3300045049 | Bacteria | 9508 |
| 413 | Ga0466959_0245173 | 3300045049 | Bacteria | 1236 |
| 414 | Ga0466967_0063821 | 3300045976 | Bacteria | 3274 |
| 415 | Ga0466967_0377060 | 3300045976 | Bacteria | 1377 |
| 416 | Ga0466967_0549232 | 3300045976 | Bacteria | 1137 |
| 417 | Ga0495592_0003202 | 3300046454 | Bacteria | 11732 |
| 418 | Ga0495592_0036190 | 3300046454 | Bacteria | 3718 |
| 419 | Ga0495603_0139262 | 3300046455 | Bacteria | 1412 |
| 420 | Ga0495629_0001830 | 3300046459 | Bacteria | 16661 |
| 421 | Ga0495629_0006153 | 3300046459 | Bacteria | 8909 |
| 422 | Ga0495629_0107512 | 3300046459 | Bacteria | 1946 |
| 423 | Ga0495641_0144258 | 3300046461 | Bacteria | 1064 |
| 424 | Ga0495651_0002500 | 3300046462 | Bacteria | 14218 |
| 425 | Ga0495651_0041294 | 3300046462 | Bacteria | 3583 |
| 426 | Ga0495651_0041839 | 3300046462 | Bacteria | 3558 |
| 427 | Ga0495651_0140950 | 3300046462 | Bacteria | 1748 |
| 428 | Ga0495653_0001471 | 3300046463 | Bacteria | 18364 |
| 429 | Ga0495653_0050752 | 3300046463 | Bacteria | 3189 |
| 430 | Ga0495653_0159296 | 3300046463 | Bacteria | 1568 |
| 431 | Ga0495582_0214523 | 3300046473 | Bacteria | 1101 |
| 432 | Ga0495639_0114838 | 3300046475 | Bacteria | 1280 |
| 433 | Ga0495662_0108284 | 3300046476 | Bacteria | 1361 |
| 434 | Ga0495664_0007676 | 3300046477 | Bacteria | 6001 |
| 435 | Ga0495664_0007911 | 3300046477 | Bacteria | 5917 |
| 436 | Ga0495664_0087653 | 3300046477 | Bacteria | 1870 |
| 437 | Ga0495596_0068738 | 3300046500 | Bacteria | 1377 |
| 438 | Ga0495606_0005210 | 3300046507 | Bacteria | 12548 |
| 439 | Ga0495608_0002191 | 3300046511 | Bacteria | 14103 |
| 440 | Ga0495608_0036131 | 3300046511 | Bacteria | 3328 |
| 441 | Ga0495608_0060094 | 3300046511 | Bacteria | 2502 |
| 442 | Ga0495618_0079959 | 3300046514 | Bacteria | 2085 |
| 443 | Ga0495618_0279140 | 3300046514 | Bacteria | 1042 |
| 444 | Ga0495620_0060077 | 3300046515 | Bacteria | 1586 |
| 445 | Ga0495628_0030883 | 3300046516 | Bacteria | 4335 |
| 446 | Ga0495628_0033600 | 3300046516 | Bacteria | 4131 |
| 447 | Ga0495628_0064783 | 3300046516 | Bacteria | 2860 |
| 448 | Ga0495630_0022407 | 3300046517 | Bacteria | 4664 |
| 449 | Ga0495648_0003767 | 3300046524 | Bacteria | 13191 |
| 450 | Ga0495648_0007614 | 3300046524 | Bacteria | 8644 |
| 451 | Ga0495652_0006321 | 3300046529 | Bacteria | 11036 |
| 452 | Ga0495652_0031923 | 3300046529 | Bacteria | 4609 |
| 453 | Ga0495640_0002348 | 3300046533 | Bacteria | 15175 |
| 454 | Ga0495640_0026198 | 3300046533 | Bacteria | 4216 |
| 455 | Ga0495586_0022337 | 3300046535 | Bacteria | 3377 |
| 456 | Ga0495587_0004728 | 3300046536 | Bacteria | 8935 |
| 457 | Ga0495587_0015523 | 3300046536 | Bacteria | 4754 |
| 458 | Ga0495587_0027948 | 3300046536 | Bacteria | 3434 |
| 459 | Ga0495645_0014837 | 3300046543 | Bacteria | 5536 |
| 460 | Ga0495645_0040372 | 3300046543 | Bacteria | 3404 |
| 461 | Ga0495645_0221128 | 3300046543 | Bacteria | 1274 |
| 462 | Ga0495667_0002963 | 3300046559 | Bacteria | 11387 |
| 463 | Ga0495667_0013368 | 3300046559 | Bacteria | 5555 |
| 464 | Ga0495667_0016179 | 3300046559 | Bacteria | 5039 |
| 465 | Ga0495634_0089901 | 3300046642 | Bacteria | 1995 |
| 466 | Ga0495634_0197772 | 3300046642 | Bacteria | 1250 |
| 467 | Ga0495625_0039696 | 3300046660 | Bacteria | 3436 |
| 468 | Ga0495635_0000636 | 3300046663 | Bacteria | 22538 |
| 469 | Ga0495635_0002205 | 3300046663 | Bacteria | 13252 |
| 470 | Ga0495657_0002552 | 3300046675 | Bacteria | 15277 |
| 471 | Ga0495657_0014012 | 3300046675 | Bacteria | 5889 |
| 472 | Ga0495599_0001077 | 3300046678 | Bacteria | 15369 |
| 473 | Ga0495599_0010332 | 3300046678 | Bacteria | 5708 |
| 474 | Ga0495599_0060861 | 3300046678 | Bacteria | 2360 |
| 475 | Ga0495623_0004268 | 3300046679 | Bacteria | 9412 |
| 476 | Ga0495623_0006526 | 3300046679 | Bacteria | 7595 |
| 477 | Ga0495623_0048527 | 3300046679 | Bacteria | 2692 |
| 478 | Ga0495646_0025871 | 3300046680 | Bacteria | 3687 |
| 479 | Ga0495613_0033951 | 3300046689 | Bacteria | 3790 |
| 480 | Ga0495613_0120524 | 3300046689 | Bacteria | 1884 |
| 481 | Ga0495624_0058576 | 3300046690 | Bacteria | 2418 |
| 482 | Ga0495624_0091302 | 3300046690 | Bacteria | 1879 |
| 483 | Ga0495624_0111238 | 3300046690 | Bacteria | 1684 |
| 484 | Ga0495600_0000873 | 3300046809 | Bacteria | 16122 |
| 485 | Ga0495600_0001010 | 3300046809 | Bacteria | 15188 |
| 486 | Ga0495604_0008420 | 3300047317 | Bacteria | 8146 |
| 487 | Ga0495604_0038621 | 3300047317 | Bacteria | 3755 |
| 488 | Ga0495604_0052467 | 3300047317 | Bacteria | 3157 |
| 489 | Ga0495604_0063576 | 3300047317 | Bacteria | 2814 |
| 490 | Ga0495674_0028066 | 3300047319 | Bacteria | 5137 |
| 491 | Ga0495674_0065255 | 3300047319 | Bacteria | 3163 |
| 492 | Ga0495674_0242918 | 3300047319 | Bacteria | 1483 |
| 493 | Ga0495676_0103736 | 3300047321 | Bacteria | 2099 |
| 494 | Ga0495680_0001037 | 3300047322 | Bacteria | 30809 |
| 495 | Ga0495680_0001883 | 3300047322 | Bacteria | 22052 |
| 496 | Ga0495680_0043083 | 3300047322 | Bacteria | 3576 |
| 497 | Ga0495675_0001800 | 3300047444 | Bacteria | 12774 |
| 498 | Ga0495675_0037092 | 3300047444 | Bacteria | 3105 |
| 499 | Ga0495684_0000666 | 3300047471 | Bacteria | 27678 |
| 500 | Ga0495684_0036531 | 3300047471 | Bacteria | 3765 |
| 501 | Ga0495684_0096515 | 3300047471 | Bacteria | 2237 |
| 502 | Ga0495684_0184941 | 3300047471 | Bacteria | 1543 |
| 503 | Ga0495686_0046711 | 3300047472 | Bacteria | 2736 |
| 504 | Ga0495686_0107093 | 3300047472 | Bacteria | 1680 |
| 505 | Ga0495593_0008032 | 3300047673 | Bacteria | 6139 |
| 506 | Ga0495602_0004340 | 3300048088 | Bacteria | 14780 |
| 507 | Ga0495602_0012996 | 3300048088 | Bacteria | 8521 |
| 508 | Ga0495602_0196647 | 3300048088 | Bacteria | 1541 |
| 509 | Ga0495602_0201081 | 3300048088 | Bacteria | 1520 |
| 510 | Ga0496100_0029945 | 3300048903 | Bacteria | 3372 |
| 511 | Ga0496102_0567391 | 3300048905 | Bacteria | 1058 |
| 512 | Ga0496104_0001245 | 3300048907 | Bacteria | 21918 |
| 513 | Ga0496104_0005309 | 3300048907 | Bacteria | 11271 |
| 514 | Ga0496104_0082198 | 3300048907 | Bacteria | 3072 |
| 515 | Ga0496104_0283502 | 3300048907 | Bacteria | 1569 |
| 516 | Ga0496105_0003657 | 3300048908 | Bacteria | 11428 |
| 517 | Ga0496105_0093356 | 3300048908 | Bacteria | 2485 |
| 518 | Ga0496106_0013957 | 3300048909 | Bacteria | 5941 |
| 519 | Ga0496107_0130771 | 3300048910 | Bacteria | 1853 |
| 520 | Ga0496108_0001861 | 3300048911 | Bacteria | 16875 |
| 521 | Ga0496108_0218656 | 3300048911 | Bacteria | 1655 |
| 522 | Ga0496109_0001073 | 3300048912 | Bacteria | 22672 |
| 523 | Ga0496109_0155295 | 3300048912 | Bacteria | 2143 |
| 524 | Ga0496110_0002479 | 3300048913 | Bacteria | 13828 |
| 525 | Ga0496111_0028004 | 3300048914 | Bacteria | 3991 |
| 526 | Ga0496111_0061970 | 3300048914 | Bacteria | 2712 |
| 527 | Ga0496111_0215505 | 3300048914 | Bacteria | 1426 |
| 528 | Ga0496112_0002061 | 3300048915 | Bacteria | 15937 |
| 529 | Ga0496112_0005807 | 3300048915 | Bacteria | 10736 |
| 530 | Ga0496112_0008838 | 3300048915 | Bacteria | 9038 |
| 531 | Ga0496112_0107427 | 3300048915 | Bacteria | 2761 |
| 532 | Ga0496112_0119654 | 3300048915 | Bacteria | 2603 |
| 533 | Ga0496112_0223868 | 3300048915 | Bacteria | 1837 |
| 534 | Ga0496112_0440495 | 3300048915 | Bacteria | 1241 |
| 535 | Ga0496113_0000095 | 3300048916 | Bacteria | 37445 |
| 536 | Ga0496113_0156636 | 3300048916 | Bacteria | 1799 |
| 537 | Ga0496114_0200299 | 3300048917 | Bacteria | 1749 |
| 538 | Ga0496115_0003952 | 3300048918 | Bacteria | 10689 |
| 539 | Ga0496115_0042478 | 3300048918 | Bacteria | 3621 |
| 540 | Ga0496115_0314357 | 3300048918 | Bacteria | 1282 |
| 541 | Ga0496116_0140996 | 3300048919 | Bacteria | 1356 |
| 542 | Ga0496118_0016456 | 3300048921 | Bacteria | 6783 |
| 543 | Ga0496118_0130626 | 3300048921 | Bacteria | 1614 |
| 544 | Ga0496119_0003004 | 3300048922 | Bacteria | 17875 |
| 545 | Ga0496119_0080481 | 3300048922 | Bacteria | 1879 |
| 546 | Ga0496121_0008659 | 3300048924 | Bacteria | 11890 |
| 547 | Ga0496121_0021131 | 3300048924 | Bacteria | 6392 |
| 548 | Ga0496121_0032677 | 3300048924 | Bacteria | 4725 |
| 549 | Ga0496121_0066895 | 3300048924 | Bacteria | 2915 |
| 550 | Ga0496121_0103413 | 3300048924 | Bacteria | 2191 |
| 551 | Ga0496124_0209458 | 3300048927 | Bacteria | 1476 |
| 552 | Ga0496125_0000237 | 3300048928 | Bacteria | 113322 |
| 553 | Ga0496125_0001822 | 3300048928 | Bacteria | 29443 |
| 554 | Ga0496126_0011267 | 3300048929 | Bacteria | 9277 |
| 555 | Ga0496126_0158354 | 3300048929 | Bacteria | 1936 |
| 556 | Ga0496126_0174038 | 3300048929 | Bacteria | 1832 |
| 557 | Ga0496126_0338736 | 3300048929 | Bacteria | 1232 |
| 558 | Ga0501031_0001197 | 3300049568 | Bacteria | 15831 |
| 559 | Ga0501031_0003032 | 3300049568 | Bacteria | 10740 |
| 560 | Ga0501031_0118857 | 3300049568 | Bacteria | 1727 |
| 561 | Ga0501032_0000358 | 3300049569 | Bacteria | 38004 |
| 562 | Ga0501032_0000696 | 3300049569 | Bacteria | 27371 |
| 563 | Ga0501032_0036140 | 3300049569 | Bacteria | 3373 |
| 564 | Ga0501032_0086541 | 3300049569 | Bacteria | 2083 |
| 565 | Ga0501033_0000232 | 3300049570 | Bacteria | 53703 |
| 566 | Ga0501033_0000601 | 3300049570 | Bacteria | 33366 |
| 567 | Ga0501033_0001532 | 3300049570 | Bacteria | 20415 |
| 568 | Ga0501033_0006726 | 3300049570 | Bacteria | 8984 |
| 569 | Ga0501033_0037684 | 3300049570 | Bacteria | 3618 |
| 570 | Ga0501034_0000039 | 3300049571 | Bacteria | 237357 |
| 571 | Ga0501034_0000704 | 3300049571 | Bacteria | 50735 |
| 572 | Ga0501034_0193399 | 3300049571 | Bacteria | 1996 |
| 573 | Ga0501036_0000007 | 3300049572 | Bacteria | 240500 |
| 574 | Ga0501036_0000052 | 3300049572 | Bacteria | 74795 |
| 575 | Ga0501036_0301604 | 3300049572 | Bacteria | 1340 |
| 576 | Ga0501037_0000025 | 3300049573 | Bacteria | 143276 |
| 577 | Ga0501037_0001450 | 3300049573 | Bacteria | 17426 |
| 578 | Ga0501037_0020087 | 3300049573 | Bacteria | 4931 |
| 579 | Ga0501037_0149374 | 3300049573 | Bacteria | 1671 |
| 580 | Ga0501038_0000026 | 3300049574 | Bacteria | 146493 |
| 581 | Ga0501038_0000168 | 3300049574 | Bacteria | 55496 |
| 582 | Ga0501038_0119167 | 3300049574 | Bacteria | 2179 |
| 583 | Ga0501038_0177296 | 3300049574 | Bacteria | 1722 |
| 584 | Ga0501038_0275468 | 3300049574 | Bacteria | 1326 |
| 585 | Ga0501039_0000005 | 3300049575 | Bacteria | 295471 |
| 586 | Ga0501039_0003632 | 3300049575 | Bacteria | 11560 |
| 587 | Ga0501039_0156253 | 3300049575 | Bacteria | 1792 |
| 588 | Ga0501042_0118124 | 3300049578 | Bacteria | 1909 |
| 589 | Ga0501043_0000007 | 3300049579 | Bacteria | 224595 |
| 590 | Ga0501043_0000036 | 3300049579 | Bacteria | 132959 |
| 591 | Ga0501043_0002042 | 3300049579 | Bacteria | 17221 |
| 592 | Ga0501043_0133440 | 3300049579 | Bacteria | 1946 |
| 593 | Ga0501046_0000147 | 3300049580 | Bacteria | 74186 |
| 594 | Ga0501046_0000231 | 3300049580 | Bacteria | 57655 |
| 595 | Ga0501046_0070614 | 3300049580 | Bacteria | 2715 |
| 596 | Ga0501046_0171712 | 3300049580 | Bacteria | 1627 |
| 597 | Ga0501046_0304341 | 3300049580 | Bacteria | 1164 |
| 598 | Ga0501047_0000209 | 3300049581 | Bacteria | 70658 |
| 599 | Ga0501047_0000457 | 3300049581 | Bacteria | 45136 |
| 600 | Ga0501047_0009482 | 3300049581 | Bacteria | 9198 |
| 601 | Ga0501047_0012842 | 3300049581 | Bacteria | 7935 |
| 602 | Ga0501047_0071155 | 3300049581 | Bacteria | 3348 |
| 603 | Ga0501047_0102930 | 3300049581 | Bacteria | 2735 |
| 604 | Ga0501047_0145750 | 3300049581 | Bacteria | 2245 |
| 605 | Ga0501047_0223123 | 3300049581 | Bacteria | 1740 |
| 606 | Ga0501048_0000585 | 3300049582 | Bacteria | 25849 |
| 607 | Ga0501048_0020451 | 3300049582 | Bacteria | 4850 |
| 608 | Ga0501067_0000025 | 3300049583 | Bacteria | 91481 |
| 609 | Ga0501067_0063143 | 3300049583 | Bacteria | 2051 |
| 610 | Ga0501067_0087364 | 3300049583 | Bacteria | 1730 |
| 611 | Ga0501068_0002387 | 3300049584 | Bacteria | 9984 |
| 612 | Ga0501068_0004030 | 3300049584 | Bacteria | 7988 |
| 613 | Ga0501069_0000001 | 3300049585 | Bacteria | 289100 |
| 614 | Ga0501069_0133516 | 3300049585 | Bacteria | 1422 |
| 615 | Ga0501070_0000071 | 3300049586 | Bacteria | 86669 |
| 616 | Ga0501070_0000824 | 3300049586 | Bacteria | 28140 |
| 617 | Ga0501070_0001839 | 3300049586 | Bacteria | 18710 |
| 618 | Ga0501070_0024940 | 3300049586 | Bacteria | 5015 |
| 619 | Ga0501070_0178591 | 3300049586 | Bacteria | 1747 |
| 620 | Ga0501070_0178612 | 3300049586 | Bacteria | 1747 |
| 621 | Ga0501071_0010530 | 3300049587 | Bacteria | 6202 |
| 622 | Ga0501071_0022185 | 3300049587 | Bacteria | 4425 |
| 623 | Ga0501072_0003385 | 3300049588 | Bacteria | 11997 |
| 624 | Ga0501072_0051510 | 3300049588 | Bacteria | 3241 |
| 625 | Ga0501073_0000135 | 3300049589 | Bacteria | 47869 |
| 626 | Ga0501073_0011727 | 3300049589 | Bacteria | 6399 |
| 627 | Ga0501073_0013905 | 3300049589 | Bacteria | 5849 |
| 628 | Ga0501073_0032984 | 3300049589 | Bacteria | 3690 |
| 629 | Ga0501074_0000003 | 3300049590 | Bacteria | 116101 |
| 630 | Ga0501074_0000443 | 3300049590 | Bacteria | 24761 |
| 631 | Ga0501074_0019268 | 3300049590 | Bacteria | 4956 |
| 632 | Ga0501074_0023253 | 3300049590 | Bacteria | 4508 |
| 633 | Ga0501076_0332905 | 3300049592 | Bacteria | 1246 |
| 634 | Ga0501079_0003407 | 3300049741 | Bacteria | 11674 |
| 635 | Ga0501080_0000382 | 3300049742 | Bacteria | 34121 |
| 636 | Ga0501080_0000470 | 3300049742 | Bacteria | 31361 |
| 637 | Ga0501080_0000669 | 3300049742 | Bacteria | 27250 |
| 638 | Ga0501080_0005657 | 3300049742 | Bacteria | 11171 |
| 639 | Ga0501081_0326335 | 3300049743 | Bacteria | 1129 |
| 640 | Ga0501083_0000080 | 3300049744 | Bacteria | 64705 |
| 641 | Ga0501083_0003054 | 3300049744 | Bacteria | 11634 |
| 642 | Ga0501083_0101325 | 3300049744 | Bacteria | 1899 |
| 643 | Ga0501035_0000037 | 3300049822 | Bacteria | 160921 |
| 644 | Ga0501035_0000052 | 3300049822 | Bacteria | 143038 |
| 645 | Ga0501035_0001237 | 3300049822 | Bacteria | 26512 |
| 646 | Ga0501035_0001584 | 3300049822 | Bacteria | 23082 |
| 647 | Ga0501035_0002187 | 3300049822 | Bacteria | 19401 |
| 648 | Ga0501035_0070539 | 3300049822 | Bacteria | 3095 |
| 649 | Ga0501035_0121270 | 3300049822 | Bacteria | 2285 |
| 650 | Ga0501035_0175161 | 3300049822 | Bacteria | 1851 |
| 651 | Ga0501044_0000018 | 3300049823 | Bacteria | 225885 |
| 652 | Ga0501044_0000217 | 3300049823 | Bacteria | 73242 |
| 653 | Ga0501044_0000366 | 3300049823 | Bacteria | 56832 |
| 654 | Ga0501044_0046984 | 3300049823 | Bacteria | 4467 |
| 655 | Ga0501044_0072305 | 3300049823 | Bacteria | 3506 |
| 656 | Ga0501044_0085781 | 3300049823 | Bacteria | 3181 |
| 657 | Ga0501044_0087528 | 3300049823 | Bacteria | 3146 |
| 658 | Ga0501044_0091284 | 3300049823 | Bacteria | 3072 |
| 659 | Ga0501044_0147382 | 3300049823 | Bacteria | 2338 |
| 660 | nmdc:mga03n38_14660_c1 | 3300050490 | Bacteria | 3010 |
| 661 | nmdc:mga03n38_224_c1 | 3300050490 | Bacteria | 13138 |
| 662 | nmdc:mga00v17_205002_c1 | 3300050491 | Bacteria | 1275 |
| 663 | nmdc:mga00v17_9386_c1 | 3300050491 | Bacteria | 5292 |
| 664 | nmdc:mga0yw44_52563_c1 | 3300050492 | Bacteria | 2470 |
| 665 | nmdc:mga0yw44_72837_c1 | 3300050492 | Bacteria | 2136 |
| 666 | nmdc:mga0k408_5979_c1 | 3300050493 | Bacteria | 6497 |
| 667 | nmdc:mga04h51_6775_c1 | 3300050495 | Bacteria | 2992 |
| 668 | nmdc:mga07m45_6074_c1 | 3300050496 | Bacteria | 6081 |
| 669 | nmdc:mga0n895_64214_c1 | 3300050512 | Bacteria | 3631 |
| 670 | nmdc:mga08x19_79614_c1 | 3300050514 | Bacteria | 2149 |
| 671 | nmdc:mga0sz30_55309_c1 | 3300050516 | Bacteria | 1689 |
| 672 | nmdc:mga0sz30_9528_c1 | 3300050516 | Bacteria | 3699 |
| 673 | Ga0495601_0014819 | 3300053077 | Bacteria | 4705 |
| 674 | Ga0495601_0041332 | 3300053077 | Bacteria | 2889 |
| 675 | Ga0495601_0185195 | 3300053077 | Bacteria | 1361 |
| 676 | Ga0495601_0239203 | 3300053077 | Bacteria | 1185 |
| 677 | Ga0495612_0013454 | 3300053078 | Bacteria | 3296 |
| 678 | Ga0495655_0009206 | 3300053083 | Bacteria | 1906 |
| 679 | Ga0495655_0056796 | 3300053083 | Bacteria | 1054 |
| 680 | Ga0495595_0003095 | 3300053084 | Bacteria | 6581 |
| 681 | Ga0495595_0016247 | 3300053084 | Bacteria | 3180 |
| 682 | Ga0495619_0004543 | 3300053085 | Bacteria | 8862 |
| 683 | Ga0495619_0030322 | 3300053085 | Bacteria | 3500 |
| 684 | Ga0500578_0068194 | 3300053086 | Bacteria | 2268 |
| 685 | Ga0500578_0107327 | 3300053086 | Bacteria | 1763 |
| 686 | Ga0500647_0033209 | 3300053091 | Bacteria | 2460 |
| 687 | Ga0500651_0000526 | 3300053093 | Bacteria | 19635 |
| 688 | Ga0500566_0000097 | 3300053094 | Bacteria | 43920 |
| 689 | Ga0500640_014937 | 3300053095 | Bacteria | 3240 |
| 690 | Ga0500557_000008 | 3300053105 | Bacteria | 127284 |
| 691 | Ga0500572_000853 | 3300053111 | Bacteria | 9498 |
| 692 | Ga0500595_006403 | 3300053119 | Bacteria | 4995 |
| 693 | Ga0500597_043245 | 3300053120 | Bacteria | 1901 |
| 694 | Ga0500607_075728 | 3300053121 | Bacteria | 1727 |
| 695 | Ga0500614_014025 | 3300053123 | Bacteria | 1768 |
| 696 | Ga0500642_0000067 | 3300053130 | Bacteria | 56324 |
| 697 | Ga0500642_0104340 | 3300053130 | Bacteria | 1321 |
| 698 | Ga0500559_0120556 | 3300053136 | Bacteria | 1219 |
| 699 | Ga0500585_057645 | 3300053144 | Bacteria | 1394 |
| 700 | Ga0500603_001381 | 3300053150 | Bacteria | 5534 |
| 701 | Ga0500619_021578 | 3300053154 | Bacteria | 1857 |
| 702 | Ga0500630_035540 | 3300053159 | Bacteria | 2441 |
| 703 | Ga0500639_000219 | 3300053163 | Bacteria | 28391 |
| 704 | Ga0500636_0066605 | 3300053177 | Bacteria | 2094 |
| 705 | Ga0500625_005765 | 3300053729 | Bacteria | 5212 |
| 706 | Ga0501084_0006290 | 3300054114 | Bacteria | 9760 |
| 707 | 2507510856 | 2507262055 | Bacteria | 8048963 |
| 708 | 2508544673 | 2508501009 | Bacteria | 7784016 |
| 709 | 2508697111 | 2508501042 | Bacteria | 8719808 |
| 710 | 2509148566 | 2508501128 | Bacteria | 8613869 |
| 711 | 2513637633 | 2513237094 | Bacteria | 8789602 |
| 712 | 2513649515 | 2513237095 | Bacteria | 8976980 |
| 713 | 2513653945 | 2513237096 | Bacteria | 8722461 |
| 714 | 2513719321 | 2513237104 | Bacteria | 10034502 |
| 715 | 2513856379 | 2513237137 | Bacteria | 9558895 |
| 716 | 2513888424 | 2513237141 | Bacteria | 8496279 |
| 717 | 2513918285 | 2513237145 | Bacteria | 8979722 |
| 718 | 2515630715 | 2515154112 | Bacteria | 8294334 |
| 719 | 2517100429 | 2517093001 | Bacteria | 9002274 |
| 720 | 2517891485 | 2517572143 | Bacteria | 9484767 |
| 721 | 2524437289 | 2524023205 | Bacteria | 8918781 |
| 722 | 2524541002 | 2524023228 | Bacteria | 10118060 |
| 723 | 2528855271 | 2528768022 | Bacteria | 10457665 |
| 724 | 2545674496 | 2545555834 | Bacteria | 8130841 |
| 725 | 2596371343 | 2595698237 | Bacteria | 6712432 |
| 726 | 2644291197 | 2643221651 | Bacteria | 4798932 |
| 727 | 2671118746 | 2667528175 | Bacteria | 7532676 |
| 728 | 2728754864 | 2728368998 | Bacteria | 8720350 |
| 729 | 2745076758 | 2744054633 | Bacteria | 8678936 |
| 730 | 2793065131 | 2791355196 | Bacteria | 7323613 |
| 731 | 2793066853 | 2791355197 | Bacteria | 8420563 |
| 732 | 2818237985 | 2816332527 | Bacteria | 8933356 |
| 733 | 2824601533 | 2824600985 | Bacteria | 8488197 |
| 734 | 2824617195 | 2824609381 | Bacteria | 8672835 |
| 735 | 2824653665 | 2824653114 | Bacteria | 8493680 |
| 736 | 2824663038 | 2824661429 | Bacteria | 9877870 |
| 737 | 2824709871 | 2824704595 | Bacteria | 9667483 |
| 738 | 2824756996 | 2824753945 | Bacteria | 9787441 |
| 739 | 2824770124 | 2824763712 | Bacteria | 9792355 |
| 740 | 2844317084 | 2844315083 | Bacteria | 8138177 |
| 741 | 2847938425 | 2847930680 | Bacteria | 9342022 |
| 742 | 2849081384 | 2849076700 | Bacteria | 7039503 |
| 743 | 2874597571 | 2874590934 | Bacteria | 8299676 |
| 744 | 2874649134 | 2874645413 | Bacteria | 8214782 |
| 745 | 2876767736 | 2876761206 | Bacteria | 10111113 |
| 746 | 2876774956 | 2876771140 | Bacteria | 8287509 |
| 747 | 2876822292 | 2876818435 | Bacteria | 8274608 |
| 748 | 2879078044 | 2879074833 | Bacteria | 8279565 |
| 749 | 2879088662 | 2879083081 | Bacteria | 8587928 |
| 750 | 2879103994 | 2879099564 | Bacteria | 10442239 |
| 751 | 2879132405 | 2879127579 | Bacteria | 8294491 |
| 752 | 2879145296 | 2879142872 | Bacteria | 8267021 |
| 753 | 2881370533 | 2881364244 | Bacteria | 7710352 |
| 754 | 2881667297 | 2881665667 | Bacteria | 8175609 |
| 755 | 2885377810 | 2885374607 | Bacteria | 8927485 |
| 756 | 2885416493 | 2885409591 | Bacteria | 9235467 |
| 757 | 2888381698 | 2888378607 | Bacteria | 9652610 |
| 758 | 2888422085 | 2888419890 | Bacteria | 7857137 |
| 759 | 2889306677 | 2889306138 | Bacteria | 6358934 |
| 760 | 2902332324 | 2902330777 | Bacteria | 6395352 |
| 761 | 2902409673 | 2902405164 | Bacteria | 6784948 |
| 762 | 2903735051 | 2903727486 | Bacteria | 8281579 |
| 763 | 2903758733 | 2903748898 | Bacteria | 9972761 |
| 764 | 2904691341 | 2904690495 | Bacteria | 9412302 |
| 765 | 2904704815 | |||
| 766 | 2904719040 | 2904711408 | Bacteria | 9771557 |
| 767 | 2906604167 | 2906602504 | Bacteria | 8295279 |
| 768 | 2906616661 | |||
| 769 | 2906643717 | 2906635258 | Bacteria | 8601019 |
| 770 | 2906647979 | 2906643746 | Bacteria | 8722424 |
| 771 | 2906666988 | 2906660503 | Bacteria | 8595048 |
| 772 | 2908741827 | 2908739725 | Bacteria | 8628932 |
| 773 | 2908759521 | 2908756301 | Bacteria | 8864324 |
| 774 | 2922371384 | |||
| 775 | 2922431314 | |||
| 776 | 2928126276 | 2928125067 | Bacteria | 5937560 |
| 777 | 2929623243 | 2929615660 | Bacteria | 9193770 |
| 778 | 2929630923 | 2929624759 | Bacteria | 9339455 |
| 779 | 2932786088 | 2932784394 | Bacteria | 9704911 |
| 780 | 2932799136 | 2932794094 | Bacteria | 7915132 |
| 781 | 2932803941 | 2932801729 | Bacteria | 7987968 |
| 782 | 2932811969 | 2932809354 | Bacteria | 9135765 |
| 783 | 2932822545 | 2932818245 | Bacteria | 9955613 |
| 784 | 2932831132 | 2932828146 | Bacteria | 9745859 |
| 785 | 2933585147 | 2933577622 | Bacteria | 9116884 |
| 786 | 2935612922 | 2935608549 | Bacteria | 8203142 |
| 787 | 2935624082 | 2935616580 | Bacteria | 9032984 |
| 788 | 2935633908 | 2935630451 | Bacteria | 8169952 |
| 789 | 2935640272 | 2935638405 | Bacteria | 10015038 |
| 790 | 2935654714 | 2935648319 | Bacteria | 8801166 |
| 791 | 2935663509 | 2935656913 | Bacteria | 8965014 |
| 792 | 2935666890 | 2935665750 | Bacteria | 9571747 |
| 793 | 2935684356 | 2935675223 | Bacteria | 9928132 |
| 794 | 2935691338 | 2935684952 | Bacteria | 9590419 |
| 795 | 2935699897 | 2935694250 | Bacteria | 9291695 |
| 796 | 2935704645 | 2935703347 | Bacteria | 10242284 |
| 797 | 2935719172 | 2935713505 | Bacteria | 9608509 |
| 798 | 2935729228 | 2935722832 | Bacteria | 9608746 |
| 799 | 2935737531 | 2935732158 | Bacteria | 9706831 |
| 800 | 2935746907 | 2935741537 | Bacteria | 9707219 |
| 801 | 2935758294 | 2935750917 | Bacteria | 9590372 |
| 802 | 2935762455 | 2935760218 | Bacteria | 9817913 |
| 803 | 2935777293 | 2935769743 | Bacteria | 7878163 |
| 804 | 2935780388 | 2935777560 | Bacteria | 8077691 |
| 805 | 2935793203 | 2935785616 | Bacteria | 7962367 |
| 806 | 2935801201 | 2935793552 | Bacteria | 8012592 |
| 807 | 2935803952 | 2935801545 | Bacteria | 9301974 |
| 808 | 2935811871 | 2935810662 | Bacteria | 9401221 |
| 809 | 2935824410 | 2935819856 | Bacteria | 8261050 |
| 810 | 2935829755 | 2935827899 | Bacteria | 10038562 |
| 811 | 2935842888 | 2935837841 | Bacteria | 9454360 |
| 812 | 2935852445 | 2935847175 | Bacteria | 8228321 |
| 813 | 2935862418 | 2935855204 | Bacteria | 9035059 |
| 814 | 2935870553 | 2935864058 | Bacteria | 9784707 |
| 815 | 2935881135 | 2935873716 | Bacteria | 9632195 |
| 816 | 2935884253 | 2935883170 | Bacteria | 7964738 |
| 817 | 2935912408 | 2935908558 | Bacteria | 8568796 |
| 818 | 2935921759 | 2935916978 | Bacteria | 9113783 |
| 819 | 2935929703 | 2935926038 | Bacteria | 8601059 |
| 820 | 2935938935 | 2935934488 | Bacteria | 8602579 |
| 821 | 2935948230 | 2935942939 | Bacteria | 8599779 |
| 822 | 2935954954 | 2935951376 | Bacteria | 8602333 |
| 823 | 2935962222 | 2935959822 | Bacteria | 7869783 |
| 824 | 2935972012 | 2935967501 | Bacteria | 8603075 |
| 825 | 2935979340 | 2935975950 | Bacteria | 8347125 |
| 826 | 2935988075 | 2935984226 | Bacteria | 8302647 |
| 827 | 2935993632 | 2935992306 | Bacteria | 9802711 |
| 828 | 2936004528 | 2936002035 | Bacteria | 9362176 |
| 829 | 2936017665 | 2936011229 | Bacteria | 8801034 |
| 830 | 2936026253 | 2936019824 | Bacteria | 8804134 |
| 831 | 2936035243 | 2936028420 | Bacteria | 8965941 |
| 832 | 2936038454 | 2936037263 | Bacteria | 9446081 |
| 833 | 2936053151 | 2936046547 | Bacteria | 8903709 |
| 834 | 2936059374 | 2936055302 | Bacteria | 8785755 |
| 835 | 2940563796 | 2940556831 | Bacteria | 9590747 |
| 836 | 2941510789 | 2941507105 | Bacteria | 8166816 |
| 837 | 2941518173 | 2941515067 | Bacteria | 8166720 |
| 838 | 2941526956 | 2941523033 | Bacteria | 8169134 |
| 839 | 2941533853 | 2941531003 | Bacteria | 7653939 |
| 840 | 2941544137 | 2941538514 | Bacteria | 9402094 |
| 841 | 3003666887 | 3003665799 | Bacteria | 7279786 |
| 842 | 3005481110 | 3005474847 | Bacteria | 9259049 |
| 843 | 3005596714 | 3005594810 | Bacteria | 8716512 |
| 844 | 3005712785 | 3005710791 | Bacteria | 7622528 |
| 845 | 3005719842 | 3005718088 | Bacteria | 8283608 |
| 846 | 641644901 | 641522639 | Bacteria | 7737025 |
| 847 | 643597844 | 643348564 | Bacteria | 8839022 |
| 848 | 8006939601 | 8006933436 | Bacteria | 10410654 |
| 849 | 8006979352 | 8006973647 | Bacteria | 10679141 |
| 850 | 8016516245 | 8016511872 | Bacteria | 9921665 |
| 851 | 8016537162 | 8016530956 | Bacteria | 8155261 |
| 852 | 8016551832 | 8016548790 | Bacteria | 8155074 |
| 853 | 8016560215 | 8016557553 | Bacteria | 8154380 |
| 854 | 8016566812 | 8016566248 | Bacteria | 8158151 |
| 855 | 8016589310 | 8016583857 | Bacteria | 10421953 |
| 856 | 8016598133 | 8016595262 | Bacteria | 8149947 |
| 857 | 8016604272 | 8016603502 | Bacteria | 8731218 |
| 858 | 8016620858 | 8016613128 | Bacteria | 8794220 |
| 859 | 8016629130 | 8016622563 | Bacteria | 7999408 |
| 860 | 8016633667 | 8016630954 | Bacteria | 9217207 |
| 861 | 8017060287 | 8017057580 | Bacteria | 10023680 |
| 862 | 8019536854 | 8019530166 | Bacteria | 8155624 |
| 863 | 8019548062 | 8019547302 | Bacteria | 7996444 |
| 864 | 8019565492 | 8019555841 | Bacteria | 9642137 |
| 865 | 8019575588 | 8019565922 | Bacteria | 9639779 |
| 866 | 8019579814 | 8019576017 | Bacteria | 10049540 |
| 867 | 8019587520 | 8019586578 | Bacteria | 10212056 |
| 868 | 8019603818 | 8019597564 | Bacteria | 10041141 |
| 869 | 8019614717 | 8019608314 | Bacteria | 10042931 |
| 870 | 8019625328 | 8019619141 | Bacteria | 9218857 |
| 871 | 8019636853 | 8019629233 | Bacteria | 8687553 |
| 872 | 8019642754 | 8019638758 | Bacteria | 9062356 |
| 873 | 8019649838 | 8019648815 | Bacteria | 10014479 |
| 874 | 8019664674 | 8019659431 | Bacteria | 8577854 |
| 875 | 8019674264 | 8019668869 | Bacteria | 8791617 |
| 876 | 8019693930 | 8019687851 | Bacteria | 8712826 |
| 877 | 8055748979 | 8055742211 | Bacteria | 9226248 |
| 878 | 8056693836 | 8056689827 | Bacteria | 6712655 |
| 879 | 8056972022 | 8056967851 | Bacteria | 9038162 |
| 880 | Ga0213874_10002639 | |||
| 881 | JGI25165J46597_1006767 | |||
| 882 | JGI25160J50197_1007582 | |||
| 883 | Ga0055543_1013756 | |||
| 884 | Ga0065165_1004374 | |||
| 885 | Ga0070658_10056239 | |||
| 886 | Ga0070676_10289184 | |||
| 887 | Ga0070683_100001891 | |||
| 888 | Ga0070683_100019924 | |||
| 889 | Ga0070683_100072047 | |||
| 890 | Ga0070683_100658453 | |||
| 891 | Ga0068869_100001186 | |||
| 892 | Ga0070680_100016775 | |||
| 893 | Ga0070680_100195987 | |||
| 894 | Ga0070680_100312437 | |||
| 895 | Ga0070682_100056630 | |||
| 896 | Ga0070682_100316334 | |||
| 897 | Ga0068868_100002380 | |||
| 898 | Ga0070689_100090026 | |||
| 899 | Ga0070691_10186651 | |||
| 900 | Ga0070668_100008952 | |||
| 901 | Ga0070674_100161557 | |||
| 902 | Ga0070659_100051334 | |||
| 903 | Ga0070659_100256937 | |||
| 904 | Ga0070667_100362682 | |||
| 905 | Ga0070709_10002013 | |||
| 906 | Ga0070709_10005865 | |||
| 907 | Ga0070714_100006313 | |||
| 908 | Ga0070714_100041770 | |||
| 909 | Ga0070714_100173398 | |||
| 910 | Ga0070713_100004655 | |||
| 911 | Ga0070713_100039500 | |||
| 912 | Ga0070713_100164699 | |||
| 913 | Ga0070710_10000896 | |||
| 914 | Ga0070710_10002832 | |||
| 915 | Ga0070701_10083906 | |||
| 916 | Ga0070711_100007213 | |||
| 917 | Ga0070711_100008957 | |||
| 918 | Ga0070711_100093101 | |||
| 919 | Ga0070711_100119075 | |||
| 920 | Ga0070663_100033127 | |||
| 921 | Ga0070663_100036834 | |||
| 922 | Ga0070662_100132585 | |||
| 923 | Ga0070681_10076300 | |||
| 924 | Ga0070681_10146085 | |||
| 925 | Ga0070681_10315190 | |||
| 926 | Ga0070681_10493869 | |||
| 927 | Ga0070681_10511038 | |||
| 928 | Ga0070706_100118744 | |||
| 929 | Ga0070707_100171685 | |||
| 930 | Ga0070679_100029796 | |||
| 931 | Ga0070679_100291008 | |||
| 932 | Ga0070679_100316505 | |||
| 933 | Ga0070684_100010920 | |||
| 934 | Ga0070684_100052866 | |||
| 935 | Ga0070697_100093961 | |||
| 936 | Ga0068853_100035551 | |||
| 937 | Ga0068853_100169342 | |||
| 938 | Ga0070686_100053425 | |||
| 939 | Ga0070665_100012340 | |||
| 940 | Ga0070665_100035823 | |||
| 941 | Ga0068855_100040104 | |||
| 942 | Ga0068855_100072657 | |||
| 943 | Ga0068855_100077687 | |||
| 944 | Ga0068855_100097896 | |||
| 945 | Ga0068855_100328828 | |||
| 946 | Ga0068855_100342315 | |||
| 947 | Ga0068855_100425519 | |||
| 948 | Ga0070664_100026724 | |||
| 949 | Ga0070664_100152168 | |||
| 950 | Ga0070664_100410739 | |||
| 951 | Ga0068857_100017610 | |||
| 952 | Ga0068857_100028282 | |||
| 953 | Ga0068854_100097839 | |||
| 954 | Ga0068856_100000183 | |||
| 955 | Ga0068856_100029563 | |||
| 956 | Ga0068856_100063430 | |||
| 957 | Ga0068852_100053488 | |||
| 958 | Ga0068852_100230989 | |||
| 959 | Ga0068859_100063595 | |||
| 960 | Ga0068864_100049226 | |||
| 961 | Ga0068864_100122039 | |||
| 962 | Ga0068861_100042059 | |||
| 963 | Ga0068870_10004287 | |||
| 964 | Ga0068863_100027853 | |||
| 965 | Ga0068858_100041385 | |||
| 966 | Ga0068858_100589553 | |||
| 967 | Ga0068860_100093295 | |||
| 968 | Ga0081540_1002227 | |||
| 969 | Ga0081540_1005198 | |||
| 970 | Ga0081540_1006571 | |||
| 971 | Ga0081540_1006785 | |||
| 972 | Ga0081540_1018573 | |||
| 973 | Ga0070717_10087311 | |||
| 974 | Ga0070717_10429945 | |||
| 975 | Ga0075365_10059561 | |||
| 976 | Ga0075368_10019062 | |||
| 977 | Ga0075363_100010158 | |||
| 978 | Ga0075363_100048514 | |||
| 979 | Ga0075364_10024619 | |||
| 980 | Ga0075364_10295801 | |||
| 981 | Ga0070715_10000456 | |||
| 982 | Ga0070716_100011137 | |||
| 983 | Ga0070716_100023798 | |||
| 984 | Ga0070712_100015504 | |||
| 985 | Ga0075367_10001130 | |||
| 986 | Ga0075369_10005353 | |||
| 987 | Ga0075366_10016316 | |||
| 988 | Ga0075370_10009564 | |||
| 989 | Ga0075370_10017687 | |||
| 990 | Ga0068865_100055253 | |||
| 991 | Ga0075436_100088588 | |||
| 992 | Ga0097620_100063592 | |||
| 993 | Ga0099824_1021709 | |||
| 994 | Ga0099824_1033210 | |||
| 995 | Ga0099822_1024226 | |||
| 996 | Ga0105240_10039694 | |||
| 997 | Ga0105240_10109427 | |||
| 998 | Ga0105240_10121920 | |||
| 999 | Ga0105240_10135701 | |||
| 1000 | Ga0105240_10276799 | |||
| 1001 | Ga0111539_10714684 | |||
| 1002 | Ga0105245_10005441 | |||
| 1003 | Ga0105245_10038994 | |||
| 1004 | Ga0105247_10005785 | |||
| 1005 | Ga0105247_10240256 | |||
| 1006 | Ga0105243_10042185 | |||
| 1007 | Ga0105241_10037493 | |||
| 1008 | Ga0105241_10211105 | |||
| 1009 | Ga0105248_10646336 | |||
| 1010 | Ga0105237_10017339 | |||
| 1011 | Ga0105237_10095319 | |||
| 1012 | Ga0105237_10138567 | |||
| 1013 | Ga0105237_10298145 | |||
| 1014 | Ga0105238_10142049 | |||
| 1015 | Ga0105238_10398268 | |||
| 1016 | Ga0099796_10010555 | |||
| 1017 | Ga0105239_10003963 | |||
| 1018 | Ga0105239_10109809 | |||
| 1019 | Ga0105239_10546926 | |||
| 1020 | Ga0105246_10379968 | |||
| 1021 | Ga0157371_10237967 | |||
| 1022 | Ga0157370_10097584 | |||
| 1023 | Ga0157370_10205900 | |||
| 1024 | Ga0157370_10338421 | |||
| 1025 | Ga0157370_10357736 | |||
| 1026 | Ga0157369_10012373 | |||
| 1027 | Ga0157369_10026071 | |||
| 1028 | Ga0157369_10083698 | |||
| 1029 | Ga0157374_10634738 | |||
| 1030 | Ga0157378_10172127 | |||
| 1031 | Ga0163162_10025402 | |||
| 1032 | Ga0163162_10146465 | |||
| 1033 | Ga0157372_10034737 | |||
| 1034 | Ga0157372_10048052 | |||
| 1035 | Ga0157372_10326057 | |||
| 1036 | Ga0157375_10011636 | |||
| 1037 | Ga0163163_10007610 | |||
| 1038 | Ga0163163_10073797 | |||
| 1039 | Ga0157376_10153431 | |||
| 1040 | Ga0213873_10000846 | |||
| 1041 | Ga0213872_10000429 | |||
| 1042 | Ga0213872_10004083 | |||
| 1043 | Ga0213872_10004694 | |||
| 1044 | Ga0213872_10016051 | |||
| 1045 | Ga0213874_10002580 | |||
| 1046 | Ga0213874_10005128 | |||
| 1047 | Ga0213876_10001306 | |||
| 1048 | Ga0213876_10001630 | |||
| 1049 | Ga0213876_10134690 | |||
| 1050 | Ga0213875_10000030 | |||
| 1051 | Ga0213875_10003482 | |||
| 1052 | Ga0213875_10003821 | |||
| 1053 | Ga0213875_10007291 | |||
| 1054 | Ga0213875_10010083 | |||
| 1055 | Ga0213875_10014477 | |||
| 1056 | Ga0213875_10019616 | |||
| 1057 | Ga0213875_10046437 | |||
| 1058 | Ga0213875_10077961 | |||
| 1059 | Ga0213875_10091232 | |||
| 1060 | Ga0213871_10068475 | |||
| 1061 | Ga0209677_100749 | |||
| 1062 | Ga0209148_1000773 | |||
| 1063 | Ga0209233_1003148 | |||
| 1064 | Ga0209233_1004858 | |||
| 1065 | Ga0209233_1005292 | |||
| 1066 | Ga0209233_1005946 | |||
| 1067 | Ga0209455_1001728 | |||
| 1068 | Ga0209455_1008216 | |||
| 1069 | Ga0209564_1003916 | |||
| 1070 | Ga0209758_1000282 | |||
| 1071 | Ga0209758_1004003 | |||
| 1072 | Ga0209758_1027779 | |||
| 1073 | Ga0207426_1000437 | |||
| 1074 | Ga0207426_1001098 | |||
| 1075 | Ga0207426_1012310 | |||
| 1076 | Ga0207692_10002885 | |||
| 1077 | Ga0207692_10005756 | |||
| 1078 | Ga0207692_10009200 | |||
| 1079 | Ga0207710_10018346 | |||
| 1080 | Ga0207688_10019965 | |||
| 1081 | Ga0207685_10000267 | |||
| 1082 | Ga0207699_10002339 | |||
| 1083 | Ga0207699_10003537 | |||
| 1084 | Ga0207643_10025498 | |||
| 1085 | Ga0207705_10082672 | |||
| 1086 | Ga0207654_10021751 | |||
| 1087 | Ga0207654_10029110 | |||
| 1088 | Ga0207707_10018073 | |||
| 1089 | Ga0207695_10000062 | |||
| 1090 | Ga0207695_10019960 | |||
| 1091 | Ga0207695_10078563 | |||
| 1092 | Ga0207695_10133694 | |||
| 1093 | Ga0207695_10251375 | |||
| 1094 | Ga0207671_10008251 | |||
| 1095 | Ga0207671_10051920 | |||
| 1096 | Ga0207671_10092336 | |||
| 1097 | Ga0207671_10139497 | |||
| 1098 | Ga0207671_10223517 | |||
| 1099 | Ga0207693_10000326 | |||
| 1100 | Ga0207693_10003223 | |||
| 1101 | Ga0207693_10015787 | |||
| 1102 | Ga0207663_10000225 | |||
| 1103 | Ga0207663_10009124 | |||
| 1104 | Ga0207663_10096713 | |||
| 1105 | Ga0207663_10116539 | |||
| 1106 | Ga0207663_10132455 | |||
| 1107 | Ga0207660_10228682 | |||
| 1108 | Ga0207657_10004806 | |||
| 1109 | Ga0207649_10102875 | |||
| 1110 | Ga0207652_10013842 | |||
| 1111 | Ga0207652_10023687 | |||
| 1112 | Ga0207652_10084661 | |||
| 1113 | Ga0207652_10525394 | |||
| 1114 | Ga0207694_10132083 | |||
| 1115 | Ga0207694_10525114 | |||
| 1116 | Ga0207664_10014435 | |||
| 1117 | Ga0207664_10031784 | |||
| 1118 | Ga0207664_10109709 | |||
| 1119 | Ga0207644_10016717 | |||
| 1120 | Ga0207690_10025298 | |||
| 1121 | Ga0207706_10199961 | |||
| 1122 | Ga0207709_10203375 | |||
| 1123 | Ga0207704_10048142 | |||
| 1124 | Ga0207665_10001364 | |||
| 1125 | Ga0207665_10015528 | |||
| 1126 | Ga0207665_10036269 | |||
| 1127 | Ga0207711_10054778 | |||
| 1128 | Ga0207689_10014080 | |||
| 1129 | Ga0207661_10001182 | |||
| 1130 | Ga0207661_10203221 | |||
| 1131 | Ga0207679_10363881 | |||
| 1132 | Ga0207679_10489006 | |||
| 1133 | Ga0207712_10125479 | |||
| 1134 | Ga0207668_10004125 | |||
| 1135 | Ga0207658_10093472 | |||
| 1136 | Ga0207677_10038130 | |||
| 1137 | Ga0207639_10010102 | |||
| 1138 | Ga0207639_10196860 | |||
| 1139 | Ga0207639_10311422 | |||
| 1140 | Ga0207678_10014454 | |||
| 1141 | Ga0207678_10021795 | |||
| 1142 | Ga0207678_10023002 | |||
| 1143 | Ga0207678_10054764 | |||
| 1144 | Ga0207702_10000197 | |||
| 1145 | Ga0207702_10018501 | |||
| 1146 | Ga0207641_10238720 | |||
| 1147 | Ga0207648_10219239 | |||
| 1148 | Ga0207676_10106108 | |||
| 1149 | Ga0207674_10464147 | |||
| 1150 | Ga0207675_100041364 | |||
| 1151 | Ga0207683_10011087 | |||
| 1152 | Ga0207698_10105090 | |||
| 1153 | Ga0207698_10200930 | |||
| 1154 | Ga0207698_10314938 | |||
| 1155 | Ga0209389_1000004 | |||
| 1156 | Ga0209389_1001618 | |||
| 1157 | Ga0209589_1000010 | |||
| 1158 | Ga0209589_1000014 | |||
| 1159 | Ga0209489_100011 | |||
| 1160 | Ga0209489_100014 | |||
| 1161 | Ga0209489_100777 | |||
| 1162 | Ga0209700_100013 | |||
| 1163 | Ga0209700_100024 | |||
| 1164 | Ga0209813_10002203 | |||
| 1165 | Ga0268266_10001413 | |||
| 1166 | Ga0268266_10087585 | |||
| 1167 | Ga0268264_10062341 | |||
| 1168 | Ga0265334_10054565 | |||
| 1169 | Ga0265770_1014959 | |||
| 1170 | Ga0265773_1001012 | |||
| 1171 | Ga0265760_10051491 | |||
| 1172 | Ga0265330_10035799 | |||
| 1173 | Ga0265325_10012959 | |||
| 1174 | Ga0265340_10011608 | |||
| 1175 | Ga0265339_10000016 | |||
| 1176 | Ga0265339_10006455 | |||
| 1177 | Ga0265339_10016353 | |||
| 1178 | Ga0265339_10110791 | |||
| 1179 | Ga0265316_10387288 | |||
| 1180 | Ga0307513_10018286 | |||
| 1181 | Ga0265313_10000060 | |||
| 1182 | Ga0265314_10016312 | |||
| 1183 | Ga0265314_10069850 | |||
| 1184 | Ga0265342_10010600 | |||
| 1185 | Ga0307516_10092521 | |||
| 1186 | Ga0316583_10027407 | |||
| 1187 | Ga0307510_10019799 | |||
| 1188 | Ga0315911_1000002 | |||
| 1189 | Ga0316215_1001104 | |||
| 1190 | Ga0373934_0002405 | |||
| 1191 | Ga0373923_0022547 | |||
| 1192 | Ga0373936_0018479 | |||
| 1193 | Ga0373953_0000409 | |||
| 1194 | Ga0373953_0009941 | |||
| 1195 | Ga0373954_0002776 | |||
| 1196 | Ga0373954_0029995 | |||
| 1197 | Ga0373956_0004736 | |||
| 1198 | Ga0373956_0005250 | |||
| 1199 | Ga0373957_0014177 | |||
| 1200 | Ga0373955_0002711 | |||
| 1201 | Ga0373955_0003550 | |||
| 1202 | Ga0373924_0006225 | |||
| 1203 | Ga0373927_0004054 | |||
| 1204 | Ga0373933_0002107 | |||
| 1205 | Ga0373937_0008396 | |||
| 1206 | Ga0373937_0021312 | |||
| 1207 | Ga0373937_0324402 | |||
| 1208 | Ga0372808_001074 | |||
| 1209 | Ga0373925_0024876 | |||
| 1210 | Ga0395899_0122972 | |||
| 1211 | Ga0395900_0000660 | |||
| 1212 | Ga0395900_0002114 | |||
| 1213 | Ga0395900_0008707 | |||
| 1214 | Ga0395900_0199262 | |||
| 1215 | Ga0395900_0378614 | |||
| 1216 | Ga0395898_0003200 | |||
| 1217 | Ga0395898_0006500 | |||
| 1218 | Ga0395898_0007107 | |||
| 1219 | Ga0395898_0064826 | |||
| 1220 | Ga0395905_0021700 | |||
| 1221 | Ga0395905_0259473 | |||
| 1222 | Ga0436364_0051975 | |||
| 1223 | Ga0436364_0102033 | |||
| 1224 | Ga0436364_0134493 | |||
| 1225 | Ga0436364_0178729 | |||
| 1226 | Ga0436364_0240938 | |||
| 1227 | Ga0436364_0294887 | |||
| 1228 | Ga0436364_0330571 | |||
| 1229 | Ga0436364_0341833 | |||
| 1230 | Ga0436364_0425317 | |||
| 1231 | Ga0436364_0480253 | |||
| 1232 | Ga0436364_0629092 | |||
| 1233 | Ga0436364_0654054 | |||
| 1234 | Ga0436364_1015733 | |||
| 1235 | Ga0436364_1040604 | |||
| 1236 | Ga0436364_1401270 | |||
| 1237 | Ga0436364_1503331 | |||
| 1238 | Ga0436364_1527859 | |||
| 1239 | Ga0395901_0034087 | |||
| 1240 | Ga0395901_0063663 | |||
| 1241 | Ga0395901_0101488 | |||
| 1242 | Ga0395901_0437117 | |||
| 1243 | Ga0395901_0515459 | |||
| 1244 | Ga0436365_0151043 | |||
| 1245 | Ga0436365_0159409 | |||
| 1246 | Ga0436365_0459588 | |||
| 1247 | Ga0436365_0510188 | |||
| 1248 | Ga0436365_0697045 | |||
| 1249 | Ga0436365_0917056 | |||
| 1250 | Ga0436365_1047663 | |||
| 1251 | Ga0436360_0202427 | |||
| 1252 | Ga0436360_0480010 | |||
| 1253 | Ga0436360_0545523 | |||
| 1254 | Ga0436360_1060729 | |||
| 1255 | Ga0436360_1101828 | |||
| 1256 | Ga0436361_0200283 | |||
| 1257 | Ga0436361_0512286 | |||
| 1258 | Ga0436361_0638445 | |||
| 1259 | Ga0436361_0838125 | |||
| 1260 | Ga0436361_1054672 | |||
| 1261 | Ga0436361_1159707 | |||
| 1262 | Ga0436363_0121554 | |||
| 1263 | Ga0436363_0274569 | |||
| 1264 | Ga0436363_0454820 | |||
| 1265 | Ga0436363_0627803 | |||
| 1266 | Ga0436363_0700194 | |||
| 1267 | Ga0436363_0761127 | |||
| 1268 | Ga0436363_1022276 | |||
| 1269 | Ga0436363_1499575 | |||
| 1270 | Ga0436362_0278148 | |||
| 1271 | Ga0436362_0842308 | |||
| 1272 | Ga0436362_0895327 | |||
| 1273 | Ga0436362_0983233 | |||
| 1274 | Ga0466969_0100925 | |||
| 1275 | Ga0466972_0000079 | |||
| 1276 | Ga0466972_0004644 | |||
| 1277 | Ga0466966_0001208 | |||
| 1278 | Ga0466966_0006229 | |||
| 1279 | Ga0466961_0000020 | |||
| 1280 | Ga0466961_0039468 | |||
| 1281 | Ga0466961_0049669 | |||
| 1282 | Ga0466963_0031974 | |||
| 1283 | Ga0466963_0209438 | |||
| 1284 | Ga0466971_0051755 | |||
| 1285 | Ga0466968_0011964 | |||
| 1286 | Ga0466970_0026083 | |||
| 1287 | Ga0466970_0087989 | |||
| 1288 | Ga0466957_0041896 | |||
| 1289 | Ga0466957_0165300 | |||
| 1290 | Ga0466960_0000424 | |||
| 1291 | Ga0466959_0004294 | |||
| 1292 | Ga0466959_0245173 | |||
| 1293 | Ga0466967_0063821 | |||
| 1294 | Ga0466967_0377060 | |||
| 1295 | Ga0466967_0549232 | |||
| 1296 | Ga0495592_0003202 | |||
| 1297 | Ga0495592_0036190 | |||
| 1298 | Ga0495603_0139262 | |||
| 1299 | Ga0495629_0001830 | |||
| 1300 | Ga0495629_0006153 | |||
| 1301 | Ga0495629_0107512 | |||
| 1302 | Ga0495641_0144258 | |||
| 1303 | Ga0495651_0002500 | |||
| 1304 | Ga0495651_0041294 | |||
| 1305 | Ga0495651_0041839 | |||
| 1306 | Ga0495651_0140950 | |||
| 1307 | Ga0495653_0001471 | |||
| 1308 | Ga0495653_0050752 | |||
| 1309 | Ga0495653_0159296 | |||
| 1310 | Ga0495582_0214523 | |||
| 1311 | Ga0495639_0114838 | |||
| 1312 | Ga0495662_0108284 | |||
| 1313 | Ga0495664_0007676 | |||
| 1314 | Ga0495664_0007911 | |||
| 1315 | Ga0495664_0087653 | |||
| 1316 | Ga0495596_0068738 | |||
| 1317 | Ga0495606_0005210 | |||
| 1318 | Ga0495608_0002191 | |||
| 1319 | Ga0495608_0036131 | |||
| 1320 | Ga0495608_0060094 | |||
| 1321 | Ga0495618_0079959 | |||
| 1322 | Ga0495618_0279140 | |||
| 1323 | Ga0495620_0060077 | |||
| 1324 | Ga0495628_0030883 | |||
| 1325 | Ga0495628_0033600 | |||
| 1326 | Ga0495628_0064783 | |||
| 1327 | Ga0495630_0022407 | |||
| 1328 | Ga0495648_0003767 | |||
| 1329 | Ga0495648_0007614 | |||
| 1330 | Ga0495652_0006321 | |||
| 1331 | Ga0495652_0031923 | |||
| 1332 | Ga0495640_0002348 | |||
| 1333 | Ga0495640_0026198 | |||
| 1334 | Ga0495586_0022337 | |||
| 1335 | Ga0495587_0004728 | |||
| 1336 | Ga0495587_0015523 | |||
| 1337 | Ga0495587_0027948 | |||
| 1338 | Ga0495645_0014837 | |||
| 1339 | Ga0495645_0040372 | |||
| 1340 | Ga0495645_0221128 | |||
| 1341 | Ga0495667_0002963 | |||
| 1342 | Ga0495667_0013368 | |||
| 1343 | Ga0495667_0016179 | |||
| 1344 | Ga0495634_0089901 | |||
| 1345 | Ga0495634_0197772 | |||
| 1346 | Ga0495625_0039696 | |||
| 1347 | Ga0495635_0000636 | |||
| 1348 | Ga0495635_0002205 | |||
| 1349 | Ga0495657_0002552 | |||
| 1350 | Ga0495657_0014012 | |||
| 1351 | Ga0495599_0001077 | |||
| 1352 | Ga0495599_0010332 | |||
| 1353 | Ga0495599_0060861 | |||
| 1354 | Ga0495623_0004268 | |||
| 1355 | Ga0495623_0006526 | |||
| 1356 | Ga0495623_0048527 | |||
| 1357 | Ga0495646_0025871 | |||
| 1358 | Ga0495613_0033951 | |||
| 1359 | Ga0495613_0120524 | |||
| 1360 | Ga0495624_0058576 | |||
| 1361 | Ga0495624_0091302 | |||
| 1362 | Ga0495624_0111238 | |||
| 1363 | Ga0495600_0000873 | |||
| 1364 | Ga0495600_0001010 | |||
| 1365 | Ga0495604_0008420 | |||
| 1366 | Ga0495604_0038621 | |||
| 1367 | Ga0495604_0052467 | |||
| 1368 | Ga0495604_0063576 | |||
| 1369 | Ga0495674_0028066 | |||
| 1370 | Ga0495674_0065255 | |||
| 1371 | Ga0495674_0242918 | |||
| 1372 | Ga0495676_0103736 | |||
| 1373 | Ga0495680_0001037 | |||
| 1374 | Ga0495680_0001883 | |||
| 1375 | Ga0495680_0043083 | |||
| 1376 | Ga0495675_0001800 | |||
| 1377 | Ga0495675_0037092 | |||
| 1378 | Ga0495684_0000666 | |||
| 1379 | Ga0495684_0036531 | |||
| 1380 | Ga0495684_0096515 | |||
| 1381 | Ga0495684_0184941 | |||
| 1382 | Ga0495686_0046711 | |||
| 1383 | Ga0495686_0107093 | |||
| 1384 | Ga0495593_0008032 | |||
| 1385 | Ga0495602_0004340 | |||
| 1386 | Ga0495602_0012996 | |||
| 1387 | Ga0495602_0196647 | |||
| 1388 | Ga0495602_0201081 | |||
| 1389 | Ga0496100_0029945 | |||
| 1390 | Ga0496102_0567391 | |||
| 1391 | Ga0496104_0001245 | |||
| 1392 | Ga0496104_0005309 | |||
| 1393 | Ga0496104_0082198 | |||
| 1394 | Ga0496104_0283502 | |||
| 1395 | Ga0496105_0003657 | |||
| 1396 | Ga0496105_0093356 | |||
| 1397 | Ga0496106_0013957 | |||
| 1398 | Ga0496107_0130771 | |||
| 1399 | Ga0496108_0001861 | |||
| 1400 | Ga0496108_0218656 | |||
| 1401 | Ga0496109_0001073 | |||
| 1402 | Ga0496109_0155295 | |||
| 1403 | Ga0496110_0002479 | |||
| 1404 | Ga0496111_0028004 | |||
| 1405 | Ga0496111_0061970 | |||
| 1406 | Ga0496111_0215505 | |||
| 1407 | Ga0496112_0002061 | |||
| 1408 | Ga0496112_0005807 | |||
| 1409 | Ga0496112_0008838 | |||
| 1410 | Ga0496112_0107427 | |||
| 1411 | Ga0496112_0119654 | |||
| 1412 | Ga0496112_0223868 | |||
| 1413 | Ga0496112_0440495 | |||
| 1414 | Ga0496113_0000095 | |||
| 1415 | Ga0496113_0156636 | |||
| 1416 | Ga0496114_0200299 | |||
| 1417 | Ga0496115_0003952 | |||
| 1418 | Ga0496115_0042478 | |||
| 1419 | Ga0496115_0314357 | |||
| 1420 | Ga0496116_0140996 | |||
| 1421 | Ga0496118_0016456 | |||
| 1422 | Ga0496118_0130626 | |||
| 1423 | Ga0496119_0003004 | |||
| 1424 | Ga0496119_0080481 | |||
| 1425 | Ga0496121_0008659 | |||
| 1426 | Ga0496121_0021131 | |||
| 1427 | Ga0496121_0032677 | |||
| 1428 | Ga0496121_0066895 | |||
| 1429 | Ga0496121_0103413 | |||
| 1430 | Ga0496124_0209458 | |||
| 1431 | Ga0496125_0000237 | |||
| 1432 | Ga0496125_0001822 | |||
| 1433 | Ga0496126_0011267 | |||
| 1434 | Ga0496126_0158354 | |||
| 1435 | Ga0496126_0174038 | |||
| 1436 | Ga0496126_0338736 | |||
| 1437 | Ga0501031_0001197 | |||
| 1438 | Ga0501031_0003032 | |||
| 1439 | Ga0501031_0118857 | |||
| 1440 | Ga0501032_0000358 | |||
| 1441 | Ga0501032_0000696 | |||
| 1442 | Ga0501032_0036140 | |||
| 1443 | Ga0501032_0086541 | |||
| 1444 | Ga0501033_0000232 | |||
| 1445 | Ga0501033_0000601 | |||
| 1446 | Ga0501033_0001532 | |||
| 1447 | Ga0501033_0006726 | |||
| 1448 | Ga0501033_0037684 | |||
| 1449 | Ga0501034_0000039 | |||
| 1450 | Ga0501034_0000704 | |||
| 1451 | Ga0501034_0193399 | |||
| 1452 | Ga0501036_0000007 | |||
| 1453 | Ga0501036_0000052 | |||
| 1454 | Ga0501036_0301604 | |||
| 1455 | Ga0501037_0000025 | |||
| 1456 | Ga0501037_0001450 | |||
| 1457 | Ga0501037_0020087 | |||
| 1458 | Ga0501037_0149374 | |||
| 1459 | Ga0501038_0000026 | |||
| 1460 | Ga0501038_0000168 | |||
| 1461 | Ga0501038_0119167 | |||
| 1462 | Ga0501038_0177296 | |||
| 1463 | Ga0501038_0275468 | |||
| 1464 | Ga0501039_0000005 | |||
| 1465 | Ga0501039_0003632 | |||
| 1466 | Ga0501039_0156253 | |||
| 1467 | Ga0501042_0118124 | |||
| 1468 | Ga0501043_0000007 | |||
| 1469 | Ga0501043_0000036 | |||
| 1470 | Ga0501043_0002042 | |||
| 1471 | Ga0501043_0133440 | |||
| 1472 | Ga0501046_0000147 | |||
| 1473 | Ga0501046_0000231 | |||
| 1474 | Ga0501046_0070614 | |||
| 1475 | Ga0501046_0171712 | |||
| 1476 | Ga0501046_0304341 | |||
| 1477 | Ga0501047_0000209 | |||
| 1478 | Ga0501047_0000457 | |||
| 1479 | Ga0501047_0009482 | |||
| 1480 | Ga0501047_0012842 | |||
| 1481 | Ga0501047_0071155 | |||
| 1482 | Ga0501047_0102930 | |||
| 1483 | Ga0501047_0145750 | |||
| 1484 | Ga0501047_0223123 | |||
| 1485 | Ga0501048_0000585 | |||
| 1486 | Ga0501048_0020451 | |||
| 1487 | Ga0501067_0000025 | |||
| 1488 | Ga0501067_0063143 | |||
| 1489 | Ga0501067_0087364 | |||
| 1490 | Ga0501068_0002387 | |||
| 1491 | Ga0501068_0004030 | |||
| 1492 | Ga0501069_0000001 | |||
| 1493 | Ga0501069_0133516 | |||
| 1494 | Ga0501070_0000071 | |||
| 1495 | Ga0501070_0000824 | |||
| 1496 | Ga0501070_0001839 | |||
| 1497 | Ga0501070_0024940 | |||
| 1498 | Ga0501070_0178591 | |||
| 1499 | Ga0501070_0178612 | |||
| 1500 | Ga0501071_0010530 | |||
| 1501 | Ga0501071_0022185 | |||
| 1502 | Ga0501072_0003385 | |||
| 1503 | Ga0501072_0051510 | |||
| 1504 | Ga0501073_0000135 | |||
| 1505 | Ga0501073_0011727 | |||
| 1506 | Ga0501073_0013905 | |||
| 1507 | Ga0501073_0032984 | |||
| 1508 | Ga0501074_0000003 | |||
| 1509 | Ga0501074_0000443 | |||
| 1510 | Ga0501074_0019268 | |||
| 1511 | Ga0501074_0023253 | |||
| 1512 | Ga0501076_0332905 | |||
| 1513 | Ga0501079_0003407 | |||
| 1514 | Ga0501080_0000382 | |||
| 1515 | Ga0501080_0000470 | |||
| 1516 | Ga0501080_0000669 | |||
| 1517 | Ga0501080_0005657 | |||
| 1518 | Ga0501081_0326335 | |||
| 1519 | Ga0501083_0000080 | |||
| 1520 | Ga0501083_0003054 | |||
| 1521 | Ga0501083_0101325 | |||
| 1522 | Ga0501035_0000037 | |||
| 1523 | Ga0501035_0000052 | |||
| 1524 | Ga0501035_0001237 | |||
| 1525 | Ga0501035_0001584 | |||
| 1526 | Ga0501035_0002187 | |||
| 1527 | Ga0501035_0070539 | |||
| 1528 | Ga0501035_0121270 | |||
| 1529 | Ga0501035_0175161 | |||
| 1530 | Ga0501044_0000018 | |||
| 1531 | Ga0501044_0000217 | |||
| 1532 | Ga0501044_0000366 | |||
| 1533 | Ga0501044_0046984 | |||
| 1534 | Ga0501044_0072305 | |||
| 1535 | Ga0501044_0085781 | |||
| 1536 | Ga0501044_0087528 | |||
| 1537 | Ga0501044_0091284 | |||
| 1538 | Ga0501044_0147382 | |||
| 1539 | nmdc:mga03n38_14660_c1 | |||
| 1540 | nmdc:mga03n38_224_c1 | |||
| 1541 | nmdc:mga00v17_205002_c1 | |||
| 1542 | nmdc:mga00v17_9386_c1 | |||
| 1543 | nmdc:mga0yw44_52563_c1 | |||
| 1544 | nmdc:mga0yw44_72837_c1 | |||
| 1545 | nmdc:mga0k408_5979_c1 | |||
| 1546 | nmdc:mga04h51_6775_c1 | |||
| 1547 | nmdc:mga07m45_6074_c1 | |||
| 1548 | nmdc:mga0n895_64214_c1 | |||
| 1549 | nmdc:mga08x19_79614_c1 | |||
| 1550 | nmdc:mga0sz30_55309_c1 | |||
| 1551 | nmdc:mga0sz30_9528_c1 | |||
| 1552 | Ga0495601_0014819 | |||
| 1553 | Ga0495601_0041332 | |||
| 1554 | Ga0495601_0185195 | |||
| 1555 | Ga0495601_0239203 | |||
| 1556 | Ga0495612_0013454 | |||
| 1557 | Ga0495655_0009206 | |||
| 1558 | Ga0495655_0056796 | |||
| 1559 | Ga0495595_0003095 | |||
| 1560 | Ga0495595_0016247 | |||
| 1561 | Ga0495619_0004543 | |||
| 1562 | Ga0495619_0030322 | |||
| 1563 | Ga0500578_0068194 | |||
| 1564 | Ga0500578_0107327 | |||
| 1565 | Ga0500647_0033209 | |||
| 1566 | Ga0500651_0000526 | |||
| 1567 | Ga0500566_0000097 | |||
| 1568 | Ga0500640_014937 | |||
| 1569 | Ga0500557_000008 | |||
| 1570 | Ga0500572_000853 | |||
| 1571 | Ga0500595_006403 | |||
| 1572 | Ga0500597_043245 | |||
| 1573 | Ga0500607_075728 | |||
| 1574 | Ga0500614_014025 | |||
| 1575 | Ga0500642_0000067 | |||
| 1576 | Ga0500642_0104340 | |||
| 1577 | Ga0500559_0120556 | |||
| 1578 | Ga0500585_057645 | |||
| 1579 | Ga0500603_001381 | |||
| 1580 | Ga0500619_021578 | |||
| 1581 | Ga0500630_035540 | |||
| 1582 | Ga0500639_000219 | |||
| 1583 | Ga0500636_0066605 | |||
| 1584 | Ga0500625_005765 | |||
| 1585 | Ga0501084_0006290 | |||
| 1586 | 2507510856 | |||
| 1587 | 2508544673 | |||
| 1588 | 2508697111 | |||
| 1589 | 2509148566 | |||
| 1590 | 2513637633 | |||
| 1591 | 2513649515 | |||
| 1592 | 2513653945 | |||
| 1593 | 2513719321 | |||
| 1594 | 2513856379 | |||
| 1595 | 2513888424 | |||
| 1596 | 2513918285 | |||
| 1597 | 2515630715 | |||
| 1598 | 2517100429 | |||
| 1599 | 2517891485 | |||
| 1600 | 2524437289 | |||
| 1601 | 2524541002 | |||
| 1602 | 2528855271 | |||
| 1603 | 2545674496 | |||
| 1604 | 2596371343 | |||
| 1605 | 2644291197 | |||
| 1606 | 2671118746 | |||
| 1607 | 2728754864 | |||
| 1608 | 2745076758 | |||
| 1609 | 2793065131 | |||
| 1610 | 2793066853 | |||
| 1611 | 2818237985 | |||
| 1612 | 2824601533 | |||
| 1613 | 2824617195 | |||
| 1614 | 2824653665 | |||
| 1615 | 2824663038 | |||
| 1616 | 2824709871 | |||
| 1617 | 2824756996 | |||
| 1618 | 2824770124 | |||
| 1619 | 2844317084 | |||
| 1620 | 2847938425 | |||
| 1621 | 2849081384 | |||
| 1622 | 2874597571 | |||
| 1623 | 2874649134 | |||
| 1624 | 2876767736 | |||
| 1625 | 2876774956 | |||
| 1626 | 2876822292 | |||
| 1627 | 2879078044 | |||
| 1628 | 2879088662 | |||
| 1629 | 2879103994 | |||
| 1630 | 2879132405 | |||
| 1631 | 2879145296 | |||
| 1632 | 2881370533 | |||
| 1633 | 2881667297 | |||
| 1634 | 2885377810 | |||
| 1635 | 2885416493 | |||
| 1636 | 2888381698 | |||
| 1637 | 2888422085 | |||
| 1638 | 2889306677 | |||
| 1639 | 2902332324 | |||
| 1640 | 2902409673 | |||
| 1641 | 2903735051 | |||
| 1642 | 2903758733 | |||
| 1643 | 2904691341 | |||
| 1644 | 2904704815 | |||
| 1645 | 2904719040 | |||
| 1646 | 2906604167 | |||
| 1647 | 2906616661 | |||
| 1648 | 2906643717 | |||
| 1649 | 2906647979 | |||
| 1650 | 2906666988 | |||
| 1651 | 2908741827 | |||
| 1652 | 2908759521 | |||
| 1653 | 2922371384 | |||
| 1654 | 2922431314 | |||
| 1655 | 2928126276 | |||
| 1656 | 2929623243 | |||
| 1657 | 2929630923 | |||
| 1658 | 2932786088 | |||
| 1659 | 2932799136 | |||
| 1660 | 2932803941 | |||
| 1661 | 2932811969 | |||
| 1662 | 2932822545 | |||
| 1663 | 2932831132 | |||
| 1664 | 2933585147 | |||
| 1665 | 2935612922 | |||
| 1666 | 2935624082 | |||
| 1667 | 2935633908 | |||
| 1668 | 2935640272 | |||
| 1669 | 2935654714 | |||
| 1670 | 2935663509 | |||
| 1671 | 2935666890 | |||
| 1672 | 2935684356 | |||
| 1673 | 2935691338 | |||
| 1674 | 2935699897 | |||
| 1675 | 2935704645 | |||
| 1676 | 2935719172 | |||
| 1677 | 2935729228 | |||
| 1678 | 2935737531 | |||
| 1679 | 2935746907 | |||
| 1680 | 2935758294 | |||
| 1681 | 2935762455 | |||
| 1682 | 2935777293 | |||
| 1683 | 2935780388 | |||
| 1684 | 2935793203 | |||
| 1685 | 2935801201 | |||
| 1686 | 2935803952 | |||
| 1687 | 2935811871 | |||
| 1688 | 2935824410 | |||
| 1689 | 2935829755 | |||
| 1690 | 2935842888 | |||
| 1691 | 2935852445 | |||
| 1692 | 2935862418 | |||
| 1693 | 2935870553 | |||
| 1694 | 2935881135 | |||
| 1695 | 2935884253 | |||
| 1696 | 2935912408 | |||
| 1697 | 2935921759 | |||
| 1698 | 2935929703 | |||
| 1699 | 2935938935 | |||
| 1700 | 2935948230 | |||
| 1701 | 2935954954 | |||
| 1702 | 2935962222 | |||
| 1703 | 2935972012 | |||
| 1704 | 2935979340 | |||
| 1705 | 2935988075 | |||
| 1706 | 2935993632 | |||
| 1707 | 2936004528 | |||
| 1708 | 2936017665 | |||
| 1709 | 2936026253 | |||
| 1710 | 2936035243 | |||
| 1711 | 2936038454 | |||
| 1712 | 2936053151 | |||
| 1713 | 2936059374 | |||
| 1714 | 2940563796 | |||
| 1715 | 2941510789 | |||
| 1716 | 2941518173 | |||
| 1717 | 2941526956 | |||
| 1718 | 2941533853 | |||
| 1719 | 2941544137 | |||
| 1720 | 3003666887 | |||
| 1721 | 3005481110 | |||
| 1722 | 3005596714 | |||
| 1723 | 3005712785 | |||
| 1724 | 3005719842 | |||
| 1725 | 641644901 | |||
| 1726 | 643597844 | |||
| 1727 | 8006939601 | |||
| 1728 | 8006979352 | |||
| 1729 | 8016516245 | |||
| 1730 | 8016537162 | |||
| 1731 | 8016551832 | |||
| 1732 | 8016560215 | |||
| 1733 | 8016566812 | |||
| 1734 | 8016589310 | |||
| 1735 | 8016598133 | |||
| 1736 | 8016604272 | |||
| 1737 | 8016620858 | |||
| 1738 | 8016629130 | |||
| 1739 | 8016633667 | |||
| 1740 | 8017060287 | |||
| 1741 | 8019536854 | |||
| 1742 | 8019548062 | |||
| 1743 | 8019565492 | |||
| 1744 | 8019575588 | |||
| 1745 | 8019579814 | |||
| 1746 | 8019587520 | |||
| 1747 | 8019603818 | |||
| 1748 | 8019614717 | |||
| 1749 | 8019625328 | |||
| 1750 | 8019636853 | |||
| 1751 | 8019642754 | |||
| 1752 | 8019649838 | |||
| 1753 | 8019664674 | |||
| 1754 | 8019674264 | |||
| 1755 | 8019693930 | |||
| 1756 | 8055748979 | |||
| 1757 | 8056693836 | |||
| 1758 | 8056972022 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2nq2-assembly1.cif.gz_A | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.5945 | 8 | 294 |
| 4dbl-assembly1.cif.gz_B | crystal structure of e159q mutant of btucdf | 0.5909 | 34 | 292 |
| 1l7v-assembly1.cif.gz_B | bacterial abc transporter involved in b12 uptake | 0.5858 | 31 | 292 |
| 4g1u-assembly1.cif.gz_B | x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis | 0.576 | 14 | 292 |
| 2nq2-assembly1.cif.gz_B | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.5571 | 15 | 292 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58666_4_320_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8652 | 31 | 290 | 1.10.3470.10 |
| af_P23200_41_325_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8077 | 33 | 290 | 1.10.3470.10 |
| af_P0AGI4_56_383_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8062 | 33 | 290 | 1.10.3470.10 |
| af_P39328_55_321_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8042 | 28 | 289 | 1.10.3470.10 |
| af_P0AGI1_45_314_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7995 | 31 | 290 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0D7EH95-F1-model_v4 | ABC transporter permease | 0.9752 | 3 | 216 |
GO:0005886
GO:0015658 |
| AF-A0A257S961-F1-model_v4 | deleted | 0.9649 | 7 | 308 |
|
| AF-A0A0D7EH95-F1-model_v4 | ABC transporter permease | 0.962 | 3 | 216 |
GO:0005886
GO:0015658 |
| AF-A0A523UBX2-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9472 | 12 | 221 |
GO:0005886
GO:0015658 |
| AF-A0A7Y0C2Q4-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9469 | 10 | 307 |
GO:0005886
GO:0015658 |