F484459

General Info

Members Datasets Scaffolds Average Seq Length
879 505 1758 306

Family's Representative Sequence

Representative Sequence 3300021377|Ga0213874_10002639|Ga0213874_100026393
Length 321
Sequence MCARAGSLGDGRPMPRLSVREMSFAAIIVVALAAALPFFVSDYVLGVLTPGFYIAVFAMAWDLLFGFANEVNFGPTFLIGLGAYAAGIIDNRLGWAIWLCVAAGTAAAVAGGLVLALPALRVRGPYFGLTTLVAVLILSNLIVVFADLTGGEIGLTVPDVISIDAHANYWIALGFMSASGAILFALSRSPMGLILQASGQDAVQAGALGFNVTKHKLAAFTISAFFSGLAGALYVFYLGAASVGTLVDVTVGVQVIIAAVLGGRRTILGAALGAIFLIGATEALRPLGELATLVVSAVALLIVLFFPNGLLALIARIGGRA

Samples

Sample ID Description Type Environment
1 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
66 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
90 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
94 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
145 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
146 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
147 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
148 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
152 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
156 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
157 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
158 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
164 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
165 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
166 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
167 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
168 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
169 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
170 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
173 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
191 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
194 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
195 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
213 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
214 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
215 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
216 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
217 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
220 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
223 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
224 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
227 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
235 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
236 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
237 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
238 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
247 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
248 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
264 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
265 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
266 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
267 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
268 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
284 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
285 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
286 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
287 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
288 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
289 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
290 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
291 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
292 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
293 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
294 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
295 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
296 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
298 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
299 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
300 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
301 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
302 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
303 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
304 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
305 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
306 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
307 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
308 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
309 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
310 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
313 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
314 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
315 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
316 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
317 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
318 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
319 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
320 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
321 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
322 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
323 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
324 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
325 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
326 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
327 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
328 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
329 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
330 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
331 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
332 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
333 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
334 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
335 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
336 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
337 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
338 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
339 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
340 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
341 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
342 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
343 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
344 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
345 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
346 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
347 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
348 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
349 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
350 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
351 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
352 2643221651 Afipia sp. Root123D2 Isolate Unclassified
353 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
354 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
355 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
356 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
357 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
358 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
359 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
360 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
361 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
362 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
363 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
364 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
365 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
366 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
367 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
368 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
369 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
370 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
371 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
372 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
373 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
374 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
375 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
376 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
377 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
378 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
379 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
380 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
381 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
382 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
383 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
384 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
385 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
386 2902330777 Methylobacterium sp. 2A Isolate Unclassified
387 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
388 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
389 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
390 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
391 2904699407
392 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
393 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
394 2906610324
395 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
396 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
397 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
398 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
399 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
400 2922368715
401 2922425934
402 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
403 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
404 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
405 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
406 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
407 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
408 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
409 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
410 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
411 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
412 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
413 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
414 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
415 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
416 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
417 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
418 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
419 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
420 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
421 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
422 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
423 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
424 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
425 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
426 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
427 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
428 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
429 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
430 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
431 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
432 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
433 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
434 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
435 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
436 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
437 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
438 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
439 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
440 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
441 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
442 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
443 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
444 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
445 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
446 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
447 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
448 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
449 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
450 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
451 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
452 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
453 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
454 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
455 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
456 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
457 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
458 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
459 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
460 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
461 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
462 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
463 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
464 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
465 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
466 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
467 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
468 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
469 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
470 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
471 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
472 641522639 Methylobacterium sp. 4-46 Isolate Nodule
473 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
474 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
475 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
476 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
477 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
478 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
479 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
480 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
481 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
482 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
483 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
484 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
485 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
486 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
487 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
488 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
489 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
490 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
491 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
492 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
493 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
494 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
495 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
496 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
497 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
498 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
499 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
500 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
501 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
502 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
503 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
504 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
505 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.23
Metatranscriptomes 0.46
Isolates 19.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.28
Nodule 16.95
Rhizoplane 3.64
Rhizosphere 60.18
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213874_10002639 3300021377 Bacteria 3888
2 JGI25165J46597_1006767 3300003214 Bacteria 1992
3 JGI25160J50197_1007582 3300003354 Bacteria 4232
4 Ga0055543_1013756 3300004625 Bacteria 1592
5 Ga0065165_1004374 3300005262 Bacteria 8825
6 Ga0070658_10056239 3300005327 Bacteria 3197
7 Ga0070676_10289184 3300005328 Bacteria 1107
8 Ga0070683_100001891 3300005329 Bacteria 16357
9 Ga0070683_100019924 3300005329 Bacteria 5963
10 Ga0070683_100072047 3300005329 Bacteria 3225
11 Ga0070683_100658453 3300005329 Bacteria 1003
12 Ga0068869_100001186 3300005334 Bacteria 15287
13 Ga0070680_100016775 3300005336 Bacteria 5763
14 Ga0070680_100195987 3300005336 Bacteria 1703
15 Ga0070680_100312437 3300005336 Bacteria 1334
16 Ga0070682_100056630 3300005337 Bacteria 2466
17 Ga0070682_100316334 3300005337 Bacteria 1151
18 Ga0068868_100002380 3300005338 Bacteria 13017
19 Ga0070689_100090026 3300005340 Bacteria 2417
20 Ga0070691_10186651 3300005341 Bacteria 1082
21 Ga0070668_100008952 3300005347 Bacteria 7432
22 Ga0070674_100161557 3300005356 Bacteria 1700
23 Ga0070659_100051334 3300005366 Bacteria 3243
24 Ga0070659_100256937 3300005366 Bacteria 1449
25 Ga0070667_100362682 3300005367 Bacteria 1314
26 Ga0070709_10002013 3300005434 Bacteria 11043
27 Ga0070709_10005865 3300005434 Bacteria 6660
28 Ga0070714_100006313 3300005435 Bacteria 9137
29 Ga0070714_100041770 3300005435 Bacteria 3872
30 Ga0070714_100173398 3300005435 Bacteria 1958
31 Ga0070713_100004655 3300005436 Bacteria 9259
32 Ga0070713_100039500 3300005436 Bacteria 3831
33 Ga0070713_100164699 3300005436 Bacteria 1982
34 Ga0070710_10000896 3300005437 Bacteria 14247
35 Ga0070710_10002832 3300005437 Bacteria 8268
36 Ga0070701_10083906 3300005438 Bacteria 1731
37 Ga0070711_100007213 3300005439 Bacteria 6752
38 Ga0070711_100008957 3300005439 Bacteria 6142
39 Ga0070711_100093101 3300005439 Bacteria 2175
40 Ga0070711_100119075 3300005439 Bacteria 1950
41 Ga0070663_100033127 3300005455 Bacteria 3567
42 Ga0070663_100036834 3300005455 Bacteria 3401
43 Ga0070662_100132585 3300005457 Bacteria 1923
44 Ga0070681_10076300 3300005458 Bacteria 3310
45 Ga0070681_10146085 3300005458 Bacteria 2294
46 Ga0070681_10315190 3300005458 Bacteria 1473
47 Ga0070681_10493869 3300005458 Bacteria 1137
48 Ga0070681_10511038 3300005458 Bacteria 1115
49 Ga0070706_100118744 3300005467 Bacteria 2464
50 Ga0070707_100171685 3300005468 Bacteria 2113
51 Ga0070679_100029796 3300005530 Bacteria 5384
52 Ga0070679_100291008 3300005530 Bacteria 1585
53 Ga0070679_100316505 3300005530 Bacteria 1510
54 Ga0070684_100010920 3300005535 Bacteria 7217
55 Ga0070684_100052866 3300005535 Bacteria 3534
56 Ga0070697_100093961 3300005536 Bacteria 2484
57 Ga0068853_100035551 3300005539 Bacteria 4232
58 Ga0068853_100169342 3300005539 Bacteria 1975
59 Ga0070686_100053425 3300005544 Bacteria 2580
60 Ga0070665_100012340 3300005548 Bacteria 8611
61 Ga0070665_100035823 3300005548 Bacteria 4992
62 Ga0068855_100040104 3300005563 Bacteria 5558
63 Ga0068855_100072657 3300005563 Bacteria 3998
64 Ga0068855_100077687 3300005563 Bacteria 3852
65 Ga0068855_100097896 3300005563 Bacteria 3379
66 Ga0068855_100328828 3300005563 Bacteria 1688
67 Ga0068855_100342315 3300005563 Bacteria 1649
68 Ga0068855_100425519 3300005563 Bacteria 1452
69 Ga0070664_100026724 3300005564 Bacteria 4791
70 Ga0070664_100152168 3300005564 Bacteria 2043
71 Ga0070664_100410739 3300005564 Bacteria 1239
72 Ga0068857_100017610 3300005577 Bacteria 6264
73 Ga0068857_100028282 3300005577 Bacteria 4946
74 Ga0068854_100097839 3300005578 Bacteria 2194
75 Ga0068856_100000183 3300005614 Bacteria 65005
76 Ga0068856_100029563 3300005614 Bacteria 5352
77 Ga0068856_100063430 3300005614 Bacteria 3651
78 Ga0068852_100053488 3300005616 Bacteria 3475
79 Ga0068852_100230989 3300005616 Bacteria 1763
80 Ga0068859_100063595 3300005617 Bacteria 3721
81 Ga0068864_100049226 3300005618 Bacteria 3625
82 Ga0068864_100122039 3300005618 Bacteria 2331
83 Ga0068861_100042059 3300005719 Bacteria 3424
84 Ga0068870_10004287 3300005840 Bacteria 6137
85 Ga0068863_100027853 3300005841 Bacteria 5394
86 Ga0068858_100041385 3300005842 Bacteria 4272
87 Ga0068858_100589553 3300005842 Bacteria 1078
88 Ga0068860_100093295 3300005843 Bacteria 2869
89 Ga0081540_1002227 3300005983 Bacteria 15974
90 Ga0081540_1005198 3300005983 Bacteria 9740
91 Ga0081540_1006571 3300005983 Bacteria 8437
92 Ga0081540_1006785 3300005983 Bacteria 8274
93 Ga0081540_1018573 3300005983 Bacteria 4259
94 Ga0070717_10087311 3300006028 Bacteria 2627
95 Ga0070717_10429945 3300006028 Bacteria 1188
96 Ga0075365_10059561 3300006038 Bacteria 2545
97 Ga0075368_10019062 3300006042 Bacteria 2587
98 Ga0075363_100010158 3300006048 Bacteria 4453
99 Ga0075363_100048514 3300006048 Bacteria 2258
100 Ga0075364_10024619 3300006051 Bacteria 3824
101 Ga0075364_10295801 3300006051 Bacteria 1102
102 Ga0070715_10000456 3300006163 Bacteria 10562
103 Ga0070716_100011137 3300006173 Bacteria 4526
104 Ga0070716_100023798 3300006173 Bacteria 3253
105 Ga0070712_100015504 3300006175 Bacteria 4912
106 Ga0075367_10001130 3300006178 Bacteria 11093
107 Ga0075369_10005353 3300006186 Bacteria 4787
108 Ga0075366_10016316 3300006195 Bacteria 4268
109 Ga0075370_10009564 3300006353 Bacteria 5039
110 Ga0075370_10017687 3300006353 Bacteria 3854
111 Ga0068865_100055253 3300006881 Bacteria 2762
112 Ga0075436_100088588 3300006914 Bacteria 2150
113 Ga0097620_100063592 3300006931 Bacteria 3721
114 Ga0099824_1021709 3300006942 Bacteria 4410
115 Ga0099824_1033210 3300006942 Bacteria 1768
116 Ga0099822_1024226 3300006943 Bacteria 5463
117 Ga0105240_10039694 3300009093 Bacteria 6026
118 Ga0105240_10109427 3300009093 Bacteria 3346
119 Ga0105240_10121920 3300009093 Bacteria 3138
120 Ga0105240_10135701 3300009093 Bacteria 2947
121 Ga0105240_10276799 3300009093 Bacteria 1930
122 Ga0111539_10714684 3300009094 Bacteria 1166
123 Ga0105245_10005441 3300009098 Bacteria 11187
124 Ga0105245_10038994 3300009098 Bacteria 4228
125 Ga0105247_10005785 3300009101 Bacteria 7742
126 Ga0105247_10240256 3300009101 Bacteria 1234
127 Ga0105243_10042185 3300009148 Bacteria 3571
128 Ga0105241_10037493 3300009174 Bacteria 3652
129 Ga0105241_10211105 3300009174 Bacteria 1626
130 Ga0105248_10646336 3300009177 Bacteria 1193
131 Ga0105237_10017339 3300009545 Bacteria 7466
132 Ga0105237_10095319 3300009545 Bacteria 2965
133 Ga0105237_10138567 3300009545 Bacteria 2427
134 Ga0105237_10298145 3300009545 Bacteria 1615
135 Ga0105238_10142049 3300009551 Bacteria 2377
136 Ga0105238_10398268 3300009551 Bacteria 1370
137 Ga0099796_10010555 3300010159 Bacteria 2543
138 Ga0105239_10003963 3300010375 Bacteria 17936
139 Ga0105239_10109809 3300010375 Bacteria 3057
140 Ga0105239_10546926 3300010375 Bacteria 1318
141 Ga0105246_10379968 3300011119 Bacteria 1167
142 Ga0157371_10237967 3300013102 Bacteria 1309
143 Ga0157370_10097584 3300013104 Bacteria 2756
144 Ga0157370_10205900 3300013104 Bacteria 1824
145 Ga0157370_10338421 3300013104 Bacteria 1387
146 Ga0157370_10357736 3300013104 Bacteria 1345
147 Ga0157369_10012373 3300013105 Bacteria 9688
148 Ga0157369_10026071 3300013105 Bacteria 6485
149 Ga0157369_10083698 3300013105 Bacteria 3411
150 Ga0157374_10634738 3300013296 Bacteria 1079
151 Ga0157378_10172127 3300013297 Bacteria 2031
152 Ga0163162_10025402 3300013306 Bacteria 5853
153 Ga0163162_10146465 3300013306 Bacteria 2478
154 Ga0157372_10034737 3300013307 Bacteria 5546
155 Ga0157372_10048052 3300013307 Bacteria 4743
156 Ga0157372_10326057 3300013307 Bacteria 1788
157 Ga0157375_10011636 3300013308 Bacteria 7774
158 Ga0163163_10007610 3300014325 Bacteria 9569
159 Ga0163163_10073797 3300014325 Bacteria 3403
160 Ga0157376_10153431 3300014969 Bacteria 2080
161 Ga0213873_10000846 3300021358 Bacteria 4931
162 Ga0213872_10000429 3300021361 Bacteria 34403
163 Ga0213872_10004083 3300021361 Bacteria 7859
164 Ga0213872_10004694 3300021361 Bacteria 7180
165 Ga0213872_10016051 3300021361 Bacteria 3478
166 Ga0213874_10002580 3300021377 Bacteria 3917
167 Ga0213874_10005128 3300021377 Bacteria 3035
168 Ga0213876_10001306 3300021384 Bacteria 15675
169 Ga0213876_10001630 3300021384 Bacteria 13688
170 Ga0213876_10134690 3300021384 Bacteria 1314
171 Ga0213875_10000030 3300021388 Bacteria 178500
172 Ga0213875_10003482 3300021388 Bacteria 8959
173 Ga0213875_10003821 3300021388 Bacteria 8464
174 Ga0213875_10007291 3300021388 Bacteria 5723
175 Ga0213875_10010083 3300021388 Bacteria 4749
176 Ga0213875_10014477 3300021388 Bacteria 3848
177 Ga0213875_10019616 3300021388 Bacteria 3252
178 Ga0213875_10046437 3300021388 Bacteria 2038
179 Ga0213875_10077961 3300021388 Bacteria 1546
180 Ga0213875_10091232 3300021388 Bacteria 1421
181 Ga0213871_10068475 3300021441 Bacteria 999
182 Ga0209677_100749 3300025253 Bacteria 16460
183 Ga0209148_1000773 3300025254 Bacteria 23969
184 Ga0209233_1003148 3300025261 Bacteria 5852
185 Ga0209233_1004858 3300025261 Bacteria 4525
186 Ga0209233_1005292 3300025261 Bacteria 4301
187 Ga0209233_1005946 3300025261 Bacteria 3993
188 Ga0209455_1001728 3300025272 Bacteria 9312
189 Ga0209455_1008216 3300025272 Bacteria 2858
190 Ga0209564_1003916 3300025295 Bacteria 9529
191 Ga0209758_1000282 3300025297 Bacteria 100746
192 Ga0209758_1004003 3300025297 Bacteria 12747
193 Ga0209758_1027779 3300025297 Bacteria 2410
194 Ga0207426_1000437 3300025302 Bacteria 67439
195 Ga0207426_1001098 3300025302 Bacteria 24902
196 Ga0207426_1012310 3300025302 Bacteria 3218
197 Ga0207692_10002885 3300025898 Bacteria 6655
198 Ga0207692_10005756 3300025898 Bacteria 4986
199 Ga0207692_10009200 3300025898 Bacteria 4116
200 Ga0207710_10018346 3300025900 Bacteria 2975
201 Ga0207688_10019965 3300025901 Bacteria 3655
202 Ga0207685_10000267 3300025905 Bacteria 8260
203 Ga0207699_10002339 3300025906 Bacteria 8949
204 Ga0207699_10003537 3300025906 Bacteria 7456
205 Ga0207643_10025498 3300025908 Bacteria 3267
206 Ga0207705_10082672 3300025909 Bacteria 2342
207 Ga0207654_10021751 3300025911 Bacteria 3414
208 Ga0207654_10029110 3300025911 Bacteria 3019
209 Ga0207707_10018073 3300025912 Bacteria 6143
210 Ga0207695_10000062 3300025913 Bacteria 351979
211 Ga0207695_10019960 3300025913 Bacteria 7695
212 Ga0207695_10078563 3300025913 Bacteria 3348
213 Ga0207695_10133694 3300025913 Bacteria 2435
214 Ga0207695_10251375 3300025913 Bacteria 1667
215 Ga0207671_10008251 3300025914 Bacteria 8862
216 Ga0207671_10051920 3300025914 Bacteria 3037
217 Ga0207671_10092336 3300025914 Bacteria 2282
218 Ga0207671_10139497 3300025914 Bacteria 1867
219 Ga0207671_10223517 3300025914 Bacteria 1476
220 Ga0207693_10000326 3300025915 Bacteria 44051
221 Ga0207693_10003223 3300025915 Bacteria 14005
222 Ga0207693_10015787 3300025915 Bacteria 6050
223 Ga0207663_10000225 3300025916 Bacteria 25184
224 Ga0207663_10009124 3300025916 Bacteria 5229
225 Ga0207663_10096713 3300025916 Bacteria 1973
226 Ga0207663_10116539 3300025916 Bacteria 1821
227 Ga0207663_10132455 3300025916 Bacteria 1724
228 Ga0207660_10228682 3300025917 Bacteria 1462
229 Ga0207657_10004806 3300025919 Bacteria 14248
230 Ga0207649_10102875 3300025920 Bacteria 1894
231 Ga0207652_10013842 3300025921 Bacteria 6527
232 Ga0207652_10023687 3300025921 Bacteria 5088
233 Ga0207652_10084661 3300025921 Bacteria 2778
234 Ga0207652_10525394 3300025921 Bacteria 1065
235 Ga0207694_10132083 3300025924 Bacteria 2002
236 Ga0207694_10525114 3300025924 Bacteria 992
237 Ga0207664_10014435 3300025929 Bacteria 5704
238 Ga0207664_10031784 3300025929 Bacteria 4042
239 Ga0207664_10109709 3300025929 Bacteria 2293
240 Ga0207644_10016717 3300025931 Bacteria 4940
241 Ga0207690_10025298 3300025932 Bacteria 3725
242 Ga0207706_10199961 3300025933 Bacteria 1753
243 Ga0207709_10203375 3300025935 Bacteria 1416
244 Ga0207704_10048142 3300025938 Bacteria 2554
245 Ga0207665_10001364 3300025939 Bacteria 16457
246 Ga0207665_10015528 3300025939 Bacteria 4997
247 Ga0207665_10036269 3300025939 Bacteria 3278
248 Ga0207711_10054778 3300025941 Bacteria 3423
249 Ga0207689_10014080 3300025942 Bacteria 6807
250 Ga0207661_10001182 3300025944 Bacteria 17455
251 Ga0207661_10203221 3300025944 Bacteria 1743
252 Ga0207679_10363881 3300025945 Bacteria 1264
253 Ga0207679_10489006 3300025945 Bacteria 1097
254 Ga0207712_10125479 3300025961 Bacteria 1948
255 Ga0207668_10004125 3300025972 Bacteria 8524
256 Ga0207658_10093472 3300025986 Bacteria 2338
257 Ga0207677_10038130 3300026023 Bacteria 3148
258 Ga0207639_10010102 3300026041 Bacteria 6528
259 Ga0207639_10196860 3300026041 Bacteria 1725
260 Ga0207639_10311422 3300026041 Bacteria 1395
261 Ga0207678_10014454 3300026067 Bacteria 6941
262 Ga0207678_10021795 3300026067 Bacteria 5619
263 Ga0207678_10023002 3300026067 Bacteria 5454
264 Ga0207678_10054764 3300026067 Bacteria 3436
265 Ga0207702_10000197 3300026078 Bacteria 71667
266 Ga0207702_10018501 3300026078 Bacteria 5764
267 Ga0207641_10238720 3300026088 Bacteria 1693
268 Ga0207648_10219239 3300026089 Bacteria 1690
269 Ga0207676_10106108 3300026095 Bacteria 2340
270 Ga0207674_10464147 3300026116 Bacteria 1224
271 Ga0207675_100041364 3300026118 Bacteria 4304
272 Ga0207683_10011087 3300026121 Bacteria 7681
273 Ga0207698_10105090 3300026142 Bacteria 2352
274 Ga0207698_10200930 3300026142 Bacteria 1785
275 Ga0207698_10314938 3300026142 Bacteria 1463
276 Ga0209389_1000004 3300027296 Bacteria 263759
277 Ga0209389_1001618 3300027296 Bacteria 16174
278 Ga0209589_1000010 3300027357 Bacteria 237657
279 Ga0209589_1000014 3300027357 Bacteria 227996
280 Ga0209489_100011 3300027361 Bacteria 244710
281 Ga0209489_100014 3300027361 Bacteria 227996
282 Ga0209489_100777 3300027361 Bacteria 63061
283 Ga0209700_100013 3300027363 Bacteria 341906
284 Ga0209700_100024 3300027363 Bacteria 227996
285 Ga0209813_10002203 3300027866 Bacteria 4450
286 Ga0268266_10001413 3300028379 Bacteria 28643
287 Ga0268266_10087585 3300028379 Bacteria 2724
288 Ga0268264_10062341 3300028381 Bacteria 3130
289 Ga0265334_10054565 3300028573 Bacteria 1524
290 Ga0265770_1014959 3300030878 Bacteria 1176
291 Ga0265773_1001012 3300031018 Bacteria 1387
292 Ga0265760_10051491 3300031090 Bacteria 1240
293 Ga0265330_10035799 3300031235 Bacteria 2214
294 Ga0265325_10012959 3300031241 Bacteria 4755
295 Ga0265340_10011608 3300031247 Bacteria 4676
296 Ga0265339_10000016 3300031249 Bacteria 185313
297 Ga0265339_10006455 3300031249 Bacteria 7692
298 Ga0265339_10016353 3300031249 Bacteria 4424
299 Ga0265339_10110791 3300031249 Bacteria 1420
300 Ga0265316_10387288 3300031344 Bacteria 1008
301 Ga0307513_10018286 3300031456 Bacteria 8378
302 Ga0265313_10000060 3300031595 Bacteria 107224
303 Ga0265314_10016312 3300031711 Bacteria 5871
304 Ga0265314_10069850 3300031711 Bacteria 2356
305 Ga0265342_10010600 3300031712 Bacteria 6375
306 Ga0307516_10092521 3300031730 Bacteria 2851
307 Ga0316583_10027407 3300032133 Bacteria 2034
308 Ga0307510_10019799 3300033180 Bacteria 7881
309 Ga0315911_1000002 3300033442 Bacteria 926833
310 Ga0316215_1001104 3300033544 Bacteria 2623
311 Ga0373934_0002405 3300035086 Bacteria 6890
312 Ga0373923_0022547 3300035111 Bacteria 2470
313 Ga0373936_0018479 3300035113 Bacteria 2693
314 Ga0373953_0000409 3300035117 Bacteria 11662
315 Ga0373953_0009941 3300035117 Bacteria 3296
316 Ga0373954_0002776 3300035118 Bacteria 7375
317 Ga0373954_0029995 3300035118 Bacteria 2507
318 Ga0373956_0004736 3300035119 Bacteria 5443
319 Ga0373956_0005250 3300035119 Bacteria 5184
320 Ga0373957_0014177 3300035120 Bacteria 2720
321 Ga0373955_0002711 3300035172 Bacteria 7754
322 Ga0373955_0003550 3300035172 Bacteria 6865
323 Ga0373924_0006225 3300035410 Bacteria 4267
324 Ga0373927_0004054 3300035695 Bacteria 10349
325 Ga0373933_0002107 3300035724 Bacteria 11423
326 Ga0373937_0008396 3300036401 Bacteria 8974
327 Ga0373937_0021312 3300036401 Bacteria 5816
328 Ga0373937_0324402 3300036401 Bacteria 1457
329 Ga0372808_001074 3300036459 Bacteria 2661
330 Ga0373925_0024876 3300037068 Bacteria 4374
331 Ga0395899_0122972 3300037312 Bacteria 1857
332 Ga0395900_0000660 3300037418 Bacteria 46104
333 Ga0395900_0002114 3300037418 Bacteria 22253
334 Ga0395900_0008707 3300037418 Bacteria 10423
335 Ga0395900_0199262 3300037418 Bacteria 2027
336 Ga0395900_0378614 3300037418 Bacteria 1384
337 Ga0395898_0003200 3300037466 Bacteria 18438
338 Ga0395898_0006500 3300037466 Bacteria 12485
339 Ga0395898_0007107 3300037466 Bacteria 11890
340 Ga0395898_0064826 3300037466 Bacteria 3543
341 Ga0395905_0021700 3300037471 Bacteria 6074
342 Ga0395905_0259473 3300037471 Bacteria 1622
343 Ga0436364_0051975 3300037853 Bacteria 3739
344 Ga0436364_0102033 3300037853 Bacteria 1689
345 Ga0436364_0134493 3300037853 Bacteria 6192
346 Ga0436364_0178729 3300037853 Bacteria 19908
347 Ga0436364_0240938 3300037853 Bacteria 2811
348 Ga0436364_0294887 3300037853 Bacteria 20599
349 Ga0436364_0330571 3300037853 Bacteria 2928
350 Ga0436364_0341833 3300037853 Bacteria 5349
351 Ga0436364_0425317 3300037853 Bacteria 2884
352 Ga0436364_0480253 3300037853 Bacteria 2172
353 Ga0436364_0629092 3300037853 Bacteria 6792
354 Ga0436364_0654054 3300037853 Bacteria 1462
355 Ga0436364_1015733 3300037853 Bacteria 2723
356 Ga0436364_1040604 3300037853 Bacteria 60326
357 Ga0436364_1401270 3300037853 Bacteria 10880
358 Ga0436364_1503331 3300037853 Bacteria 31628
359 Ga0436364_1527859 3300037853 Bacteria 20905
360 Ga0395901_0034087 3300038443 Bacteria 5257
361 Ga0395901_0063663 3300038443 Bacteria 3839
362 Ga0395901_0101488 3300038443 Bacteria 3019
363 Ga0395901_0437117 3300038443 Bacteria 1340
364 Ga0395901_0515459 3300038443 Bacteria 1215
365 Ga0436365_0151043 3300039437 Bacteria 1380
366 Ga0436365_0159409 3300039437 Bacteria 2110
367 Ga0436365_0459588 3300039437 Bacteria 1325
368 Ga0436365_0510188 3300039437 Bacteria 12764
369 Ga0436365_0697045 3300039437 Bacteria 35162
370 Ga0436365_0917056 3300039437 Bacteria 16389
371 Ga0436365_1047663 3300039437 Bacteria 2746
372 Ga0436360_0202427 3300039438 Bacteria 4987
373 Ga0436360_0480010 3300039438 Bacteria 3604
374 Ga0436360_0545523 3300039438 Bacteria 2119
375 Ga0436360_1060729 3300039438 Bacteria 1128
376 Ga0436360_1101828 3300039438 Bacteria 2281
377 Ga0436361_0200283 3300039447 Bacteria 2300
378 Ga0436361_0512286 3300039447 Bacteria 5516
379 Ga0436361_0638445 3300039447 Bacteria 9354
380 Ga0436361_0838125 3300039447 Bacteria 5115
381 Ga0436361_1054672 3300039447 Bacteria 3969
382 Ga0436361_1159707 3300039447 Bacteria 1567
383 Ga0436363_0121554 3300039450 Bacteria 5905
384 Ga0436363_0274569 3300039450 Bacteria 2779
385 Ga0436363_0454820 3300039450 Bacteria 3677
386 Ga0436363_0627803 3300039450 Bacteria 1682
387 Ga0436363_0700194 3300039450 Bacteria 1499
388 Ga0436363_0761127 3300039450 Bacteria 1785
389 Ga0436363_1022276 3300039450 Bacteria 10376
390 Ga0436363_1499575 3300039450 Bacteria 4582
391 Ga0436362_0278148 3300039453 Bacteria 2371
392 Ga0436362_0842308 3300039453 Bacteria 1254
393 Ga0436362_0895327 3300039453 Bacteria 9610
394 Ga0436362_0983233 3300039453 Bacteria 2080
395 Ga0466969_0100925 3300044656 Bacteria 1358
396 Ga0466972_0000079 3300044658 Bacteria 90348
397 Ga0466972_0004644 3300044658 Bacteria 6881
398 Ga0466966_0001208 3300044684 Bacteria 16568
399 Ga0466966_0006229 3300044684 Bacteria 7887
400 Ga0466961_0000020 3300044693 Bacteria 107610
401 Ga0466961_0039468 3300044693 Bacteria 3027
402 Ga0466961_0049669 3300044693 Bacteria 2680
403 Ga0466963_0031974 3300044694 Bacteria 3404
404 Ga0466963_0209438 3300044694 Bacteria 1364
405 Ga0466971_0051755 3300044719 Bacteria 1849
406 Ga0466968_0011964 3300044735 Bacteria 3389
407 Ga0466970_0026083 3300044765 Bacteria 3063
408 Ga0466970_0087989 3300044765 Bacteria 1685
409 Ga0466957_0041896 3300044842 Bacteria 2769
410 Ga0466957_0165300 3300044842 Bacteria 1439
411 Ga0466960_0000424 3300044901 Bacteria 14510
412 Ga0466959_0004294 3300045049 Bacteria 9508
413 Ga0466959_0245173 3300045049 Bacteria 1236
414 Ga0466967_0063821 3300045976 Bacteria 3274
415 Ga0466967_0377060 3300045976 Bacteria 1377
416 Ga0466967_0549232 3300045976 Bacteria 1137
417 Ga0495592_0003202 3300046454 Bacteria 11732
418 Ga0495592_0036190 3300046454 Bacteria 3718
419 Ga0495603_0139262 3300046455 Bacteria 1412
420 Ga0495629_0001830 3300046459 Bacteria 16661
421 Ga0495629_0006153 3300046459 Bacteria 8909
422 Ga0495629_0107512 3300046459 Bacteria 1946
423 Ga0495641_0144258 3300046461 Bacteria 1064
424 Ga0495651_0002500 3300046462 Bacteria 14218
425 Ga0495651_0041294 3300046462 Bacteria 3583
426 Ga0495651_0041839 3300046462 Bacteria 3558
427 Ga0495651_0140950 3300046462 Bacteria 1748
428 Ga0495653_0001471 3300046463 Bacteria 18364
429 Ga0495653_0050752 3300046463 Bacteria 3189
430 Ga0495653_0159296 3300046463 Bacteria 1568
431 Ga0495582_0214523 3300046473 Bacteria 1101
432 Ga0495639_0114838 3300046475 Bacteria 1280
433 Ga0495662_0108284 3300046476 Bacteria 1361
434 Ga0495664_0007676 3300046477 Bacteria 6001
435 Ga0495664_0007911 3300046477 Bacteria 5917
436 Ga0495664_0087653 3300046477 Bacteria 1870
437 Ga0495596_0068738 3300046500 Bacteria 1377
438 Ga0495606_0005210 3300046507 Bacteria 12548
439 Ga0495608_0002191 3300046511 Bacteria 14103
440 Ga0495608_0036131 3300046511 Bacteria 3328
441 Ga0495608_0060094 3300046511 Bacteria 2502
442 Ga0495618_0079959 3300046514 Bacteria 2085
443 Ga0495618_0279140 3300046514 Bacteria 1042
444 Ga0495620_0060077 3300046515 Bacteria 1586
445 Ga0495628_0030883 3300046516 Bacteria 4335
446 Ga0495628_0033600 3300046516 Bacteria 4131
447 Ga0495628_0064783 3300046516 Bacteria 2860
448 Ga0495630_0022407 3300046517 Bacteria 4664
449 Ga0495648_0003767 3300046524 Bacteria 13191
450 Ga0495648_0007614 3300046524 Bacteria 8644
451 Ga0495652_0006321 3300046529 Bacteria 11036
452 Ga0495652_0031923 3300046529 Bacteria 4609
453 Ga0495640_0002348 3300046533 Bacteria 15175
454 Ga0495640_0026198 3300046533 Bacteria 4216
455 Ga0495586_0022337 3300046535 Bacteria 3377
456 Ga0495587_0004728 3300046536 Bacteria 8935
457 Ga0495587_0015523 3300046536 Bacteria 4754
458 Ga0495587_0027948 3300046536 Bacteria 3434
459 Ga0495645_0014837 3300046543 Bacteria 5536
460 Ga0495645_0040372 3300046543 Bacteria 3404
461 Ga0495645_0221128 3300046543 Bacteria 1274
462 Ga0495667_0002963 3300046559 Bacteria 11387
463 Ga0495667_0013368 3300046559 Bacteria 5555
464 Ga0495667_0016179 3300046559 Bacteria 5039
465 Ga0495634_0089901 3300046642 Bacteria 1995
466 Ga0495634_0197772 3300046642 Bacteria 1250
467 Ga0495625_0039696 3300046660 Bacteria 3436
468 Ga0495635_0000636 3300046663 Bacteria 22538
469 Ga0495635_0002205 3300046663 Bacteria 13252
470 Ga0495657_0002552 3300046675 Bacteria 15277
471 Ga0495657_0014012 3300046675 Bacteria 5889
472 Ga0495599_0001077 3300046678 Bacteria 15369
473 Ga0495599_0010332 3300046678 Bacteria 5708
474 Ga0495599_0060861 3300046678 Bacteria 2360
475 Ga0495623_0004268 3300046679 Bacteria 9412
476 Ga0495623_0006526 3300046679 Bacteria 7595
477 Ga0495623_0048527 3300046679 Bacteria 2692
478 Ga0495646_0025871 3300046680 Bacteria 3687
479 Ga0495613_0033951 3300046689 Bacteria 3790
480 Ga0495613_0120524 3300046689 Bacteria 1884
481 Ga0495624_0058576 3300046690 Bacteria 2418
482 Ga0495624_0091302 3300046690 Bacteria 1879
483 Ga0495624_0111238 3300046690 Bacteria 1684
484 Ga0495600_0000873 3300046809 Bacteria 16122
485 Ga0495600_0001010 3300046809 Bacteria 15188
486 Ga0495604_0008420 3300047317 Bacteria 8146
487 Ga0495604_0038621 3300047317 Bacteria 3755
488 Ga0495604_0052467 3300047317 Bacteria 3157
489 Ga0495604_0063576 3300047317 Bacteria 2814
490 Ga0495674_0028066 3300047319 Bacteria 5137
491 Ga0495674_0065255 3300047319 Bacteria 3163
492 Ga0495674_0242918 3300047319 Bacteria 1483
493 Ga0495676_0103736 3300047321 Bacteria 2099
494 Ga0495680_0001037 3300047322 Bacteria 30809
495 Ga0495680_0001883 3300047322 Bacteria 22052
496 Ga0495680_0043083 3300047322 Bacteria 3576
497 Ga0495675_0001800 3300047444 Bacteria 12774
498 Ga0495675_0037092 3300047444 Bacteria 3105
499 Ga0495684_0000666 3300047471 Bacteria 27678
500 Ga0495684_0036531 3300047471 Bacteria 3765
501 Ga0495684_0096515 3300047471 Bacteria 2237
502 Ga0495684_0184941 3300047471 Bacteria 1543
503 Ga0495686_0046711 3300047472 Bacteria 2736
504 Ga0495686_0107093 3300047472 Bacteria 1680
505 Ga0495593_0008032 3300047673 Bacteria 6139
506 Ga0495602_0004340 3300048088 Bacteria 14780
507 Ga0495602_0012996 3300048088 Bacteria 8521
508 Ga0495602_0196647 3300048088 Bacteria 1541
509 Ga0495602_0201081 3300048088 Bacteria 1520
510 Ga0496100_0029945 3300048903 Bacteria 3372
511 Ga0496102_0567391 3300048905 Bacteria 1058
512 Ga0496104_0001245 3300048907 Bacteria 21918
513 Ga0496104_0005309 3300048907 Bacteria 11271
514 Ga0496104_0082198 3300048907 Bacteria 3072
515 Ga0496104_0283502 3300048907 Bacteria 1569
516 Ga0496105_0003657 3300048908 Bacteria 11428
517 Ga0496105_0093356 3300048908 Bacteria 2485
518 Ga0496106_0013957 3300048909 Bacteria 5941
519 Ga0496107_0130771 3300048910 Bacteria 1853
520 Ga0496108_0001861 3300048911 Bacteria 16875
521 Ga0496108_0218656 3300048911 Bacteria 1655
522 Ga0496109_0001073 3300048912 Bacteria 22672
523 Ga0496109_0155295 3300048912 Bacteria 2143
524 Ga0496110_0002479 3300048913 Bacteria 13828
525 Ga0496111_0028004 3300048914 Bacteria 3991
526 Ga0496111_0061970 3300048914 Bacteria 2712
527 Ga0496111_0215505 3300048914 Bacteria 1426
528 Ga0496112_0002061 3300048915 Bacteria 15937
529 Ga0496112_0005807 3300048915 Bacteria 10736
530 Ga0496112_0008838 3300048915 Bacteria 9038
531 Ga0496112_0107427 3300048915 Bacteria 2761
532 Ga0496112_0119654 3300048915 Bacteria 2603
533 Ga0496112_0223868 3300048915 Bacteria 1837
534 Ga0496112_0440495 3300048915 Bacteria 1241
535 Ga0496113_0000095 3300048916 Bacteria 37445
536 Ga0496113_0156636 3300048916 Bacteria 1799
537 Ga0496114_0200299 3300048917 Bacteria 1749
538 Ga0496115_0003952 3300048918 Bacteria 10689
539 Ga0496115_0042478 3300048918 Bacteria 3621
540 Ga0496115_0314357 3300048918 Bacteria 1282
541 Ga0496116_0140996 3300048919 Bacteria 1356
542 Ga0496118_0016456 3300048921 Bacteria 6783
543 Ga0496118_0130626 3300048921 Bacteria 1614
544 Ga0496119_0003004 3300048922 Bacteria 17875
545 Ga0496119_0080481 3300048922 Bacteria 1879
546 Ga0496121_0008659 3300048924 Bacteria 11890
547 Ga0496121_0021131 3300048924 Bacteria 6392
548 Ga0496121_0032677 3300048924 Bacteria 4725
549 Ga0496121_0066895 3300048924 Bacteria 2915
550 Ga0496121_0103413 3300048924 Bacteria 2191
551 Ga0496124_0209458 3300048927 Bacteria 1476
552 Ga0496125_0000237 3300048928 Bacteria 113322
553 Ga0496125_0001822 3300048928 Bacteria 29443
554 Ga0496126_0011267 3300048929 Bacteria 9277
555 Ga0496126_0158354 3300048929 Bacteria 1936
556 Ga0496126_0174038 3300048929 Bacteria 1832
557 Ga0496126_0338736 3300048929 Bacteria 1232
558 Ga0501031_0001197 3300049568 Bacteria 15831
559 Ga0501031_0003032 3300049568 Bacteria 10740
560 Ga0501031_0118857 3300049568 Bacteria 1727
561 Ga0501032_0000358 3300049569 Bacteria 38004
562 Ga0501032_0000696 3300049569 Bacteria 27371
563 Ga0501032_0036140 3300049569 Bacteria 3373
564 Ga0501032_0086541 3300049569 Bacteria 2083
565 Ga0501033_0000232 3300049570 Bacteria 53703
566 Ga0501033_0000601 3300049570 Bacteria 33366
567 Ga0501033_0001532 3300049570 Bacteria 20415
568 Ga0501033_0006726 3300049570 Bacteria 8984
569 Ga0501033_0037684 3300049570 Bacteria 3618
570 Ga0501034_0000039 3300049571 Bacteria 237357
571 Ga0501034_0000704 3300049571 Bacteria 50735
572 Ga0501034_0193399 3300049571 Bacteria 1996
573 Ga0501036_0000007 3300049572 Bacteria 240500
574 Ga0501036_0000052 3300049572 Bacteria 74795
575 Ga0501036_0301604 3300049572 Bacteria 1340
576 Ga0501037_0000025 3300049573 Bacteria 143276
577 Ga0501037_0001450 3300049573 Bacteria 17426
578 Ga0501037_0020087 3300049573 Bacteria 4931
579 Ga0501037_0149374 3300049573 Bacteria 1671
580 Ga0501038_0000026 3300049574 Bacteria 146493
581 Ga0501038_0000168 3300049574 Bacteria 55496
582 Ga0501038_0119167 3300049574 Bacteria 2179
583 Ga0501038_0177296 3300049574 Bacteria 1722
584 Ga0501038_0275468 3300049574 Bacteria 1326
585 Ga0501039_0000005 3300049575 Bacteria 295471
586 Ga0501039_0003632 3300049575 Bacteria 11560
587 Ga0501039_0156253 3300049575 Bacteria 1792
588 Ga0501042_0118124 3300049578 Bacteria 1909
589 Ga0501043_0000007 3300049579 Bacteria 224595
590 Ga0501043_0000036 3300049579 Bacteria 132959
591 Ga0501043_0002042 3300049579 Bacteria 17221
592 Ga0501043_0133440 3300049579 Bacteria 1946
593 Ga0501046_0000147 3300049580 Bacteria 74186
594 Ga0501046_0000231 3300049580 Bacteria 57655
595 Ga0501046_0070614 3300049580 Bacteria 2715
596 Ga0501046_0171712 3300049580 Bacteria 1627
597 Ga0501046_0304341 3300049580 Bacteria 1164
598 Ga0501047_0000209 3300049581 Bacteria 70658
599 Ga0501047_0000457 3300049581 Bacteria 45136
600 Ga0501047_0009482 3300049581 Bacteria 9198
601 Ga0501047_0012842 3300049581 Bacteria 7935
602 Ga0501047_0071155 3300049581 Bacteria 3348
603 Ga0501047_0102930 3300049581 Bacteria 2735
604 Ga0501047_0145750 3300049581 Bacteria 2245
605 Ga0501047_0223123 3300049581 Bacteria 1740
606 Ga0501048_0000585 3300049582 Bacteria 25849
607 Ga0501048_0020451 3300049582 Bacteria 4850
608 Ga0501067_0000025 3300049583 Bacteria 91481
609 Ga0501067_0063143 3300049583 Bacteria 2051
610 Ga0501067_0087364 3300049583 Bacteria 1730
611 Ga0501068_0002387 3300049584 Bacteria 9984
612 Ga0501068_0004030 3300049584 Bacteria 7988
613 Ga0501069_0000001 3300049585 Bacteria 289100
614 Ga0501069_0133516 3300049585 Bacteria 1422
615 Ga0501070_0000071 3300049586 Bacteria 86669
616 Ga0501070_0000824 3300049586 Bacteria 28140
617 Ga0501070_0001839 3300049586 Bacteria 18710
618 Ga0501070_0024940 3300049586 Bacteria 5015
619 Ga0501070_0178591 3300049586 Bacteria 1747
620 Ga0501070_0178612 3300049586 Bacteria 1747
621 Ga0501071_0010530 3300049587 Bacteria 6202
622 Ga0501071_0022185 3300049587 Bacteria 4425
623 Ga0501072_0003385 3300049588 Bacteria 11997
624 Ga0501072_0051510 3300049588 Bacteria 3241
625 Ga0501073_0000135 3300049589 Bacteria 47869
626 Ga0501073_0011727 3300049589 Bacteria 6399
627 Ga0501073_0013905 3300049589 Bacteria 5849
628 Ga0501073_0032984 3300049589 Bacteria 3690
629 Ga0501074_0000003 3300049590 Bacteria 116101
630 Ga0501074_0000443 3300049590 Bacteria 24761
631 Ga0501074_0019268 3300049590 Bacteria 4956
632 Ga0501074_0023253 3300049590 Bacteria 4508
633 Ga0501076_0332905 3300049592 Bacteria 1246
634 Ga0501079_0003407 3300049741 Bacteria 11674
635 Ga0501080_0000382 3300049742 Bacteria 34121
636 Ga0501080_0000470 3300049742 Bacteria 31361
637 Ga0501080_0000669 3300049742 Bacteria 27250
638 Ga0501080_0005657 3300049742 Bacteria 11171
639 Ga0501081_0326335 3300049743 Bacteria 1129
640 Ga0501083_0000080 3300049744 Bacteria 64705
641 Ga0501083_0003054 3300049744 Bacteria 11634
642 Ga0501083_0101325 3300049744 Bacteria 1899
643 Ga0501035_0000037 3300049822 Bacteria 160921
644 Ga0501035_0000052 3300049822 Bacteria 143038
645 Ga0501035_0001237 3300049822 Bacteria 26512
646 Ga0501035_0001584 3300049822 Bacteria 23082
647 Ga0501035_0002187 3300049822 Bacteria 19401
648 Ga0501035_0070539 3300049822 Bacteria 3095
649 Ga0501035_0121270 3300049822 Bacteria 2285
650 Ga0501035_0175161 3300049822 Bacteria 1851
651 Ga0501044_0000018 3300049823 Bacteria 225885
652 Ga0501044_0000217 3300049823 Bacteria 73242
653 Ga0501044_0000366 3300049823 Bacteria 56832
654 Ga0501044_0046984 3300049823 Bacteria 4467
655 Ga0501044_0072305 3300049823 Bacteria 3506
656 Ga0501044_0085781 3300049823 Bacteria 3181
657 Ga0501044_0087528 3300049823 Bacteria 3146
658 Ga0501044_0091284 3300049823 Bacteria 3072
659 Ga0501044_0147382 3300049823 Bacteria 2338
660 nmdc:mga03n38_14660_c1 3300050490 Bacteria 3010
661 nmdc:mga03n38_224_c1 3300050490 Bacteria 13138
662 nmdc:mga00v17_205002_c1 3300050491 Bacteria 1275
663 nmdc:mga00v17_9386_c1 3300050491 Bacteria 5292
664 nmdc:mga0yw44_52563_c1 3300050492 Bacteria 2470
665 nmdc:mga0yw44_72837_c1 3300050492 Bacteria 2136
666 nmdc:mga0k408_5979_c1 3300050493 Bacteria 6497
667 nmdc:mga04h51_6775_c1 3300050495 Bacteria 2992
668 nmdc:mga07m45_6074_c1 3300050496 Bacteria 6081
669 nmdc:mga0n895_64214_c1 3300050512 Bacteria 3631
670 nmdc:mga08x19_79614_c1 3300050514 Bacteria 2149
671 nmdc:mga0sz30_55309_c1 3300050516 Bacteria 1689
672 nmdc:mga0sz30_9528_c1 3300050516 Bacteria 3699
673 Ga0495601_0014819 3300053077 Bacteria 4705
674 Ga0495601_0041332 3300053077 Bacteria 2889
675 Ga0495601_0185195 3300053077 Bacteria 1361
676 Ga0495601_0239203 3300053077 Bacteria 1185
677 Ga0495612_0013454 3300053078 Bacteria 3296
678 Ga0495655_0009206 3300053083 Bacteria 1906
679 Ga0495655_0056796 3300053083 Bacteria 1054
680 Ga0495595_0003095 3300053084 Bacteria 6581
681 Ga0495595_0016247 3300053084 Bacteria 3180
682 Ga0495619_0004543 3300053085 Bacteria 8862
683 Ga0495619_0030322 3300053085 Bacteria 3500
684 Ga0500578_0068194 3300053086 Bacteria 2268
685 Ga0500578_0107327 3300053086 Bacteria 1763
686 Ga0500647_0033209 3300053091 Bacteria 2460
687 Ga0500651_0000526 3300053093 Bacteria 19635
688 Ga0500566_0000097 3300053094 Bacteria 43920
689 Ga0500640_014937 3300053095 Bacteria 3240
690 Ga0500557_000008 3300053105 Bacteria 127284
691 Ga0500572_000853 3300053111 Bacteria 9498
692 Ga0500595_006403 3300053119 Bacteria 4995
693 Ga0500597_043245 3300053120 Bacteria 1901
694 Ga0500607_075728 3300053121 Bacteria 1727
695 Ga0500614_014025 3300053123 Bacteria 1768
696 Ga0500642_0000067 3300053130 Bacteria 56324
697 Ga0500642_0104340 3300053130 Bacteria 1321
698 Ga0500559_0120556 3300053136 Bacteria 1219
699 Ga0500585_057645 3300053144 Bacteria 1394
700 Ga0500603_001381 3300053150 Bacteria 5534
701 Ga0500619_021578 3300053154 Bacteria 1857
702 Ga0500630_035540 3300053159 Bacteria 2441
703 Ga0500639_000219 3300053163 Bacteria 28391
704 Ga0500636_0066605 3300053177 Bacteria 2094
705 Ga0500625_005765 3300053729 Bacteria 5212
706 Ga0501084_0006290 3300054114 Bacteria 9760
707 2507510856 2507262055 Bacteria 8048963
708 2508544673 2508501009 Bacteria 7784016
709 2508697111 2508501042 Bacteria 8719808
710 2509148566 2508501128 Bacteria 8613869
711 2513637633 2513237094 Bacteria 8789602
712 2513649515 2513237095 Bacteria 8976980
713 2513653945 2513237096 Bacteria 8722461
714 2513719321 2513237104 Bacteria 10034502
715 2513856379 2513237137 Bacteria 9558895
716 2513888424 2513237141 Bacteria 8496279
717 2513918285 2513237145 Bacteria 8979722
718 2515630715 2515154112 Bacteria 8294334
719 2517100429 2517093001 Bacteria 9002274
720 2517891485 2517572143 Bacteria 9484767
721 2524437289 2524023205 Bacteria 8918781
722 2524541002 2524023228 Bacteria 10118060
723 2528855271 2528768022 Bacteria 10457665
724 2545674496 2545555834 Bacteria 8130841
725 2596371343 2595698237 Bacteria 6712432
726 2644291197 2643221651 Bacteria 4798932
727 2671118746 2667528175 Bacteria 7532676
728 2728754864 2728368998 Bacteria 8720350
729 2745076758 2744054633 Bacteria 8678936
730 2793065131 2791355196 Bacteria 7323613
731 2793066853 2791355197 Bacteria 8420563
732 2818237985 2816332527 Bacteria 8933356
733 2824601533 2824600985 Bacteria 8488197
734 2824617195 2824609381 Bacteria 8672835
735 2824653665 2824653114 Bacteria 8493680
736 2824663038 2824661429 Bacteria 9877870
737 2824709871 2824704595 Bacteria 9667483
738 2824756996 2824753945 Bacteria 9787441
739 2824770124 2824763712 Bacteria 9792355
740 2844317084 2844315083 Bacteria 8138177
741 2847938425 2847930680 Bacteria 9342022
742 2849081384 2849076700 Bacteria 7039503
743 2874597571 2874590934 Bacteria 8299676
744 2874649134 2874645413 Bacteria 8214782
745 2876767736 2876761206 Bacteria 10111113
746 2876774956 2876771140 Bacteria 8287509
747 2876822292 2876818435 Bacteria 8274608
748 2879078044 2879074833 Bacteria 8279565
749 2879088662 2879083081 Bacteria 8587928
750 2879103994 2879099564 Bacteria 10442239
751 2879132405 2879127579 Bacteria 8294491
752 2879145296 2879142872 Bacteria 8267021
753 2881370533 2881364244 Bacteria 7710352
754 2881667297 2881665667 Bacteria 8175609
755 2885377810 2885374607 Bacteria 8927485
756 2885416493 2885409591 Bacteria 9235467
757 2888381698 2888378607 Bacteria 9652610
758 2888422085 2888419890 Bacteria 7857137
759 2889306677 2889306138 Bacteria 6358934
760 2902332324 2902330777 Bacteria 6395352
761 2902409673 2902405164 Bacteria 6784948
762 2903735051 2903727486 Bacteria 8281579
763 2903758733 2903748898 Bacteria 9972761
764 2904691341 2904690495 Bacteria 9412302
765 2904704815
766 2904719040 2904711408 Bacteria 9771557
767 2906604167 2906602504 Bacteria 8295279
768 2906616661
769 2906643717 2906635258 Bacteria 8601019
770 2906647979 2906643746 Bacteria 8722424
771 2906666988 2906660503 Bacteria 8595048
772 2908741827 2908739725 Bacteria 8628932
773 2908759521 2908756301 Bacteria 8864324
774 2922371384
775 2922431314
776 2928126276 2928125067 Bacteria 5937560
777 2929623243 2929615660 Bacteria 9193770
778 2929630923 2929624759 Bacteria 9339455
779 2932786088 2932784394 Bacteria 9704911
780 2932799136 2932794094 Bacteria 7915132
781 2932803941 2932801729 Bacteria 7987968
782 2932811969 2932809354 Bacteria 9135765
783 2932822545 2932818245 Bacteria 9955613
784 2932831132 2932828146 Bacteria 9745859
785 2933585147 2933577622 Bacteria 9116884
786 2935612922 2935608549 Bacteria 8203142
787 2935624082 2935616580 Bacteria 9032984
788 2935633908 2935630451 Bacteria 8169952
789 2935640272 2935638405 Bacteria 10015038
790 2935654714 2935648319 Bacteria 8801166
791 2935663509 2935656913 Bacteria 8965014
792 2935666890 2935665750 Bacteria 9571747
793 2935684356 2935675223 Bacteria 9928132
794 2935691338 2935684952 Bacteria 9590419
795 2935699897 2935694250 Bacteria 9291695
796 2935704645 2935703347 Bacteria 10242284
797 2935719172 2935713505 Bacteria 9608509
798 2935729228 2935722832 Bacteria 9608746
799 2935737531 2935732158 Bacteria 9706831
800 2935746907 2935741537 Bacteria 9707219
801 2935758294 2935750917 Bacteria 9590372
802 2935762455 2935760218 Bacteria 9817913
803 2935777293 2935769743 Bacteria 7878163
804 2935780388 2935777560 Bacteria 8077691
805 2935793203 2935785616 Bacteria 7962367
806 2935801201 2935793552 Bacteria 8012592
807 2935803952 2935801545 Bacteria 9301974
808 2935811871 2935810662 Bacteria 9401221
809 2935824410 2935819856 Bacteria 8261050
810 2935829755 2935827899 Bacteria 10038562
811 2935842888 2935837841 Bacteria 9454360
812 2935852445 2935847175 Bacteria 8228321
813 2935862418 2935855204 Bacteria 9035059
814 2935870553 2935864058 Bacteria 9784707
815 2935881135 2935873716 Bacteria 9632195
816 2935884253 2935883170 Bacteria 7964738
817 2935912408 2935908558 Bacteria 8568796
818 2935921759 2935916978 Bacteria 9113783
819 2935929703 2935926038 Bacteria 8601059
820 2935938935 2935934488 Bacteria 8602579
821 2935948230 2935942939 Bacteria 8599779
822 2935954954 2935951376 Bacteria 8602333
823 2935962222 2935959822 Bacteria 7869783
824 2935972012 2935967501 Bacteria 8603075
825 2935979340 2935975950 Bacteria 8347125
826 2935988075 2935984226 Bacteria 8302647
827 2935993632 2935992306 Bacteria 9802711
828 2936004528 2936002035 Bacteria 9362176
829 2936017665 2936011229 Bacteria 8801034
830 2936026253 2936019824 Bacteria 8804134
831 2936035243 2936028420 Bacteria 8965941
832 2936038454 2936037263 Bacteria 9446081
833 2936053151 2936046547 Bacteria 8903709
834 2936059374 2936055302 Bacteria 8785755
835 2940563796 2940556831 Bacteria 9590747
836 2941510789 2941507105 Bacteria 8166816
837 2941518173 2941515067 Bacteria 8166720
838 2941526956 2941523033 Bacteria 8169134
839 2941533853 2941531003 Bacteria 7653939
840 2941544137 2941538514 Bacteria 9402094
841 3003666887 3003665799 Bacteria 7279786
842 3005481110 3005474847 Bacteria 9259049
843 3005596714 3005594810 Bacteria 8716512
844 3005712785 3005710791 Bacteria 7622528
845 3005719842 3005718088 Bacteria 8283608
846 641644901 641522639 Bacteria 7737025
847 643597844 643348564 Bacteria 8839022
848 8006939601 8006933436 Bacteria 10410654
849 8006979352 8006973647 Bacteria 10679141
850 8016516245 8016511872 Bacteria 9921665
851 8016537162 8016530956 Bacteria 8155261
852 8016551832 8016548790 Bacteria 8155074
853 8016560215 8016557553 Bacteria 8154380
854 8016566812 8016566248 Bacteria 8158151
855 8016589310 8016583857 Bacteria 10421953
856 8016598133 8016595262 Bacteria 8149947
857 8016604272 8016603502 Bacteria 8731218
858 8016620858 8016613128 Bacteria 8794220
859 8016629130 8016622563 Bacteria 7999408
860 8016633667 8016630954 Bacteria 9217207
861 8017060287 8017057580 Bacteria 10023680
862 8019536854 8019530166 Bacteria 8155624
863 8019548062 8019547302 Bacteria 7996444
864 8019565492 8019555841 Bacteria 9642137
865 8019575588 8019565922 Bacteria 9639779
866 8019579814 8019576017 Bacteria 10049540
867 8019587520 8019586578 Bacteria 10212056
868 8019603818 8019597564 Bacteria 10041141
869 8019614717 8019608314 Bacteria 10042931
870 8019625328 8019619141 Bacteria 9218857
871 8019636853 8019629233 Bacteria 8687553
872 8019642754 8019638758 Bacteria 9062356
873 8019649838 8019648815 Bacteria 10014479
874 8019664674 8019659431 Bacteria 8577854
875 8019674264 8019668869 Bacteria 8791617
876 8019693930 8019687851 Bacteria 8712826
877 8055748979 8055742211 Bacteria 9226248
878 8056693836 8056689827 Bacteria 6712655
879 8056972022 8056967851 Bacteria 9038162
880 Ga0213874_10002639
881 JGI25165J46597_1006767
882 JGI25160J50197_1007582
883 Ga0055543_1013756
884 Ga0065165_1004374
885 Ga0070658_10056239
886 Ga0070676_10289184
887 Ga0070683_100001891
888 Ga0070683_100019924
889 Ga0070683_100072047
890 Ga0070683_100658453
891 Ga0068869_100001186
892 Ga0070680_100016775
893 Ga0070680_100195987
894 Ga0070680_100312437
895 Ga0070682_100056630
896 Ga0070682_100316334
897 Ga0068868_100002380
898 Ga0070689_100090026
899 Ga0070691_10186651
900 Ga0070668_100008952
901 Ga0070674_100161557
902 Ga0070659_100051334
903 Ga0070659_100256937
904 Ga0070667_100362682
905 Ga0070709_10002013
906 Ga0070709_10005865
907 Ga0070714_100006313
908 Ga0070714_100041770
909 Ga0070714_100173398
910 Ga0070713_100004655
911 Ga0070713_100039500
912 Ga0070713_100164699
913 Ga0070710_10000896
914 Ga0070710_10002832
915 Ga0070701_10083906
916 Ga0070711_100007213
917 Ga0070711_100008957
918 Ga0070711_100093101
919 Ga0070711_100119075
920 Ga0070663_100033127
921 Ga0070663_100036834
922 Ga0070662_100132585
923 Ga0070681_10076300
924 Ga0070681_10146085
925 Ga0070681_10315190
926 Ga0070681_10493869
927 Ga0070681_10511038
928 Ga0070706_100118744
929 Ga0070707_100171685
930 Ga0070679_100029796
931 Ga0070679_100291008
932 Ga0070679_100316505
933 Ga0070684_100010920
934 Ga0070684_100052866
935 Ga0070697_100093961
936 Ga0068853_100035551
937 Ga0068853_100169342
938 Ga0070686_100053425
939 Ga0070665_100012340
940 Ga0070665_100035823
941 Ga0068855_100040104
942 Ga0068855_100072657
943 Ga0068855_100077687
944 Ga0068855_100097896
945 Ga0068855_100328828
946 Ga0068855_100342315
947 Ga0068855_100425519
948 Ga0070664_100026724
949 Ga0070664_100152168
950 Ga0070664_100410739
951 Ga0068857_100017610
952 Ga0068857_100028282
953 Ga0068854_100097839
954 Ga0068856_100000183
955 Ga0068856_100029563
956 Ga0068856_100063430
957 Ga0068852_100053488
958 Ga0068852_100230989
959 Ga0068859_100063595
960 Ga0068864_100049226
961 Ga0068864_100122039
962 Ga0068861_100042059
963 Ga0068870_10004287
964 Ga0068863_100027853
965 Ga0068858_100041385
966 Ga0068858_100589553
967 Ga0068860_100093295
968 Ga0081540_1002227
969 Ga0081540_1005198
970 Ga0081540_1006571
971 Ga0081540_1006785
972 Ga0081540_1018573
973 Ga0070717_10087311
974 Ga0070717_10429945
975 Ga0075365_10059561
976 Ga0075368_10019062
977 Ga0075363_100010158
978 Ga0075363_100048514
979 Ga0075364_10024619
980 Ga0075364_10295801
981 Ga0070715_10000456
982 Ga0070716_100011137
983 Ga0070716_100023798
984 Ga0070712_100015504
985 Ga0075367_10001130
986 Ga0075369_10005353
987 Ga0075366_10016316
988 Ga0075370_10009564
989 Ga0075370_10017687
990 Ga0068865_100055253
991 Ga0075436_100088588
992 Ga0097620_100063592
993 Ga0099824_1021709
994 Ga0099824_1033210
995 Ga0099822_1024226
996 Ga0105240_10039694
997 Ga0105240_10109427
998 Ga0105240_10121920
999 Ga0105240_10135701
1000 Ga0105240_10276799
1001 Ga0111539_10714684
1002 Ga0105245_10005441
1003 Ga0105245_10038994
1004 Ga0105247_10005785
1005 Ga0105247_10240256
1006 Ga0105243_10042185
1007 Ga0105241_10037493
1008 Ga0105241_10211105
1009 Ga0105248_10646336
1010 Ga0105237_10017339
1011 Ga0105237_10095319
1012 Ga0105237_10138567
1013 Ga0105237_10298145
1014 Ga0105238_10142049
1015 Ga0105238_10398268
1016 Ga0099796_10010555
1017 Ga0105239_10003963
1018 Ga0105239_10109809
1019 Ga0105239_10546926
1020 Ga0105246_10379968
1021 Ga0157371_10237967
1022 Ga0157370_10097584
1023 Ga0157370_10205900
1024 Ga0157370_10338421
1025 Ga0157370_10357736
1026 Ga0157369_10012373
1027 Ga0157369_10026071
1028 Ga0157369_10083698
1029 Ga0157374_10634738
1030 Ga0157378_10172127
1031 Ga0163162_10025402
1032 Ga0163162_10146465
1033 Ga0157372_10034737
1034 Ga0157372_10048052
1035 Ga0157372_10326057
1036 Ga0157375_10011636
1037 Ga0163163_10007610
1038 Ga0163163_10073797
1039 Ga0157376_10153431
1040 Ga0213873_10000846
1041 Ga0213872_10000429
1042 Ga0213872_10004083
1043 Ga0213872_10004694
1044 Ga0213872_10016051
1045 Ga0213874_10002580
1046 Ga0213874_10005128
1047 Ga0213876_10001306
1048 Ga0213876_10001630
1049 Ga0213876_10134690
1050 Ga0213875_10000030
1051 Ga0213875_10003482
1052 Ga0213875_10003821
1053 Ga0213875_10007291
1054 Ga0213875_10010083
1055 Ga0213875_10014477
1056 Ga0213875_10019616
1057 Ga0213875_10046437
1058 Ga0213875_10077961
1059 Ga0213875_10091232
1060 Ga0213871_10068475
1061 Ga0209677_100749
1062 Ga0209148_1000773
1063 Ga0209233_1003148
1064 Ga0209233_1004858
1065 Ga0209233_1005292
1066 Ga0209233_1005946
1067 Ga0209455_1001728
1068 Ga0209455_1008216
1069 Ga0209564_1003916
1070 Ga0209758_1000282
1071 Ga0209758_1004003
1072 Ga0209758_1027779
1073 Ga0207426_1000437
1074 Ga0207426_1001098
1075 Ga0207426_1012310
1076 Ga0207692_10002885
1077 Ga0207692_10005756
1078 Ga0207692_10009200
1079 Ga0207710_10018346
1080 Ga0207688_10019965
1081 Ga0207685_10000267
1082 Ga0207699_10002339
1083 Ga0207699_10003537
1084 Ga0207643_10025498
1085 Ga0207705_10082672
1086 Ga0207654_10021751
1087 Ga0207654_10029110
1088 Ga0207707_10018073
1089 Ga0207695_10000062
1090 Ga0207695_10019960
1091 Ga0207695_10078563
1092 Ga0207695_10133694
1093 Ga0207695_10251375
1094 Ga0207671_10008251
1095 Ga0207671_10051920
1096 Ga0207671_10092336
1097 Ga0207671_10139497
1098 Ga0207671_10223517
1099 Ga0207693_10000326
1100 Ga0207693_10003223
1101 Ga0207693_10015787
1102 Ga0207663_10000225
1103 Ga0207663_10009124
1104 Ga0207663_10096713
1105 Ga0207663_10116539
1106 Ga0207663_10132455
1107 Ga0207660_10228682
1108 Ga0207657_10004806
1109 Ga0207649_10102875
1110 Ga0207652_10013842
1111 Ga0207652_10023687
1112 Ga0207652_10084661
1113 Ga0207652_10525394
1114 Ga0207694_10132083
1115 Ga0207694_10525114
1116 Ga0207664_10014435
1117 Ga0207664_10031784
1118 Ga0207664_10109709
1119 Ga0207644_10016717
1120 Ga0207690_10025298
1121 Ga0207706_10199961
1122 Ga0207709_10203375
1123 Ga0207704_10048142
1124 Ga0207665_10001364
1125 Ga0207665_10015528
1126 Ga0207665_10036269
1127 Ga0207711_10054778
1128 Ga0207689_10014080
1129 Ga0207661_10001182
1130 Ga0207661_10203221
1131 Ga0207679_10363881
1132 Ga0207679_10489006
1133 Ga0207712_10125479
1134 Ga0207668_10004125
1135 Ga0207658_10093472
1136 Ga0207677_10038130
1137 Ga0207639_10010102
1138 Ga0207639_10196860
1139 Ga0207639_10311422
1140 Ga0207678_10014454
1141 Ga0207678_10021795
1142 Ga0207678_10023002
1143 Ga0207678_10054764
1144 Ga0207702_10000197
1145 Ga0207702_10018501
1146 Ga0207641_10238720
1147 Ga0207648_10219239
1148 Ga0207676_10106108
1149 Ga0207674_10464147
1150 Ga0207675_100041364
1151 Ga0207683_10011087
1152 Ga0207698_10105090
1153 Ga0207698_10200930
1154 Ga0207698_10314938
1155 Ga0209389_1000004
1156 Ga0209389_1001618
1157 Ga0209589_1000010
1158 Ga0209589_1000014
1159 Ga0209489_100011
1160 Ga0209489_100014
1161 Ga0209489_100777
1162 Ga0209700_100013
1163 Ga0209700_100024
1164 Ga0209813_10002203
1165 Ga0268266_10001413
1166 Ga0268266_10087585
1167 Ga0268264_10062341
1168 Ga0265334_10054565
1169 Ga0265770_1014959
1170 Ga0265773_1001012
1171 Ga0265760_10051491
1172 Ga0265330_10035799
1173 Ga0265325_10012959
1174 Ga0265340_10011608
1175 Ga0265339_10000016
1176 Ga0265339_10006455
1177 Ga0265339_10016353
1178 Ga0265339_10110791
1179 Ga0265316_10387288
1180 Ga0307513_10018286
1181 Ga0265313_10000060
1182 Ga0265314_10016312
1183 Ga0265314_10069850
1184 Ga0265342_10010600
1185 Ga0307516_10092521
1186 Ga0316583_10027407
1187 Ga0307510_10019799
1188 Ga0315911_1000002
1189 Ga0316215_1001104
1190 Ga0373934_0002405
1191 Ga0373923_0022547
1192 Ga0373936_0018479
1193 Ga0373953_0000409
1194 Ga0373953_0009941
1195 Ga0373954_0002776
1196 Ga0373954_0029995
1197 Ga0373956_0004736
1198 Ga0373956_0005250
1199 Ga0373957_0014177
1200 Ga0373955_0002711
1201 Ga0373955_0003550
1202 Ga0373924_0006225
1203 Ga0373927_0004054
1204 Ga0373933_0002107
1205 Ga0373937_0008396
1206 Ga0373937_0021312
1207 Ga0373937_0324402
1208 Ga0372808_001074
1209 Ga0373925_0024876
1210 Ga0395899_0122972
1211 Ga0395900_0000660
1212 Ga0395900_0002114
1213 Ga0395900_0008707
1214 Ga0395900_0199262
1215 Ga0395900_0378614
1216 Ga0395898_0003200
1217 Ga0395898_0006500
1218 Ga0395898_0007107
1219 Ga0395898_0064826
1220 Ga0395905_0021700
1221 Ga0395905_0259473
1222 Ga0436364_0051975
1223 Ga0436364_0102033
1224 Ga0436364_0134493
1225 Ga0436364_0178729
1226 Ga0436364_0240938
1227 Ga0436364_0294887
1228 Ga0436364_0330571
1229 Ga0436364_0341833
1230 Ga0436364_0425317
1231 Ga0436364_0480253
1232 Ga0436364_0629092
1233 Ga0436364_0654054
1234 Ga0436364_1015733
1235 Ga0436364_1040604
1236 Ga0436364_1401270
1237 Ga0436364_1503331
1238 Ga0436364_1527859
1239 Ga0395901_0034087
1240 Ga0395901_0063663
1241 Ga0395901_0101488
1242 Ga0395901_0437117
1243 Ga0395901_0515459
1244 Ga0436365_0151043
1245 Ga0436365_0159409
1246 Ga0436365_0459588
1247 Ga0436365_0510188
1248 Ga0436365_0697045
1249 Ga0436365_0917056
1250 Ga0436365_1047663
1251 Ga0436360_0202427
1252 Ga0436360_0480010
1253 Ga0436360_0545523
1254 Ga0436360_1060729
1255 Ga0436360_1101828
1256 Ga0436361_0200283
1257 Ga0436361_0512286
1258 Ga0436361_0638445
1259 Ga0436361_0838125
1260 Ga0436361_1054672
1261 Ga0436361_1159707
1262 Ga0436363_0121554
1263 Ga0436363_0274569
1264 Ga0436363_0454820
1265 Ga0436363_0627803
1266 Ga0436363_0700194
1267 Ga0436363_0761127
1268 Ga0436363_1022276
1269 Ga0436363_1499575
1270 Ga0436362_0278148
1271 Ga0436362_0842308
1272 Ga0436362_0895327
1273 Ga0436362_0983233
1274 Ga0466969_0100925
1275 Ga0466972_0000079
1276 Ga0466972_0004644
1277 Ga0466966_0001208
1278 Ga0466966_0006229
1279 Ga0466961_0000020
1280 Ga0466961_0039468
1281 Ga0466961_0049669
1282 Ga0466963_0031974
1283 Ga0466963_0209438
1284 Ga0466971_0051755
1285 Ga0466968_0011964
1286 Ga0466970_0026083
1287 Ga0466970_0087989
1288 Ga0466957_0041896
1289 Ga0466957_0165300
1290 Ga0466960_0000424
1291 Ga0466959_0004294
1292 Ga0466959_0245173
1293 Ga0466967_0063821
1294 Ga0466967_0377060
1295 Ga0466967_0549232
1296 Ga0495592_0003202
1297 Ga0495592_0036190
1298 Ga0495603_0139262
1299 Ga0495629_0001830
1300 Ga0495629_0006153
1301 Ga0495629_0107512
1302 Ga0495641_0144258
1303 Ga0495651_0002500
1304 Ga0495651_0041294
1305 Ga0495651_0041839
1306 Ga0495651_0140950
1307 Ga0495653_0001471
1308 Ga0495653_0050752
1309 Ga0495653_0159296
1310 Ga0495582_0214523
1311 Ga0495639_0114838
1312 Ga0495662_0108284
1313 Ga0495664_0007676
1314 Ga0495664_0007911
1315 Ga0495664_0087653
1316 Ga0495596_0068738
1317 Ga0495606_0005210
1318 Ga0495608_0002191
1319 Ga0495608_0036131
1320 Ga0495608_0060094
1321 Ga0495618_0079959
1322 Ga0495618_0279140
1323 Ga0495620_0060077
1324 Ga0495628_0030883
1325 Ga0495628_0033600
1326 Ga0495628_0064783
1327 Ga0495630_0022407
1328 Ga0495648_0003767
1329 Ga0495648_0007614
1330 Ga0495652_0006321
1331 Ga0495652_0031923
1332 Ga0495640_0002348
1333 Ga0495640_0026198
1334 Ga0495586_0022337
1335 Ga0495587_0004728
1336 Ga0495587_0015523
1337 Ga0495587_0027948
1338 Ga0495645_0014837
1339 Ga0495645_0040372
1340 Ga0495645_0221128
1341 Ga0495667_0002963
1342 Ga0495667_0013368
1343 Ga0495667_0016179
1344 Ga0495634_0089901
1345 Ga0495634_0197772
1346 Ga0495625_0039696
1347 Ga0495635_0000636
1348 Ga0495635_0002205
1349 Ga0495657_0002552
1350 Ga0495657_0014012
1351 Ga0495599_0001077
1352 Ga0495599_0010332
1353 Ga0495599_0060861
1354 Ga0495623_0004268
1355 Ga0495623_0006526
1356 Ga0495623_0048527
1357 Ga0495646_0025871
1358 Ga0495613_0033951
1359 Ga0495613_0120524
1360 Ga0495624_0058576
1361 Ga0495624_0091302
1362 Ga0495624_0111238
1363 Ga0495600_0000873
1364 Ga0495600_0001010
1365 Ga0495604_0008420
1366 Ga0495604_0038621
1367 Ga0495604_0052467
1368 Ga0495604_0063576
1369 Ga0495674_0028066
1370 Ga0495674_0065255
1371 Ga0495674_0242918
1372 Ga0495676_0103736
1373 Ga0495680_0001037
1374 Ga0495680_0001883
1375 Ga0495680_0043083
1376 Ga0495675_0001800
1377 Ga0495675_0037092
1378 Ga0495684_0000666
1379 Ga0495684_0036531
1380 Ga0495684_0096515
1381 Ga0495684_0184941
1382 Ga0495686_0046711
1383 Ga0495686_0107093
1384 Ga0495593_0008032
1385 Ga0495602_0004340
1386 Ga0495602_0012996
1387 Ga0495602_0196647
1388 Ga0495602_0201081
1389 Ga0496100_0029945
1390 Ga0496102_0567391
1391 Ga0496104_0001245
1392 Ga0496104_0005309
1393 Ga0496104_0082198
1394 Ga0496104_0283502
1395 Ga0496105_0003657
1396 Ga0496105_0093356
1397 Ga0496106_0013957
1398 Ga0496107_0130771
1399 Ga0496108_0001861
1400 Ga0496108_0218656
1401 Ga0496109_0001073
1402 Ga0496109_0155295
1403 Ga0496110_0002479
1404 Ga0496111_0028004
1405 Ga0496111_0061970
1406 Ga0496111_0215505
1407 Ga0496112_0002061
1408 Ga0496112_0005807
1409 Ga0496112_0008838
1410 Ga0496112_0107427
1411 Ga0496112_0119654
1412 Ga0496112_0223868
1413 Ga0496112_0440495
1414 Ga0496113_0000095
1415 Ga0496113_0156636
1416 Ga0496114_0200299
1417 Ga0496115_0003952
1418 Ga0496115_0042478
1419 Ga0496115_0314357
1420 Ga0496116_0140996
1421 Ga0496118_0016456
1422 Ga0496118_0130626
1423 Ga0496119_0003004
1424 Ga0496119_0080481
1425 Ga0496121_0008659
1426 Ga0496121_0021131
1427 Ga0496121_0032677
1428 Ga0496121_0066895
1429 Ga0496121_0103413
1430 Ga0496124_0209458
1431 Ga0496125_0000237
1432 Ga0496125_0001822
1433 Ga0496126_0011267
1434 Ga0496126_0158354
1435 Ga0496126_0174038
1436 Ga0496126_0338736
1437 Ga0501031_0001197
1438 Ga0501031_0003032
1439 Ga0501031_0118857
1440 Ga0501032_0000358
1441 Ga0501032_0000696
1442 Ga0501032_0036140
1443 Ga0501032_0086541
1444 Ga0501033_0000232
1445 Ga0501033_0000601
1446 Ga0501033_0001532
1447 Ga0501033_0006726
1448 Ga0501033_0037684
1449 Ga0501034_0000039
1450 Ga0501034_0000704
1451 Ga0501034_0193399
1452 Ga0501036_0000007
1453 Ga0501036_0000052
1454 Ga0501036_0301604
1455 Ga0501037_0000025
1456 Ga0501037_0001450
1457 Ga0501037_0020087
1458 Ga0501037_0149374
1459 Ga0501038_0000026
1460 Ga0501038_0000168
1461 Ga0501038_0119167
1462 Ga0501038_0177296
1463 Ga0501038_0275468
1464 Ga0501039_0000005
1465 Ga0501039_0003632
1466 Ga0501039_0156253
1467 Ga0501042_0118124
1468 Ga0501043_0000007
1469 Ga0501043_0000036
1470 Ga0501043_0002042
1471 Ga0501043_0133440
1472 Ga0501046_0000147
1473 Ga0501046_0000231
1474 Ga0501046_0070614
1475 Ga0501046_0171712
1476 Ga0501046_0304341
1477 Ga0501047_0000209
1478 Ga0501047_0000457
1479 Ga0501047_0009482
1480 Ga0501047_0012842
1481 Ga0501047_0071155
1482 Ga0501047_0102930
1483 Ga0501047_0145750
1484 Ga0501047_0223123
1485 Ga0501048_0000585
1486 Ga0501048_0020451
1487 Ga0501067_0000025
1488 Ga0501067_0063143
1489 Ga0501067_0087364
1490 Ga0501068_0002387
1491 Ga0501068_0004030
1492 Ga0501069_0000001
1493 Ga0501069_0133516
1494 Ga0501070_0000071
1495 Ga0501070_0000824
1496 Ga0501070_0001839
1497 Ga0501070_0024940
1498 Ga0501070_0178591
1499 Ga0501070_0178612
1500 Ga0501071_0010530
1501 Ga0501071_0022185
1502 Ga0501072_0003385
1503 Ga0501072_0051510
1504 Ga0501073_0000135
1505 Ga0501073_0011727
1506 Ga0501073_0013905
1507 Ga0501073_0032984
1508 Ga0501074_0000003
1509 Ga0501074_0000443
1510 Ga0501074_0019268
1511 Ga0501074_0023253
1512 Ga0501076_0332905
1513 Ga0501079_0003407
1514 Ga0501080_0000382
1515 Ga0501080_0000470
1516 Ga0501080_0000669
1517 Ga0501080_0005657
1518 Ga0501081_0326335
1519 Ga0501083_0000080
1520 Ga0501083_0003054
1521 Ga0501083_0101325
1522 Ga0501035_0000037
1523 Ga0501035_0000052
1524 Ga0501035_0001237
1525 Ga0501035_0001584
1526 Ga0501035_0002187
1527 Ga0501035_0070539
1528 Ga0501035_0121270
1529 Ga0501035_0175161
1530 Ga0501044_0000018
1531 Ga0501044_0000217
1532 Ga0501044_0000366
1533 Ga0501044_0046984
1534 Ga0501044_0072305
1535 Ga0501044_0085781
1536 Ga0501044_0087528
1537 Ga0501044_0091284
1538 Ga0501044_0147382
1539 nmdc:mga03n38_14660_c1
1540 nmdc:mga03n38_224_c1
1541 nmdc:mga00v17_205002_c1
1542 nmdc:mga00v17_9386_c1
1543 nmdc:mga0yw44_52563_c1
1544 nmdc:mga0yw44_72837_c1
1545 nmdc:mga0k408_5979_c1
1546 nmdc:mga04h51_6775_c1
1547 nmdc:mga07m45_6074_c1
1548 nmdc:mga0n895_64214_c1
1549 nmdc:mga08x19_79614_c1
1550 nmdc:mga0sz30_55309_c1
1551 nmdc:mga0sz30_9528_c1
1552 Ga0495601_0014819
1553 Ga0495601_0041332
1554 Ga0495601_0185195
1555 Ga0495601_0239203
1556 Ga0495612_0013454
1557 Ga0495655_0009206
1558 Ga0495655_0056796
1559 Ga0495595_0003095
1560 Ga0495595_0016247
1561 Ga0495619_0004543
1562 Ga0495619_0030322
1563 Ga0500578_0068194
1564 Ga0500578_0107327
1565 Ga0500647_0033209
1566 Ga0500651_0000526
1567 Ga0500566_0000097
1568 Ga0500640_014937
1569 Ga0500557_000008
1570 Ga0500572_000853
1571 Ga0500595_006403
1572 Ga0500597_043245
1573 Ga0500607_075728
1574 Ga0500614_014025
1575 Ga0500642_0000067
1576 Ga0500642_0104340
1577 Ga0500559_0120556
1578 Ga0500585_057645
1579 Ga0500603_001381
1580 Ga0500619_021578
1581 Ga0500630_035540
1582 Ga0500639_000219
1583 Ga0500636_0066605
1584 Ga0500625_005765
1585 Ga0501084_0006290
1586 2507510856
1587 2508544673
1588 2508697111
1589 2509148566
1590 2513637633
1591 2513649515
1592 2513653945
1593 2513719321
1594 2513856379
1595 2513888424
1596 2513918285
1597 2515630715
1598 2517100429
1599 2517891485
1600 2524437289
1601 2524541002
1602 2528855271
1603 2545674496
1604 2596371343
1605 2644291197
1606 2671118746
1607 2728754864
1608 2745076758
1609 2793065131
1610 2793066853
1611 2818237985
1612 2824601533
1613 2824617195
1614 2824653665
1615 2824663038
1616 2824709871
1617 2824756996
1618 2824770124
1619 2844317084
1620 2847938425
1621 2849081384
1622 2874597571
1623 2874649134
1624 2876767736
1625 2876774956
1626 2876822292
1627 2879078044
1628 2879088662
1629 2879103994
1630 2879132405
1631 2879145296
1632 2881370533
1633 2881667297
1634 2885377810
1635 2885416493
1636 2888381698
1637 2888422085
1638 2889306677
1639 2902332324
1640 2902409673
1641 2903735051
1642 2903758733
1643 2904691341
1644 2904704815
1645 2904719040
1646 2906604167
1647 2906616661
1648 2906643717
1649 2906647979
1650 2906666988
1651 2908741827
1652 2908759521
1653 2922371384
1654 2922431314
1655 2928126276
1656 2929623243
1657 2929630923
1658 2932786088
1659 2932799136
1660 2932803941
1661 2932811969
1662 2932822545
1663 2932831132
1664 2933585147
1665 2935612922
1666 2935624082
1667 2935633908
1668 2935640272
1669 2935654714
1670 2935663509
1671 2935666890
1672 2935684356
1673 2935691338
1674 2935699897
1675 2935704645
1676 2935719172
1677 2935729228
1678 2935737531
1679 2935746907
1680 2935758294
1681 2935762455
1682 2935777293
1683 2935780388
1684 2935793203
1685 2935801201
1686 2935803952
1687 2935811871
1688 2935824410
1689 2935829755
1690 2935842888
1691 2935852445
1692 2935862418
1693 2935870553
1694 2935881135
1695 2935884253
1696 2935912408
1697 2935921759
1698 2935929703
1699 2935938935
1700 2935948230
1701 2935954954
1702 2935962222
1703 2935972012
1704 2935979340
1705 2935988075
1706 2935993632
1707 2936004528
1708 2936017665
1709 2936026253
1710 2936035243
1711 2936038454
1712 2936053151
1713 2936059374
1714 2940563796
1715 2941510789
1716 2941518173
1717 2941526956
1718 2941533853
1719 2941544137
1720 3003666887
1721 3005481110
1722 3005596714
1723 3005712785
1724 3005719842
1725 641644901
1726 643597844
1727 8006939601
1728 8006979352
1729 8016516245
1730 8016537162
1731 8016551832
1732 8016560215
1733 8016566812
1734 8016589310
1735 8016598133
1736 8016604272
1737 8016620858
1738 8016629130
1739 8016633667
1740 8017060287
1741 8019536854
1742 8019548062
1743 8019565492
1744 8019575588
1745 8019579814
1746 8019587520
1747 8019603818
1748 8019614717
1749 8019625328
1750 8019636853
1751 8019642754
1752 8019649838
1753 8019664674
1754 8019674264
1755 8019693930
1756 8055748979
1757 8056693836
1758 8056972022

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

43

306

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nq2-assembly1.cif.gz_A an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5945 8 294
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.5909 34 292
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.5858 31 292
4g1u-assembly1.cif.gz_B x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.576 14 292
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5571 15 292
ID Description Score Start End Superfamily
af_Q58666_4_320_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8652 31 290 1.10.3470.10
af_P23200_41_325_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8077 33 290 1.10.3470.10
af_P0AGI4_56_383_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8062 33 290 1.10.3470.10
af_P39328_55_321_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8042 28 289 1.10.3470.10
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7995 31 290 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A0D7EH95-F1-model_v4 ABC transporter permease 0.9752 3 216 GO:0005886
GO:0015658
AF-A0A257S961-F1-model_v4 deleted 0.9649 7 308
AF-A0A0D7EH95-F1-model_v4 ABC transporter permease 0.962 3 216 GO:0005886
GO:0015658
AF-A0A523UBX2-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9472 12 221 GO:0005886
GO:0015658
AF-A0A7Y0C2Q4-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9469 10 307 GO:0005886
GO:0015658

Map