F484465
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 879 | 456 | 1758 | 85 |
Family's Representative Sequence
| Representative Sequence | 3300032004|Ga0307414_10147875|Ga0307414_101478752 |
| Length | 98 |
| Sequence | MAHKKGASSSRNGRDSNAQRLGVKRFGGQIVKAGEIIVRQRGTHFHPGTNVGRGGDDTLFATAPGAVTFGTKRGRKTISVLRPSASGLDVAAGAAPKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 8 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 12 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 15 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 16 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 19 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 96 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020071 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 115 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 122 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 124 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 183 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 184 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 185 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 186 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 187 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 188 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 191 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 192 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 193 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 194 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 195 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 197 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 201 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 205 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 206 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 207 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 208 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 209 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 215 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 216 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 217 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 218 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 219 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 220 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 221 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 222 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 223 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 224 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 225 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 226 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 227 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 228 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 229 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 230 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 231 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 233 | 3300041450 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaT | Metatranscriptome | Rhizoplane |
| 234 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 241 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 242 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 243 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 244 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 245 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 246 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 247 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 248 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 249 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 250 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 251 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 252 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 253 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 254 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 255 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 256 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 257 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 258 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 259 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 260 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 261 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 262 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 263 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 264 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 265 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 266 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 267 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 268 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 269 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 291 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 292 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 293 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 294 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 295 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 296 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 299 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 300 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 301 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 302 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 303 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 304 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 305 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 306 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 307 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 308 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 309 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 310 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 311 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 312 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 313 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 314 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 353 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 354 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 355 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 356 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 357 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 358 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 359 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 360 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 362 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 363 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 364 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 365 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 366 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 367 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 368 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 369 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 370 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 372 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 403 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 404 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 405 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 406 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 407 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 408 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 409 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 410 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 411 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 412 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 413 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 414 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 415 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 416 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 417 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 418 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 419 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 420 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 421 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 422 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 423 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 424 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 425 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 426 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 427 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 428 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 429 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 430 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 431 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 432 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 433 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 434 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 435 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 436 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 437 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 438 | 2919039151 | Curtobacterium sp. 260 | Isolate | Rhizosphere |
| 439 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 440 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 441 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 442 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 443 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 444 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 445 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 446 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 447 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 448 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 449 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 450 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 451 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 452 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 453 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 454 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 455 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 456 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.95 |
| Metatranscriptomes | 14.9 |
| Isolates | 6.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.46 |
| Bulb | 0 |
| Endosphere | 6.48 |
| Nodule | 0 |
| Rhizoplane | 7.05 |
| Rhizosphere | 72.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307414_10147875 | 3300032004 | Bacteria | 1849 |
| 2 | JGI24739J22299_10073607 | 3300001989 | Bacteria | 1060 |
| 3 | JGI24743J22301_10010175 | 3300001991 | Bacteria | 1675 |
| 4 | JGI24735J21928_10084376 | 3300002067 | Bacteria | 910 |
| 5 | JGI25154J39366_1001284 | 3300002738 | Bacteria | 9360 |
| 6 | Ga0006778J45830_1015710 | 3300003162 | Bacteria | 568 |
| 7 | JGI25407J50210_10045377 | 3300003373 | Bacteria | 1120 |
| 8 | JGI25407J50210_10190372 | 3300003373 | Bacteria | 506 |
| 9 | Ga0007417J51691_1012460 | 3300003544 | Bacteria | 776 |
| 10 | Ga0007427J51700_111594 | 3300003559 | Bacteria | 664 |
| 11 | Ga0007410J51695_1024883 | 3300003574 | Bacteria | 564 |
| 12 | Ga0007410J51695_1028109 | 3300003574 | Bacteria | 537 |
| 13 | Ga0006562J51391_1077031 | 3300003578 | Bacteria | 636 |
| 14 | Ga0032354_1026694 | 3300003693 | Bacteria | 557 |
| 15 | Ga0055542_1006658 | 3300003762 | Bacteria | 2442 |
| 16 | Ga0058858_1426826 | 3300004785 | Bacteria | 719 |
| 17 | Ga0058859_11241572 | 3300004798 | Bacteria | 678 |
| 18 | Ga0058863_11633219 | 3300004799 | Bacteria | 722 |
| 19 | Ga0058861_11584081 | 3300004800 | Bacteria | 798 |
| 20 | Ga0058860_12151711 | 3300004801 | Bacteria | 837 |
| 21 | Ga0065715_10795225 | 3300005293 | Bacteria | 607 |
| 22 | Ga0070658_10029253 | 3300005327 | Bacteria | 4426 |
| 23 | Ga0070658_10047629 | 3300005327 | Bacteria | 3469 |
| 24 | Ga0070658_10069192 | 3300005327 | Bacteria | 2887 |
| 25 | Ga0070677_10882910 | 3300005333 | Bacteria | 516 |
| 26 | Ga0068869_100115301 | 3300005334 | Bacteria | 2048 |
| 27 | Ga0070682_100259104 | 3300005337 | Bacteria | 1258 |
| 28 | Ga0070682_100570786 | 3300005337 | Bacteria | 888 |
| 29 | Ga0068868_100150079 | 3300005338 | Bacteria | 1919 |
| 30 | Ga0070660_100596074 | 3300005339 | Bacteria | 924 |
| 31 | Ga0070660_100831217 | 3300005339 | Bacteria | 777 |
| 32 | Ga0070687_100394995 | 3300005343 | Bacteria | 905 |
| 33 | Ga0070661_100023380 | 3300005344 | Bacteria | 4429 |
| 34 | Ga0070661_100067572 | 3300005344 | Bacteria | 2627 |
| 35 | Ga0070668_100483203 | 3300005347 | Bacteria | 1070 |
| 36 | Ga0070668_100770527 | 3300005347 | Bacteria | 853 |
| 37 | Ga0070671_100207927 | 3300005355 | Bacteria | 1660 |
| 38 | Ga0070674_100407309 | 3300005356 | Bacteria | 1113 |
| 39 | Ga0070674_100796350 | 3300005356 | Bacteria | 816 |
| 40 | Ga0070688_100167655 | 3300005365 | Bacteria | 1513 |
| 41 | Ga0070659_100013488 | 3300005366 | Bacteria | 6082 |
| 42 | Ga0070667_100096421 | 3300005367 | Bacteria | 2550 |
| 43 | Ga0070667_100181210 | 3300005367 | Bacteria | 1863 |
| 44 | Ga0070667_100587386 | 3300005367 | Bacteria | 1026 |
| 45 | Ga0070713_100193100 | 3300005436 | Bacteria | 1836 |
| 46 | Ga0070700_100858929 | 3300005441 | Bacteria | 735 |
| 47 | Ga0070663_100255275 | 3300005455 | Bacteria | 1389 |
| 48 | Ga0070663_100300989 | 3300005455 | Bacteria | 1284 |
| 49 | Ga0070663_100393866 | 3300005455 | Bacteria | 1131 |
| 50 | Ga0070663_101184557 | 3300005455 | Bacteria | 671 |
| 51 | Ga0070678_100231487 | 3300005456 | Bacteria | 1541 |
| 52 | Ga0070662_100789224 | 3300005457 | Bacteria | 807 |
| 53 | Ga0070662_101528167 | 3300005457 | Bacteria | 576 |
| 54 | Ga0070681_10546975 | 3300005458 | Bacteria | 1071 |
| 55 | Ga0070681_10850130 | 3300005458 | Bacteria | 830 |
| 56 | Ga0070685_10047048 | 3300005466 | Bacteria | 2479 |
| 57 | Ga0070685_10559517 | 3300005466 | Bacteria | 817 |
| 58 | Ga0070706_101630657 | 3300005467 | Bacteria | 588 |
| 59 | Ga0070679_101993241 | 3300005530 | Bacteria | 530 |
| 60 | Ga0070697_100121856 | 3300005536 | Bacteria | 2182 |
| 61 | Ga0068853_100028090 | 3300005539 | Bacteria | 4731 |
| 62 | Ga0068853_100052946 | 3300005539 | Bacteria | 3495 |
| 63 | Ga0068853_102058853 | 3300005539 | Bacteria | 553 |
| 64 | Ga0068853_102248699 | 3300005539 | Bacteria | 528 |
| 65 | Ga0070672_100207081 | 3300005543 | Bacteria | 1642 |
| 66 | Ga0070695_100147064 | 3300005545 | Bacteria | 1640 |
| 67 | Ga0070696_100044500 | 3300005546 | Bacteria | 3073 |
| 68 | Ga0070693_100150524 | 3300005547 | Bacteria | 1473 |
| 69 | Ga0070665_100027879 | 3300005548 | Bacteria | 5687 |
| 70 | Ga0070704_100119640 | 3300005549 | Bacteria | 2020 |
| 71 | Ga0068855_100030427 | 3300005563 | Bacteria | 6458 |
| 72 | Ga0068855_100031330 | 3300005563 | Bacteria | 6350 |
| 73 | Ga0068855_100056300 | 3300005563 | Bacteria | 4615 |
| 74 | Ga0068855_100501765 | 3300005563 | Bacteria | 1318 |
| 75 | Ga0070664_100683268 | 3300005564 | Bacteria | 955 |
| 76 | Ga0068857_100021798 | 3300005577 | Bacteria | 5639 |
| 77 | Ga0068857_100249321 | 3300005577 | Bacteria | 1627 |
| 78 | Ga0068854_100102323 | 3300005578 | Bacteria | 2149 |
| 79 | Ga0068854_100405067 | 3300005578 | Bacteria | 1130 |
| 80 | Ga0068854_100660295 | 3300005578 | Bacteria | 899 |
| 81 | Ga0068856_100344429 | 3300005614 | Bacteria | 1509 |
| 82 | Ga0068856_101781922 | 3300005614 | Bacteria | 627 |
| 83 | Ga0068856_101823740 | 3300005614 | Bacteria | 620 |
| 84 | Ga0068856_102531017 | 3300005614 | Bacteria | 520 |
| 85 | Ga0070702_101405681 | 3300005615 | Bacteria | 571 |
| 86 | Ga0068852_100017671 | 3300005616 | Bacteria | 5601 |
| 87 | Ga0068852_100066070 | 3300005616 | Bacteria | 3158 |
| 88 | Ga0068859_100052312 | 3300005617 | Bacteria | 4106 |
| 89 | Ga0068864_100148152 | 3300005618 | Bacteria | 2123 |
| 90 | Ga0068851_10000174 | 3300005834 | Bacteria | 32729 |
| 91 | Ga0068870_11008324 | 3300005840 | Bacteria | 594 |
| 92 | Ga0068870_11415049 | 3300005840 | Bacteria | 510 |
| 93 | Ga0068863_100056137 | 3300005841 | Bacteria | 3728 |
| 94 | Ga0068863_100252035 | 3300005841 | Bacteria | 1705 |
| 95 | Ga0068863_101873710 | 3300005841 | Bacteria | 610 |
| 96 | Ga0068860_100001180 | 3300005843 | Bacteria | 28624 |
| 97 | Ga0068860_100086873 | 3300005843 | Bacteria | 2977 |
| 98 | Ga0068860_100424812 | 3300005843 | Bacteria | 1318 |
| 99 | Ga0081455_10003134 | 3300005937 | Bacteria | 19237 |
| 100 | Ga0081455_10014161 | 3300005937 | Bacteria | 7835 |
| 101 | Ga0081538_10000991 | 3300005981 | Bacteria | 30132 |
| 102 | Ga0081538_10048190 | 3300005981 | Bacteria | 2602 |
| 103 | Ga0070717_10109999 | 3300006028 | Bacteria | 2349 |
| 104 | Ga0070717_10887028 | 3300006028 | Bacteria | 812 |
| 105 | Ga0075365_10111041 | 3300006038 | Bacteria | 1884 |
| 106 | Ga0075365_10262019 | 3300006038 | Bacteria | 1215 |
| 107 | Ga0075365_10579281 | 3300006038 | Bacteria | 794 |
| 108 | Ga0075368_10101365 | 3300006042 | Bacteria | 1182 |
| 109 | Ga0075368_10359718 | 3300006042 | Bacteria | 635 |
| 110 | Ga0075363_100011874 | 3300006048 | Bacteria | 4183 |
| 111 | Ga0075363_100272113 | 3300006048 | Bacteria | 978 |
| 112 | Ga0075363_100990878 | 3300006048 | Bacteria | 517 |
| 113 | Ga0075364_10028577 | 3300006051 | Bacteria | 3570 |
| 114 | Ga0075364_10217284 | 3300006051 | Bacteria | 1296 |
| 115 | Ga0075364_10759428 | 3300006051 | Bacteria | 661 |
| 116 | Ga0070715_10828491 | 3300006163 | Bacteria | 564 |
| 117 | Ga0070716_101514141 | 3300006173 | Bacteria | 549 |
| 118 | Ga0075367_10000695 | 3300006178 | Bacteria | 12946 |
| 119 | Ga0075367_10192528 | 3300006178 | Bacteria | 1272 |
| 120 | Ga0075369_10000991 | 3300006186 | Bacteria | 9469 |
| 121 | Ga0075369_10013993 | 3300006186 | Bacteria | 3197 |
| 122 | Ga0075369_10639133 | 3300006186 | Bacteria | 511 |
| 123 | Ga0075366_10569042 | 3300006195 | Bacteria | 702 |
| 124 | Ga0097621_101678718 | 3300006237 | Bacteria | 605 |
| 125 | Ga0075370_10004480 | 3300006353 | Bacteria | 6789 |
| 126 | Ga0075370_10188480 | 3300006353 | Bacteria | 1215 |
| 127 | Ga0075370_10504242 | 3300006353 | Bacteria | 730 |
| 128 | Ga0075370_10819922 | 3300006353 | Bacteria | 568 |
| 129 | Ga0068865_101940892 | 3300006881 | Bacteria | 534 |
| 130 | Ga0097620_100052313 | 3300006931 | Bacteria | 4106 |
| 131 | Ga0105251_10087257 | 3300009011 | Bacteria | 1436 |
| 132 | Ga0105251_10257942 | 3300009011 | Bacteria | 786 |
| 133 | Ga0105244_10056209 | 3300009036 | Bacteria | 1993 |
| 134 | Ga0105244_10102657 | 3300009036 | Bacteria | 1397 |
| 135 | Ga0105240_10005074 | 3300009093 | Bacteria | 19737 |
| 136 | Ga0105240_10078100 | 3300009093 | Bacteria | 4077 |
| 137 | Ga0105240_11267102 | 3300009093 | Bacteria | 779 |
| 138 | Ga0105240_11791100 | 3300009093 | Bacteria | 640 |
| 139 | Ga0111539_11700456 | 3300009094 | Bacteria | 732 |
| 140 | Ga0105245_10032365 | 3300009098 | Bacteria | 4629 |
| 141 | Ga0105247_10377835 | 3300009101 | Bacteria | 1004 |
| 142 | Ga0105247_11733047 | 3300009101 | Bacteria | 518 |
| 143 | Ga0105243_11176410 | 3300009148 | Bacteria | 779 |
| 144 | Ga0105241_10010709 | 3300009174 | Bacteria | 6729 |
| 145 | Ga0105241_10320648 | 3300009174 | Bacteria | 1336 |
| 146 | Ga0105241_10345131 | 3300009174 | Bacteria | 1291 |
| 147 | Ga0105241_10902309 | 3300009174 | Bacteria | 821 |
| 148 | Ga0105242_10703009 | 3300009176 | Bacteria | 989 |
| 149 | Ga0105237_10000660 | 3300009545 | Bacteria | 47919 |
| 150 | Ga0105237_10061574 | 3300009545 | Bacteria | 3752 |
| 151 | Ga0105237_10108611 | 3300009545 | Bacteria | 2766 |
| 152 | Ga0105237_10182819 | 3300009545 | Bacteria | 2096 |
| 153 | Ga0105237_11649273 | 3300009545 | Bacteria | 648 |
| 154 | Ga0105238_10006538 | 3300009551 | Bacteria | 11608 |
| 155 | Ga0105238_10141262 | 3300009551 | Bacteria | 2385 |
| 156 | Ga0105249_12375663 | 3300009553 | Bacteria | 603 |
| 157 | Ga0105030_113292 | 3300009987 | Bacteria | 719 |
| 158 | Ga0105239_10230657 | 3300010375 | Bacteria | 2077 |
| 159 | Ga0105239_10627199 | 3300010375 | Bacteria | 1227 |
| 160 | Ga0105239_11108833 | 3300010375 | Bacteria | 911 |
| 161 | Ga0105246_10092415 | 3300011119 | Bacteria | 2183 |
| 162 | Ga0105246_10734437 | 3300011119 | Bacteria | 869 |
| 163 | Ga0157328_1005549 | 3300012478 | Bacteria | 741 |
| 164 | Ga0157342_1068135 | 3300012507 | Bacteria | 536 |
| 165 | Ga0157370_10032625 | 3300013104 | Bacteria | 5084 |
| 166 | Ga0157370_10056334 | 3300013104 | Bacteria | 3741 |
| 167 | Ga0157370_10312667 | 3300013104 | Bacteria | 1449 |
| 168 | Ga0157369_10042192 | 3300013105 | Bacteria | 4977 |
| 169 | Ga0157369_10330001 | 3300013105 | Bacteria | 1585 |
| 170 | Ga0157369_10488439 | 3300013105 | Bacteria | 1274 |
| 171 | Ga0157369_10751155 | 3300013105 | Bacteria | 1003 |
| 172 | Ga0157369_10906875 | 3300013105 | Bacteria | 904 |
| 173 | Ga0171462_1003 | 3300013250 | Bacteria | 853796 |
| 174 | Ga0157374_11406583 | 3300013296 | Bacteria | 720 |
| 175 | Ga0157374_11948036 | 3300013296 | Bacteria | 614 |
| 176 | Ga0163162_10010190 | 3300013306 | Bacteria | 9129 |
| 177 | Ga0163162_10140160 | 3300013306 | Bacteria | 2531 |
| 178 | Ga0163162_10425353 | 3300013306 | Bacteria | 1460 |
| 179 | Ga0163162_11130635 | 3300013306 | Bacteria | 888 |
| 180 | Ga0157372_10716384 | 3300013307 | Bacteria | 1164 |
| 181 | Ga0157372_11232771 | 3300013307 | Bacteria | 864 |
| 182 | Ga0157372_11595936 | 3300013307 | Bacteria | 751 |
| 183 | Ga0157375_11348787 | 3300013308 | Bacteria | 839 |
| 184 | Ga0157375_11617684 | 3300013308 | Bacteria | 766 |
| 185 | Ga0163163_10027908 | 3300014325 | Bacteria | 5412 |
| 186 | Ga0157380_10027310 | 3300014326 | Bacteria | 4340 |
| 187 | Ga0157380_11512147 | 3300014326 | Bacteria | 725 |
| 188 | Ga0157380_13187689 | 3300014326 | Bacteria | 524 |
| 189 | Ga0157377_10132403 | 3300014745 | Bacteria | 1525 |
| 190 | Ga0157377_10663261 | 3300014745 | Bacteria | 752 |
| 191 | Ga0157379_10017319 | 3300014968 | Bacteria | 6349 |
| 192 | Ga0157379_10023926 | 3300014968 | Bacteria | 5422 |
| 193 | Ga0157379_12544100 | 3300014968 | Bacteria | 512 |
| 194 | Ga0157376_10365935 | 3300014969 | Bacteria | 1384 |
| 195 | Ga0157376_10510567 | 3300014969 | Bacteria | 1183 |
| 196 | Ga0157376_11190019 | 3300014969 | Bacteria | 790 |
| 197 | Ga0163161_10754691 | 3300017792 | Bacteria | 814 |
| 198 | Ga0197907_10326987 | 3300020069 | Bacteria | 677 |
| 199 | Ga0197907_10854447 | 3300020069 | Bacteria | 872 |
| 200 | Ga0197907_10912036 | 3300020069 | Bacteria | 741 |
| 201 | Ga0197907_10935291 | 3300020069 | Bacteria | 679 |
| 202 | Ga0206356_10978583 | 3300020070 | Bacteria | 780 |
| 203 | Ga0206356_11078444 | 3300020070 | Bacteria | 701 |
| 204 | Ga0206356_11307403 | 3300020070 | Bacteria | 1172 |
| 205 | Ga0206356_11376106 | 3300020070 | Bacteria | 1124 |
| 206 | Ga0206348_109438 | 3300020071 | Bacteria | 661 |
| 207 | Ga0206349_1061883 | 3300020075 | Bacteria | 770 |
| 208 | Ga0206349_1634353 | 3300020075 | Bacteria | 1044 |
| 209 | Ga0206349_1930185 | 3300020075 | Bacteria | 1379 |
| 210 | Ga0206355_1014107 | 3300020076 | Bacteria | 723 |
| 211 | Ga0206355_1167418 | 3300020076 | Bacteria | 808 |
| 212 | Ga0206355_1276013 | 3300020076 | Bacteria | 1622 |
| 213 | Ga0206355_1492312 | 3300020076 | Bacteria | 538 |
| 214 | Ga0206355_1665678 | 3300020076 | Bacteria | 836 |
| 215 | Ga0206355_1716449 | 3300020076 | Bacteria | 578 |
| 216 | Ga0206351_10093022 | 3300020077 | Bacteria | 792 |
| 217 | Ga0206351_10773028 | 3300020077 | Bacteria | 716 |
| 218 | Ga0206351_10924608 | 3300020077 | Bacteria | 635 |
| 219 | Ga0206352_10090527 | 3300020078 | Bacteria | 728 |
| 220 | Ga0206352_10675540 | 3300020078 | Bacteria | 1079 |
| 221 | Ga0206352_10998634 | 3300020078 | Bacteria | 843 |
| 222 | Ga0206350_10430210 | 3300020080 | Bacteria | 824 |
| 223 | Ga0206350_11165638 | 3300020080 | Bacteria | 692 |
| 224 | Ga0206350_11217244 | 3300020080 | Bacteria | 958 |
| 225 | Ga0206350_11364143 | 3300020080 | Bacteria | 733 |
| 226 | Ga0206350_11438219 | 3300020080 | Bacteria | 718 |
| 227 | Ga0206354_10160236 | 3300020081 | Bacteria | 1036 |
| 228 | Ga0206354_10402436 | 3300020081 | Bacteria | 685 |
| 229 | Ga0206354_10565015 | 3300020081 | Bacteria | 849 |
| 230 | Ga0206354_10694027 | 3300020081 | Bacteria | 510 |
| 231 | Ga0206354_11544819 | 3300020081 | Bacteria | 644 |
| 232 | Ga0206353_10903616 | 3300020082 | Bacteria | 510 |
| 233 | Ga0206353_11635006 | 3300020082 | Bacteria | 925 |
| 234 | Ga0154015_1053277 | 3300020610 | Bacteria | 973 |
| 235 | Ga0154015_1157237 | 3300020610 | Bacteria | 615 |
| 236 | Ga0154015_1239016 | 3300020610 | Bacteria | 839 |
| 237 | Ga0154015_1250307 | 3300020610 | Bacteria | 1094 |
| 238 | Ga0154015_1266277 | 3300020610 | Bacteria | 571 |
| 239 | Ga0154015_1310473 | 3300020610 | Bacteria | 688 |
| 240 | Ga0154015_1416389 | 3300020610 | Bacteria | 584 |
| 241 | Ga0213872_10356248 | 3300021361 | Bacteria | 599 |
| 242 | Ga0224712_10148613 | 3300022467 | Bacteria | 1036 |
| 243 | Ga0224712_10189565 | 3300022467 | Bacteria | 930 |
| 244 | Ga0224712_10352643 | 3300022467 | Bacteria | 695 |
| 245 | Ga0224712_10369055 | 3300022467 | Bacteria | 680 |
| 246 | Ga0224712_10369422 | 3300022467 | Bacteria | 680 |
| 247 | Ga0209646_1000071 | 3300025246 | Bacteria | 228702 |
| 248 | Ga0209148_1000624 | 3300025254 | Bacteria | 31386 |
| 249 | Ga0207656_10000002 | 3300025321 | Bacteria | 792178 |
| 250 | Ga0207655_1003360 | 3300025728 | Bacteria | 11974 |
| 251 | Ga0207713_1099531 | 3300025735 | Bacteria | 1006 |
| 252 | Ga0207682_10470612 | 3300025893 | Bacteria | 595 |
| 253 | Ga0207692_10028262 | 3300025898 | Bacteria | 2650 |
| 254 | Ga0207710_10032300 | 3300025900 | Bacteria | 2293 |
| 255 | Ga0207710_10169267 | 3300025900 | Bacteria | 1068 |
| 256 | Ga0207710_10257946 | 3300025900 | Bacteria | 873 |
| 257 | Ga0207685_10807095 | 3300025905 | Bacteria | 517 |
| 258 | Ga0207643_10464632 | 3300025908 | Bacteria | 806 |
| 259 | Ga0207643_10926238 | 3300025908 | Bacteria | 564 |
| 260 | Ga0207705_10054040 | 3300025909 | Bacteria | 2895 |
| 261 | Ga0207705_10426787 | 3300025909 | Bacteria | 1027 |
| 262 | Ga0207705_11112833 | 3300025909 | Bacteria | 608 |
| 263 | Ga0207684_11283800 | 3300025910 | Bacteria | 603 |
| 264 | Ga0207654_10000001 | 3300025911 | Bacteria | 1816198 |
| 265 | Ga0207654_11260105 | 3300025911 | Bacteria | 539 |
| 266 | Ga0207707_11371392 | 3300025912 | Bacteria | 565 |
| 267 | Ga0207695_10021351 | 3300025913 | Bacteria | 7388 |
| 268 | Ga0207695_10022892 | 3300025913 | Bacteria | 7077 |
| 269 | Ga0207695_10173790 | 3300025913 | Bacteria | 2078 |
| 270 | Ga0207695_10720620 | 3300025913 | Bacteria | 878 |
| 271 | Ga0207671_10000002 | 3300025914 | Bacteria | 1144816 |
| 272 | Ga0207671_10044467 | 3300025914 | Bacteria | 3284 |
| 273 | Ga0207693_10033430 | 3300025915 | Bacteria | 4058 |
| 274 | Ga0207663_10321275 | 3300025916 | Bacteria | 1163 |
| 275 | Ga0207660_11139543 | 3300025917 | Bacteria | 635 |
| 276 | Ga0207660_11169074 | 3300025917 | Bacteria | 626 |
| 277 | Ga0207662_10251634 | 3300025918 | Bacteria | 1160 |
| 278 | Ga0207662_11299709 | 3300025918 | Bacteria | 517 |
| 279 | Ga0207657_10010777 | 3300025919 | Bacteria | 9101 |
| 280 | Ga0207657_11379855 | 3300025919 | Bacteria | 530 |
| 281 | Ga0207649_10032826 | 3300025920 | Bacteria | 3097 |
| 282 | Ga0207652_11793600 | 3300025921 | Bacteria | 519 |
| 283 | Ga0207694_10000153 | 3300025924 | Bacteria | 71753 |
| 284 | Ga0207694_10040322 | 3300025924 | Bacteria | 3594 |
| 285 | Ga0207694_10084470 | 3300025924 | Bacteria | 2497 |
| 286 | Ga0207650_10831746 | 3300025925 | Bacteria | 783 |
| 287 | Ga0207659_10906264 | 3300025926 | Bacteria | 758 |
| 288 | Ga0207687_10020899 | 3300025927 | Bacteria | 4345 |
| 289 | Ga0207687_10029146 | 3300025927 | Bacteria | 3711 |
| 290 | Ga0207700_10356705 | 3300025928 | Bacteria | 1274 |
| 291 | Ga0207700_10976598 | 3300025928 | Bacteria | 758 |
| 292 | Ga0207664_10393745 | 3300025929 | Bacteria | 1231 |
| 293 | Ga0207664_11170215 | 3300025929 | Bacteria | 686 |
| 294 | Ga0207644_10119010 | 3300025931 | Bacteria | 2008 |
| 295 | Ga0207690_10020759 | 3300025932 | Bacteria | 4063 |
| 296 | Ga0207686_10863071 | 3300025934 | Bacteria | 729 |
| 297 | Ga0207709_10885638 | 3300025935 | Bacteria | 725 |
| 298 | Ga0207709_11013473 | 3300025935 | Bacteria | 679 |
| 299 | Ga0207669_10657570 | 3300025937 | Bacteria | 858 |
| 300 | Ga0207704_10853159 | 3300025938 | Bacteria | 763 |
| 301 | Ga0207691_10217438 | 3300025940 | Bacteria | 1658 |
| 302 | Ga0207691_10881571 | 3300025940 | Bacteria | 750 |
| 303 | Ga0207711_10063716 | 3300025941 | Bacteria | 3183 |
| 304 | Ga0207711_10260653 | 3300025941 | Bacteria | 1593 |
| 305 | Ga0207667_10054976 | 3300025949 | Bacteria | 4186 |
| 306 | Ga0207667_10110945 | 3300025949 | Bacteria | 2829 |
| 307 | Ga0207667_10189711 | 3300025949 | Bacteria | 2109 |
| 308 | Ga0207667_10266651 | 3300025949 | Bacteria | 1751 |
| 309 | Ga0207667_10483383 | 3300025949 | Bacteria | 1257 |
| 310 | Ga0207667_11098447 | 3300025949 | Bacteria | 779 |
| 311 | Ga0207651_10300070 | 3300025960 | Bacteria | 1335 |
| 312 | Ga0207668_10858252 | 3300025972 | Bacteria | 806 |
| 313 | Ga0207668_11187525 | 3300025972 | Bacteria | 685 |
| 314 | Ga0207640_10433669 | 3300025981 | Bacteria | 1079 |
| 315 | Ga0207658_10020806 | 3300025986 | Bacteria | 4545 |
| 316 | Ga0207658_10380954 | 3300025986 | Bacteria | 1235 |
| 317 | Ga0207658_10491206 | 3300025986 | Bacteria | 1092 |
| 318 | Ga0207677_10020605 | 3300026023 | Bacteria | 4007 |
| 319 | Ga0207677_10079415 | 3300026023 | Bacteria | 2346 |
| 320 | Ga0207677_10124572 | 3300026023 | Bacteria | 1945 |
| 321 | Ga0207703_10000031 | 3300026035 | Bacteria | 196940 |
| 322 | Ga0207703_10248429 | 3300026035 | Bacteria | 1602 |
| 323 | Ga0207639_10022174 | 3300026041 | Bacteria | 4572 |
| 324 | Ga0207678_10001249 | 3300026067 | Bacteria | 23448 |
| 325 | Ga0207678_10450075 | 3300026067 | Bacteria | 1119 |
| 326 | Ga0207678_10623151 | 3300026067 | Bacteria | 947 |
| 327 | Ga0207708_10424430 | 3300026075 | Bacteria | 1103 |
| 328 | Ga0207702_10053773 | 3300026078 | Bacteria | 3410 |
| 329 | Ga0207702_10093978 | 3300026078 | Bacteria | 2631 |
| 330 | Ga0207702_10354150 | 3300026078 | Bacteria | 1405 |
| 331 | Ga0207641_10044128 | 3300026088 | Bacteria | 3748 |
| 332 | Ga0207641_10253188 | 3300026088 | Bacteria | 1645 |
| 333 | Ga0207641_12452901 | 3300026088 | Bacteria | 520 |
| 334 | Ga0207648_12021970 | 3300026089 | Bacteria | 537 |
| 335 | Ga0207676_10107667 | 3300026095 | Bacteria | 2325 |
| 336 | Ga0207674_10059775 | 3300026116 | Bacteria | 3856 |
| 337 | Ga0207674_10229669 | 3300026116 | Bacteria | 1803 |
| 338 | Ga0207683_10021780 | 3300026121 | Bacteria | 5494 |
| 339 | Ga0207683_10128823 | 3300026121 | Bacteria | 2275 |
| 340 | Ga0207698_10140748 | 3300026142 | Bacteria | 2078 |
| 341 | Ga0207698_10640032 | 3300026142 | Bacteria | 1052 |
| 342 | Ga0209813_10136791 | 3300027866 | Bacteria | 866 |
| 343 | Ga0209813_10482102 | 3300027866 | Bacteria | 512 |
| 344 | Ga0268266_10087579 | 3300028379 | Bacteria | 2725 |
| 345 | Ga0268266_10306749 | 3300028379 | Bacteria | 1482 |
| 346 | Ga0268266_11383849 | 3300028379 | Bacteria | 679 |
| 347 | Ga0268265_10884593 | 3300028380 | Bacteria | 876 |
| 348 | Ga0268264_10000987 | 3300028381 | Bacteria | 29098 |
| 349 | Ga0268264_10137202 | 3300028381 | Bacteria | 2176 |
| 350 | Ga0268264_10511587 | 3300028381 | Bacteria | 1172 |
| 351 | Ga0268264_11402415 | 3300028381 | Bacteria | 709 |
| 352 | Ga0265334_10007622 | 3300028573 | Bacteria | 4637 |
| 353 | Ga0307515_10446720 | 3300028794 | Bacteria | 909 |
| 354 | Ga0307515_10483612 | 3300028794 | Bacteria | 850 |
| 355 | Ga0307511_10316414 | 3300030521 | Bacteria | 693 |
| 356 | Ga0314311_1122579 | 3300030733 | Bacteria | 927 |
| 357 | Ga0316181_1252750 | 3300030744 | Bacteria | 1754 |
| 358 | Ga0316182_1109466 | 3300030745 | Bacteria | 3392 |
| 359 | Ga0307513_10907350 | 3300031456 | Bacteria | 589 |
| 360 | Ga0307509_10536258 | 3300031507 | Bacteria | 850 |
| 361 | Ga0307408_100270314 | 3300031548 | Bacteria | 1411 |
| 362 | Ga0307408_101175431 | 3300031548 | Bacteria | 715 |
| 363 | Ga0307514_10383541 | 3300031649 | Bacteria | 728 |
| 364 | Ga0316575_10002481 | 3300031665 | Bacteria | 6207 |
| 365 | Ga0316579_10030946 | 3300031691 | Bacteria | 2447 |
| 366 | Ga0316579_10079621 | 3300031691 | Bacteria | 1559 |
| 367 | Ga0316579_10121107 | 3300031691 | Bacteria | 1257 |
| 368 | Ga0316576_10006347 | 3300031727 | Bacteria | 7349 |
| 369 | Ga0316576_10039257 | 3300031727 | Bacteria | 3397 |
| 370 | Ga0316576_10046810 | 3300031727 | Bacteria | 3132 |
| 371 | Ga0316576_10083058 | 3300031727 | Bacteria | 2379 |
| 372 | Ga0316578_10025525 | 3300031728 | Bacteria | 3323 |
| 373 | Ga0316578_10040601 | 3300031728 | Bacteria | 2691 |
| 374 | Ga0316578_10050930 | 3300031728 | Bacteria | 2424 |
| 375 | Ga0307405_10579826 | 3300031731 | Bacteria | 912 |
| 376 | Ga0307405_11055901 | 3300031731 | Bacteria | 696 |
| 377 | Ga0307405_11752215 | 3300031731 | Bacteria | 551 |
| 378 | Ga0307405_11761025 | 3300031731 | Bacteria | 550 |
| 379 | Ga0316577_10037186 | 3300031733 | Bacteria | 2722 |
| 380 | Ga0316577_10150171 | 3300031733 | Bacteria | 1313 |
| 381 | Ga0316577_10303288 | 3300031733 | Bacteria | 905 |
| 382 | Ga0307413_10352090 | 3300031824 | Bacteria | 1137 |
| 383 | Ga0307410_10099134 | 3300031852 | Bacteria | 2085 |
| 384 | Ga0307410_10852134 | 3300031852 | Bacteria | 778 |
| 385 | Ga0307410_11872070 | 3300031852 | Bacteria | 534 |
| 386 | Ga0307406_10014155 | 3300031901 | Bacteria | 4584 |
| 387 | Ga0307406_10492598 | 3300031901 | Bacteria | 992 |
| 388 | Ga0307406_10983925 | 3300031901 | Bacteria | 723 |
| 389 | Ga0307407_10031786 | 3300031903 | Bacteria | 2863 |
| 390 | Ga0307407_10485365 | 3300031903 | Bacteria | 903 |
| 391 | Ga0307412_10226887 | 3300031911 | Bacteria | 1436 |
| 392 | Ga0307409_100039407 | 3300031995 | Bacteria | 3506 |
| 393 | Ga0307409_100114010 | 3300031995 | Bacteria | 2273 |
| 394 | Ga0307409_100455060 | 3300031995 | Bacteria | 1236 |
| 395 | Ga0307416_100114623 | 3300032002 | Bacteria | 2385 |
| 396 | Ga0307416_100284593 | 3300032002 | Bacteria | 1632 |
| 397 | Ga0307416_101076555 | 3300032002 | Bacteria | 908 |
| 398 | Ga0307414_11262500 | 3300032004 | Bacteria | 685 |
| 399 | Ga0307414_12025678 | 3300032004 | Bacteria | 537 |
| 400 | Ga0307411_10276741 | 3300032005 | Bacteria | 1334 |
| 401 | Ga0307415_100393359 | 3300032126 | Bacteria | 1181 |
| 402 | Ga0316583_10006503 | 3300032133 | Bacteria | 4197 |
| 403 | Ga0316583_10157169 | 3300032133 | Bacteria | 791 |
| 404 | Ga0316585_10008208 | 3300032137 | Bacteria | 3024 |
| 405 | Ga0316580_10037842 | 3300032139 | Bacteria | 1491 |
| 406 | Ga0316580_10083811 | 3300032139 | Bacteria | 975 |
| 407 | Ga0316593_10004078 | 3300032168 | Bacteria | 3705 |
| 408 | Ga0316593_10036808 | 3300032168 | Bacteria | 1615 |
| 409 | Ga0316593_10116587 | 3300032168 | Bacteria | 956 |
| 410 | Ga0316592_1040494 | 3300033524 | Bacteria | 1030 |
| 411 | Ga0316592_1100203 | 3300033524 | Bacteria | 666 |
| 412 | Ga0316586_1059785 | 3300033527 | Bacteria | 691 |
| 413 | Ga0316588_1066174 | 3300033528 | Bacteria | 885 |
| 414 | Ga0316588_1143549 | 3300033528 | Bacteria | 611 |
| 415 | Ga0316588_1157459 | 3300033528 | Bacteria | 584 |
| 416 | Ga0316596_1000246 | 3300033541 | Bacteria | 8300 |
| 417 | Ga0316596_1030137 | 3300033541 | Bacteria | 1406 |
| 418 | Ga0316596_1070862 | 3300033541 | Bacteria | 933 |
| 419 | Ga0316596_1185114 | 3300033541 | Bacteria | 577 |
| 420 | Ga0316596_1202893 | 3300033541 | Unclassified | 552 |
| 421 | Ga0316574_0009952 | 3300035398 | Bacteria | 5350 |
| 422 | Ga0316574_0030284 | 3300035398 | Bacteria | 3276 |
| 423 | Ga0316574_0136834 | 3300035398 | Bacteria | 1577 |
| 424 | Ga0316574_0170914 | 3300035398 | Bacteria | 1399 |
| 425 | Ga0316582_0299072 | 3300036647 | Bacteria | 1105 |
| 426 | Ga0316582_0442099 | 3300036647 | Bacteria | 896 |
| 427 | Ga0316582_0673026 | 3300036647 | Bacteria | 711 |
| 428 | Ga0316584_0001267 | 3300036712 | Bacteria | 14951 |
| 429 | Ga0316584_0045469 | 3300036712 | Bacteria | 3277 |
| 430 | Ga0316584_0080072 | 3300036712 | Bacteria | 2447 |
| 431 | Ga0316584_0950130 | 3300036712 | Bacteria | 576 |
| 432 | Ga0395899_0381370 | 3300037312 | Bacteria | 937 |
| 433 | Ga0395900_0017198 | 3300037418 | Bacteria | 7380 |
| 434 | Ga0395900_0127340 | 3300037418 | Bacteria | 2611 |
| 435 | Ga0395900_1424141 | 3300037418 | Bacteria | 606 |
| 436 | Ga0395900_1502563 | 3300037418 | Bacteria | 586 |
| 437 | Ga0395898_0287877 | 3300037466 | Bacteria | 1567 |
| 438 | Ga0395898_0346737 | 3300037466 | Bacteria | 1416 |
| 439 | Ga0395898_1424394 | 3300037466 | Bacteria | 620 |
| 440 | Ga0395898_1907993 | 3300037466 | Bacteria | 514 |
| 441 | Ga0316581_0000149 | 3300037588 | Bacteria | 10812 |
| 442 | Ga0395901_0778705 | 3300038443 | Bacteria | 947 |
| 443 | Ga0400485_19729 | 3300038735 | Bacteria | 13426 |
| 444 | Ga0400486_32646 | 3300038742 | Bacteria | 15037 |
| 445 | Ga0400489_87014 | 3300039093 | Bacteria | 1317 |
| 446 | Ga0436365_1513875 | 3300039437 | Bacteria | 1120 |
| 447 | Ga0436361_0965496 | 3300039447 | Bacteria | 1300 |
| 448 | Ga0436362_1249237 | 3300039453 | Bacteria | 570 |
| 449 | Ga0439439_0110793 | 3300041406 | Bacteria | 761 |
| 450 | Ga0439466_0114319 | 3300041411 | Bacteria | 836 |
| 451 | Ga0439466_0161318 | 3300041411 | Bacteria | 686 |
| 452 | Ga0439465_0048243 | 3300041413 | Bacteria | 1389 |
| 453 | Ga0439465_0090100 | 3300041413 | Bacteria | 1048 |
| 454 | Ga0439465_0123823 | 3300041413 | Bacteria | 908 |
| 455 | Ga0451789_0231381 | 3300041443 | Bacteria | 669 |
| 456 | Ga0451789_0396782 | 3300041443 | Bacteria | 1311 |
| 457 | Ga0451790_30891 | 3300041444 | Bacteria | 581 |
| 458 | Ga0451796_10591 | 3300041450 | Bacteria | 716 |
| 459 | Ga0451793_0715769 | 3300041452 | Bacteria | 780 |
| 460 | Ga0451793_0789263 | 3300041452 | Bacteria | 2434 |
| 461 | Ga0451797_1218952 | 3300041453 | Bacteria | 507 |
| 462 | Ga0451797_1255051 | 3300041453 | Bacteria | 544 |
| 463 | Ga0451795_0292788 | 3300041456 | Bacteria | 580 |
| 464 | Ga0451795_0294527 | 3300041456 | Bacteria | 640 |
| 465 | Ga0451795_0902187 | 3300041456 | Bacteria | 845 |
| 466 | Ga0451800_1058039 | 3300041459 | Bacteria | 694 |
| 467 | Ga0451800_1401438 | 3300041459 | Bacteria | 634 |
| 468 | Ga0451802_0085081 | 3300041460 | Bacteria | 751 |
| 469 | Ga0451802_0143883 | 3300041460 | Bacteria | 616 |
| 470 | Ga0451802_0800214 | 3300041460 | Bacteria | 558 |
| 471 | Ga0451807_1553210 | 3300041486 | Bacteria | 649 |
| 472 | Ga0451807_1667980 | 3300041486 | Bacteria | 627 |
| 473 | Ga0451807_2621320 | 3300041486 | Bacteria | 537 |
| 474 | Ga0451833_0276161 | 3300041491 | Bacteria | 4559 |
| 475 | Ga0451837_0160140 | 3300041494 | Bacteria | 681 |
| 476 | Ga0451837_0210431 | 3300041494 | Bacteria | 814 |
| 477 | Ga0451837_0949823 | 3300041494 | Bacteria | 558 |
| 478 | Ga0451837_1052852 | 3300041494 | Bacteria | 3865 |
| 479 | Ga0451839_0010674 | 3300041496 | Bacteria | 2785 |
| 480 | Ga0451841_0315296 | 3300041498 | Bacteria | 551 |
| 481 | Ga0451841_0963788 | 3300041498 | Bacteria | 1753 |
| 482 | Ga0451845_0086215 | 3300041501 | Bacteria | 1298 |
| 483 | Ga0451846_47497 | 3300041502 | Bacteria | 581 |
| 484 | Ga0451843_0176465 | 3300041509 | Bacteria | 743 |
| 485 | Ga0451843_0390362 | 3300041509 | Bacteria | 552 |
| 486 | Ga0451843_1649887 | 3300041509 | Bacteria | 618 |
| 487 | Ga0451843_1745894 | 3300041509 | Bacteria | 638 |
| 488 | Ga0451855_1387741 | 3300041511 | Bacteria | 578 |
| 489 | Ga0451853_0057221 | 3300041512 | Bacteria | 7174 |
| 490 | Ga0451853_0407957 | 3300041512 | Bacteria | 569 |
| 491 | Ga0451853_2386619 | 3300041512 | Bacteria | 1746 |
| 492 | Ga0451853_2624360 | 3300041512 | Bacteria | 504 |
| 493 | Ga0439445_0027772 | 3300042004 | Bacteria | 1455 |
| 494 | Ga0439432_056326 | 3300042006 | Bacteria | 1218 |
| 495 | Ga0439446_0094568 | 3300042156 | Bacteria | 939 |
| 496 | Ga0439459_0112591 | 3300042438 | Bacteria | 678 |
| 497 | Ga0466969_0017660 | 3300044656 | Bacteria | 3723 |
| 498 | Ga0466969_0062150 | 3300044656 | Bacteria | 1813 |
| 499 | Ga0466969_0248751 | 3300044656 | Bacteria | 806 |
| 500 | Ga0466972_0037579 | 3300044658 | Bacteria | 2367 |
| 501 | Ga0466972_0168960 | 3300044658 | Bacteria | 1027 |
| 502 | Ga0466972_0213221 | 3300044658 | Bacteria | 903 |
| 503 | Ga0466972_0217083 | 3300044658 | Bacteria | 895 |
| 504 | Ga0466972_0402998 | 3300044658 | Bacteria | 641 |
| 505 | Ga0466965_0161261 | 3300044683 | Bacteria | 1176 |
| 506 | Ga0466965_0238911 | 3300044683 | Bacteria | 972 |
| 507 | Ga0466965_0406016 | 3300044683 | Bacteria | 753 |
| 508 | Ga0466965_0422065 | 3300044683 | Bacteria | 739 |
| 509 | Ga0466965_0474493 | 3300044683 | Bacteria | 699 |
| 510 | Ga0466965_0894244 | 3300044683 | Bacteria | 518 |
| 511 | Ga0466966_0098303 | 3300044684 | Bacteria | 1812 |
| 512 | Ga0466966_0131941 | 3300044684 | Bacteria | 1529 |
| 513 | Ga0466966_0398987 | 3300044684 | Bacteria | 826 |
| 514 | Ga0466961_0041554 | 3300044693 | Bacteria | 2948 |
| 515 | Ga0466961_0067005 | 3300044693 | Bacteria | 2280 |
| 516 | Ga0466961_0109310 | 3300044693 | Bacteria | 1740 |
| 517 | Ga0466961_0426426 | 3300044693 | Bacteria | 804 |
| 518 | Ga0466961_0904767 | 3300044693 | Bacteria | 525 |
| 519 | Ga0466963_0239166 | 3300044694 | Bacteria | 1273 |
| 520 | Ga0466964_0023349 | 3300044706 | Bacteria | 2405 |
| 521 | Ga0453684_0837163 | 3300044712 | Bacteria | 990 |
| 522 | Ga0466971_0246736 | 3300044719 | Bacteria | 850 |
| 523 | Ga0466968_0088816 | 3300044735 | Bacteria | 1367 |
| 524 | Ga0466968_0090654 | 3300044735 | Bacteria | 1354 |
| 525 | Ga0466970_0005900 | 3300044765 | Bacteria | 6101 |
| 526 | Ga0466970_0058962 | 3300044765 | Bacteria | 2055 |
| 527 | Ga0466970_0193928 | 3300044765 | Bacteria | 1129 |
| 528 | Ga0466970_0369744 | 3300044765 | Bacteria | 815 |
| 529 | Ga0466970_0864876 | 3300044765 | Bacteria | 531 |
| 530 | Ga0466957_0101812 | 3300044842 | Bacteria | 1811 |
| 531 | Ga0466957_0536768 | 3300044842 | Bacteria | 814 |
| 532 | Ga0466957_0693127 | 3300044842 | Bacteria | 718 |
| 533 | Ga0466957_0980112 | 3300044842 | Bacteria | 606 |
| 534 | Ga0466960_0250145 | 3300044901 | Bacteria | 984 |
| 535 | Ga0466960_0977053 | 3300044901 | Bacteria | 519 |
| 536 | Ga0466959_0143603 | 3300045049 | Bacteria | 1685 |
| 537 | Ga0466959_0190525 | 3300045049 | Bacteria | 1431 |
| 538 | Ga0466959_0391539 | 3300045049 | Bacteria | 945 |
| 539 | Ga0466958_0327777 | 3300045836 | Bacteria | 984 |
| 540 | Ga0466958_0981194 | 3300045836 | Bacteria | 551 |
| 541 | Ga0466967_0305278 | 3300045976 | Bacteria | 1532 |
| 542 | Ga0466967_0484939 | 3300045976 | Bacteria | 1211 |
| 543 | Ga0466967_0832639 | 3300045976 | Bacteria | 917 |
| 544 | Ga0466967_0987869 | 3300045976 | Bacteria | 838 |
| 545 | Ga0466967_1835973 | 3300045976 | Bacteria | 603 |
| 546 | Ga0466967_2177912 | 3300045976 | Bacteria | 550 |
| 547 | Ga0495627_097854 | 3300046453 | Bacteria | 840 |
| 548 | Ga0495591_122499 | 3300046458 | Bacteria | 634 |
| 549 | Ga0495638_0135324 | 3300046460 | Bacteria | 1444 |
| 550 | Ga0495650_0010799 | 3300046471 | Bacteria | 5065 |
| 551 | Ga0495650_0024978 | 3300046471 | Bacteria | 2812 |
| 552 | Ga0495639_0171620 | 3300046475 | Bacteria | 1053 |
| 553 | Ga0495620_0275483 | 3300046515 | Bacteria | 640 |
| 554 | Ga0495631_0349853 | 3300046518 | Bacteria | 629 |
| 555 | Ga0495643_0142616 | 3300046522 | Bacteria | 1193 |
| 556 | Ga0495654_0032925 | 3300046530 | Bacteria | 2626 |
| 557 | Ga0495609_0049279 | 3300046538 | Bacteria | 1880 |
| 558 | Ga0495656_0251254 | 3300046615 | Bacteria | 893 |
| 559 | Ga0495625_0142695 | 3300046660 | Bacteria | 1615 |
| 560 | Ga0495657_0334786 | 3300046675 | Bacteria | 898 |
| 561 | Ga0495647_0407478 | 3300046681 | Bacteria | 625 |
| 562 | Ga0495671_0229100 | 3300046692 | Bacteria | 899 |
| 563 | Ga0495649_0078152 | 3300046694 | Bacteria | 1771 |
| 564 | Ga0495672_0245464 | 3300047320 | Bacteria | 872 |
| 565 | Ga0495672_0428121 | 3300047320 | Bacteria | 601 |
| 566 | Ga0495686_0187319 | 3300047472 | Bacteria | 1195 |
| 567 | Ga0495626_0211333 | 3300048091 | Bacteria | 791 |
| 568 | Ga0496100_0018960 | 3300048903 | Bacteria | 4095 |
| 569 | Ga0496100_0209265 | 3300048903 | Bacteria | 1426 |
| 570 | Ga0496100_0231191 | 3300048903 | Bacteria | 1360 |
| 571 | Ga0496101_0006334 | 3300048904 | Bacteria | 7616 |
| 572 | Ga0496102_0022739 | 3300048905 | Bacteria | 5557 |
| 573 | Ga0496102_0217530 | 3300048905 | Bacteria | 1801 |
| 574 | Ga0496102_0346625 | 3300048905 | Bacteria | 1398 |
| 575 | Ga0496102_1780292 | 3300048905 | Bacteria | 533 |
| 576 | Ga0496103_0011718 | 3300048906 | Bacteria | 5201 |
| 577 | Ga0496104_0005777 | 3300048907 | Bacteria | 10829 |
| 578 | Ga0496104_0121240 | 3300048907 | Bacteria | 2510 |
| 579 | Ga0496104_0202754 | 3300048907 | Bacteria | 1895 |
| 580 | Ga0496105_0002712 | 3300048908 | Bacteria | 12913 |
| 581 | Ga0496105_0053232 | 3300048908 | Bacteria | 3342 |
| 582 | Ga0496105_0133027 | 3300048908 | Bacteria | 2049 |
| 583 | Ga0496106_0020578 | 3300048909 | Bacteria | 4898 |
| 584 | Ga0496107_0004317 | 3300048910 | Bacteria | 9625 |
| 585 | Ga0496107_0065388 | 3300048910 | Bacteria | 2636 |
| 586 | Ga0496108_0010564 | 3300048911 | Bacteria | 7495 |
| 587 | Ga0496108_0035480 | 3300048911 | Bacteria | 4146 |
| 588 | Ga0496108_0211667 | 3300048911 | Bacteria | 1683 |
| 589 | Ga0496109_0008423 | 3300048912 | Bacteria | 8766 |
| 590 | Ga0496109_0033739 | 3300048912 | Bacteria | 4606 |
| 591 | Ga0496110_1716588 | 3300048913 | Bacteria | 538 |
| 592 | Ga0496111_0001311 | 3300048914 | Bacteria | 13958 |
| 593 | Ga0496111_0174980 | 3300048914 | Bacteria | 1595 |
| 594 | Ga0496111_0685254 | 3300048914 | Bacteria | 746 |
| 595 | Ga0496111_0762851 | 3300048914 | Bacteria | 701 |
| 596 | Ga0496112_0031543 | 3300048915 | Bacteria | 5142 |
| 597 | Ga0496112_0040203 | 3300048915 | Bacteria | 4572 |
| 598 | Ga0496112_0212811 | 3300048915 | Bacteria | 1890 |
| 599 | Ga0496112_1614501 | 3300048915 | Bacteria | 562 |
| 600 | Ga0496113_0049454 | 3300048916 | Bacteria | 3130 |
| 601 | Ga0496113_0107738 | 3300048916 | Bacteria | 2165 |
| 602 | Ga0496114_0023635 | 3300048917 | Bacteria | 5016 |
| 603 | Ga0496114_0063976 | 3300048917 | Bacteria | 3080 |
| 604 | Ga0496114_0181650 | 3300048917 | Bacteria | 1837 |
| 605 | Ga0496114_0553668 | 3300048917 | Bacteria | 1016 |
| 606 | Ga0496114_1141878 | 3300048917 | Bacteria | 664 |
| 607 | Ga0496114_1271347 | 3300048917 | Bacteria | 622 |
| 608 | Ga0496115_0033887 | 3300048918 | Bacteria | 4034 |
| 609 | Ga0496115_0058473 | 3300048918 | Bacteria | 3102 |
| 610 | Ga0496115_0487868 | 3300048918 | Bacteria | 991 |
| 611 | Ga0496116_0022531 | 3300048919 | Bacteria | 4717 |
| 612 | Ga0496117_0000053 | 3300048920 | Bacteria | 279396 |
| 613 | Ga0496117_0002379 | 3300048920 | Bacteria | 23971 |
| 614 | Ga0496117_0005856 | 3300048920 | Bacteria | 12723 |
| 615 | Ga0496117_0019479 | 3300048920 | Bacteria | 5570 |
| 616 | Ga0496117_0034093 | 3300048920 | Bacteria | 3842 |
| 617 | Ga0496117_0188220 | 3300048920 | Bacteria | 1179 |
| 618 | Ga0496117_0319738 | 3300048920 | Bacteria | 814 |
| 619 | Ga0496118_0000134 | 3300048921 | Bacteria | 130991 |
| 620 | Ga0496118_0003938 | 3300048921 | Bacteria | 18160 |
| 621 | Ga0496118_0277403 | 3300048921 | Bacteria | 935 |
| 622 | Ga0496118_0332049 | 3300048921 | Bacteria | 819 |
| 623 | Ga0496118_0454331 | 3300048921 | Bacteria | 649 |
| 624 | Ga0496119_0002876 | 3300048922 | Bacteria | 18371 |
| 625 | Ga0496119_0002920 | 3300048922 | Bacteria | 18233 |
| 626 | Ga0496119_0007344 | 3300048922 | Bacteria | 9964 |
| 627 | Ga0496119_0033701 | 3300048922 | Bacteria | 3389 |
| 628 | Ga0496119_0099165 | 3300048922 | Bacteria | 1639 |
| 629 | Ga0496119_0106653 | 3300048922 | Bacteria | 1563 |
| 630 | Ga0496120_0001606 | 3300048923 | Bacteria | 26223 |
| 631 | Ga0496120_0002418 | 3300048923 | Bacteria | 18940 |
| 632 | Ga0496120_0005690 | 3300048923 | Bacteria | 9839 |
| 633 | Ga0496120_0010747 | 3300048923 | Bacteria | 6347 |
| 634 | Ga0496120_0018423 | 3300048923 | Bacteria | 4502 |
| 635 | Ga0496120_0026291 | 3300048923 | Bacteria | 3596 |
| 636 | Ga0496120_0060529 | 3300048923 | Bacteria | 2118 |
| 637 | Ga0496120_0149235 | 3300048923 | Bacteria | 1177 |
| 638 | Ga0496122_0000030 | 3300048925 | Bacteria | 331586 |
| 639 | Ga0496122_0001750 | 3300048925 | Bacteria | 33455 |
| 640 | Ga0496122_0002826 | 3300048925 | Bacteria | 23793 |
| 641 | Ga0496122_0024042 | 3300048925 | Bacteria | 5344 |
| 642 | Ga0496122_0170148 | 3300048925 | Bacteria | 1315 |
| 643 | Ga0496123_0000024 | 3300048926 | Bacteria | 331587 |
| 644 | Ga0496123_0003526 | 3300048926 | Bacteria | 17426 |
| 645 | Ga0496123_0003716 | 3300048926 | Bacteria | 16787 |
| 646 | Ga0496123_0141416 | 3300048926 | Bacteria | 1315 |
| 647 | Ga0496123_0335998 | 3300048926 | Bacteria | 708 |
| 648 | Ga0496124_0000256 | 3300048927 | Bacteria | 102144 |
| 649 | Ga0496124_0003673 | 3300048927 | Bacteria | 18552 |
| 650 | Ga0496124_0058865 | 3300048927 | Bacteria | 3229 |
| 651 | Ga0496124_0227210 | 3300048927 | Bacteria | 1398 |
| 652 | Ga0496124_0490252 | 3300048927 | Bacteria | 827 |
| 653 | Ga0496124_0493084 | 3300048927 | Bacteria | 823 |
| 654 | Ga0496125_0004043 | 3300048928 | Bacteria | 17191 |
| 655 | Ga0496125_0004883 | 3300048928 | Bacteria | 15211 |
| 656 | Ga0496125_0580132 | 3300048928 | Bacteria | 616 |
| 657 | Ga0496126_0004970 | 3300048929 | Bacteria | 15509 |
| 658 | Ga0496126_0008058 | 3300048929 | Bacteria | 11419 |
| 659 | Ga0496126_0083076 | 3300048929 | Bacteria | 2828 |
| 660 | Ga0496126_0466232 | 3300048929 | Bacteria | 1014 |
| 661 | Ga0501306_055966 | 3300049127 | Bacteria | 642 |
| 662 | Ga0501308_080432 | 3300049128 | Bacteria | 518 |
| 663 | Ga0501305_048878 | 3300049161 | Bacteria | 705 |
| 664 | Ga0501311_028365 | 3300049527 | Bacteria | 799 |
| 665 | Ga0501311_053509 | 3300049527 | Bacteria | 638 |
| 666 | Ga0501317_015058 | 3300049533 | Bacteria | 988 |
| 667 | Ga0501317_033450 | 3300049533 | Bacteria | 757 |
| 668 | Ga0501317_036146 | 3300049533 | Bacteria | 737 |
| 669 | Ga0501317_061733 | 3300049533 | Bacteria | 616 |
| 670 | Ga0501318_041901 | 3300049534 | Bacteria | 657 |
| 671 | Ga0501321_016150 | 3300049537 | Bacteria | 886 |
| 672 | Ga0501325_012740 | 3300049541 | Bacteria | 796 |
| 673 | Ga0501031_0005342 | 3300049568 | Bacteria | 8367 |
| 674 | Ga0501032_0068474 | 3300049569 | Bacteria | 2369 |
| 675 | Ga0501032_0095790 | 3300049569 | Bacteria | 1967 |
| 676 | Ga0501032_0161073 | 3300049569 | Bacteria | 1473 |
| 677 | Ga0501033_0072472 | 3300049570 | Bacteria | 2529 |
| 678 | Ga0501033_0717353 | 3300049570 | Bacteria | 679 |
| 679 | Ga0501034_0037990 | 3300049571 | Bacteria | 4876 |
| 680 | Ga0501034_0970943 | 3300049571 | Bacteria | 734 |
| 681 | Ga0501034_1714836 | 3300049571 | Bacteria | 500 |
| 682 | Ga0501036_0087292 | 3300049572 | Bacteria | 2636 |
| 683 | Ga0501036_0158878 | 3300049572 | Bacteria | 1906 |
| 684 | Ga0501036_0182437 | 3300049572 | Bacteria | 1767 |
| 685 | Ga0501036_1024362 | 3300049572 | Bacteria | 675 |
| 686 | Ga0501037_0025811 | 3300049573 | Bacteria | 4339 |
| 687 | Ga0501037_0034216 | 3300049573 | Bacteria | 3749 |
| 688 | Ga0501037_0053602 | 3300049573 | Bacteria | 2950 |
| 689 | Ga0501037_0177813 | 3300049573 | Bacteria | 1511 |
| 690 | Ga0501038_0014449 | 3300049574 | Bacteria | 7196 |
| 691 | Ga0501038_0284053 | 3300049574 | Bacteria | 1302 |
| 692 | Ga0501039_0011177 | 3300049575 | Bacteria | 6840 |
| 693 | Ga0501039_0086806 | 3300049575 | Bacteria | 2437 |
| 694 | Ga0501040_0541873 | 3300049576 | Bacteria | 840 |
| 695 | Ga0501041_0942164 | 3300049577 | Bacteria | 555 |
| 696 | Ga0501042_0095433 | 3300049578 | Bacteria | 2136 |
| 697 | Ga0501042_0779368 | 3300049578 | Bacteria | 696 |
| 698 | Ga0501042_1051445 | 3300049578 | Bacteria | 593 |
| 699 | Ga0501043_0010788 | 3300049579 | Bacteria | 7155 |
| 700 | Ga0501043_0115130 | 3300049579 | Bacteria | 2110 |
| 701 | Ga0501043_0178628 | 3300049579 | Bacteria | 1654 |
| 702 | Ga0501046_0010145 | 3300049580 | Bacteria | 8108 |
| 703 | Ga0501046_0771402 | 3300049580 | Bacteria | 675 |
| 704 | Ga0501047_0245072 | 3300049581 | Bacteria | 1641 |
| 705 | Ga0501047_0266290 | 3300049581 | Bacteria | 1560 |
| 706 | Ga0501047_0958811 | 3300049581 | Bacteria | 669 |
| 707 | Ga0501048_0023082 | 3300049582 | Bacteria | 4548 |
| 708 | Ga0501048_0591621 | 3300049582 | Bacteria | 796 |
| 709 | Ga0501048_1228041 | 3300049582 | Bacteria | 539 |
| 710 | Ga0501067_0083654 | 3300049583 | Bacteria | 1770 |
| 711 | Ga0501067_0153901 | 3300049583 | Bacteria | 1281 |
| 712 | Ga0501067_0502075 | 3300049583 | Bacteria | 679 |
| 713 | Ga0501068_0182487 | 3300049584 | Bacteria | 1327 |
| 714 | Ga0501068_0277994 | 3300049584 | Bacteria | 1070 |
| 715 | Ga0501069_0018628 | 3300049585 | Bacteria | 3748 |
| 716 | Ga0501069_0039598 | 3300049585 | Bacteria | 2604 |
| 717 | Ga0501069_0110795 | 3300049585 | Bacteria | 1563 |
| 718 | Ga0501070_0053511 | 3300049586 | Bacteria | 3348 |
| 719 | Ga0501070_0059346 | 3300049586 | Bacteria | 3171 |
| 720 | Ga0501070_0180838 | 3300049586 | Bacteria | 1735 |
| 721 | Ga0501071_0478029 | 3300049587 | Bacteria | 955 |
| 722 | Ga0501071_1219130 | 3300049587 | Bacteria | 581 |
| 723 | Ga0501073_0027393 | 3300049589 | Bacteria | 4075 |
| 724 | Ga0501073_0354250 | 3300049589 | Bacteria | 1013 |
| 725 | Ga0501073_0440406 | 3300049589 | Bacteria | 901 |
| 726 | Ga0501074_0295009 | 3300049590 | Bacteria | 1152 |
| 727 | Ga0501074_1259389 | 3300049590 | Bacteria | 518 |
| 728 | Ga0501076_0431158 | 3300049592 | Bacteria | 1085 |
| 729 | Ga0501077_0796427 | 3300049593 | Bacteria | 608 |
| 730 | Ga0501079_0094252 | 3300049741 | Bacteria | 2320 |
| 731 | Ga0501079_0111553 | 3300049741 | Bacteria | 2125 |
| 732 | Ga0501080_0021682 | 3300049742 | Bacteria | 5948 |
| 733 | Ga0501080_0155978 | 3300049742 | Bacteria | 2109 |
| 734 | Ga0501081_0218466 | 3300049743 | Bacteria | 1386 |
| 735 | Ga0501081_0316629 | 3300049743 | Bacteria | 1146 |
| 736 | Ga0501035_0215456 | 3300049822 | Bacteria | 1641 |
| 737 | Ga0501035_0467071 | 3300049822 | Bacteria | 1042 |
| 738 | Ga0501035_1376757 | 3300049822 | Bacteria | 541 |
| 739 | Ga0501044_0042949 | 3300049823 | Bacteria | 4698 |
| 740 | Ga0501044_1628706 | 3300049823 | Bacteria | 510 |
| 741 | Ga0501045_0473750 | 3300049824 | Bacteria | 930 |
| 742 | nmdc:mga03n38_222569_c1 | 3300050490 | Bacteria | 986 |
| 743 | nmdc:mga00v17_114948_c1 | 3300050491 | Bacteria | 1710 |
| 744 | nmdc:mga00v17_173872_c1 | 3300050491 | Bacteria | 1389 |
| 745 | nmdc:mga00v17_296205_c1 | 3300050491 | Bacteria | 1051 |
| 746 | nmdc:mga00v17_310638_c1 | 3300050491 | Bacteria | 1024 |
| 747 | nmdc:mga00v17_62442_c1 | 3300050491 | Bacteria | 2292 |
| 748 | nmdc:mga00v17_971_c1 | 3300050491 | Bacteria | 15352 |
| 749 | nmdc:mga0yw44_114563_c1 | 3300050492 | Bacteria | 1731 |
| 750 | nmdc:mga0yw44_22559_c1 | 3300050492 | Bacteria | 3532 |
| 751 | nmdc:mga0yw44_289036_c1 | 3300050492 | Bacteria | 1097 |
| 752 | nmdc:mga0yw44_82211_c1 | 3300050492 | Bacteria | 2020 |
| 753 | nmdc:mga0k408_872708_c1 | 3300050493 | Bacteria | 522 |
| 754 | nmdc:mga06z11_391110_c1 | 3300050494 | Bacteria | 836 |
| 755 | nmdc:mga06z11_4263_c1 | 3300050494 | Bacteria | 5614 |
| 756 | nmdc:mga04h51_82785_c1 | 3300050495 | Bacteria | 1142 |
| 757 | nmdc:mga07m45_16476_c1 | 3300050496 | Bacteria | 3957 |
| 758 | nmdc:mga07m45_60779_c1 | 3300050496 | Bacteria | 2139 |
| 759 | nmdc:mga07m45_657785_c1 | 3300050496 | Bacteria | 604 |
| 760 | nmdc:mga07m45_733198_c1 | 3300050496 | Bacteria | 568 |
| 761 | nmdc:mga0sz30_2151_c1 | 3300050516 | Bacteria | 7038 |
| 762 | nmdc:mga0sz30_4797_c2 | 3300050516 | Bacteria | 3699 |
| 763 | Ga0495619_0873288 | 3300053085 | Bacteria | 606 |
| 764 | Ga0500643_000174 | 3300053087 | Bacteria | 63222 |
| 765 | Ga0500651_0001075 | 3300053093 | Bacteria | 13493 |
| 766 | Ga0500641_0006257 | 3300053096 | Bacteria | 4224 |
| 767 | Ga0500556_0000001 | 3300053104 | Bacteria | 1135060 |
| 768 | Ga0500559_0016386 | 3300053136 | Bacteria | 3128 |
| 769 | Ga0500568_0000006 | 3300053139 | Bacteria | 522235 |
| 770 | Ga0500573_0000023 | 3300053140 | Bacteria | 152268 |
| 771 | Ga0500573_0323798 | 3300053140 | Bacteria | 760 |
| 772 | Ga0500573_0369953 | 3300053140 | Bacteria | 689 |
| 773 | Ga0500616_0000221 | 3300053153 | Bacteria | 88983 |
| 774 | Ga0500620_000031 | 3300053155 | Bacteria | 27977 |
| 775 | Ga0501084_0434284 | 3300054114 | Bacteria | 1110 |
| 776 | Ga0501084_0476250 | 3300054114 | Bacteria | 1055 |
| 777 | Ga0590075_078126 | 3300059424 | Bacteria | 857 |
| 778 | Ga0587093_048773 | 3300059478 | Bacteria | 663 |
| 779 | Ga0587066_073211 | 3300059490 | Bacteria | 726 |
| 780 | Ga0587066_080776 | 3300059490 | Bacteria | 704 |
| 781 | Ga0587070_056282 | 3300059491 | Bacteria | 800 |
| 782 | Ga0587073_0124378 | 3300059492 | Bacteria | 700 |
| 783 | Ga0587073_0124825 | 3300059492 | Bacteria | 699 |
| 784 | Ga0587073_0242641 | 3300059492 | Bacteria | 561 |
| 785 | Ga0587077_102352 | 3300059493 | Bacteria | 690 |
| 786 | Ga0587080_109638 | 3300059503 | Bacteria | 600 |
| 787 | Ga0587082_049701 | 3300059504 | Bacteria | 796 |
| 788 | Ga0587083_0074773 | 3300059505 | Bacteria | 794 |
| 789 | Ga0587086_015905 | 3300059507 | Bacteria | 977 |
| 790 | Ga0587088_031686 | 3300059508 | Bacteria | 949 |
| 791 | Ga0587088_054641 | 3300059508 | Bacteria | 792 |
| 792 | Ga0587089_042758 | 3300059509 | Bacteria | 706 |
| 793 | Ga0587089_109428 | 3300059509 | Bacteria | 509 |
| 794 | Ga0587091_026687 | 3300059511 | Bacteria | 1054 |
| 795 | Ga0587091_099077 | 3300059511 | Bacteria | 681 |
| 796 | Ga0587098_034335 | 3300059604 | Bacteria | 712 |
| 797 | Ga0587106_035625 | 3300059605 | Bacteria | 821 |
| 798 | Ga0587106_051237 | 3300059605 | Bacteria | 732 |
| 799 | Ga0587106_149983 | 3300059605 | Bacteria | 518 |
| 800 | Ga0587129_023990 | 3300059608 | Bacteria | 557 |
| 801 | Ga0587099_049749 | 3300059622 | Bacteria | 557 |
| 802 | Ga0587101_039922 | 3300059623 | Bacteria | 770 |
| 803 | Ga0587101_106997 | 3300059623 | Bacteria | 563 |
| 804 | Ga0587115_009733 | 3300059626 | Bacteria | 1185 |
| 805 | Ga0587115_042285 | 3300059626 | Bacteria | 716 |
| 806 | Ga0587122_016159 | 3300059628 | Bacteria | 769 |
| 807 | Ga0587128_023558 | 3300059630 | Bacteria | 966 |
| 808 | Ga0587128_085130 | 3300059630 | Bacteria | 639 |
| 809 | Ga0587068_073356 | 3300059641 | Bacteria | 679 |
| 810 | Ga0587069_024639 | 3300059642 | Bacteria | 930 |
| 811 | Ga0587075_068341 | 3300059644 | Bacteria | 655 |
| 812 | Ga0587078_089476 | 3300059646 | Bacteria | 503 |
| 813 | Ga0587079_051091 | 3300059647 | Bacteria | 868 |
| 814 | Ga0587079_076662 | 3300059647 | Bacteria | 756 |
| 815 | Ga0587104_009990 | 3300059650 | Bacteria | 691 |
| 816 | Ga0587114_017539 | 3300059655 | Bacteria | 972 |
| 817 | Ga0587071_040609 | 3300060344 | Bacteria | 931 |
| 818 | Ga0587071_083584 | 3300060344 | Bacteria | 715 |
| 819 | Ga0587111_0096733 | 3300060346 | Bacteria | 729 |
| 820 | Ga0501082_0150864 | 3300060353 | Bacteria | 2019 |
| 821 | Ga0501082_0571534 | 3300060353 | Bacteria | 989 |
| 822 | Ga0501082_0706465 | 3300060353 | Bacteria | 882 |
| 823 | Ga0466962_0043154 | 3300061719 | Bacteria | 2158 |
| 824 | Ga0466962_0178297 | 3300061719 | Bacteria | 1036 |
| 825 | Ga0466962_0590282 | 3300061719 | Bacteria | 566 |
| 826 | 2643753461 | 2643221546 | Bacteria | 2910897 |
| 827 | 2643848163 | 2643221566 | Bacteria | 3460379 |
| 828 | 2643875189 | 2643221572 | Bacteria | 3614809 |
| 829 | 2643995665 | 2643221597 | Bacteria | 3347721 |
| 830 | 2644198464 | 2643221635 | Bacteria | 2632343 |
| 831 | 2644382245 | 2643221669 | Bacteria | 3611286 |
| 832 | 2644456396 | 2643221681 | Bacteria | 3707866 |
| 833 | 2645723000 | 2643221961 | Bacteria | 3919167 |
| 834 | 2645725955 | 2643221962 | Bacteria | 3874254 |
| 835 | 2753301336 | 2751185788 | Bacteria | 4541048 |
| 836 | 2758226058 | 2757320536 | Bacteria | 3629334 |
| 837 | 2760306592 | 2758568522 | Bacteria | 5953541 |
| 838 | 2774380297 | 2773857758 | Bacteria | 3592392 |
| 839 | 2774384586 | 2773857759 | Bacteria | 2963774 |
| 840 | 2809195363 | 2808606439 | Bacteria | 5952208 |
| 841 | 2809227500 | 2808606447 | Bacteria | 3572005 |
| 842 | 2810363920 | 2808606700 | Bacteria | 3482157 |
| 843 | 2812323272 | 2811994872 | Bacteria | 4121241 |
| 844 | 2812364754 | 2811994880 | Bacteria | 4147780 |
| 845 | 2833711030 | 2833709550 | Bacteria | 4008291 |
| 846 | 2852634262 | 2852632344 | Bacteria | 3463163 |
| 847 | 2857720236 | 2857720070 | Bacteria | 3189373 |
| 848 | 2857730044 | 2857729791 | Bacteria | 4040535 |
| 849 | 2857733678 | 2857733635 | Bacteria | 3532004 |
| 850 | 2870630427 | 2870628048 | Bacteria | 3696012 |
| 851 | 2891972140 | 2891968417 | Bacteria | 5821697 |
| 852 | 2895661316 | 2895660088 | Bacteria | 3782833 |
| 853 | 2904433443 | 2904430863 | Bacteria | 3486923 |
| 854 | 2904503690 | 2904501621 | Bacteria | 3401437 |
| 855 | 2904511925 | 2904509784 | Bacteria | 3520416 |
| 856 | 2905926929 | 2905926851 | Bacteria | 4423176 |
| 857 | 2906800636 | 2906799679 | Bacteria | 4031749 |
| 858 | 2908675330 | 2908674828 | Bacteria | 3382763 |
| 859 | 2908680838 | 2908678064 | Bacteria | 3482747 |
| 860 | 2909075347 | 2909074476 | Bacteria | 3436050 |
| 861 | 2919040014 | 2919039151 | Bacteria | 3391018 |
| 862 | 2919044963 | 2919042368 | Bacteria | 3905917 |
| 863 | 2919071612 | 2919069694 | Bacteria | 3622919 |
| 864 | 2928091926 | 2928090899 | Bacteria | 3158267 |
| 865 | 2928106751 | 2928104781 | Bacteria | 3877447 |
| 866 | 2928123269 | 2928121344 | Bacteria | 3972376 |
| 867 | 2928501355 | 2928500415 | Bacteria | 3384541 |
| 868 | 2946004207 | 2946003308 | Bacteria | 3857229 |
| 869 | 2974297254 | 2974294766 | Bacteria | 3767688 |
| 870 | 2974326511 | 2974324384 | Bacteria | 3750535 |
| 871 | 2977231491 | 2977228692 | Bacteria | 3450105 |
| 872 | 2977240265 | 2977236895 | Bacteria | 3569373 |
| 873 | 2977266705 | 2977264416 | Bacteria | 3750737 |
| 874 | 2984545457 | 2984542743 | Bacteria | 3569378 |
| 875 | 2984553523 | 2984551494 | Bacteria | 3877562 |
| 876 | 2984581307 | 2984580707 | Bacteria | 3351387 |
| 877 | 2984594183 | 2984592036 | Bacteria | 3670284 |
| 878 | 8004214050 | 8004212874 | Bacteria | 2861420 |
| 879 | 8045831660 | 8045830549 | Bacteria | 4444727 |
| 880 | Ga0307414_10147875 | |||
| 881 | JGI24739J22299_10073607 | |||
| 882 | JGI24743J22301_10010175 | |||
| 883 | JGI24735J21928_10084376 | |||
| 884 | JGI25154J39366_1001284 | |||
| 885 | Ga0006778J45830_1015710 | |||
| 886 | JGI25407J50210_10045377 | |||
| 887 | JGI25407J50210_10190372 | |||
| 888 | Ga0007417J51691_1012460 | |||
| 889 | Ga0007427J51700_111594 | |||
| 890 | Ga0007410J51695_1024883 | |||
| 891 | Ga0007410J51695_1028109 | |||
| 892 | Ga0006562J51391_1077031 | |||
| 893 | Ga0032354_1026694 | |||
| 894 | Ga0055542_1006658 | |||
| 895 | Ga0058858_1426826 | |||
| 896 | Ga0058859_11241572 | |||
| 897 | Ga0058863_11633219 | |||
| 898 | Ga0058861_11584081 | |||
| 899 | Ga0058860_12151711 | |||
| 900 | Ga0065715_10795225 | |||
| 901 | Ga0070658_10029253 | |||
| 902 | Ga0070658_10047629 | |||
| 903 | Ga0070658_10069192 | |||
| 904 | Ga0070677_10882910 | |||
| 905 | Ga0068869_100115301 | |||
| 906 | Ga0070682_100259104 | |||
| 907 | Ga0070682_100570786 | |||
| 908 | Ga0068868_100150079 | |||
| 909 | Ga0070660_100596074 | |||
| 910 | Ga0070660_100831217 | |||
| 911 | Ga0070687_100394995 | |||
| 912 | Ga0070661_100023380 | |||
| 913 | Ga0070661_100067572 | |||
| 914 | Ga0070668_100483203 | |||
| 915 | Ga0070668_100770527 | |||
| 916 | Ga0070671_100207927 | |||
| 917 | Ga0070674_100407309 | |||
| 918 | Ga0070674_100796350 | |||
| 919 | Ga0070688_100167655 | |||
| 920 | Ga0070659_100013488 | |||
| 921 | Ga0070667_100096421 | |||
| 922 | Ga0070667_100181210 | |||
| 923 | Ga0070667_100587386 | |||
| 924 | Ga0070713_100193100 | |||
| 925 | Ga0070700_100858929 | |||
| 926 | Ga0070663_100255275 | |||
| 927 | Ga0070663_100300989 | |||
| 928 | Ga0070663_100393866 | |||
| 929 | Ga0070663_101184557 | |||
| 930 | Ga0070678_100231487 | |||
| 931 | Ga0070662_100789224 | |||
| 932 | Ga0070662_101528167 | |||
| 933 | Ga0070681_10546975 | |||
| 934 | Ga0070681_10850130 | |||
| 935 | Ga0070685_10047048 | |||
| 936 | Ga0070685_10559517 | |||
| 937 | Ga0070706_101630657 | |||
| 938 | Ga0070679_101993241 | |||
| 939 | Ga0070697_100121856 | |||
| 940 | Ga0068853_100028090 | |||
| 941 | Ga0068853_100052946 | |||
| 942 | Ga0068853_102058853 | |||
| 943 | Ga0068853_102248699 | |||
| 944 | Ga0070672_100207081 | |||
| 945 | Ga0070695_100147064 | |||
| 946 | Ga0070696_100044500 | |||
| 947 | Ga0070693_100150524 | |||
| 948 | Ga0070665_100027879 | |||
| 949 | Ga0070704_100119640 | |||
| 950 | Ga0068855_100030427 | |||
| 951 | Ga0068855_100031330 | |||
| 952 | Ga0068855_100056300 | |||
| 953 | Ga0068855_100501765 | |||
| 954 | Ga0070664_100683268 | |||
| 955 | Ga0068857_100021798 | |||
| 956 | Ga0068857_100249321 | |||
| 957 | Ga0068854_100102323 | |||
| 958 | Ga0068854_100405067 | |||
| 959 | Ga0068854_100660295 | |||
| 960 | Ga0068856_100344429 | |||
| 961 | Ga0068856_101781922 | |||
| 962 | Ga0068856_101823740 | |||
| 963 | Ga0068856_102531017 | |||
| 964 | Ga0070702_101405681 | |||
| 965 | Ga0068852_100017671 | |||
| 966 | Ga0068852_100066070 | |||
| 967 | Ga0068859_100052312 | |||
| 968 | Ga0068864_100148152 | |||
| 969 | Ga0068851_10000174 | |||
| 970 | Ga0068870_11008324 | |||
| 971 | Ga0068870_11415049 | |||
| 972 | Ga0068863_100056137 | |||
| 973 | Ga0068863_100252035 | |||
| 974 | Ga0068863_101873710 | |||
| 975 | Ga0068860_100001180 | |||
| 976 | Ga0068860_100086873 | |||
| 977 | Ga0068860_100424812 | |||
| 978 | Ga0081455_10003134 | |||
| 979 | Ga0081455_10014161 | |||
| 980 | Ga0081538_10000991 | |||
| 981 | Ga0081538_10048190 | |||
| 982 | Ga0070717_10109999 | |||
| 983 | Ga0070717_10887028 | |||
| 984 | Ga0075365_10111041 | |||
| 985 | Ga0075365_10262019 | |||
| 986 | Ga0075365_10579281 | |||
| 987 | Ga0075368_10101365 | |||
| 988 | Ga0075368_10359718 | |||
| 989 | Ga0075363_100011874 | |||
| 990 | Ga0075363_100272113 | |||
| 991 | Ga0075363_100990878 | |||
| 992 | Ga0075364_10028577 | |||
| 993 | Ga0075364_10217284 | |||
| 994 | Ga0075364_10759428 | |||
| 995 | Ga0070715_10828491 | |||
| 996 | Ga0070716_101514141 | |||
| 997 | Ga0075367_10000695 | |||
| 998 | Ga0075367_10192528 | |||
| 999 | Ga0075369_10000991 | |||
| 1000 | Ga0075369_10013993 | |||
| 1001 | Ga0075369_10639133 | |||
| 1002 | Ga0075366_10569042 | |||
| 1003 | Ga0097621_101678718 | |||
| 1004 | Ga0075370_10004480 | |||
| 1005 | Ga0075370_10188480 | |||
| 1006 | Ga0075370_10504242 | |||
| 1007 | Ga0075370_10819922 | |||
| 1008 | Ga0068865_101940892 | |||
| 1009 | Ga0097620_100052313 | |||
| 1010 | Ga0105251_10087257 | |||
| 1011 | Ga0105251_10257942 | |||
| 1012 | Ga0105244_10056209 | |||
| 1013 | Ga0105244_10102657 | |||
| 1014 | Ga0105240_10005074 | |||
| 1015 | Ga0105240_10078100 | |||
| 1016 | Ga0105240_11267102 | |||
| 1017 | Ga0105240_11791100 | |||
| 1018 | Ga0111539_11700456 | |||
| 1019 | Ga0105245_10032365 | |||
| 1020 | Ga0105247_10377835 | |||
| 1021 | Ga0105247_11733047 | |||
| 1022 | Ga0105243_11176410 | |||
| 1023 | Ga0105241_10010709 | |||
| 1024 | Ga0105241_10320648 | |||
| 1025 | Ga0105241_10345131 | |||
| 1026 | Ga0105241_10902309 | |||
| 1027 | Ga0105242_10703009 | |||
| 1028 | Ga0105237_10000660 | |||
| 1029 | Ga0105237_10061574 | |||
| 1030 | Ga0105237_10108611 | |||
| 1031 | Ga0105237_10182819 | |||
| 1032 | Ga0105237_11649273 | |||
| 1033 | Ga0105238_10006538 | |||
| 1034 | Ga0105238_10141262 | |||
| 1035 | Ga0105249_12375663 | |||
| 1036 | Ga0105030_113292 | |||
| 1037 | Ga0105239_10230657 | |||
| 1038 | Ga0105239_10627199 | |||
| 1039 | Ga0105239_11108833 | |||
| 1040 | Ga0105246_10092415 | |||
| 1041 | Ga0105246_10734437 | |||
| 1042 | Ga0157328_1005549 | |||
| 1043 | Ga0157342_1068135 | |||
| 1044 | Ga0157370_10032625 | |||
| 1045 | Ga0157370_10056334 | |||
| 1046 | Ga0157370_10312667 | |||
| 1047 | Ga0157369_10042192 | |||
| 1048 | Ga0157369_10330001 | |||
| 1049 | Ga0157369_10488439 | |||
| 1050 | Ga0157369_10751155 | |||
| 1051 | Ga0157369_10906875 | |||
| 1052 | Ga0171462_1003 | |||
| 1053 | Ga0157374_11406583 | |||
| 1054 | Ga0157374_11948036 | |||
| 1055 | Ga0163162_10010190 | |||
| 1056 | Ga0163162_10140160 | |||
| 1057 | Ga0163162_10425353 | |||
| 1058 | Ga0163162_11130635 | |||
| 1059 | Ga0157372_10716384 | |||
| 1060 | Ga0157372_11232771 | |||
| 1061 | Ga0157372_11595936 | |||
| 1062 | Ga0157375_11348787 | |||
| 1063 | Ga0157375_11617684 | |||
| 1064 | Ga0163163_10027908 | |||
| 1065 | Ga0157380_10027310 | |||
| 1066 | Ga0157380_11512147 | |||
| 1067 | Ga0157380_13187689 | |||
| 1068 | Ga0157377_10132403 | |||
| 1069 | Ga0157377_10663261 | |||
| 1070 | Ga0157379_10017319 | |||
| 1071 | Ga0157379_10023926 | |||
| 1072 | Ga0157379_12544100 | |||
| 1073 | Ga0157376_10365935 | |||
| 1074 | Ga0157376_10510567 | |||
| 1075 | Ga0157376_11190019 | |||
| 1076 | Ga0163161_10754691 | |||
| 1077 | Ga0197907_10326987 | |||
| 1078 | Ga0197907_10854447 | |||
| 1079 | Ga0197907_10912036 | |||
| 1080 | Ga0197907_10935291 | |||
| 1081 | Ga0206356_10978583 | |||
| 1082 | Ga0206356_11078444 | |||
| 1083 | Ga0206356_11307403 | |||
| 1084 | Ga0206356_11376106 | |||
| 1085 | Ga0206348_109438 | |||
| 1086 | Ga0206349_1061883 | |||
| 1087 | Ga0206349_1634353 | |||
| 1088 | Ga0206349_1930185 | |||
| 1089 | Ga0206355_1014107 | |||
| 1090 | Ga0206355_1167418 | |||
| 1091 | Ga0206355_1276013 | |||
| 1092 | Ga0206355_1492312 | |||
| 1093 | Ga0206355_1665678 | |||
| 1094 | Ga0206355_1716449 | |||
| 1095 | Ga0206351_10093022 | |||
| 1096 | Ga0206351_10773028 | |||
| 1097 | Ga0206351_10924608 | |||
| 1098 | Ga0206352_10090527 | |||
| 1099 | Ga0206352_10675540 | |||
| 1100 | Ga0206352_10998634 | |||
| 1101 | Ga0206350_10430210 | |||
| 1102 | Ga0206350_11165638 | |||
| 1103 | Ga0206350_11217244 | |||
| 1104 | Ga0206350_11364143 | |||
| 1105 | Ga0206350_11438219 | |||
| 1106 | Ga0206354_10160236 | |||
| 1107 | Ga0206354_10402436 | |||
| 1108 | Ga0206354_10565015 | |||
| 1109 | Ga0206354_10694027 | |||
| 1110 | Ga0206354_11544819 | |||
| 1111 | Ga0206353_10903616 | |||
| 1112 | Ga0206353_11635006 | |||
| 1113 | Ga0154015_1053277 | |||
| 1114 | Ga0154015_1157237 | |||
| 1115 | Ga0154015_1239016 | |||
| 1116 | Ga0154015_1250307 | |||
| 1117 | Ga0154015_1266277 | |||
| 1118 | Ga0154015_1310473 | |||
| 1119 | Ga0154015_1416389 | |||
| 1120 | Ga0213872_10356248 | |||
| 1121 | Ga0224712_10148613 | |||
| 1122 | Ga0224712_10189565 | |||
| 1123 | Ga0224712_10352643 | |||
| 1124 | Ga0224712_10369055 | |||
| 1125 | Ga0224712_10369422 | |||
| 1126 | Ga0209646_1000071 | |||
| 1127 | Ga0209148_1000624 | |||
| 1128 | Ga0207656_10000002 | |||
| 1129 | Ga0207655_1003360 | |||
| 1130 | Ga0207713_1099531 | |||
| 1131 | Ga0207682_10470612 | |||
| 1132 | Ga0207692_10028262 | |||
| 1133 | Ga0207710_10032300 | |||
| 1134 | Ga0207710_10169267 | |||
| 1135 | Ga0207710_10257946 | |||
| 1136 | Ga0207685_10807095 | |||
| 1137 | Ga0207643_10464632 | |||
| 1138 | Ga0207643_10926238 | |||
| 1139 | Ga0207705_10054040 | |||
| 1140 | Ga0207705_10426787 | |||
| 1141 | Ga0207705_11112833 | |||
| 1142 | Ga0207684_11283800 | |||
| 1143 | Ga0207654_10000001 | |||
| 1144 | Ga0207654_11260105 | |||
| 1145 | Ga0207707_11371392 | |||
| 1146 | Ga0207695_10021351 | |||
| 1147 | Ga0207695_10022892 | |||
| 1148 | Ga0207695_10173790 | |||
| 1149 | Ga0207695_10720620 | |||
| 1150 | Ga0207671_10000002 | |||
| 1151 | Ga0207671_10044467 | |||
| 1152 | Ga0207693_10033430 | |||
| 1153 | Ga0207663_10321275 | |||
| 1154 | Ga0207660_11139543 | |||
| 1155 | Ga0207660_11169074 | |||
| 1156 | Ga0207662_10251634 | |||
| 1157 | Ga0207662_11299709 | |||
| 1158 | Ga0207657_10010777 | |||
| 1159 | Ga0207657_11379855 | |||
| 1160 | Ga0207649_10032826 | |||
| 1161 | Ga0207652_11793600 | |||
| 1162 | Ga0207694_10000153 | |||
| 1163 | Ga0207694_10040322 | |||
| 1164 | Ga0207694_10084470 | |||
| 1165 | Ga0207650_10831746 | |||
| 1166 | Ga0207659_10906264 | |||
| 1167 | Ga0207687_10020899 | |||
| 1168 | Ga0207687_10029146 | |||
| 1169 | Ga0207700_10356705 | |||
| 1170 | Ga0207700_10976598 | |||
| 1171 | Ga0207664_10393745 | |||
| 1172 | Ga0207664_11170215 | |||
| 1173 | Ga0207644_10119010 | |||
| 1174 | Ga0207690_10020759 | |||
| 1175 | Ga0207686_10863071 | |||
| 1176 | Ga0207709_10885638 | |||
| 1177 | Ga0207709_11013473 | |||
| 1178 | Ga0207669_10657570 | |||
| 1179 | Ga0207704_10853159 | |||
| 1180 | Ga0207691_10217438 | |||
| 1181 | Ga0207691_10881571 | |||
| 1182 | Ga0207711_10063716 | |||
| 1183 | Ga0207711_10260653 | |||
| 1184 | Ga0207667_10054976 | |||
| 1185 | Ga0207667_10110945 | |||
| 1186 | Ga0207667_10189711 | |||
| 1187 | Ga0207667_10266651 | |||
| 1188 | Ga0207667_10483383 | |||
| 1189 | Ga0207667_11098447 | |||
| 1190 | Ga0207651_10300070 | |||
| 1191 | Ga0207668_10858252 | |||
| 1192 | Ga0207668_11187525 | |||
| 1193 | Ga0207640_10433669 | |||
| 1194 | Ga0207658_10020806 | |||
| 1195 | Ga0207658_10380954 | |||
| 1196 | Ga0207658_10491206 | |||
| 1197 | Ga0207677_10020605 | |||
| 1198 | Ga0207677_10079415 | |||
| 1199 | Ga0207677_10124572 | |||
| 1200 | Ga0207703_10000031 | |||
| 1201 | Ga0207703_10248429 | |||
| 1202 | Ga0207639_10022174 | |||
| 1203 | Ga0207678_10001249 | |||
| 1204 | Ga0207678_10450075 | |||
| 1205 | Ga0207678_10623151 | |||
| 1206 | Ga0207708_10424430 | |||
| 1207 | Ga0207702_10053773 | |||
| 1208 | Ga0207702_10093978 | |||
| 1209 | Ga0207702_10354150 | |||
| 1210 | Ga0207641_10044128 | |||
| 1211 | Ga0207641_10253188 | |||
| 1212 | Ga0207641_12452901 | |||
| 1213 | Ga0207648_12021970 | |||
| 1214 | Ga0207676_10107667 | |||
| 1215 | Ga0207674_10059775 | |||
| 1216 | Ga0207674_10229669 | |||
| 1217 | Ga0207683_10021780 | |||
| 1218 | Ga0207683_10128823 | |||
| 1219 | Ga0207698_10140748 | |||
| 1220 | Ga0207698_10640032 | |||
| 1221 | Ga0209813_10136791 | |||
| 1222 | Ga0209813_10482102 | |||
| 1223 | Ga0268266_10087579 | |||
| 1224 | Ga0268266_10306749 | |||
| 1225 | Ga0268266_11383849 | |||
| 1226 | Ga0268265_10884593 | |||
| 1227 | Ga0268264_10000987 | |||
| 1228 | Ga0268264_10137202 | |||
| 1229 | Ga0268264_10511587 | |||
| 1230 | Ga0268264_11402415 | |||
| 1231 | Ga0265334_10007622 | |||
| 1232 | Ga0307515_10446720 | |||
| 1233 | Ga0307515_10483612 | |||
| 1234 | Ga0307511_10316414 | |||
| 1235 | Ga0314311_1122579 | |||
| 1236 | Ga0316181_1252750 | |||
| 1237 | Ga0316182_1109466 | |||
| 1238 | Ga0307513_10907350 | |||
| 1239 | Ga0307509_10536258 | |||
| 1240 | Ga0307408_100270314 | |||
| 1241 | Ga0307408_101175431 | |||
| 1242 | Ga0307514_10383541 | |||
| 1243 | Ga0316575_10002481 | |||
| 1244 | Ga0316579_10030946 | |||
| 1245 | Ga0316579_10079621 | |||
| 1246 | Ga0316579_10121107 | |||
| 1247 | Ga0316576_10006347 | |||
| 1248 | Ga0316576_10039257 | |||
| 1249 | Ga0316576_10046810 | |||
| 1250 | Ga0316576_10083058 | |||
| 1251 | Ga0316578_10025525 | |||
| 1252 | Ga0316578_10040601 | |||
| 1253 | Ga0316578_10050930 | |||
| 1254 | Ga0307405_10579826 | |||
| 1255 | Ga0307405_11055901 | |||
| 1256 | Ga0307405_11752215 | |||
| 1257 | Ga0307405_11761025 | |||
| 1258 | Ga0316577_10037186 | |||
| 1259 | Ga0316577_10150171 | |||
| 1260 | Ga0316577_10303288 | |||
| 1261 | Ga0307413_10352090 | |||
| 1262 | Ga0307410_10099134 | |||
| 1263 | Ga0307410_10852134 | |||
| 1264 | Ga0307410_11872070 | |||
| 1265 | Ga0307406_10014155 | |||
| 1266 | Ga0307406_10492598 | |||
| 1267 | Ga0307406_10983925 | |||
| 1268 | Ga0307407_10031786 | |||
| 1269 | Ga0307407_10485365 | |||
| 1270 | Ga0307412_10226887 | |||
| 1271 | Ga0307409_100039407 | |||
| 1272 | Ga0307409_100114010 | |||
| 1273 | Ga0307409_100455060 | |||
| 1274 | Ga0307416_100114623 | |||
| 1275 | Ga0307416_100284593 | |||
| 1276 | Ga0307416_101076555 | |||
| 1277 | Ga0307414_11262500 | |||
| 1278 | Ga0307414_12025678 | |||
| 1279 | Ga0307411_10276741 | |||
| 1280 | Ga0307415_100393359 | |||
| 1281 | Ga0316583_10006503 | |||
| 1282 | Ga0316583_10157169 | |||
| 1283 | Ga0316585_10008208 | |||
| 1284 | Ga0316580_10037842 | |||
| 1285 | Ga0316580_10083811 | |||
| 1286 | Ga0316593_10004078 | |||
| 1287 | Ga0316593_10036808 | |||
| 1288 | Ga0316593_10116587 | |||
| 1289 | Ga0316592_1040494 | |||
| 1290 | Ga0316592_1100203 | |||
| 1291 | Ga0316586_1059785 | |||
| 1292 | Ga0316588_1066174 | |||
| 1293 | Ga0316588_1143549 | |||
| 1294 | Ga0316588_1157459 | |||
| 1295 | Ga0316596_1000246 | |||
| 1296 | Ga0316596_1030137 | |||
| 1297 | Ga0316596_1070862 | |||
| 1298 | Ga0316596_1185114 | |||
| 1299 | Ga0316596_1202893 | |||
| 1300 | Ga0316574_0009952 | |||
| 1301 | Ga0316574_0030284 | |||
| 1302 | Ga0316574_0136834 | |||
| 1303 | Ga0316574_0170914 | |||
| 1304 | Ga0316582_0299072 | |||
| 1305 | Ga0316582_0442099 | |||
| 1306 | Ga0316582_0673026 | |||
| 1307 | Ga0316584_0001267 | |||
| 1308 | Ga0316584_0045469 | |||
| 1309 | Ga0316584_0080072 | |||
| 1310 | Ga0316584_0950130 | |||
| 1311 | Ga0395899_0381370 | |||
| 1312 | Ga0395900_0017198 | |||
| 1313 | Ga0395900_0127340 | |||
| 1314 | Ga0395900_1424141 | |||
| 1315 | Ga0395900_1502563 | |||
| 1316 | Ga0395898_0287877 | |||
| 1317 | Ga0395898_0346737 | |||
| 1318 | Ga0395898_1424394 | |||
| 1319 | Ga0395898_1907993 | |||
| 1320 | Ga0316581_0000149 | |||
| 1321 | Ga0395901_0778705 | |||
| 1322 | Ga0400485_19729 | |||
| 1323 | Ga0400486_32646 | |||
| 1324 | Ga0400489_87014 | |||
| 1325 | Ga0436365_1513875 | |||
| 1326 | Ga0436361_0965496 | |||
| 1327 | Ga0436362_1249237 | |||
| 1328 | Ga0439439_0110793 | |||
| 1329 | Ga0439466_0114319 | |||
| 1330 | Ga0439466_0161318 | |||
| 1331 | Ga0439465_0048243 | |||
| 1332 | Ga0439465_0090100 | |||
| 1333 | Ga0439465_0123823 | |||
| 1334 | Ga0451789_0231381 | |||
| 1335 | Ga0451789_0396782 | |||
| 1336 | Ga0451790_30891 | |||
| 1337 | Ga0451796_10591 | |||
| 1338 | Ga0451793_0715769 | |||
| 1339 | Ga0451793_0789263 | |||
| 1340 | Ga0451797_1218952 | |||
| 1341 | Ga0451797_1255051 | |||
| 1342 | Ga0451795_0292788 | |||
| 1343 | Ga0451795_0294527 | |||
| 1344 | Ga0451795_0902187 | |||
| 1345 | Ga0451800_1058039 | |||
| 1346 | Ga0451800_1401438 | |||
| 1347 | Ga0451802_0085081 | |||
| 1348 | Ga0451802_0143883 | |||
| 1349 | Ga0451802_0800214 | |||
| 1350 | Ga0451807_1553210 | |||
| 1351 | Ga0451807_1667980 | |||
| 1352 | Ga0451807_2621320 | |||
| 1353 | Ga0451833_0276161 | |||
| 1354 | Ga0451837_0160140 | |||
| 1355 | Ga0451837_0210431 | |||
| 1356 | Ga0451837_0949823 | |||
| 1357 | Ga0451837_1052852 | |||
| 1358 | Ga0451839_0010674 | |||
| 1359 | Ga0451841_0315296 | |||
| 1360 | Ga0451841_0963788 | |||
| 1361 | Ga0451845_0086215 | |||
| 1362 | Ga0451846_47497 | |||
| 1363 | Ga0451843_0176465 | |||
| 1364 | Ga0451843_0390362 | |||
| 1365 | Ga0451843_1649887 | |||
| 1366 | Ga0451843_1745894 | |||
| 1367 | Ga0451855_1387741 | |||
| 1368 | Ga0451853_0057221 | |||
| 1369 | Ga0451853_0407957 | |||
| 1370 | Ga0451853_2386619 | |||
| 1371 | Ga0451853_2624360 | |||
| 1372 | Ga0439445_0027772 | |||
| 1373 | Ga0439432_056326 | |||
| 1374 | Ga0439446_0094568 | |||
| 1375 | Ga0439459_0112591 | |||
| 1376 | Ga0466969_0017660 | |||
| 1377 | Ga0466969_0062150 | |||
| 1378 | Ga0466969_0248751 | |||
| 1379 | Ga0466972_0037579 | |||
| 1380 | Ga0466972_0168960 | |||
| 1381 | Ga0466972_0213221 | |||
| 1382 | Ga0466972_0217083 | |||
| 1383 | Ga0466972_0402998 | |||
| 1384 | Ga0466965_0161261 | |||
| 1385 | Ga0466965_0238911 | |||
| 1386 | Ga0466965_0406016 | |||
| 1387 | Ga0466965_0422065 | |||
| 1388 | Ga0466965_0474493 | |||
| 1389 | Ga0466965_0894244 | |||
| 1390 | Ga0466966_0098303 | |||
| 1391 | Ga0466966_0131941 | |||
| 1392 | Ga0466966_0398987 | |||
| 1393 | Ga0466961_0041554 | |||
| 1394 | Ga0466961_0067005 | |||
| 1395 | Ga0466961_0109310 | |||
| 1396 | Ga0466961_0426426 | |||
| 1397 | Ga0466961_0904767 | |||
| 1398 | Ga0466963_0239166 | |||
| 1399 | Ga0466964_0023349 | |||
| 1400 | Ga0453684_0837163 | |||
| 1401 | Ga0466971_0246736 | |||
| 1402 | Ga0466968_0088816 | |||
| 1403 | Ga0466968_0090654 | |||
| 1404 | Ga0466970_0005900 | |||
| 1405 | Ga0466970_0058962 | |||
| 1406 | Ga0466970_0193928 | |||
| 1407 | Ga0466970_0369744 | |||
| 1408 | Ga0466970_0864876 | |||
| 1409 | Ga0466957_0101812 | |||
| 1410 | Ga0466957_0536768 | |||
| 1411 | Ga0466957_0693127 | |||
| 1412 | Ga0466957_0980112 | |||
| 1413 | Ga0466960_0250145 | |||
| 1414 | Ga0466960_0977053 | |||
| 1415 | Ga0466959_0143603 | |||
| 1416 | Ga0466959_0190525 | |||
| 1417 | Ga0466959_0391539 | |||
| 1418 | Ga0466958_0327777 | |||
| 1419 | Ga0466958_0981194 | |||
| 1420 | Ga0466967_0305278 | |||
| 1421 | Ga0466967_0484939 | |||
| 1422 | Ga0466967_0832639 | |||
| 1423 | Ga0466967_0987869 | |||
| 1424 | Ga0466967_1835973 | |||
| 1425 | Ga0466967_2177912 | |||
| 1426 | Ga0495627_097854 | |||
| 1427 | Ga0495591_122499 | |||
| 1428 | Ga0495638_0135324 | |||
| 1429 | Ga0495650_0010799 | |||
| 1430 | Ga0495650_0024978 | |||
| 1431 | Ga0495639_0171620 | |||
| 1432 | Ga0495620_0275483 | |||
| 1433 | Ga0495631_0349853 | |||
| 1434 | Ga0495643_0142616 | |||
| 1435 | Ga0495654_0032925 | |||
| 1436 | Ga0495609_0049279 | |||
| 1437 | Ga0495656_0251254 | |||
| 1438 | Ga0495625_0142695 | |||
| 1439 | Ga0495657_0334786 | |||
| 1440 | Ga0495647_0407478 | |||
| 1441 | Ga0495671_0229100 | |||
| 1442 | Ga0495649_0078152 | |||
| 1443 | Ga0495672_0245464 | |||
| 1444 | Ga0495672_0428121 | |||
| 1445 | Ga0495686_0187319 | |||
| 1446 | Ga0495626_0211333 | |||
| 1447 | Ga0496100_0018960 | |||
| 1448 | Ga0496100_0209265 | |||
| 1449 | Ga0496100_0231191 | |||
| 1450 | Ga0496101_0006334 | |||
| 1451 | Ga0496102_0022739 | |||
| 1452 | Ga0496102_0217530 | |||
| 1453 | Ga0496102_0346625 | |||
| 1454 | Ga0496102_1780292 | |||
| 1455 | Ga0496103_0011718 | |||
| 1456 | Ga0496104_0005777 | |||
| 1457 | Ga0496104_0121240 | |||
| 1458 | Ga0496104_0202754 | |||
| 1459 | Ga0496105_0002712 | |||
| 1460 | Ga0496105_0053232 | |||
| 1461 | Ga0496105_0133027 | |||
| 1462 | Ga0496106_0020578 | |||
| 1463 | Ga0496107_0004317 | |||
| 1464 | Ga0496107_0065388 | |||
| 1465 | Ga0496108_0010564 | |||
| 1466 | Ga0496108_0035480 | |||
| 1467 | Ga0496108_0211667 | |||
| 1468 | Ga0496109_0008423 | |||
| 1469 | Ga0496109_0033739 | |||
| 1470 | Ga0496110_1716588 | |||
| 1471 | Ga0496111_0001311 | |||
| 1472 | Ga0496111_0174980 | |||
| 1473 | Ga0496111_0685254 | |||
| 1474 | Ga0496111_0762851 | |||
| 1475 | Ga0496112_0031543 | |||
| 1476 | Ga0496112_0040203 | |||
| 1477 | Ga0496112_0212811 | |||
| 1478 | Ga0496112_1614501 | |||
| 1479 | Ga0496113_0049454 | |||
| 1480 | Ga0496113_0107738 | |||
| 1481 | Ga0496114_0023635 | |||
| 1482 | Ga0496114_0063976 | |||
| 1483 | Ga0496114_0181650 | |||
| 1484 | Ga0496114_0553668 | |||
| 1485 | Ga0496114_1141878 | |||
| 1486 | Ga0496114_1271347 | |||
| 1487 | Ga0496115_0033887 | |||
| 1488 | Ga0496115_0058473 | |||
| 1489 | Ga0496115_0487868 | |||
| 1490 | Ga0496116_0022531 | |||
| 1491 | Ga0496117_0000053 | |||
| 1492 | Ga0496117_0002379 | |||
| 1493 | Ga0496117_0005856 | |||
| 1494 | Ga0496117_0019479 | |||
| 1495 | Ga0496117_0034093 | |||
| 1496 | Ga0496117_0188220 | |||
| 1497 | Ga0496117_0319738 | |||
| 1498 | Ga0496118_0000134 | |||
| 1499 | Ga0496118_0003938 | |||
| 1500 | Ga0496118_0277403 | |||
| 1501 | Ga0496118_0332049 | |||
| 1502 | Ga0496118_0454331 | |||
| 1503 | Ga0496119_0002876 | |||
| 1504 | Ga0496119_0002920 | |||
| 1505 | Ga0496119_0007344 | |||
| 1506 | Ga0496119_0033701 | |||
| 1507 | Ga0496119_0099165 | |||
| 1508 | Ga0496119_0106653 | |||
| 1509 | Ga0496120_0001606 | |||
| 1510 | Ga0496120_0002418 | |||
| 1511 | Ga0496120_0005690 | |||
| 1512 | Ga0496120_0010747 | |||
| 1513 | Ga0496120_0018423 | |||
| 1514 | Ga0496120_0026291 | |||
| 1515 | Ga0496120_0060529 | |||
| 1516 | Ga0496120_0149235 | |||
| 1517 | Ga0496122_0000030 | |||
| 1518 | Ga0496122_0001750 | |||
| 1519 | Ga0496122_0002826 | |||
| 1520 | Ga0496122_0024042 | |||
| 1521 | Ga0496122_0170148 | |||
| 1522 | Ga0496123_0000024 | |||
| 1523 | Ga0496123_0003526 | |||
| 1524 | Ga0496123_0003716 | |||
| 1525 | Ga0496123_0141416 | |||
| 1526 | Ga0496123_0335998 | |||
| 1527 | Ga0496124_0000256 | |||
| 1528 | Ga0496124_0003673 | |||
| 1529 | Ga0496124_0058865 | |||
| 1530 | Ga0496124_0227210 | |||
| 1531 | Ga0496124_0490252 | |||
| 1532 | Ga0496124_0493084 | |||
| 1533 | Ga0496125_0004043 | |||
| 1534 | Ga0496125_0004883 | |||
| 1535 | Ga0496125_0580132 | |||
| 1536 | Ga0496126_0004970 | |||
| 1537 | Ga0496126_0008058 | |||
| 1538 | Ga0496126_0083076 | |||
| 1539 | Ga0496126_0466232 | |||
| 1540 | Ga0501306_055966 | |||
| 1541 | Ga0501308_080432 | |||
| 1542 | Ga0501305_048878 | |||
| 1543 | Ga0501311_028365 | |||
| 1544 | Ga0501311_053509 | |||
| 1545 | Ga0501317_015058 | |||
| 1546 | Ga0501317_033450 | |||
| 1547 | Ga0501317_036146 | |||
| 1548 | Ga0501317_061733 | |||
| 1549 | Ga0501318_041901 | |||
| 1550 | Ga0501321_016150 | |||
| 1551 | Ga0501325_012740 | |||
| 1552 | Ga0501031_0005342 | |||
| 1553 | Ga0501032_0068474 | |||
| 1554 | Ga0501032_0095790 | |||
| 1555 | Ga0501032_0161073 | |||
| 1556 | Ga0501033_0072472 | |||
| 1557 | Ga0501033_0717353 | |||
| 1558 | Ga0501034_0037990 | |||
| 1559 | Ga0501034_0970943 | |||
| 1560 | Ga0501034_1714836 | |||
| 1561 | Ga0501036_0087292 | |||
| 1562 | Ga0501036_0158878 | |||
| 1563 | Ga0501036_0182437 | |||
| 1564 | Ga0501036_1024362 | |||
| 1565 | Ga0501037_0025811 | |||
| 1566 | Ga0501037_0034216 | |||
| 1567 | Ga0501037_0053602 | |||
| 1568 | Ga0501037_0177813 | |||
| 1569 | Ga0501038_0014449 | |||
| 1570 | Ga0501038_0284053 | |||
| 1571 | Ga0501039_0011177 | |||
| 1572 | Ga0501039_0086806 | |||
| 1573 | Ga0501040_0541873 | |||
| 1574 | Ga0501041_0942164 | |||
| 1575 | Ga0501042_0095433 | |||
| 1576 | Ga0501042_0779368 | |||
| 1577 | Ga0501042_1051445 | |||
| 1578 | Ga0501043_0010788 | |||
| 1579 | Ga0501043_0115130 | |||
| 1580 | Ga0501043_0178628 | |||
| 1581 | Ga0501046_0010145 | |||
| 1582 | Ga0501046_0771402 | |||
| 1583 | Ga0501047_0245072 | |||
| 1584 | Ga0501047_0266290 | |||
| 1585 | Ga0501047_0958811 | |||
| 1586 | Ga0501048_0023082 | |||
| 1587 | Ga0501048_0591621 | |||
| 1588 | Ga0501048_1228041 | |||
| 1589 | Ga0501067_0083654 | |||
| 1590 | Ga0501067_0153901 | |||
| 1591 | Ga0501067_0502075 | |||
| 1592 | Ga0501068_0182487 | |||
| 1593 | Ga0501068_0277994 | |||
| 1594 | Ga0501069_0018628 | |||
| 1595 | Ga0501069_0039598 | |||
| 1596 | Ga0501069_0110795 | |||
| 1597 | Ga0501070_0053511 | |||
| 1598 | Ga0501070_0059346 | |||
| 1599 | Ga0501070_0180838 | |||
| 1600 | Ga0501071_0478029 | |||
| 1601 | Ga0501071_1219130 | |||
| 1602 | Ga0501073_0027393 | |||
| 1603 | Ga0501073_0354250 | |||
| 1604 | Ga0501073_0440406 | |||
| 1605 | Ga0501074_0295009 | |||
| 1606 | Ga0501074_1259389 | |||
| 1607 | Ga0501076_0431158 | |||
| 1608 | Ga0501077_0796427 | |||
| 1609 | Ga0501079_0094252 | |||
| 1610 | Ga0501079_0111553 | |||
| 1611 | Ga0501080_0021682 | |||
| 1612 | Ga0501080_0155978 | |||
| 1613 | Ga0501081_0218466 | |||
| 1614 | Ga0501081_0316629 | |||
| 1615 | Ga0501035_0215456 | |||
| 1616 | Ga0501035_0467071 | |||
| 1617 | Ga0501035_1376757 | |||
| 1618 | Ga0501044_0042949 | |||
| 1619 | Ga0501044_1628706 | |||
| 1620 | Ga0501045_0473750 | |||
| 1621 | nmdc:mga03n38_222569_c1 | |||
| 1622 | nmdc:mga00v17_114948_c1 | |||
| 1623 | nmdc:mga00v17_173872_c1 | |||
| 1624 | nmdc:mga00v17_296205_c1 | |||
| 1625 | nmdc:mga00v17_310638_c1 | |||
| 1626 | nmdc:mga00v17_62442_c1 | |||
| 1627 | nmdc:mga00v17_971_c1 | |||
| 1628 | nmdc:mga0yw44_114563_c1 | |||
| 1629 | nmdc:mga0yw44_22559_c1 | |||
| 1630 | nmdc:mga0yw44_289036_c1 | |||
| 1631 | nmdc:mga0yw44_82211_c1 | |||
| 1632 | nmdc:mga0k408_872708_c1 | |||
| 1633 | nmdc:mga06z11_391110_c1 | |||
| 1634 | nmdc:mga06z11_4263_c1 | |||
| 1635 | nmdc:mga04h51_82785_c1 | |||
| 1636 | nmdc:mga07m45_16476_c1 | |||
| 1637 | nmdc:mga07m45_60779_c1 | |||
| 1638 | nmdc:mga07m45_657785_c1 | |||
| 1639 | nmdc:mga07m45_733198_c1 | |||
| 1640 | nmdc:mga0sz30_2151_c1 | |||
| 1641 | nmdc:mga0sz30_4797_c2 | |||
| 1642 | Ga0495619_0873288 | |||
| 1643 | Ga0500643_000174 | |||
| 1644 | Ga0500651_0001075 | |||
| 1645 | Ga0500641_0006257 | |||
| 1646 | Ga0500556_0000001 | |||
| 1647 | Ga0500559_0016386 | |||
| 1648 | Ga0500568_0000006 | |||
| 1649 | Ga0500573_0000023 | |||
| 1650 | Ga0500573_0323798 | |||
| 1651 | Ga0500573_0369953 | |||
| 1652 | Ga0500616_0000221 | |||
| 1653 | Ga0500620_000031 | |||
| 1654 | Ga0501084_0434284 | |||
| 1655 | Ga0501084_0476250 | |||
| 1656 | Ga0590075_078126 | |||
| 1657 | Ga0587093_048773 | |||
| 1658 | Ga0587066_073211 | |||
| 1659 | Ga0587066_080776 | |||
| 1660 | Ga0587070_056282 | |||
| 1661 | Ga0587073_0124378 | |||
| 1662 | Ga0587073_0124825 | |||
| 1663 | Ga0587073_0242641 | |||
| 1664 | Ga0587077_102352 | |||
| 1665 | Ga0587080_109638 | |||
| 1666 | Ga0587082_049701 | |||
| 1667 | Ga0587083_0074773 | |||
| 1668 | Ga0587086_015905 | |||
| 1669 | Ga0587088_031686 | |||
| 1670 | Ga0587088_054641 | |||
| 1671 | Ga0587089_042758 | |||
| 1672 | Ga0587089_109428 | |||
| 1673 | Ga0587091_026687 | |||
| 1674 | Ga0587091_099077 | |||
| 1675 | Ga0587098_034335 | |||
| 1676 | Ga0587106_035625 | |||
| 1677 | Ga0587106_051237 | |||
| 1678 | Ga0587106_149983 | |||
| 1679 | Ga0587129_023990 | |||
| 1680 | Ga0587099_049749 | |||
| 1681 | Ga0587101_039922 | |||
| 1682 | Ga0587101_106997 | |||
| 1683 | Ga0587115_009733 | |||
| 1684 | Ga0587115_042285 | |||
| 1685 | Ga0587122_016159 | |||
| 1686 | Ga0587128_023558 | |||
| 1687 | Ga0587128_085130 | |||
| 1688 | Ga0587068_073356 | |||
| 1689 | Ga0587069_024639 | |||
| 1690 | Ga0587075_068341 | |||
| 1691 | Ga0587078_089476 | |||
| 1692 | Ga0587079_051091 | |||
| 1693 | Ga0587079_076662 | |||
| 1694 | Ga0587104_009990 | |||
| 1695 | Ga0587114_017539 | |||
| 1696 | Ga0587071_040609 | |||
| 1697 | Ga0587071_083584 | |||
| 1698 | Ga0587111_0096733 | |||
| 1699 | Ga0501082_0150864 | |||
| 1700 | Ga0501082_0571534 | |||
| 1701 | Ga0501082_0706465 | |||
| 1702 | Ga0466962_0043154 | |||
| 1703 | Ga0466962_0178297 | |||
| 1704 | Ga0466962_0590282 | |||
| 1705 | 2643753461 | |||
| 1706 | 2643848163 | |||
| 1707 | 2643875189 | |||
| 1708 | 2643995665 | |||
| 1709 | 2644198464 | |||
| 1710 | 2644382245 | |||
| 1711 | 2644456396 | |||
| 1712 | 2645723000 | |||
| 1713 | 2645725955 | |||
| 1714 | 2753301336 | |||
| 1715 | 2758226058 | |||
| 1716 | 2760306592 | |||
| 1717 | 2774380297 | |||
| 1718 | 2774384586 | |||
| 1719 | 2809195363 | |||
| 1720 | 2809227500 | |||
| 1721 | 2810363920 | |||
| 1722 | 2812323272 | |||
| 1723 | 2812364754 | |||
| 1724 | 2833711030 | |||
| 1725 | 2852634262 | |||
| 1726 | 2857720236 | |||
| 1727 | 2857730044 | |||
| 1728 | 2857733678 | |||
| 1729 | 2870630427 | |||
| 1730 | 2891972140 | |||
| 1731 | 2895661316 | |||
| 1732 | 2904433443 | |||
| 1733 | 2904503690 | |||
| 1734 | 2904511925 | |||
| 1735 | 2905926929 | |||
| 1736 | 2906800636 | |||
| 1737 | 2908675330 | |||
| 1738 | 2908680838 | |||
| 1739 | 2909075347 | |||
| 1740 | 2919040014 | |||
| 1741 | 2919044963 | |||
| 1742 | 2919071612 | |||
| 1743 | 2928091926 | |||
| 1744 | 2928106751 | |||
| 1745 | 2928123269 | |||
| 1746 | 2928501355 | |||
| 1747 | 2946004207 | |||
| 1748 | 2974297254 | |||
| 1749 | 2974326511 | |||
| 1750 | 2977231491 | |||
| 1751 | 2977240265 | |||
| 1752 | 2977266705 | |||
| 1753 | 2984545457 | |||
| 1754 | 2984553523 | |||
| 1755 | 2984581307 | |||
| 1756 | 2984594183 | |||
| 1757 | 8004214050 | |||
| 1758 | 8045831660 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ywy-assembly1.cif.gz_R | the structure of the mitoribosome from neurospora crassa with bound trna at the p-site | 0.9003 | 19 | 81 |
| 1v8q-assembly1.cif.gz_A | crystal structure of ribosomal protein l27 from thermus thermophilus hb8 | 0.8986 | 20 | 83 |
| 6yws-assembly1.cif.gz_R | the structure of the large subunit of the mitoribosome from neurospora crassa | 0.897 | 19 | 81 |
| 7pkt-assembly1.cif.gz_u | large subunit of the chlamydomonas reinhardtii mitoribosome | 0.8931 | 23 | 84 |
| 6ywv-assembly1.cif.gz_R | the structure of the atp25 bound assembly intermediate of the mitoribosome from neurospora crassa | 0.8913 | 19 | 81 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8986 | 20 | 83 | 2.40.50.100 |
| af_Q4DLT4_19_136_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8662 | 23 | 82 | 2.40.50.100 |
| af_Q4DVL3_299_475_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8646 | 67 | 80 | 3.40.50.300 |
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8604 | 20 | 83 | 2.40.50.100 |
| af_Q95XD0_22_81_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8225 | 27 | 85 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-I4M014-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.972 | 27 | 83 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-I0R0V1-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9663 | 23 | 83 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-W4UE80-F1-model_v4 | deleted | 0.964 | 23 | 84 |
|
| AF-A0A421K8E4-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9556 | 23 | 84 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-I4M014-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9556 | 27 | 83 |
GO:0003735
GO:0006412 GO:0022625 |