F484471
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 879 | 394 | 1758 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300048922|Ga0496119_0000344|Ga0496119_0000344_62357_62881 |
| Length | 174 |
| Sequence | MVQRVTSFVALKEVYVVRRIDGIDQNILRELQEDGRITNVELSKRVGISAPPCLRRVRSLEEDGIIRGYRALLDEKKLGFDLMAFAMVHLVSQAEADLSAFSEQVQRWPLVRSCWMLSGEVDFLLLCVAPDLRTFQSFVLELTGAPNVRNVKTALTLKQAKDAPVVPMEGVPQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001432 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 5 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 6 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 7 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 14 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 15 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 16 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 17 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 18 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 19 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 20 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 21 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 31 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 92 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 188 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 190 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 193 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 196 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 197 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 198 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 199 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 200 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 201 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 202 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 203 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 204 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 205 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 207 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 208 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 209 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 210 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 211 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 212 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 213 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 214 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 218 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 219 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 220 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 221 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 222 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 223 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 224 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 225 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 226 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 227 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 228 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 229 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 230 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 231 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 270 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 271 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 272 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 273 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 274 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 275 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 278 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 279 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 280 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 281 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 282 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 283 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 284 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 285 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 286 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 287 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 288 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 289 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 290 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 291 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 292 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 295 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 311 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 312 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 313 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 314 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 315 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 316 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 317 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 319 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 320 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 321 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 322 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 323 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 324 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 325 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 326 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 327 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 328 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 329 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 330 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 331 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 332 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 333 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 334 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 335 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 336 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 337 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 338 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 339 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 340 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 341 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 342 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 343 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 344 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 345 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 346 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 347 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 348 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 349 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 350 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 351 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 352 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 353 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 354 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 355 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 356 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 357 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 358 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 359 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 360 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 361 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 362 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 363 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 364 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 365 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 366 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 367 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 368 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 369 | 2842882022 | Bacillus sp. R-71893 | Isolate | Unclassified |
| 370 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 371 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 372 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 373 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 374 | 2904524088 | Priestia megaterium 1428 | Isolate | Rhizosphere |
| 375 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 376 | 2919143609 | Priestia megaterium 1751 | Isolate | Rhizosphere |
| 377 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 378 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 379 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 380 | 2928093941 | Priestia aryabhattai 1389 | Isolate | Rhizosphere |
| 381 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 382 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 383 | 2929004312 | Priestia megaterium 1104 | Isolate | Unclassified |
| 384 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 385 | 2960375949 | Priestia megaterium AFS067084 | Isolate | Unclassified |
| 386 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 387 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 388 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 389 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 390 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 391 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 392 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 393 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 394 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.77 |
| Metatranscriptomes | 0 |
| Isolates | 5.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.57 |
| Bulb | 0 |
| Endosphere | 19.68 |
| Nodule | 0.23 |
| Rhizoplane | 5.35 |
| Rhizosphere | 64.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496119_0000344 | 3300048922 | Bacteria | 65097 |
| 2 | SwRhRL2b_contig_2139260 | 2162886007 | Bacteria | 32362 |
| 3 | SwRhRL2b_contig_2638822 | 2162886007 | Bacteria | 2305 |
| 4 | SwRhRL2b_contig_3219086 | 2162886007 | Bacteria | 1214 |
| 5 | SwRhRL2b_contig_3748734 | 2162886007 | Bacteria | 1440 |
| 6 | SwRhRL2b_contig_887096 | 2162886007 | Bacteria | 970 |
| 7 | JGI24034J14986_101037 | 3300001432 | Bacteria | 1628 |
| 8 | JGI24736J21556_1000031 | 3300001904 | Bacteria | 24133 |
| 9 | JGI24741J21665_1017119 | 3300001915 | Bacteria | 1174 |
| 10 | JGI24752J21851_1000036 | 3300001976 | Bacteria | 15708 |
| 11 | JGI24740J21852_10007875 | 3300001979 | Bacteria | 4297 |
| 12 | JGI24739J22299_10003686 | 3300001989 | Bacteria | 5843 |
| 13 | JGI24739J22299_10017629 | 3300001989 | Bacteria | 2573 |
| 14 | JGI24737J22298_10007725 | 3300001990 | Bacteria | 3624 |
| 15 | JGI24750J21931_1000424 | 3300002070 | Bacteria | 6905 |
| 16 | JGI24748J21848_1000029 | 3300002074 | Bacteria | 90134 |
| 17 | JGI24748J21848_1010040 | 3300002074 | Bacteria | 1115 |
| 18 | JGI24738J21930_10002292 | 3300002075 | Bacteria | 5055 |
| 19 | JGI24738J21930_10008464 | 3300002075 | Bacteria | 2341 |
| 20 | JGI24034J26672_10000006 | 3300002239 | Bacteria | 294495 |
| 21 | JGI24034J26672_10010366 | 3300002239 | Bacteria | 1384 |
| 22 | JGI24742J22300_10002270 | 3300002244 | Bacteria | 3069 |
| 23 | JGI25152J39213_1025184 | 3300002773 | Bacteria | 989 |
| 24 | JGI25150J39212_1000020 | 3300002774 | Bacteria | 134928 |
| 25 | JGI25159J45721_1044908 | 3300002987 | Bacteria | 627 |
| 26 | JGI25151J46595_10001678 | 3300003187 | Bacteria | 14501 |
| 27 | JGI25151J46595_10010952 | 3300003187 | Bacteria | 4192 |
| 28 | JGI25151J46595_10011677 | 3300003187 | Bacteria | 4028 |
| 29 | JGI25151J46595_10014794 | 3300003187 | Bacteria | 3463 |
| 30 | JGI25151J46595_10015684 | 3300003187 | Bacteria | 3329 |
| 31 | JGI25165J46597_1000053 | 3300003214 | Bacteria | 235857 |
| 32 | JGI25153J46596_10000017 | 3300003215 | Bacteria | 274325 |
| 33 | Ga0055532_1000115 | 3300003758 | Bacteria | 85554 |
| 34 | Ga0055535_1004854 | 3300003761 | Bacteria | 3126 |
| 35 | Ga0055535_1013750 | 3300003761 | Bacteria | 1184 |
| 36 | Ga0055536_1001565 | 3300003781 | Bacteria | 13693 |
| 37 | Ga0055536_1010951 | 3300003781 | Bacteria | 3532 |
| 38 | Ga0055534_1017663 | 3300003784 | Bacteria | 1257 |
| 39 | Ga0055528_1003541 | 3300003790 | Bacteria | 7784 |
| 40 | Ga0055530_10000095 | 3300003791 | Bacteria | 74707 |
| 41 | Ga0055530_10010511 | 3300003791 | Bacteria | 3414 |
| 42 | Ga0055540_1009149 | 3300003792 | Bacteria | 3464 |
| 43 | Ga0055531_10001802 | 3300003794 | Bacteria | 15217 |
| 44 | Ga0055531_10002920 | 3300003794 | Bacteria | 11126 |
| 45 | Ga0055531_10022710 | 3300003794 | Bacteria | 2380 |
| 46 | Ga0055541_1000733 | 3300003841 | Bacteria | 8349 |
| 47 | JGI25405J52794_10001431 | 3300003911 | Bacteria | 3922 |
| 48 | Ga0065704_10000190 | 3300005289 | Bacteria | 213919 |
| 49 | Ga0065704_10003249 | 3300005289 | Bacteria | 4618 |
| 50 | Ga0065704_10095003 | 3300005289 | Bacteria | 2512 |
| 51 | Ga0065704_10143789 | 3300005289 | Bacteria | 1492 |
| 52 | Ga0065704_10145587 | 3300005289 | Bacteria | 1475 |
| 53 | Ga0065704_10316801 | 3300005289 | Bacteria | 859 |
| 54 | Ga0065707_10090604 | 3300005295 | Bacteria | 4108 |
| 55 | Ga0065707_10111706 | 3300005295 | Bacteria | 2386 |
| 56 | Ga0065707_10154342 | 3300005295 | Bacteria | 1624 |
| 57 | Ga0070658_10000371 | 3300005327 | Bacteria | 39178 |
| 58 | Ga0070658_10012881 | 3300005327 | Bacteria | 6713 |
| 59 | Ga0070658_10051560 | 3300005327 | Bacteria | 3334 |
| 60 | Ga0070658_10071384 | 3300005327 | Bacteria | 2844 |
| 61 | Ga0070658_10212206 | 3300005327 | Bacteria | 1636 |
| 62 | Ga0070683_100006345 | 3300005329 | Bacteria | 9915 |
| 63 | Ga0070683_100453623 | 3300005329 | Bacteria | 1223 |
| 64 | Ga0070690_100000002 | 3300005330 | Bacteria | 176748 |
| 65 | Ga0070670_100000168 | 3300005331 | Bacteria | 59111 |
| 66 | Ga0070670_100155116 | 3300005331 | Bacteria | 1983 |
| 67 | Ga0070670_100327523 | 3300005331 | Bacteria | 1343 |
| 68 | Ga0068869_100132712 | 3300005334 | Bacteria | 1916 |
| 69 | Ga0070666_10000014 | 3300005335 | Bacteria | 224479 |
| 70 | Ga0070680_100634730 | 3300005336 | Bacteria | 917 |
| 71 | Ga0070682_100276235 | 3300005337 | Bacteria | 1223 |
| 72 | Ga0070682_101065597 | 3300005337 | Bacteria | 675 |
| 73 | Ga0070660_100002018 | 3300005339 | Bacteria | 13999 |
| 74 | Ga0070660_100073658 | 3300005339 | Bacteria | 2671 |
| 75 | Ga0070660_100194506 | 3300005339 | Bacteria | 1643 |
| 76 | Ga0070660_100218824 | 3300005339 | Bacteria | 1547 |
| 77 | Ga0070689_100033303 | 3300005340 | Bacteria | 3925 |
| 78 | Ga0070691_10208696 | 3300005341 | Bacteria | 1030 |
| 79 | Ga0070687_100190789 | 3300005343 | Bacteria | 1235 |
| 80 | Ga0070661_100020845 | 3300005344 | Bacteria | 4677 |
| 81 | Ga0070692_10068259 | 3300005345 | Bacteria | 1889 |
| 82 | Ga0070668_100014755 | 3300005347 | Bacteria | 5840 |
| 83 | Ga0070668_100016256 | 3300005347 | Bacteria | 5565 |
| 84 | Ga0070668_100043654 | 3300005347 | Bacteria | 3438 |
| 85 | Ga0070668_100335559 | 3300005347 | Bacteria | 1276 |
| 86 | Ga0070669_100000184 | 3300005353 | Bacteria | 54362 |
| 87 | Ga0070669_100000839 | 3300005353 | Bacteria | 22301 |
| 88 | Ga0070669_100022491 | 3300005353 | Bacteria | 4507 |
| 89 | Ga0070669_100080190 | 3300005353 | Bacteria | 2429 |
| 90 | Ga0070669_100096449 | 3300005353 | Bacteria | 2225 |
| 91 | Ga0070671_100000686 | 3300005355 | Bacteria | 24340 |
| 92 | Ga0070671_100004299 | 3300005355 | Bacteria | 11274 |
| 93 | Ga0070671_100255540 | 3300005355 | Bacteria | 1489 |
| 94 | Ga0070671_100473123 | 3300005355 | Bacteria | 1076 |
| 95 | Ga0070671_101557935 | 3300005355 | Bacteria | 585 |
| 96 | Ga0070688_100019885 | 3300005365 | Bacteria | 3895 |
| 97 | Ga0070659_100003327 | 3300005366 | Bacteria | 11439 |
| 98 | Ga0070659_100178489 | 3300005366 | Bacteria | 1742 |
| 99 | Ga0070667_100000290 | 3300005367 | Bacteria | 56841 |
| 100 | Ga0070667_100000472 | 3300005367 | Bacteria | 41248 |
| 101 | Ga0070667_100001767 | 3300005367 | Bacteria | 19258 |
| 102 | Ga0070667_100002350 | 3300005367 | Bacteria | 16565 |
| 103 | Ga0070667_100012128 | 3300005367 | Bacteria | 7134 |
| 104 | Ga0070667_100035034 | 3300005367 | Bacteria | 4204 |
| 105 | Ga0070708_100629496 | 3300005445 | Bacteria | 1011 |
| 106 | Ga0070663_100205680 | 3300005455 | Bacteria | 1539 |
| 107 | Ga0070663_100247240 | 3300005455 | Bacteria | 1410 |
| 108 | Ga0070678_101149545 | 3300005456 | Bacteria | 718 |
| 109 | Ga0070662_100000992 | 3300005457 | Bacteria | 17362 |
| 110 | Ga0070662_100027322 | 3300005457 | Bacteria | 3959 |
| 111 | Ga0070662_100134929 | 3300005457 | Bacteria | 1907 |
| 112 | Ga0070681_10058148 | 3300005458 | Bacteria | 3846 |
| 113 | Ga0070685_10000056 | 3300005466 | Bacteria | 68183 |
| 114 | Ga0070706_100430942 | 3300005467 | Bacteria | 1227 |
| 115 | Ga0070679_100030942 | 3300005530 | Bacteria | 5287 |
| 116 | Ga0070679_100031798 | 3300005530 | Bacteria | 5218 |
| 117 | Ga0070679_100049007 | 3300005530 | Bacteria | 4207 |
| 118 | Ga0070679_100152916 | 3300005530 | Bacteria | 2284 |
| 119 | Ga0070679_100697722 | 3300005530 | Bacteria | 958 |
| 120 | Ga0070684_101156365 | 3300005535 | Bacteria | 728 |
| 121 | Ga0068853_100008448 | 3300005539 | Bacteria | 8273 |
| 122 | Ga0068853_100012276 | 3300005539 | Bacteria | 6966 |
| 123 | Ga0068853_100013171 | 3300005539 | Bacteria | 6749 |
| 124 | Ga0068853_100243348 | 3300005539 | Bacteria | 1649 |
| 125 | Ga0068853_100311825 | 3300005539 | Bacteria | 1456 |
| 126 | Ga0068853_100428357 | 3300005539 | Bacteria | 1242 |
| 127 | Ga0068853_100963837 | 3300005539 | Bacteria | 820 |
| 128 | Ga0070686_100000002 | 3300005544 | Bacteria | 336303 |
| 129 | Ga0070665_100000025 | 3300005548 | Bacteria | 367488 |
| 130 | Ga0070665_100000076 | 3300005548 | Bacteria | 189228 |
| 131 | Ga0070665_100005505 | 3300005548 | Bacteria | 13037 |
| 132 | Ga0070665_100045652 | 3300005548 | Bacteria | 4400 |
| 133 | Ga0070704_100406164 | 3300005549 | Bacteria | 1163 |
| 134 | Ga0068855_100046850 | 3300005563 | Bacteria | 5110 |
| 135 | Ga0068855_100253307 | 3300005563 | Bacteria | 1963 |
| 136 | Ga0068855_100289651 | 3300005563 | Bacteria | 1816 |
| 137 | Ga0068855_100588600 | 3300005563 | Bacteria | 1201 |
| 138 | Ga0068855_100648909 | 3300005563 | Bacteria | 1134 |
| 139 | Ga0068855_101412377 | 3300005563 | Bacteria | 717 |
| 140 | Ga0070664_100010887 | 3300005564 | Bacteria | 7376 |
| 141 | Ga0070664_100240706 | 3300005564 | Bacteria | 1624 |
| 142 | Ga0068857_100088803 | 3300005577 | Bacteria | 2765 |
| 143 | Ga0068857_100179407 | 3300005577 | Bacteria | 1927 |
| 144 | Ga0068857_100195436 | 3300005577 | Bacteria | 1843 |
| 145 | Ga0068857_100229812 | 3300005577 | Bacteria | 1696 |
| 146 | Ga0068857_100233204 | 3300005577 | Bacteria | 1684 |
| 147 | Ga0068857_100859217 | 3300005577 | Bacteria | 868 |
| 148 | Ga0068854_100004727 | 3300005578 | Bacteria | 8584 |
| 149 | Ga0068854_100039497 | 3300005578 | Bacteria | 3325 |
| 150 | Ga0068854_100361610 | 3300005578 | Bacteria | 1191 |
| 151 | Ga0068854_100607981 | 3300005578 | Bacteria | 934 |
| 152 | Ga0068856_100001125 | 3300005614 | Bacteria | 28271 |
| 153 | Ga0068856_100011802 | 3300005614 | Bacteria | 8468 |
| 154 | Ga0068856_100132888 | 3300005614 | Bacteria | 2494 |
| 155 | Ga0068852_100000083 | 3300005616 | Bacteria | 65822 |
| 156 | Ga0068852_100023139 | 3300005616 | Bacteria | 4995 |
| 157 | Ga0068852_100028520 | 3300005616 | Bacteria | 4571 |
| 158 | Ga0068852_100266764 | 3300005616 | Bacteria | 1646 |
| 159 | Ga0068852_100435229 | 3300005616 | Bacteria | 1296 |
| 160 | Ga0068852_100803667 | 3300005616 | Bacteria | 955 |
| 161 | Ga0068852_100908872 | 3300005616 | Bacteria | 897 |
| 162 | Ga0068852_100973101 | 3300005616 | Bacteria | 867 |
| 163 | Ga0068859_100061439 | 3300005617 | Bacteria | 3786 |
| 164 | Ga0068864_100000063 | 3300005618 | Bacteria | 119845 |
| 165 | Ga0068864_100004504 | 3300005618 | Bacteria | 11457 |
| 166 | Ga0068864_100022037 | 3300005618 | Bacteria | 5339 |
| 167 | Ga0068864_100035463 | 3300005618 | Bacteria | 4247 |
| 168 | Ga0068864_100693797 | 3300005618 | Bacteria | 994 |
| 169 | Ga0068864_100745331 | 3300005618 | Bacteria | 960 |
| 170 | Ga0068861_100004572 | 3300005719 | Bacteria | 9290 |
| 171 | Ga0068861_101246335 | 3300005719 | Bacteria | 721 |
| 172 | Ga0068851_10183942 | 3300005834 | Bacteria | 1158 |
| 173 | Ga0068863_100000014 | 3300005841 | Bacteria | 216135 |
| 174 | Ga0068863_100000062 | 3300005841 | Bacteria | 119845 |
| 175 | Ga0068863_100000070 | 3300005841 | Bacteria | 115715 |
| 176 | Ga0068863_100080373 | 3300005841 | Bacteria | 3088 |
| 177 | Ga0068863_100342066 | 3300005841 | Bacteria | 1455 |
| 178 | Ga0068863_100648183 | 3300005841 | Bacteria | 1047 |
| 179 | Ga0068858_100000313 | 3300005842 | Bacteria | 51649 |
| 180 | Ga0068858_100002369 | 3300005842 | Bacteria | 19058 |
| 181 | Ga0068858_100003260 | 3300005842 | Bacteria | 16176 |
| 182 | Ga0068858_100156431 | 3300005842 | Bacteria | 2145 |
| 183 | Ga0068858_100353831 | 3300005842 | Bacteria | 1407 |
| 184 | Ga0068858_101165476 | 3300005842 | Bacteria | 757 |
| 185 | Ga0068860_100000001 | 3300005843 | Bacteria | 703043 |
| 186 | Ga0068860_100000007 | 3300005843 | Bacteria | 429329 |
| 187 | Ga0068860_100011780 | 3300005843 | Bacteria | 8619 |
| 188 | Ga0068860_100029781 | 3300005843 | Bacteria | 5251 |
| 189 | Ga0068862_100000020 | 3300005844 | Bacteria | 219516 |
| 190 | Ga0068862_100000069 | 3300005844 | Bacteria | 122535 |
| 191 | Ga0068862_100012958 | 3300005844 | Bacteria | 6898 |
| 192 | Ga0068862_100062551 | 3300005844 | Bacteria | 3201 |
| 193 | Ga0068862_100081269 | 3300005844 | Bacteria | 2811 |
| 194 | Ga0081455_10001124 | 3300005937 | Bacteria | 33435 |
| 195 | Ga0075365_10067981 | 3300006038 | Bacteria | 2393 |
| 196 | Ga0075368_10000199 | 3300006042 | Bacteria | 16601 |
| 197 | Ga0075368_10092963 | 3300006042 | Bacteria | 1234 |
| 198 | Ga0075363_100009342 | 3300006048 | Bacteria | 4608 |
| 199 | Ga0075363_100017436 | 3300006048 | Bacteria | 3561 |
| 200 | Ga0075364_10002598 | 3300006051 | Bacteria | 10133 |
| 201 | Ga0075364_10102269 | 3300006051 | Bacteria | 1908 |
| 202 | Ga0075364_10151087 | 3300006051 | Bacteria | 1565 |
| 203 | Ga0075364_10551599 | 3300006051 | Bacteria | 788 |
| 204 | Ga0075364_10611915 | 3300006051 | Bacteria | 744 |
| 205 | Ga0075362_10000041 | 3300006177 | Bacteria | 45834 |
| 206 | Ga0075362_10046036 | 3300006177 | Bacteria | 1939 |
| 207 | Ga0075367_10022138 | 3300006178 | Bacteria | 3561 |
| 208 | Ga0075367_10648801 | 3300006178 | Bacteria | 671 |
| 209 | Ga0075369_10000994 | 3300006186 | Bacteria | 9454 |
| 210 | Ga0075369_10120093 | 3300006186 | Bacteria | 1189 |
| 211 | Ga0075366_10000150 | 3300006195 | Bacteria | 29547 |
| 212 | Ga0075366_10028344 | 3300006195 | Bacteria | 3287 |
| 213 | Ga0075366_10217878 | 3300006195 | Bacteria | 1163 |
| 214 | Ga0075366_10436965 | 3300006195 | Bacteria | 807 |
| 215 | Ga0075370_10000003 | 3300006353 | Bacteria | 133163 |
| 216 | Ga0075370_10018925 | 3300006353 | Bacteria | 3740 |
| 217 | Ga0075370_10033548 | 3300006353 | Bacteria | 2875 |
| 218 | Ga0075370_10036616 | 3300006353 | Bacteria | 2757 |
| 219 | Ga0075370_10093820 | 3300006353 | Bacteria | 1733 |
| 220 | Ga0075370_10158613 | 3300006353 | Bacteria | 1327 |
| 221 | Ga0075370_10502340 | 3300006353 | Bacteria | 732 |
| 222 | Ga0097620_100061439 | 3300006931 | Bacteria | 3786 |
| 223 | Ga0079104_1027201 | 3300006946 | Bacteria | 1469 |
| 224 | Ga0105251_10001315 | 3300009011 | Bacteria | 21467 |
| 225 | Ga0105251_10006102 | 3300009011 | Bacteria | 7763 |
| 226 | Ga0105251_10007785 | 3300009011 | Bacteria | 6528 |
| 227 | Ga0105251_10052664 | 3300009011 | Bacteria | 1937 |
| 228 | Ga0105244_10016502 | 3300009036 | Bacteria | 4204 |
| 229 | Ga0105250_10002953 | 3300009092 | Bacteria | 8277 |
| 230 | Ga0105250_10021336 | 3300009092 | Bacteria | 2615 |
| 231 | Ga0105250_10104782 | 3300009092 | Bacteria | 1156 |
| 232 | Ga0105250_10142772 | 3300009092 | Bacteria | 993 |
| 233 | Ga0105250_10148598 | 3300009092 | Bacteria | 974 |
| 234 | Ga0105250_10189082 | 3300009092 | Bacteria | 866 |
| 235 | Ga0105240_10029936 | 3300009093 | Bacteria | 7084 |
| 236 | Ga0105247_10050332 | 3300009101 | Bacteria | 2563 |
| 237 | Ga0105247_10056551 | 3300009101 | Bacteria | 2423 |
| 238 | Ga0105247_10087521 | 3300009101 | Bacteria | 1973 |
| 239 | Ga0105243_10114789 | 3300009148 | Bacteria | 2260 |
| 240 | Ga0105241_10130650 | 3300009174 | Bacteria | 2033 |
| 241 | Ga0105248_10000284 | 3300009177 | Bacteria | 59750 |
| 242 | Ga0105248_10004661 | 3300009177 | Bacteria | 15178 |
| 243 | Ga0105248_10048387 | 3300009177 | Bacteria | 4770 |
| 244 | Ga0105248_10104896 | 3300009177 | Bacteria | 3187 |
| 245 | Ga0105248_10157534 | 3300009177 | Bacteria | 2562 |
| 246 | Ga0105237_10788457 | 3300009545 | Bacteria | 957 |
| 247 | Ga0105238_10058547 | 3300009551 | Bacteria | 3861 |
| 248 | Ga0105238_10078333 | 3300009551 | Bacteria | 3295 |
| 249 | Ga0105238_10121889 | 3300009551 | Bacteria | 2587 |
| 250 | Ga0105238_10435814 | 3300009551 | Bacteria | 1306 |
| 251 | Ga0105238_11443078 | 3300009551 | Bacteria | 716 |
| 252 | Ga0105238_11605734 | 3300009551 | Bacteria | 680 |
| 253 | Ga0105249_10000005 | 3300009553 | Bacteria | 362467 |
| 254 | Ga0105249_10000160 | 3300009553 | Bacteria | 81883 |
| 255 | Ga0105249_10136026 | 3300009553 | Bacteria | 2351 |
| 256 | Ga0105249_10463585 | 3300009553 | Bacteria | 1307 |
| 257 | Ga0105249_11242858 | 3300009553 | Bacteria | 816 |
| 258 | Ga0105246_10011029 | 3300011119 | Bacteria | 5600 |
| 259 | Ga0105246_10803155 | 3300011119 | Bacteria | 835 |
| 260 | Ga0157373_10053241 | 3300013100 | Bacteria | 2878 |
| 261 | Ga0157373_10116318 | 3300013100 | Bacteria | 1879 |
| 262 | Ga0157371_10001947 | 3300013102 | Bacteria | 20528 |
| 263 | Ga0157371_10171692 | 3300013102 | Bacteria | 1549 |
| 264 | Ga0157371_10444426 | 3300013102 | Bacteria | 953 |
| 265 | Ga0157370_10010227 | 3300013104 | Bacteria | 9906 |
| 266 | Ga0157370_10583082 | 3300013104 | Bacteria | 1024 |
| 267 | Ga0157370_10989143 | 3300013104 | Bacteria | 762 |
| 268 | Ga0157369_10000968 | 3300013105 | Bacteria | 36428 |
| 269 | Ga0157369_10031914 | 3300013105 | Bacteria | 5796 |
| 270 | Ga0157374_10027466 | 3300013296 | Bacteria | 5135 |
| 271 | Ga0157374_10476509 | 3300013296 | Bacteria | 1251 |
| 272 | Ga0157378_10065632 | 3300013297 | Bacteria | 3249 |
| 273 | Ga0157378_10417725 | 3300013297 | Bacteria | 1325 |
| 274 | Ga0157378_10938346 | 3300013297 | Bacteria | 897 |
| 275 | Ga0163162_10030993 | 3300013306 | Bacteria | 5302 |
| 276 | Ga0163162_10040293 | 3300013306 | Bacteria | 4671 |
| 277 | Ga0163162_10097636 | 3300013306 | Bacteria | 3026 |
| 278 | Ga0163162_10371029 | 3300013306 | Bacteria | 1564 |
| 279 | Ga0163162_10641933 | 3300013306 | Bacteria | 1186 |
| 280 | Ga0157372_10001238 | 3300013307 | Bacteria | 27605 |
| 281 | Ga0157372_10062791 | 3300013307 | Bacteria | 4163 |
| 282 | Ga0157372_10124496 | 3300013307 | Bacteria | 2963 |
| 283 | Ga0157372_10356831 | 3300013307 | Bacteria | 1703 |
| 284 | Ga0157375_10748286 | 3300013308 | Bacteria | 1129 |
| 285 | Ga0163163_10094960 | 3300014325 | Bacteria | 3001 |
| 286 | Ga0157377_10328575 | 3300014745 | Bacteria | 1018 |
| 287 | Ga0157377_10373619 | 3300014745 | Bacteria | 963 |
| 288 | Ga0157379_10037286 | 3300014968 | Bacteria | 4334 |
| 289 | Ga0157379_10083251 | 3300014968 | Bacteria | 2867 |
| 290 | Ga0163161_10000115 | 3300017792 | Bacteria | 76319 |
| 291 | Ga0163161_10026756 | 3300017792 | Bacteria | 4088 |
| 292 | Ga0163161_10626923 | 3300017792 | Bacteria | 889 |
| 293 | Ga0163161_11072191 | 3300017792 | Bacteria | 691 |
| 294 | Ga0209566_100042 | 3300025225 | Bacteria | 287384 |
| 295 | Ga0209147_100088 | 3300025229 | Bacteria | 179728 |
| 296 | Ga0209147_105356 | 3300025229 | Bacteria | 1934 |
| 297 | Ga0209437_105443 | 3300025233 | Bacteria | 2170 |
| 298 | Ga0209258_100827 | 3300025242 | Bacteria | 17191 |
| 299 | Ga0209258_103603 | 3300025242 | Bacteria | 3266 |
| 300 | Ga0207425_1000022 | 3300025245 | Bacteria | 355305 |
| 301 | Ga0209129_1001473 | 3300025258 | Bacteria | 13099 |
| 302 | Ga0209233_1000119 | 3300025261 | Bacteria | 235924 |
| 303 | Ga0209455_1013376 | 3300025272 | Bacteria | 1907 |
| 304 | Ga0209673_1002724 | 3300025273 | Bacteria | 11656 |
| 305 | Ga0209130_1017142 | 3300025284 | Bacteria | 1734 |
| 306 | Ga0209675_1000025 | 3300025291 | Bacteria | 294102 |
| 307 | Ga0209676_1000198 | 3300025292 | Bacteria | 134708 |
| 308 | Ga0209676_1000228 | 3300025292 | Bacteria | 123024 |
| 309 | Ga0209676_1000362 | 3300025292 | Bacteria | 85770 |
| 310 | Ga0209676_1005754 | 3300025292 | Bacteria | 6352 |
| 311 | Ga0209676_1032137 | 3300025292 | Bacteria | 1582 |
| 312 | Ga0209025_1000842 | 3300025294 | Bacteria | 48558 |
| 313 | Ga0209025_1001397 | 3300025294 | Bacteria | 32105 |
| 314 | Ga0209025_1001925 | 3300025294 | Bacteria | 24064 |
| 315 | Ga0209025_1003543 | 3300025294 | Bacteria | 14640 |
| 316 | Ga0209025_1008600 | 3300025294 | Bacteria | 7310 |
| 317 | Ga0209025_1009349 | 3300025294 | Bacteria | 6852 |
| 318 | Ga0209025_1010389 | 3300025294 | Bacteria | 6312 |
| 319 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 320 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 321 | Ga0209050_1000367 | 3300025298 | Bacteria | 86573 |
| 322 | Ga0209050_1000728 | 3300025298 | Bacteria | 47923 |
| 323 | Ga0209050_1011865 | 3300025298 | Bacteria | 4072 |
| 324 | Ga0209050_1072117 | 3300025298 | Bacteria | 766 |
| 325 | Ga0207426_1011617 | 3300025302 | Bacteria | 3344 |
| 326 | Ga0209051_1000246 | 3300025303 | Bacteria | 91170 |
| 327 | Ga0209257_1000229 | 3300025304 | Bacteria | 133121 |
| 328 | Ga0209257_1000596 | 3300025304 | Bacteria | 59951 |
| 329 | Ga0209257_1008070 | 3300025304 | Bacteria | 6128 |
| 330 | Ga0207697_10106721 | 3300025315 | Bacteria | 1197 |
| 331 | Ga0207656_10160934 | 3300025321 | Bacteria | 1068 |
| 332 | Ga0207696_1004520 | 3300025711 | Bacteria | 5976 |
| 333 | Ga0207696_1011155 | 3300025711 | Bacteria | 3251 |
| 334 | Ga0207696_1031305 | 3300025711 | Bacteria | 1610 |
| 335 | Ga0207696_1031890 | 3300025711 | Bacteria | 1590 |
| 336 | Ga0207655_1005646 | 3300025728 | Bacteria | 8461 |
| 337 | Ga0207655_1013231 | 3300025728 | Bacteria | 4751 |
| 338 | Ga0207713_1007454 | 3300025735 | Bacteria | 6454 |
| 339 | Ga0207713_1010725 | 3300025735 | Bacteria | 5048 |
| 340 | Ga0207713_1014855 | 3300025735 | Bacteria | 4019 |
| 341 | Ga0207713_1021570 | 3300025735 | Bacteria | 3083 |
| 342 | Ga0207713_1046744 | 3300025735 | Bacteria | 1758 |
| 343 | Ga0207710_10044681 | 3300025900 | Bacteria | 1973 |
| 344 | Ga0207710_10137611 | 3300025900 | Bacteria | 1177 |
| 345 | Ga0207680_10000004 | 3300025903 | Bacteria | 827324 |
| 346 | Ga0207680_10081041 | 3300025903 | Bacteria | 2039 |
| 347 | Ga0207680_10210525 | 3300025903 | Bacteria | 1329 |
| 348 | Ga0207647_10000555 | 3300025904 | Bacteria | 29646 |
| 349 | Ga0207647_10069787 | 3300025904 | Bacteria | 2124 |
| 350 | Ga0207705_10000004 | 3300025909 | Bacteria | 705756 |
| 351 | Ga0207705_10026510 | 3300025909 | Bacteria | 4133 |
| 352 | Ga0207705_10063556 | 3300025909 | Bacteria | 2667 |
| 353 | Ga0207705_10268542 | 3300025909 | Bacteria | 1304 |
| 354 | Ga0207684_10760646 | 3300025910 | Bacteria | 821 |
| 355 | Ga0207654_10004092 | 3300025911 | Bacteria | 7346 |
| 356 | Ga0207654_10393046 | 3300025911 | Bacteria | 963 |
| 357 | Ga0207707_10051378 | 3300025912 | Bacteria | 3589 |
| 358 | Ga0207695_10003879 | 3300025913 | Bacteria | 20700 |
| 359 | Ga0207695_10012208 | 3300025913 | Bacteria | 10316 |
| 360 | Ga0207671_10001983 | 3300025914 | Bacteria | 22572 |
| 361 | Ga0207660_10131387 | 3300025917 | Bacteria | 1906 |
| 362 | Ga0207657_10001614 | 3300025919 | Bacteria | 24260 |
| 363 | Ga0207657_10037866 | 3300025919 | Bacteria | 4301 |
| 364 | Ga0207649_10026472 | 3300025920 | Bacteria | 3393 |
| 365 | Ga0207652_10018883 | 3300025921 | Bacteria | 5659 |
| 366 | Ga0207652_10021249 | 3300025921 | Bacteria | 5356 |
| 367 | Ga0207652_10056452 | 3300025921 | Bacteria | 3380 |
| 368 | Ga0207681_10000130 | 3300025923 | Bacteria | 61067 |
| 369 | Ga0207681_10000140 | 3300025923 | Bacteria | 60064 |
| 370 | Ga0207681_10010126 | 3300025923 | Bacteria | 5770 |
| 371 | Ga0207681_10333281 | 3300025923 | Bacteria | 1210 |
| 372 | Ga0207681_10511467 | 3300025923 | Bacteria | 984 |
| 373 | Ga0207681_10792267 | 3300025923 | Bacteria | 791 |
| 374 | Ga0207694_10005262 | 3300025924 | Bacteria | 9967 |
| 375 | Ga0207694_10007000 | 3300025924 | Bacteria | 8562 |
| 376 | Ga0207694_10046380 | 3300025924 | Bacteria | 3359 |
| 377 | Ga0207694_10103465 | 3300025924 | Bacteria | 2258 |
| 378 | Ga0207694_10534438 | 3300025924 | Bacteria | 983 |
| 379 | Ga0207650_10000142 | 3300025925 | Bacteria | 87599 |
| 380 | Ga0207650_10057847 | 3300025925 | Bacteria | 2885 |
| 381 | Ga0207650_10086523 | 3300025925 | Bacteria | 2386 |
| 382 | Ga0207650_10354042 | 3300025925 | Bacteria | 1208 |
| 383 | Ga0207687_10000259 | 3300025927 | Bacteria | 36055 |
| 384 | Ga0207644_10000811 | 3300025931 | Bacteria | 19839 |
| 385 | Ga0207644_10000818 | 3300025931 | Bacteria | 19768 |
| 386 | Ga0207644_10006799 | 3300025931 | Bacteria | 7454 |
| 387 | Ga0207644_10325543 | 3300025931 | Bacteria | 1243 |
| 388 | Ga0207644_10851638 | 3300025931 | Bacteria | 763 |
| 389 | Ga0207690_10000894 | 3300025932 | Bacteria | 19034 |
| 390 | Ga0207690_10904539 | 3300025932 | Bacteria | 732 |
| 391 | Ga0207706_10000035 | 3300025933 | Bacteria | 138894 |
| 392 | Ga0207706_10009604 | 3300025933 | Bacteria | 8880 |
| 393 | Ga0207706_10095537 | 3300025933 | Bacteria | 2614 |
| 394 | Ga0207709_10314763 | 3300025935 | Bacteria | 1169 |
| 395 | Ga0207709_10429189 | 3300025935 | Bacteria | 1017 |
| 396 | Ga0207670_10039261 | 3300025936 | Bacteria | 3099 |
| 397 | Ga0207711_10000017 | 3300025941 | Bacteria | 441730 |
| 398 | Ga0207711_10071888 | 3300025941 | Bacteria | 3003 |
| 399 | Ga0207711_10202664 | 3300025941 | Bacteria | 1811 |
| 400 | Ga0207689_10117467 | 3300025942 | Bacteria | 2187 |
| 401 | Ga0207661_10132887 | 3300025944 | Bacteria | 2134 |
| 402 | Ga0207661_10170932 | 3300025944 | Bacteria | 1892 |
| 403 | Ga0207679_10070830 | 3300025945 | Bacteria | 2628 |
| 404 | Ga0207667_10016664 | 3300025949 | Bacteria | 8293 |
| 405 | Ga0207667_10056319 | 3300025949 | Bacteria | 4130 |
| 406 | Ga0207667_10090978 | 3300025949 | Bacteria | 3153 |
| 407 | Ga0207667_10093031 | 3300025949 | Bacteria | 3114 |
| 408 | Ga0207667_10392664 | 3300025949 | Bacteria | 1413 |
| 409 | Ga0207667_11041425 | 3300025949 | Bacteria | 804 |
| 410 | Ga0207712_10000001 | 3300025961 | Bacteria | 750309 |
| 411 | Ga0207712_10000527 | 3300025961 | Bacteria | 31373 |
| 412 | Ga0207712_10189723 | 3300025961 | Bacteria | 1621 |
| 413 | Ga0207668_10006786 | 3300025972 | Bacteria | 6779 |
| 414 | Ga0207668_10027876 | 3300025972 | Bacteria | 3685 |
| 415 | Ga0207668_10032021 | 3300025972 | Bacteria | 3470 |
| 416 | Ga0207668_10048371 | 3300025972 | Bacteria | 2918 |
| 417 | Ga0207640_10001101 | 3300025981 | Bacteria | 14929 |
| 418 | Ga0207640_10014152 | 3300025981 | Bacteria | 4586 |
| 419 | Ga0207640_10015711 | 3300025981 | Bacteria | 4387 |
| 420 | Ga0207640_10105323 | 3300025981 | Bacteria | 1987 |
| 421 | Ga0207640_10528614 | 3300025981 | Bacteria | 987 |
| 422 | Ga0207640_11080116 | 3300025981 | Bacteria | 709 |
| 423 | Ga0207640_11259434 | 3300025981 | Bacteria | 659 |
| 424 | Ga0207658_10000133 | 3300025986 | Bacteria | 78402 |
| 425 | Ga0207658_10001207 | 3300025986 | Bacteria | 20562 |
| 426 | Ga0207658_10001257 | 3300025986 | Bacteria | 20066 |
| 427 | Ga0207658_10003755 | 3300025986 | Bacteria | 10697 |
| 428 | Ga0207658_10012197 | 3300025986 | Bacteria | 5864 |
| 429 | Ga0207658_10053887 | 3300025986 | Bacteria | 2974 |
| 430 | Ga0207677_11453050 | 3300026023 | Bacteria | 632 |
| 431 | Ga0207703_10000961 | 3300026035 | Bacteria | 27866 |
| 432 | Ga0207703_10001460 | 3300026035 | Bacteria | 21567 |
| 433 | Ga0207703_10002071 | 3300026035 | Bacteria | 17638 |
| 434 | Ga0207703_10025076 | 3300026035 | Bacteria | 4690 |
| 435 | Ga0207703_10051426 | 3300026035 | Bacteria | 3339 |
| 436 | Ga0207703_10116628 | 3300026035 | Bacteria | 2286 |
| 437 | Ga0207703_10325827 | 3300026035 | Bacteria | 1408 |
| 438 | Ga0207639_10001012 | 3300026041 | Bacteria | 19116 |
| 439 | Ga0207639_10007855 | 3300026041 | Bacteria | 7287 |
| 440 | Ga0207639_10111311 | 3300026041 | Bacteria | 2232 |
| 441 | Ga0207639_10184052 | 3300026041 | Bacteria | 1779 |
| 442 | Ga0207639_10538988 | 3300026041 | Bacteria | 1070 |
| 443 | Ga0207639_10916894 | 3300026041 | Bacteria | 819 |
| 444 | Ga0207678_10028298 | 3300026067 | Bacteria | 4893 |
| 445 | Ga0207678_10106424 | 3300026067 | Bacteria | 2393 |
| 446 | Ga0207702_10043320 | 3300026078 | Bacteria | 3779 |
| 447 | Ga0207702_10139976 | 3300026078 | Bacteria | 2188 |
| 448 | Ga0207641_10000022 | 3300026088 | Bacteria | 279334 |
| 449 | Ga0207641_10000033 | 3300026088 | Bacteria | 219261 |
| 450 | Ga0207641_10000126 | 3300026088 | Bacteria | 112607 |
| 451 | Ga0207641_10020015 | 3300026088 | Bacteria | 5494 |
| 452 | Ga0207676_10000056 | 3300026095 | Bacteria | 124484 |
| 453 | Ga0207676_10011444 | 3300026095 | Bacteria | 6341 |
| 454 | Ga0207676_10337223 | 3300026095 | Bacteria | 1389 |
| 455 | Ga0207676_11395351 | 3300026095 | Bacteria | 696 |
| 456 | Ga0207674_10019205 | 3300026116 | Bacteria | 7410 |
| 457 | Ga0207674_10023877 | 3300026116 | Bacteria | 6540 |
| 458 | Ga0207674_10045037 | 3300026116 | Bacteria | 4541 |
| 459 | Ga0207674_10073006 | 3300026116 | Bacteria | 3445 |
| 460 | Ga0207674_10128780 | 3300026116 | Bacteria | 2496 |
| 461 | Ga0207674_10187178 | 3300026116 | Bacteria | 2020 |
| 462 | Ga0207674_10315125 | 3300026116 | Bacteria | 1513 |
| 463 | Ga0207675_100004034 | 3300026118 | Bacteria | 14233 |
| 464 | Ga0207675_101291922 | 3300026118 | Bacteria | 750 |
| 465 | Ga0207698_10000789 | 3300026142 | Bacteria | 18471 |
| 466 | Ga0207698_10025403 | 3300026142 | Bacteria | 4173 |
| 467 | Ga0207698_10041250 | 3300026142 | Bacteria | 3437 |
| 468 | Ga0207698_10273943 | 3300026142 | Bacteria | 1557 |
| 469 | Ga0209982_1070845 | 3300027552 | Bacteria | 571 |
| 470 | Ga0209813_10000065 | 3300027866 | Bacteria | 42169 |
| 471 | Ga0209813_10070003 | 3300027866 | Bacteria | 1138 |
| 472 | Ga0209974_10014350 | 3300027876 | Bacteria | 2636 |
| 473 | Ga0209974_10065284 | 3300027876 | Bacteria | 1236 |
| 474 | Ga0268266_10000028 | 3300028379 | Bacteria | 425294 |
| 475 | Ga0268266_10000317 | 3300028379 | Bacteria | 76446 |
| 476 | Ga0268266_10011921 | 3300028379 | Bacteria | 7529 |
| 477 | Ga0268266_10027588 | 3300028379 | Bacteria | 4827 |
| 478 | Ga0268265_10000044 | 3300028380 | Bacteria | 182545 |
| 479 | Ga0268265_10000071 | 3300028380 | Bacteria | 132890 |
| 480 | Ga0268265_10004791 | 3300028380 | Bacteria | 9326 |
| 481 | Ga0268265_10008961 | 3300028380 | Bacteria | 6767 |
| 482 | Ga0268265_10319921 | 3300028380 | Bacteria | 1404 |
| 483 | Ga0268264_10000006 | 3300028381 | Bacteria | 827324 |
| 484 | Ga0268264_10000077 | 3300028381 | Bacteria | 252597 |
| 485 | Ga0268264_10009226 | 3300028381 | Bacteria | 8172 |
| 486 | Ga0268264_10021239 | 3300028381 | Bacteria | 5304 |
| 487 | Ga0237817_10090 | 3300030083 | Bacteria | 27984 |
| 488 | Ga0265331_10133611 | 3300031250 | Bacteria | 1131 |
| 489 | Ga0307513_10097855 | 3300031456 | Bacteria | 2968 |
| 490 | Ga0307509_10068266 | 3300031507 | Bacteria | 3721 |
| 491 | Ga0307408_100281517 | 3300031548 | Bacteria | 1385 |
| 492 | Ga0307408_100316845 | 3300031548 | Bacteria | 1312 |
| 493 | Ga0307408_100885506 | 3300031548 | Bacteria | 816 |
| 494 | Ga0307508_10000858 | 3300031616 | Bacteria | 35331 |
| 495 | Ga0316575_10167435 | 3300031665 | Bacteria | 910 |
| 496 | Ga0307405_10236709 | 3300031731 | Bacteria | 1349 |
| 497 | Ga0307405_10700828 | 3300031731 | Bacteria | 838 |
| 498 | Ga0307413_10555867 | 3300031824 | Bacteria | 932 |
| 499 | Ga0307410_10012162 | 3300031852 | Bacteria | 4961 |
| 500 | Ga0307410_10117311 | 3300031852 | Bacteria | 1935 |
| 501 | Ga0307406_10033048 | 3300031901 | Bacteria | 3163 |
| 502 | Ga0307406_10143048 | 3300031901 | Bacteria | 1696 |
| 503 | Ga0307406_10225051 | 3300031901 | Bacteria | 1397 |
| 504 | Ga0307406_10234405 | 3300031901 | Bacteria | 1373 |
| 505 | Ga0307407_10216287 | 3300031903 | Bacteria | 1293 |
| 506 | Ga0307412_10005487 | 3300031911 | Bacteria | 7122 |
| 507 | Ga0307412_10093964 | 3300031911 | Bacteria | 2105 |
| 508 | Ga0307412_10173219 | 3300031911 | Bacteria | 1615 |
| 509 | Ga0307412_10247951 | 3300031911 | Bacteria | 1381 |
| 510 | Ga0307412_10397806 | 3300031911 | Bacteria | 1120 |
| 511 | Ga0307416_101276032 | 3300032002 | Bacteria | 840 |
| 512 | Ga0307416_102036845 | 3300032002 | Bacteria | 676 |
| 513 | Ga0307414_10000918 | 3300032004 | Bacteria | 15065 |
| 514 | Ga0307414_10011317 | 3300032004 | Bacteria | 5227 |
| 515 | Ga0307414_10025158 | 3300032004 | Bacteria | 3808 |
| 516 | Ga0307414_10032511 | 3300032004 | Bacteria | 3436 |
| 517 | Ga0307414_10202579 | 3300032004 | Bacteria | 1615 |
| 518 | Ga0307414_10221998 | 3300032004 | Bacteria | 1552 |
| 519 | Ga0307414_10255086 | 3300032004 | Bacteria | 1460 |
| 520 | Ga0307414_10280158 | 3300032004 | Bacteria | 1400 |
| 521 | Ga0307414_10318250 | 3300032004 | Bacteria | 1323 |
| 522 | Ga0307414_11194778 | 3300032004 | Bacteria | 704 |
| 523 | Ga0307411_10005827 | 3300032005 | Bacteria | 6105 |
| 524 | Ga0307411_10014776 | 3300032005 | Bacteria | 4358 |
| 525 | Ga0307411_10081670 | 3300032005 | Bacteria | 2227 |
| 526 | Ga0307415_100155593 | 3300032126 | Bacteria | 1765 |
| 527 | Ga0307510_10065943 | 3300033180 | Bacteria | 3660 |
| 528 | Ga0373932_0075523 | 3300035112 | Bacteria | 1054 |
| 529 | Ga0316582_0163214 | 3300036647 | Bacteria | 1510 |
| 530 | Ga0316582_0233726 | 3300036647 | Bacteria | 1258 |
| 531 | Ga0316584_0144004 | 3300036712 | Bacteria | 1776 |
| 532 | Ga0316584_0200377 | 3300036712 | Bacteria | 1473 |
| 533 | Ga0395900_0007717 | 3300037418 | Bacteria | 11096 |
| 534 | Ga0395900_0287508 | 3300037418 | Bacteria | 1634 |
| 535 | Ga0395900_0647893 | 3300037418 | Bacteria | 993 |
| 536 | Ga0395898_0023846 | 3300037466 | Bacteria | 6176 |
| 537 | Ga0316581_0041398 | 3300037588 | Bacteria | 1404 |
| 538 | Ga0436364_0420330 | 3300037853 | Bacteria | 1196 |
| 539 | Ga0395901_0008908 | 3300038443 | Bacteria | 10163 |
| 540 | Ga0395901_0042433 | 3300038443 | Bacteria | 4716 |
| 541 | Ga0436363_0349297 | 3300039450 | Bacteria | 1778 |
| 542 | Ga0451791_1703147 | 3300041451 | Bacteria | 695 |
| 543 | Ga0451793_1141815 | 3300041452 | Bacteria | 523 |
| 544 | Ga0451793_1456958 | 3300041452 | Bacteria | 542 |
| 545 | Ga0451807_1257146 | 3300041486 | Bacteria | 869 |
| 546 | Ga0451833_0856020 | 3300041491 | Bacteria | 635 |
| 547 | Ga0451837_0749401 | 3300041494 | Bacteria | 814 |
| 548 | Ga0451839_1354034 | 3300041496 | Bacteria | 621 |
| 549 | Ga0451841_0840733 | 3300041498 | Bacteria | 1072 |
| 550 | Ga0451847_0010677 | 3300041503 | Bacteria | 709 |
| 551 | Ga0451853_0254844 | 3300041512 | Bacteria | 887 |
| 552 | Ga0450894_053352 | 3300042131 | Bacteria | 599 |
| 553 | Ga0466969_0002301 | 3300044656 | Bacteria | 10198 |
| 554 | Ga0466969_0009087 | 3300044656 | Bacteria | 5268 |
| 555 | Ga0466966_0004002 | 3300044684 | Bacteria | 9734 |
| 556 | Ga0466961_0044870 | 3300044693 | Bacteria | 2828 |
| 557 | Ga0453684_0353812 | 3300044712 | Bacteria | 1655 |
| 558 | Ga0453684_0478380 | 3300044712 | Bacteria | 1382 |
| 559 | Ga0466970_0031996 | 3300044765 | Bacteria | 2779 |
| 560 | Ga0466959_0001964 | 3300045049 | Bacteria | 12968 |
| 561 | Ga0451576_0000007 | 3300045051 | Bacteria | 782228 |
| 562 | Ga0495627_000158 | 3300046453 | Bacteria | 77210 |
| 563 | Ga0495638_0001382 | 3300046460 | Bacteria | 22126 |
| 564 | Ga0495638_0044272 | 3300046460 | Bacteria | 2804 |
| 565 | Ga0495638_0245109 | 3300046460 | Bacteria | 990 |
| 566 | Ga0495651_0003251 | 3300046462 | Bacteria | 12469 |
| 567 | Ga0495650_0000831 | 3300046471 | Bacteria | 37263 |
| 568 | Ga0495662_0223583 | 3300046476 | Bacteria | 928 |
| 569 | Ga0495585_0109441 | 3300046492 | Bacteria | 1471 |
| 570 | Ga0495585_0123344 | 3300046492 | Bacteria | 1369 |
| 571 | Ga0495594_0390088 | 3300046499 | Bacteria | 792 |
| 572 | Ga0495596_0000539 | 3300046500 | Bacteria | 23771 |
| 573 | Ga0495607_0021094 | 3300046501 | Bacteria | 4103 |
| 574 | Ga0495607_0382615 | 3300046501 | Bacteria | 643 |
| 575 | Ga0495583_0012555 | 3300046506 | Bacteria | 4784 |
| 576 | Ga0495583_0013765 | 3300046506 | Bacteria | 4493 |
| 577 | Ga0495606_0003910 | 3300046507 | Bacteria | 15336 |
| 578 | Ga0495606_0083175 | 3300046507 | Bacteria | 1985 |
| 579 | Ga0495606_0308935 | 3300046507 | Bacteria | 854 |
| 580 | Ga0495610_0000020 | 3300046512 | Bacteria | 344007 |
| 581 | Ga0495610_0000377 | 3300046512 | Bacteria | 46011 |
| 582 | Ga0495610_0005814 | 3300046512 | Bacteria | 8669 |
| 583 | Ga0495620_0009442 | 3300046515 | Bacteria | 5190 |
| 584 | Ga0495628_0301069 | 3300046516 | Bacteria | 1187 |
| 585 | Ga0495632_0001745 | 3300046519 | Bacteria | 17628 |
| 586 | Ga0495632_0071947 | 3300046519 | Bacteria | 1660 |
| 587 | Ga0495632_0149293 | 3300046519 | Bacteria | 1081 |
| 588 | Ga0495643_0000007 | 3300046522 | Bacteria | 383435 |
| 589 | Ga0495643_0007169 | 3300046522 | Bacteria | 7233 |
| 590 | Ga0495643_0009816 | 3300046522 | Bacteria | 5921 |
| 591 | Ga0495643_0031602 | 3300046522 | Bacteria | 2946 |
| 592 | Ga0495643_0079094 | 3300046522 | Bacteria | 1715 |
| 593 | Ga0495643_0142655 | 3300046522 | Bacteria | 1193 |
| 594 | Ga0495648_0067804 | 3300046524 | Bacteria | 2085 |
| 595 | Ga0495648_0087932 | 3300046524 | Bacteria | 1748 |
| 596 | Ga0495648_0104429 | 3300046524 | Bacteria | 1556 |
| 597 | Ga0495663_0065775 | 3300046525 | Bacteria | 1146 |
| 598 | Ga0495663_0172099 | 3300046525 | Bacteria | 747 |
| 599 | Ga0495663_0277522 | 3300046525 | Bacteria | 600 |
| 600 | Ga0495652_0002206 | 3300046529 | Bacteria | 20433 |
| 601 | Ga0495654_0000374 | 3300046530 | Bacteria | 38569 |
| 602 | Ga0495654_0082873 | 3300046530 | Bacteria | 1500 |
| 603 | Ga0495654_0134778 | 3300046530 | Bacteria | 1105 |
| 604 | Ga0495609_0015309 | 3300046538 | Bacteria | 3591 |
| 605 | Ga0495633_0061326 | 3300046558 | Bacteria | 1761 |
| 606 | Ga0495668_0000001 | 3300046616 | Bacteria | 1013420 |
| 607 | Ga0495668_0006149 | 3300046616 | Bacteria | 7944 |
| 608 | Ga0495668_0092432 | 3300046616 | Bacteria | 1657 |
| 609 | Ga0495625_0000064 | 3300046660 | Bacteria | 174730 |
| 610 | Ga0495625_0000234 | 3300046660 | Bacteria | 86768 |
| 611 | Ga0495625_0010229 | 3300046660 | Bacteria | 7779 |
| 612 | Ga0495588_0275591 | 3300046674 | Bacteria | 886 |
| 613 | Ga0495623_0173384 | 3300046679 | Bacteria | 1258 |
| 614 | Ga0495670_0058817 | 3300046691 | Bacteria | 1929 |
| 615 | Ga0495670_0141020 | 3300046691 | Bacteria | 1260 |
| 616 | Ga0495670_0157714 | 3300046691 | Bacteria | 1191 |
| 617 | Ga0495671_0300610 | 3300046692 | Bacteria | 772 |
| 618 | Ga0495600_0154713 | 3300046809 | Bacteria | 1483 |
| 619 | Ga0495604_0007438 | 3300047317 | Bacteria | 8679 |
| 620 | Ga0495675_0012675 | 3300047444 | Bacteria | 5306 |
| 621 | Ga0495685_116284 | 3300047447 | Bacteria | 879 |
| 622 | Ga0495673_0170009 | 3300047469 | Bacteria | 831 |
| 623 | Ga0495673_0173776 | 3300047469 | Bacteria | 819 |
| 624 | Ga0495681_0000094 | 3300047470 | Bacteria | 77400 |
| 625 | Ga0495686_0000145 | 3300047472 | Bacteria | 141946 |
| 626 | Ga0495686_0027507 | 3300047472 | Bacteria | 3712 |
| 627 | Ga0495686_0027888 | 3300047472 | Bacteria | 3681 |
| 628 | Ga0495686_0048172 | 3300047472 | Bacteria | 2688 |
| 629 | Ga0495686_0175411 | 3300047472 | Bacteria | 1245 |
| 630 | Ga0495615_0000033 | 3300048090 | Bacteria | 45796 |
| 631 | Ga0496100_0011591 | 3300048903 | Bacteria | 5022 |
| 632 | Ga0496100_0061354 | 3300048903 | Bacteria | 2477 |
| 633 | Ga0496100_0801751 | 3300048903 | Bacteria | 738 |
| 634 | Ga0496101_0009157 | 3300048904 | Bacteria | 6498 |
| 635 | Ga0496101_0161863 | 3300048904 | Bacteria | 1716 |
| 636 | Ga0496101_0203804 | 3300048904 | Bacteria | 1530 |
| 637 | Ga0496101_0603190 | 3300048904 | Bacteria | 868 |
| 638 | Ga0496102_0000267 | 3300048905 | Bacteria | 66761 |
| 639 | Ga0496102_0783994 | 3300048905 | Bacteria | 875 |
| 640 | Ga0496102_0890281 | 3300048905 | Bacteria | 812 |
| 641 | Ga0496103_0000139 | 3300048906 | Bacteria | 75158 |
| 642 | Ga0496103_0014470 | 3300048906 | Bacteria | 4684 |
| 643 | Ga0496103_0026678 | 3300048906 | Bacteria | 3496 |
| 644 | Ga0496103_0035486 | 3300048906 | Bacteria | 3053 |
| 645 | Ga0496103_0353879 | 3300048906 | Bacteria | 944 |
| 646 | Ga0496104_0001261 | 3300048907 | Bacteria | 21786 |
| 647 | Ga0496104_0005335 | 3300048907 | Bacteria | 11245 |
| 648 | Ga0496104_0051151 | 3300048907 | Bacteria | 3899 |
| 649 | Ga0496104_0286807 | 3300048907 | Bacteria | 1559 |
| 650 | Ga0496105_0004419 | 3300048908 | Bacteria | 10585 |
| 651 | Ga0496105_0004449 | 3300048908 | Bacteria | 10552 |
| 652 | Ga0496105_0006672 | 3300048908 | Bacteria | 8886 |
| 653 | Ga0496105_0357718 | 3300048908 | Bacteria | 1165 |
| 654 | Ga0496106_0664981 | 3300048909 | Bacteria | 832 |
| 655 | Ga0496106_1505658 | 3300048909 | Bacteria | 517 |
| 656 | Ga0496107_0006170 | 3300048910 | Bacteria | 8232 |
| 657 | Ga0496108_0090157 | 3300048911 | Bacteria | 2606 |
| 658 | Ga0496108_1186244 | 3300048911 | Bacteria | 646 |
| 659 | Ga0496109_0017830 | 3300048912 | Bacteria | 6228 |
| 660 | Ga0496109_0201779 | 3300048912 | Bacteria | 1870 |
| 661 | Ga0496110_0057248 | 3300048913 | Bacteria | 3431 |
| 662 | Ga0496110_0068444 | 3300048913 | Bacteria | 3142 |
| 663 | Ga0496111_0002045 | 3300048914 | Bacteria | 12011 |
| 664 | Ga0496111_0014834 | 3300048914 | Bacteria | 5333 |
| 665 | Ga0496111_0903153 | 3300048914 | Bacteria | 636 |
| 666 | Ga0496112_0588958 | 3300048915 | Bacteria | 1044 |
| 667 | Ga0496112_0600219 | 3300048915 | Bacteria | 1033 |
| 668 | Ga0496113_0007197 | 3300048916 | Bacteria | 7131 |
| 669 | Ga0496113_0110664 | 3300048916 | Bacteria | 2137 |
| 670 | Ga0496114_0023283 | 3300048917 | Bacteria | 5054 |
| 671 | Ga0496114_0056565 | 3300048917 | Bacteria | 3274 |
| 672 | Ga0496114_0241100 | 3300048917 | Bacteria | 1590 |
| 673 | Ga0496116_0013857 | 3300048919 | Bacteria | 6473 |
| 674 | Ga0496117_0009437 | 3300048920 | Bacteria | 9079 |
| 675 | Ga0496117_0034849 | 3300048920 | Bacteria | 3786 |
| 676 | Ga0496117_0102213 | 3300048920 | Bacteria | 1810 |
| 677 | Ga0496117_0128287 | 3300048920 | Bacteria | 1543 |
| 678 | Ga0496117_0220842 | 3300048920 | Bacteria | 1055 |
| 679 | Ga0496118_0003648 | 3300048921 | Bacteria | 19124 |
| 680 | Ga0496118_0006964 | 3300048921 | Bacteria | 12206 |
| 681 | Ga0496118_0020455 | 3300048921 | Bacteria | 5868 |
| 682 | Ga0496118_0083218 | 3300048921 | Bacteria | 2238 |
| 683 | Ga0496118_0084791 | 3300048921 | Bacteria | 2209 |
| 684 | Ga0496118_0190308 | 3300048921 | Bacteria | 1228 |
| 685 | Ga0496119_0000077 | 3300048922 | Bacteria | 143108 |
| 686 | Ga0496119_0012840 | 3300048922 | Bacteria | 6755 |
| 687 | Ga0496119_0066703 | 3300048922 | Bacteria | 2125 |
| 688 | Ga0496120_0005768 | 3300048923 | Bacteria | 9727 |
| 689 | Ga0496120_0205030 | 3300048923 | Bacteria | 952 |
| 690 | Ga0496121_0000022 | 3300048924 | Bacteria | 472849 |
| 691 | Ga0496121_0000222 | 3300048924 | Bacteria | 123595 |
| 692 | Ga0496121_0002362 | 3300048924 | Bacteria | 29040 |
| 693 | Ga0496121_0009408 | 3300048924 | Bacteria | 11239 |
| 694 | Ga0496121_0058612 | 3300048924 | Bacteria | 3181 |
| 695 | Ga0496121_0685237 | 3300048924 | Bacteria | 619 |
| 696 | Ga0496122_0002268 | 3300048925 | Bacteria | 27820 |
| 697 | Ga0496122_0006858 | 3300048925 | Bacteria | 12900 |
| 698 | Ga0496122_0008242 | 3300048925 | Bacteria | 11310 |
| 699 | Ga0496122_0011513 | 3300048925 | Bacteria | 8947 |
| 700 | Ga0496122_0016389 | 3300048925 | Bacteria | 7014 |
| 701 | Ga0496123_0003406 | 3300048926 | Bacteria | 17901 |
| 702 | Ga0496123_0005241 | 3300048926 | Bacteria | 13168 |
| 703 | Ga0496123_0005963 | 3300048926 | Bacteria | 11998 |
| 704 | Ga0496123_0016981 | 3300048926 | Bacteria | 5876 |
| 705 | Ga0496124_0006200 | 3300048927 | Bacteria | 13103 |
| 706 | Ga0496124_0183938 | 3300048927 | Bacteria | 1605 |
| 707 | Ga0496124_0263061 | 3300048927 | Bacteria | 1268 |
| 708 | Ga0496125_0007827 | 3300048928 | Bacteria | 11295 |
| 709 | Ga0496125_0016149 | 3300048928 | Bacteria | 7180 |
| 710 | Ga0496125_0028887 | 3300048928 | Bacteria | 4995 |
| 711 | Ga0496125_0042962 | 3300048928 | Bacteria | 3843 |
| 712 | Ga0496126_0000079 | 3300048929 | Bacteria | 222463 |
| 713 | Ga0496126_0000619 | 3300048929 | Bacteria | 66827 |
| 714 | Ga0496126_0003256 | 3300048929 | Bacteria | 20755 |
| 715 | Ga0496126_0004371 | 3300048929 | Bacteria | 16942 |
| 716 | Ga0496126_0026032 | 3300048929 | Bacteria | 5617 |
| 717 | Ga0496126_0042184 | 3300048929 | Bacteria | 4215 |
| 718 | Ga0496126_0563927 | 3300048929 | Bacteria | 902 |
| 719 | Ga0495678_026512 | 3300049459 | Bacteria | 2473 |
| 720 | Ga0495682_0132776 | 3300049460 | Bacteria | 890 |
| 721 | Ga0501300_034046 | 3300049523 | Bacteria | 756 |
| 722 | Ga0501032_0006527 | 3300049569 | Bacteria | 8567 |
| 723 | Ga0501033_0004215 | 3300049570 | Bacteria | 11571 |
| 724 | Ga0501033_0031389 | 3300049570 | Bacteria | 3992 |
| 725 | Ga0501034_0010865 | 3300049571 | Bacteria | 9457 |
| 726 | Ga0501034_0326993 | 3300049571 | Bacteria | 1465 |
| 727 | Ga0501036_0025362 | 3300049572 | Bacteria | 5001 |
| 728 | Ga0501037_0009034 | 3300049573 | Bacteria | 7304 |
| 729 | Ga0501038_0017668 | 3300049574 | Bacteria | 6447 |
| 730 | Ga0501039_0091478 | 3300049575 | Bacteria | 2371 |
| 731 | Ga0501043_1161883 | 3300049579 | Bacteria | 543 |
| 732 | Ga0501046_0067378 | 3300049580 | Bacteria | 2788 |
| 733 | Ga0501047_0004376 | 3300049581 | Bacteria | 13293 |
| 734 | Ga0501047_0119971 | 3300049581 | Bacteria | 2512 |
| 735 | Ga0501047_0414497 | 3300049581 | Bacteria | 1179 |
| 736 | Ga0501047_0431344 | 3300049581 | Bacteria | 1149 |
| 737 | Ga0501048_0186999 | 3300049582 | Bacteria | 1468 |
| 738 | Ga0501080_0323625 | 3300049742 | Bacteria | 1395 |
| 739 | Ga0501083_0743537 | 3300049744 | Bacteria | 638 |
| 740 | Ga0501035_0017712 | 3300049822 | Bacteria | 6570 |
| 741 | Ga0501035_0167219 | 3300049822 | Bacteria | 1901 |
| 742 | Ga0501035_0853382 | 3300049822 | Bacteria | 724 |
| 743 | Ga0501044_0000098 | 3300049823 | Bacteria | 107528 |
| 744 | Ga0501044_0007203 | 3300049823 | Bacteria | 12234 |
| 745 | Ga0501044_0030831 | 3300049823 | Bacteria | 5647 |
| 746 | Ga0501044_0205691 | 3300049823 | Bacteria | 1925 |
| 747 | Ga0501044_0319955 | 3300049823 | Bacteria | 1476 |
| 748 | nmdc:mga03683_149_c1 | 3300050489 | Bacteria | 23934 |
| 749 | nmdc:mga03683_30_c1 | 3300050489 | Bacteria | 71765 |
| 750 | nmdc:mga03n38_147852_c1 | 3300050490 | Bacteria | 1180 |
| 751 | nmdc:mga03n38_6284_c1 | 3300050490 | Bacteria | 4116 |
| 752 | nmdc:mga00v17_125984_c1 | 3300050491 | Bacteria | 1634 |
| 753 | nmdc:mga00v17_798_c1 | 3300050491 | Bacteria | 17178 |
| 754 | nmdc:mga00v17_83529_c1 | 3300050491 | Bacteria | 1998 |
| 755 | nmdc:mga0k408_17004_c1 | 3300050493 | Bacteria | 4043 |
| 756 | nmdc:mga0k408_2730_c1 | 3300050493 | Bacteria | 9376 |
| 757 | nmdc:mga0k408_328445_c1 | 3300050493 | Bacteria | 912 |
| 758 | nmdc:mga0k408_49594_c1 | 3300050493 | Bacteria | 2430 |
| 759 | nmdc:mga0k408_563438_c1 | 3300050493 | Bacteria | 673 |
| 760 | nmdc:mga06z11_149346_c1 | 3300050494 | Bacteria | 1327 |
| 761 | nmdc:mga06z11_61_c1 | 3300050494 | Bacteria | 46697 |
| 762 | nmdc:mga04h51_1140_c1 | 3300050495 | Bacteria | 6137 |
| 763 | nmdc:mga04h51_49320_c1 | 3300050495 | Bacteria | 1406 |
| 764 | nmdc:mga07m45_155417_c1 | 3300050496 | Bacteria | 1327 |
| 765 | nmdc:mga07m45_19103_c1 | 3300050496 | Bacteria | 3709 |
| 766 | nmdc:mga07m45_238675_c1 | 3300050496 | Bacteria | 1058 |
| 767 | nmdc:mga07m45_29618_c2 | 3300050496 | Bacteria | 1449 |
| 768 | nmdc:mga07m45_368022_c1 | 3300050496 | Bacteria | 835 |
| 769 | nmdc:mga07m45_3935_c1 | 3300050496 | Bacteria | 7223 |
| 770 | nmdc:mga07m45_4960_c1 | 3300050496 | Bacteria | 6565 |
| 771 | nmdc:mga07m45_6_c1 | 3300050496 | Bacteria | 260521 |
| 772 | nmdc:mga0rr50_1197089_c1 | 3300050513 | Bacteria | 645 |
| 773 | nmdc:mga0sz30_114985_c1 | 3300050516 | Bacteria | 1181 |
| 774 | nmdc:mga0sz30_138_c1 | 3300050516 | Bacteria | 26910 |
| 775 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 776 | Ga0500643_004834 | 3300053087 | Bacteria | 5953 |
| 777 | Ga0500643_063823 | 3300053087 | Bacteria | 1030 |
| 778 | Ga0500647_0014953 | 3300053091 | Bacteria | 3540 |
| 779 | Ga0500651_0176403 | 3300053093 | Bacteria | 1271 |
| 780 | Ga0500556_0000122 | 3300053104 | Bacteria | 67150 |
| 781 | Ga0500562_048940 | 3300053108 | Bacteria | 1129 |
| 782 | Ga0500592_005142 | 3300053116 | Bacteria | 2080 |
| 783 | Ga0500592_013611 | 3300053116 | Bacteria | 1304 |
| 784 | Ga0500592_051448 | 3300053116 | Bacteria | 670 |
| 785 | Ga0500594_0063912 | 3300053118 | Bacteria | 1067 |
| 786 | Ga0500595_000472 | 3300053119 | Bacteria | 24818 |
| 787 | Ga0500595_007244 | 3300053119 | Bacteria | 4614 |
| 788 | Ga0500607_000287 | 3300053121 | Bacteria | 48083 |
| 789 | Ga0500607_000802 | 3300053121 | Bacteria | 30266 |
| 790 | Ga0500608_001154 | 3300053122 | Bacteria | 9395 |
| 791 | Ga0500618_037319 | 3300053125 | Bacteria | 1123 |
| 792 | Ga0500652_004515 | 3300053131 | Bacteria | 4313 |
| 793 | Ga0500652_119944 | 3300053131 | Bacteria | 1099 |
| 794 | Ga0500652_254584 | 3300053131 | Bacteria | 694 |
| 795 | Ga0500658_0001199 | 3300053134 | Bacteria | 10547 |
| 796 | Ga0500658_0089523 | 3300053134 | Bacteria | 1329 |
| 797 | Ga0500559_0002605 | 3300053136 | Bacteria | 9209 |
| 798 | Ga0500559_0010186 | 3300053136 | Bacteria | 4042 |
| 799 | Ga0500559_0016106 | 3300053136 | Bacteria | 3157 |
| 800 | Ga0500559_0036136 | 3300053136 | Bacteria | 2135 |
| 801 | Ga0500559_0098195 | 3300053136 | Bacteria | 1347 |
| 802 | Ga0500559_0104037 | 3300053136 | Bacteria | 1310 |
| 803 | Ga0500559_0384310 | 3300053136 | Bacteria | 654 |
| 804 | Ga0500564_002032 | 3300053138 | Bacteria | 7302 |
| 805 | Ga0500568_0002610 | 3300053139 | Bacteria | 10480 |
| 806 | Ga0500568_0036903 | 3300053139 | Bacteria | 1986 |
| 807 | Ga0500568_0097327 | 3300053139 | Bacteria | 1106 |
| 808 | Ga0500568_0135285 | 3300053139 | Bacteria | 915 |
| 809 | Ga0500568_0184394 | 3300053139 | Bacteria | 767 |
| 810 | Ga0500573_0000082 | 3300053140 | Bacteria | 45547 |
| 811 | Ga0500573_0197675 | 3300053140 | Bacteria | 1070 |
| 812 | Ga0500573_0314262 | 3300053140 | Bacteria | 777 |
| 813 | Ga0500573_0461430 | 3300053140 | Bacteria | 584 |
| 814 | Ga0500577_0010263 | 3300053142 | Bacteria | 2751 |
| 815 | Ga0500588_0130445 | 3300053146 | Bacteria | 894 |
| 816 | Ga0500590_000142 | 3300053148 | Bacteria | 19990 |
| 817 | Ga0500590_034104 | 3300053148 | Bacteria | 2636 |
| 818 | Ga0500604_0030279 | 3300053151 | Bacteria | 1582 |
| 819 | Ga0500604_0050022 | 3300053151 | Bacteria | 1287 |
| 820 | Ga0500616_0004405 | 3300053153 | Bacteria | 10045 |
| 821 | Ga0500616_0015221 | 3300053153 | Bacteria | 4403 |
| 822 | Ga0500616_0049565 | 3300053153 | Bacteria | 2221 |
| 823 | Ga0500619_247062 | 3300053154 | Bacteria | 588 |
| 824 | Ga0500622_0014303 | 3300053156 | Bacteria | 4264 |
| 825 | Ga0500627_0000004 | 3300053158 | Bacteria | 174208 |
| 826 | Ga0500627_0000231 | 3300053158 | Bacteria | 15882 |
| 827 | Ga0500630_250872 | 3300053159 | Bacteria | 628 |
| 828 | Ga0500637_0071845 | 3300053178 | Bacteria | 1990 |
| 829 | Ga0500625_000022 | 3300053729 | Bacteria | 78028 |
| 830 | Ga0500625_065684 | 3300053729 | Bacteria | 1631 |
| 831 | Ga0500645_003394 | 3300053730 | Bacteria | 6499 |
| 832 | Ga0500645_029629 | 3300053730 | Bacteria | 1651 |
| 833 | Ga0466962_0018926 | 3300061719 | Bacteria | 3309 |
| 834 | 2511128434 | 2510917021 | Bacteria | 5705459 |
| 835 | 2513590826 | 2513237087 | Bacteria | 5817514 |
| 836 | 2559431598 | 2558860280 | Bacteria | 11429938 |
| 837 | 2600201360 | 2599185354 | Bacteria | 4398675 |
| 838 | 2643823345 | 2643221560 | Bacteria | 4801179 |
| 839 | 2643835689 | 2643221563 | Bacteria | 4726935 |
| 840 | 2644019783 | 2643221601 | Bacteria | 7493239 |
| 841 | 2644056615 | 2643221608 | Bacteria | 4724829 |
| 842 | 2644180327 | 2643221631 | Bacteria | 8168043 |
| 843 | 2738709836 | 2738541275 | Bacteria | 4830863 |
| 844 | 2738848261 | 2738541301 | Bacteria | 4834102 |
| 845 | 2738863990 | 2738541304 | Bacteria | 4833665 |
| 846 | 2739296508 | 2738543022 | Bacteria | 4835059 |
| 847 | 2739358186 | 2738543033 | Bacteria | 4833336 |
| 848 | 2739650439 | 2739367664 | Bacteria | 4114334 |
| 849 | 2740028912 | 2739367865 | Bacteria | 4114482 |
| 850 | 2753764538 | 2751185897 | Bacteria | 5322941 |
| 851 | 2819553198 | 2818991438 | Bacteria | 5793701 |
| 852 | 2828307001 | 2828305725 | Bacteria | 4916900 |
| 853 | 2830077851 | 2830075706 | Bacteria | 3855215 |
| 854 | 2842883595 | 2842882022 | Bacteria | 6158489 |
| 855 | 2852655249 | 2852653556 | Bacteria | 4050083 |
| 856 | 2852681181 | 2852680915 | Bacteria | 4100189 |
| 857 | 2885430055 | 2885429604 | Bacteria | 3642894 |
| 858 | 2896256664 | 2896253425 | Bacteria | 3418029 |
| 859 | 2904525384 | 2904524088 | Bacteria | 5887454 |
| 860 | 2919140035 | 2919138771 | Bacteria | 5281312 |
| 861 | 2919146035 | 2919143609 | Bacteria | 6219228 |
| 862 | 2919454962 | 2919450847 | Bacteria | 5631160 |
| 863 | 2919517959 | 2919517244 | Bacteria | 5858162 |
| 864 | 2928027916 | 2928027323 | Bacteria | 4382488 |
| 865 | 2928097123 | 2928093941 | Bacteria | 5965005 |
| 866 | 2928101384 | 2928100450 | Bacteria | 4837635 |
| 867 | 2928960204 | 2928959182 | Bacteria | 4725774 |
| 868 | 2929010097 | 2929004312 | Bacteria | 5678476 |
| 869 | 2946788108 | 2946787523 | Bacteria | 4366789 |
| 870 | 2960380431 | 2960375949 | Bacteria | 5361395 |
| 871 | 2984558708 | 2984555340 | Bacteria | 4247089 |
| 872 | 2984566786 | 2984564862 | Bacteria | 4339992 |
| 873 | 2990266621 | 2990265787 | Bacteria | 3943888 |
| 874 | 2993357974 | 2993356040 | Bacteria | 4247105 |
| 875 | 2993695580 | 2993693658 | Bacteria | 4040749 |
| 876 | 3000865411 | 3000865235 | Bacteria | 3106258 |
| 877 | 8001849292 | 8001845381 | Bacteria | 5804942 |
| 878 | 8022896689 | 8022893055 | Bacteria | 5300455 |
| 879 | 8054305669 | 8054302542 | Bacteria | 5698134 |
| 880 | Ga0496119_0000344 | |||
| 881 | SwRhRL2b_contig_2139260 | |||
| 882 | SwRhRL2b_contig_2638822 | |||
| 883 | SwRhRL2b_contig_3219086 | |||
| 884 | SwRhRL2b_contig_3748734 | |||
| 885 | SwRhRL2b_contig_887096 | |||
| 886 | JGI24034J14986_101037 | |||
| 887 | JGI24736J21556_1000031 | |||
| 888 | JGI24741J21665_1017119 | |||
| 889 | JGI24752J21851_1000036 | |||
| 890 | JGI24740J21852_10007875 | |||
| 891 | JGI24739J22299_10003686 | |||
| 892 | JGI24739J22299_10017629 | |||
| 893 | JGI24737J22298_10007725 | |||
| 894 | JGI24750J21931_1000424 | |||
| 895 | JGI24748J21848_1000029 | |||
| 896 | JGI24748J21848_1010040 | |||
| 897 | JGI24738J21930_10002292 | |||
| 898 | JGI24738J21930_10008464 | |||
| 899 | JGI24034J26672_10000006 | |||
| 900 | JGI24034J26672_10010366 | |||
| 901 | JGI24742J22300_10002270 | |||
| 902 | JGI25152J39213_1025184 | |||
| 903 | JGI25150J39212_1000020 | |||
| 904 | JGI25159J45721_1044908 | |||
| 905 | JGI25151J46595_10001678 | |||
| 906 | JGI25151J46595_10010952 | |||
| 907 | JGI25151J46595_10011677 | |||
| 908 | JGI25151J46595_10014794 | |||
| 909 | JGI25151J46595_10015684 | |||
| 910 | JGI25165J46597_1000053 | |||
| 911 | JGI25153J46596_10000017 | |||
| 912 | Ga0055532_1000115 | |||
| 913 | Ga0055535_1004854 | |||
| 914 | Ga0055535_1013750 | |||
| 915 | Ga0055536_1001565 | |||
| 916 | Ga0055536_1010951 | |||
| 917 | Ga0055534_1017663 | |||
| 918 | Ga0055528_1003541 | |||
| 919 | Ga0055530_10000095 | |||
| 920 | Ga0055530_10010511 | |||
| 921 | Ga0055540_1009149 | |||
| 922 | Ga0055531_10001802 | |||
| 923 | Ga0055531_10002920 | |||
| 924 | Ga0055531_10022710 | |||
| 925 | Ga0055541_1000733 | |||
| 926 | JGI25405J52794_10001431 | |||
| 927 | Ga0065704_10000190 | |||
| 928 | Ga0065704_10003249 | |||
| 929 | Ga0065704_10095003 | |||
| 930 | Ga0065704_10143789 | |||
| 931 | Ga0065704_10145587 | |||
| 932 | Ga0065704_10316801 | |||
| 933 | Ga0065707_10090604 | |||
| 934 | Ga0065707_10111706 | |||
| 935 | Ga0065707_10154342 | |||
| 936 | Ga0070658_10000371 | |||
| 937 | Ga0070658_10012881 | |||
| 938 | Ga0070658_10051560 | |||
| 939 | Ga0070658_10071384 | |||
| 940 | Ga0070658_10212206 | |||
| 941 | Ga0070683_100006345 | |||
| 942 | Ga0070683_100453623 | |||
| 943 | Ga0070690_100000002 | |||
| 944 | Ga0070670_100000168 | |||
| 945 | Ga0070670_100155116 | |||
| 946 | Ga0070670_100327523 | |||
| 947 | Ga0068869_100132712 | |||
| 948 | Ga0070666_10000014 | |||
| 949 | Ga0070680_100634730 | |||
| 950 | Ga0070682_100276235 | |||
| 951 | Ga0070682_101065597 | |||
| 952 | Ga0070660_100002018 | |||
| 953 | Ga0070660_100073658 | |||
| 954 | Ga0070660_100194506 | |||
| 955 | Ga0070660_100218824 | |||
| 956 | Ga0070689_100033303 | |||
| 957 | Ga0070691_10208696 | |||
| 958 | Ga0070687_100190789 | |||
| 959 | Ga0070661_100020845 | |||
| 960 | Ga0070692_10068259 | |||
| 961 | Ga0070668_100014755 | |||
| 962 | Ga0070668_100016256 | |||
| 963 | Ga0070668_100043654 | |||
| 964 | Ga0070668_100335559 | |||
| 965 | Ga0070669_100000184 | |||
| 966 | Ga0070669_100000839 | |||
| 967 | Ga0070669_100022491 | |||
| 968 | Ga0070669_100080190 | |||
| 969 | Ga0070669_100096449 | |||
| 970 | Ga0070671_100000686 | |||
| 971 | Ga0070671_100004299 | |||
| 972 | Ga0070671_100255540 | |||
| 973 | Ga0070671_100473123 | |||
| 974 | Ga0070671_101557935 | |||
| 975 | Ga0070688_100019885 | |||
| 976 | Ga0070659_100003327 | |||
| 977 | Ga0070659_100178489 | |||
| 978 | Ga0070667_100000290 | |||
| 979 | Ga0070667_100000472 | |||
| 980 | Ga0070667_100001767 | |||
| 981 | Ga0070667_100002350 | |||
| 982 | Ga0070667_100012128 | |||
| 983 | Ga0070667_100035034 | |||
| 984 | Ga0070708_100629496 | |||
| 985 | Ga0070663_100205680 | |||
| 986 | Ga0070663_100247240 | |||
| 987 | Ga0070678_101149545 | |||
| 988 | Ga0070662_100000992 | |||
| 989 | Ga0070662_100027322 | |||
| 990 | Ga0070662_100134929 | |||
| 991 | Ga0070681_10058148 | |||
| 992 | Ga0070685_10000056 | |||
| 993 | Ga0070706_100430942 | |||
| 994 | Ga0070679_100030942 | |||
| 995 | Ga0070679_100031798 | |||
| 996 | Ga0070679_100049007 | |||
| 997 | Ga0070679_100152916 | |||
| 998 | Ga0070679_100697722 | |||
| 999 | Ga0070684_101156365 | |||
| 1000 | Ga0068853_100008448 | |||
| 1001 | Ga0068853_100012276 | |||
| 1002 | Ga0068853_100013171 | |||
| 1003 | Ga0068853_100243348 | |||
| 1004 | Ga0068853_100311825 | |||
| 1005 | Ga0068853_100428357 | |||
| 1006 | Ga0068853_100963837 | |||
| 1007 | Ga0070686_100000002 | |||
| 1008 | Ga0070665_100000025 | |||
| 1009 | Ga0070665_100000076 | |||
| 1010 | Ga0070665_100005505 | |||
| 1011 | Ga0070665_100045652 | |||
| 1012 | Ga0070704_100406164 | |||
| 1013 | Ga0068855_100046850 | |||
| 1014 | Ga0068855_100253307 | |||
| 1015 | Ga0068855_100289651 | |||
| 1016 | Ga0068855_100588600 | |||
| 1017 | Ga0068855_100648909 | |||
| 1018 | Ga0068855_101412377 | |||
| 1019 | Ga0070664_100010887 | |||
| 1020 | Ga0070664_100240706 | |||
| 1021 | Ga0068857_100088803 | |||
| 1022 | Ga0068857_100179407 | |||
| 1023 | Ga0068857_100195436 | |||
| 1024 | Ga0068857_100229812 | |||
| 1025 | Ga0068857_100233204 | |||
| 1026 | Ga0068857_100859217 | |||
| 1027 | Ga0068854_100004727 | |||
| 1028 | Ga0068854_100039497 | |||
| 1029 | Ga0068854_100361610 | |||
| 1030 | Ga0068854_100607981 | |||
| 1031 | Ga0068856_100001125 | |||
| 1032 | Ga0068856_100011802 | |||
| 1033 | Ga0068856_100132888 | |||
| 1034 | Ga0068852_100000083 | |||
| 1035 | Ga0068852_100023139 | |||
| 1036 | Ga0068852_100028520 | |||
| 1037 | Ga0068852_100266764 | |||
| 1038 | Ga0068852_100435229 | |||
| 1039 | Ga0068852_100803667 | |||
| 1040 | Ga0068852_100908872 | |||
| 1041 | Ga0068852_100973101 | |||
| 1042 | Ga0068859_100061439 | |||
| 1043 | Ga0068864_100000063 | |||
| 1044 | Ga0068864_100004504 | |||
| 1045 | Ga0068864_100022037 | |||
| 1046 | Ga0068864_100035463 | |||
| 1047 | Ga0068864_100693797 | |||
| 1048 | Ga0068864_100745331 | |||
| 1049 | Ga0068861_100004572 | |||
| 1050 | Ga0068861_101246335 | |||
| 1051 | Ga0068851_10183942 | |||
| 1052 | Ga0068863_100000014 | |||
| 1053 | Ga0068863_100000062 | |||
| 1054 | Ga0068863_100000070 | |||
| 1055 | Ga0068863_100080373 | |||
| 1056 | Ga0068863_100342066 | |||
| 1057 | Ga0068863_100648183 | |||
| 1058 | Ga0068858_100000313 | |||
| 1059 | Ga0068858_100002369 | |||
| 1060 | Ga0068858_100003260 | |||
| 1061 | Ga0068858_100156431 | |||
| 1062 | Ga0068858_100353831 | |||
| 1063 | Ga0068858_101165476 | |||
| 1064 | Ga0068860_100000001 | |||
| 1065 | Ga0068860_100000007 | |||
| 1066 | Ga0068860_100011780 | |||
| 1067 | Ga0068860_100029781 | |||
| 1068 | Ga0068862_100000020 | |||
| 1069 | Ga0068862_100000069 | |||
| 1070 | Ga0068862_100012958 | |||
| 1071 | Ga0068862_100062551 | |||
| 1072 | Ga0068862_100081269 | |||
| 1073 | Ga0081455_10001124 | |||
| 1074 | Ga0075365_10067981 | |||
| 1075 | Ga0075368_10000199 | |||
| 1076 | Ga0075368_10092963 | |||
| 1077 | Ga0075363_100009342 | |||
| 1078 | Ga0075363_100017436 | |||
| 1079 | Ga0075364_10002598 | |||
| 1080 | Ga0075364_10102269 | |||
| 1081 | Ga0075364_10151087 | |||
| 1082 | Ga0075364_10551599 | |||
| 1083 | Ga0075364_10611915 | |||
| 1084 | Ga0075362_10000041 | |||
| 1085 | Ga0075362_10046036 | |||
| 1086 | Ga0075367_10022138 | |||
| 1087 | Ga0075367_10648801 | |||
| 1088 | Ga0075369_10000994 | |||
| 1089 | Ga0075369_10120093 | |||
| 1090 | Ga0075366_10000150 | |||
| 1091 | Ga0075366_10028344 | |||
| 1092 | Ga0075366_10217878 | |||
| 1093 | Ga0075366_10436965 | |||
| 1094 | Ga0075370_10000003 | |||
| 1095 | Ga0075370_10018925 | |||
| 1096 | Ga0075370_10033548 | |||
| 1097 | Ga0075370_10036616 | |||
| 1098 | Ga0075370_10093820 | |||
| 1099 | Ga0075370_10158613 | |||
| 1100 | Ga0075370_10502340 | |||
| 1101 | Ga0097620_100061439 | |||
| 1102 | Ga0079104_1027201 | |||
| 1103 | Ga0105251_10001315 | |||
| 1104 | Ga0105251_10006102 | |||
| 1105 | Ga0105251_10007785 | |||
| 1106 | Ga0105251_10052664 | |||
| 1107 | Ga0105244_10016502 | |||
| 1108 | Ga0105250_10002953 | |||
| 1109 | Ga0105250_10021336 | |||
| 1110 | Ga0105250_10104782 | |||
| 1111 | Ga0105250_10142772 | |||
| 1112 | Ga0105250_10148598 | |||
| 1113 | Ga0105250_10189082 | |||
| 1114 | Ga0105240_10029936 | |||
| 1115 | Ga0105247_10050332 | |||
| 1116 | Ga0105247_10056551 | |||
| 1117 | Ga0105247_10087521 | |||
| 1118 | Ga0105243_10114789 | |||
| 1119 | Ga0105241_10130650 | |||
| 1120 | Ga0105248_10000284 | |||
| 1121 | Ga0105248_10004661 | |||
| 1122 | Ga0105248_10048387 | |||
| 1123 | Ga0105248_10104896 | |||
| 1124 | Ga0105248_10157534 | |||
| 1125 | Ga0105237_10788457 | |||
| 1126 | Ga0105238_10058547 | |||
| 1127 | Ga0105238_10078333 | |||
| 1128 | Ga0105238_10121889 | |||
| 1129 | Ga0105238_10435814 | |||
| 1130 | Ga0105238_11443078 | |||
| 1131 | Ga0105238_11605734 | |||
| 1132 | Ga0105249_10000005 | |||
| 1133 | Ga0105249_10000160 | |||
| 1134 | Ga0105249_10136026 | |||
| 1135 | Ga0105249_10463585 | |||
| 1136 | Ga0105249_11242858 | |||
| 1137 | Ga0105246_10011029 | |||
| 1138 | Ga0105246_10803155 | |||
| 1139 | Ga0157373_10053241 | |||
| 1140 | Ga0157373_10116318 | |||
| 1141 | Ga0157371_10001947 | |||
| 1142 | Ga0157371_10171692 | |||
| 1143 | Ga0157371_10444426 | |||
| 1144 | Ga0157370_10010227 | |||
| 1145 | Ga0157370_10583082 | |||
| 1146 | Ga0157370_10989143 | |||
| 1147 | Ga0157369_10000968 | |||
| 1148 | Ga0157369_10031914 | |||
| 1149 | Ga0157374_10027466 | |||
| 1150 | Ga0157374_10476509 | |||
| 1151 | Ga0157378_10065632 | |||
| 1152 | Ga0157378_10417725 | |||
| 1153 | Ga0157378_10938346 | |||
| 1154 | Ga0163162_10030993 | |||
| 1155 | Ga0163162_10040293 | |||
| 1156 | Ga0163162_10097636 | |||
| 1157 | Ga0163162_10371029 | |||
| 1158 | Ga0163162_10641933 | |||
| 1159 | Ga0157372_10001238 | |||
| 1160 | Ga0157372_10062791 | |||
| 1161 | Ga0157372_10124496 | |||
| 1162 | Ga0157372_10356831 | |||
| 1163 | Ga0157375_10748286 | |||
| 1164 | Ga0163163_10094960 | |||
| 1165 | Ga0157377_10328575 | |||
| 1166 | Ga0157377_10373619 | |||
| 1167 | Ga0157379_10037286 | |||
| 1168 | Ga0157379_10083251 | |||
| 1169 | Ga0163161_10000115 | |||
| 1170 | Ga0163161_10026756 | |||
| 1171 | Ga0163161_10626923 | |||
| 1172 | Ga0163161_11072191 | |||
| 1173 | Ga0209566_100042 | |||
| 1174 | Ga0209147_100088 | |||
| 1175 | Ga0209147_105356 | |||
| 1176 | Ga0209437_105443 | |||
| 1177 | Ga0209258_100827 | |||
| 1178 | Ga0209258_103603 | |||
| 1179 | Ga0207425_1000022 | |||
| 1180 | Ga0209129_1001473 | |||
| 1181 | Ga0209233_1000119 | |||
| 1182 | Ga0209455_1013376 | |||
| 1183 | Ga0209673_1002724 | |||
| 1184 | Ga0209130_1017142 | |||
| 1185 | Ga0209675_1000025 | |||
| 1186 | Ga0209676_1000198 | |||
| 1187 | Ga0209676_1000228 | |||
| 1188 | Ga0209676_1000362 | |||
| 1189 | Ga0209676_1005754 | |||
| 1190 | Ga0209676_1032137 | |||
| 1191 | Ga0209025_1000842 | |||
| 1192 | Ga0209025_1001397 | |||
| 1193 | Ga0209025_1001925 | |||
| 1194 | Ga0209025_1003543 | |||
| 1195 | Ga0209025_1008600 | |||
| 1196 | Ga0209025_1009349 | |||
| 1197 | Ga0209025_1010389 | |||
| 1198 | Ga0209758_1000004 | |||
| 1199 | Ga0209050_1000001 | |||
| 1200 | Ga0209050_1000367 | |||
| 1201 | Ga0209050_1000728 | |||
| 1202 | Ga0209050_1011865 | |||
| 1203 | Ga0209050_1072117 | |||
| 1204 | Ga0207426_1011617 | |||
| 1205 | Ga0209051_1000246 | |||
| 1206 | Ga0209257_1000229 | |||
| 1207 | Ga0209257_1000596 | |||
| 1208 | Ga0209257_1008070 | |||
| 1209 | Ga0207697_10106721 | |||
| 1210 | Ga0207656_10160934 | |||
| 1211 | Ga0207696_1004520 | |||
| 1212 | Ga0207696_1011155 | |||
| 1213 | Ga0207696_1031305 | |||
| 1214 | Ga0207696_1031890 | |||
| 1215 | Ga0207655_1005646 | |||
| 1216 | Ga0207655_1013231 | |||
| 1217 | Ga0207713_1007454 | |||
| 1218 | Ga0207713_1010725 | |||
| 1219 | Ga0207713_1014855 | |||
| 1220 | Ga0207713_1021570 | |||
| 1221 | Ga0207713_1046744 | |||
| 1222 | Ga0207710_10044681 | |||
| 1223 | Ga0207710_10137611 | |||
| 1224 | Ga0207680_10000004 | |||
| 1225 | Ga0207680_10081041 | |||
| 1226 | Ga0207680_10210525 | |||
| 1227 | Ga0207647_10000555 | |||
| 1228 | Ga0207647_10069787 | |||
| 1229 | Ga0207705_10000004 | |||
| 1230 | Ga0207705_10026510 | |||
| 1231 | Ga0207705_10063556 | |||
| 1232 | Ga0207705_10268542 | |||
| 1233 | Ga0207684_10760646 | |||
| 1234 | Ga0207654_10004092 | |||
| 1235 | Ga0207654_10393046 | |||
| 1236 | Ga0207707_10051378 | |||
| 1237 | Ga0207695_10003879 | |||
| 1238 | Ga0207695_10012208 | |||
| 1239 | Ga0207671_10001983 | |||
| 1240 | Ga0207660_10131387 | |||
| 1241 | Ga0207657_10001614 | |||
| 1242 | Ga0207657_10037866 | |||
| 1243 | Ga0207649_10026472 | |||
| 1244 | Ga0207652_10018883 | |||
| 1245 | Ga0207652_10021249 | |||
| 1246 | Ga0207652_10056452 | |||
| 1247 | Ga0207681_10000130 | |||
| 1248 | Ga0207681_10000140 | |||
| 1249 | Ga0207681_10010126 | |||
| 1250 | Ga0207681_10333281 | |||
| 1251 | Ga0207681_10511467 | |||
| 1252 | Ga0207681_10792267 | |||
| 1253 | Ga0207694_10005262 | |||
| 1254 | Ga0207694_10007000 | |||
| 1255 | Ga0207694_10046380 | |||
| 1256 | Ga0207694_10103465 | |||
| 1257 | Ga0207694_10534438 | |||
| 1258 | Ga0207650_10000142 | |||
| 1259 | Ga0207650_10057847 | |||
| 1260 | Ga0207650_10086523 | |||
| 1261 | Ga0207650_10354042 | |||
| 1262 | Ga0207687_10000259 | |||
| 1263 | Ga0207644_10000811 | |||
| 1264 | Ga0207644_10000818 | |||
| 1265 | Ga0207644_10006799 | |||
| 1266 | Ga0207644_10325543 | |||
| 1267 | Ga0207644_10851638 | |||
| 1268 | Ga0207690_10000894 | |||
| 1269 | Ga0207690_10904539 | |||
| 1270 | Ga0207706_10000035 | |||
| 1271 | Ga0207706_10009604 | |||
| 1272 | Ga0207706_10095537 | |||
| 1273 | Ga0207709_10314763 | |||
| 1274 | Ga0207709_10429189 | |||
| 1275 | Ga0207670_10039261 | |||
| 1276 | Ga0207711_10000017 | |||
| 1277 | Ga0207711_10071888 | |||
| 1278 | Ga0207711_10202664 | |||
| 1279 | Ga0207689_10117467 | |||
| 1280 | Ga0207661_10132887 | |||
| 1281 | Ga0207661_10170932 | |||
| 1282 | Ga0207679_10070830 | |||
| 1283 | Ga0207667_10016664 | |||
| 1284 | Ga0207667_10056319 | |||
| 1285 | Ga0207667_10090978 | |||
| 1286 | Ga0207667_10093031 | |||
| 1287 | Ga0207667_10392664 | |||
| 1288 | Ga0207667_11041425 | |||
| 1289 | Ga0207712_10000001 | |||
| 1290 | Ga0207712_10000527 | |||
| 1291 | Ga0207712_10189723 | |||
| 1292 | Ga0207668_10006786 | |||
| 1293 | Ga0207668_10027876 | |||
| 1294 | Ga0207668_10032021 | |||
| 1295 | Ga0207668_10048371 | |||
| 1296 | Ga0207640_10001101 | |||
| 1297 | Ga0207640_10014152 | |||
| 1298 | Ga0207640_10015711 | |||
| 1299 | Ga0207640_10105323 | |||
| 1300 | Ga0207640_10528614 | |||
| 1301 | Ga0207640_11080116 | |||
| 1302 | Ga0207640_11259434 | |||
| 1303 | Ga0207658_10000133 | |||
| 1304 | Ga0207658_10001207 | |||
| 1305 | Ga0207658_10001257 | |||
| 1306 | Ga0207658_10003755 | |||
| 1307 | Ga0207658_10012197 | |||
| 1308 | Ga0207658_10053887 | |||
| 1309 | Ga0207677_11453050 | |||
| 1310 | Ga0207703_10000961 | |||
| 1311 | Ga0207703_10001460 | |||
| 1312 | Ga0207703_10002071 | |||
| 1313 | Ga0207703_10025076 | |||
| 1314 | Ga0207703_10051426 | |||
| 1315 | Ga0207703_10116628 | |||
| 1316 | Ga0207703_10325827 | |||
| 1317 | Ga0207639_10001012 | |||
| 1318 | Ga0207639_10007855 | |||
| 1319 | Ga0207639_10111311 | |||
| 1320 | Ga0207639_10184052 | |||
| 1321 | Ga0207639_10538988 | |||
| 1322 | Ga0207639_10916894 | |||
| 1323 | Ga0207678_10028298 | |||
| 1324 | Ga0207678_10106424 | |||
| 1325 | Ga0207702_10043320 | |||
| 1326 | Ga0207702_10139976 | |||
| 1327 | Ga0207641_10000022 | |||
| 1328 | Ga0207641_10000033 | |||
| 1329 | Ga0207641_10000126 | |||
| 1330 | Ga0207641_10020015 | |||
| 1331 | Ga0207676_10000056 | |||
| 1332 | Ga0207676_10011444 | |||
| 1333 | Ga0207676_10337223 | |||
| 1334 | Ga0207676_11395351 | |||
| 1335 | Ga0207674_10019205 | |||
| 1336 | Ga0207674_10023877 | |||
| 1337 | Ga0207674_10045037 | |||
| 1338 | Ga0207674_10073006 | |||
| 1339 | Ga0207674_10128780 | |||
| 1340 | Ga0207674_10187178 | |||
| 1341 | Ga0207674_10315125 | |||
| 1342 | Ga0207675_100004034 | |||
| 1343 | Ga0207675_101291922 | |||
| 1344 | Ga0207698_10000789 | |||
| 1345 | Ga0207698_10025403 | |||
| 1346 | Ga0207698_10041250 | |||
| 1347 | Ga0207698_10273943 | |||
| 1348 | Ga0209982_1070845 | |||
| 1349 | Ga0209813_10000065 | |||
| 1350 | Ga0209813_10070003 | |||
| 1351 | Ga0209974_10014350 | |||
| 1352 | Ga0209974_10065284 | |||
| 1353 | Ga0268266_10000028 | |||
| 1354 | Ga0268266_10000317 | |||
| 1355 | Ga0268266_10011921 | |||
| 1356 | Ga0268266_10027588 | |||
| 1357 | Ga0268265_10000044 | |||
| 1358 | Ga0268265_10000071 | |||
| 1359 | Ga0268265_10004791 | |||
| 1360 | Ga0268265_10008961 | |||
| 1361 | Ga0268265_10319921 | |||
| 1362 | Ga0268264_10000006 | |||
| 1363 | Ga0268264_10000077 | |||
| 1364 | Ga0268264_10009226 | |||
| 1365 | Ga0268264_10021239 | |||
| 1366 | Ga0237817_10090 | |||
| 1367 | Ga0265331_10133611 | |||
| 1368 | Ga0307513_10097855 | |||
| 1369 | Ga0307509_10068266 | |||
| 1370 | Ga0307408_100281517 | |||
| 1371 | Ga0307408_100316845 | |||
| 1372 | Ga0307408_100885506 | |||
| 1373 | Ga0307508_10000858 | |||
| 1374 | Ga0316575_10167435 | |||
| 1375 | Ga0307405_10236709 | |||
| 1376 | Ga0307405_10700828 | |||
| 1377 | Ga0307413_10555867 | |||
| 1378 | Ga0307410_10012162 | |||
| 1379 | Ga0307410_10117311 | |||
| 1380 | Ga0307406_10033048 | |||
| 1381 | Ga0307406_10143048 | |||
| 1382 | Ga0307406_10225051 | |||
| 1383 | Ga0307406_10234405 | |||
| 1384 | Ga0307407_10216287 | |||
| 1385 | Ga0307412_10005487 | |||
| 1386 | Ga0307412_10093964 | |||
| 1387 | Ga0307412_10173219 | |||
| 1388 | Ga0307412_10247951 | |||
| 1389 | Ga0307412_10397806 | |||
| 1390 | Ga0307416_101276032 | |||
| 1391 | Ga0307416_102036845 | |||
| 1392 | Ga0307414_10000918 | |||
| 1393 | Ga0307414_10011317 | |||
| 1394 | Ga0307414_10025158 | |||
| 1395 | Ga0307414_10032511 | |||
| 1396 | Ga0307414_10202579 | |||
| 1397 | Ga0307414_10221998 | |||
| 1398 | Ga0307414_10255086 | |||
| 1399 | Ga0307414_10280158 | |||
| 1400 | Ga0307414_10318250 | |||
| 1401 | Ga0307414_11194778 | |||
| 1402 | Ga0307411_10005827 | |||
| 1403 | Ga0307411_10014776 | |||
| 1404 | Ga0307411_10081670 | |||
| 1405 | Ga0307415_100155593 | |||
| 1406 | Ga0307510_10065943 | |||
| 1407 | Ga0373932_0075523 | |||
| 1408 | Ga0316582_0163214 | |||
| 1409 | Ga0316582_0233726 | |||
| 1410 | Ga0316584_0144004 | |||
| 1411 | Ga0316584_0200377 | |||
| 1412 | Ga0395900_0007717 | |||
| 1413 | Ga0395900_0287508 | |||
| 1414 | Ga0395900_0647893 | |||
| 1415 | Ga0395898_0023846 | |||
| 1416 | Ga0316581_0041398 | |||
| 1417 | Ga0436364_0420330 | |||
| 1418 | Ga0395901_0008908 | |||
| 1419 | Ga0395901_0042433 | |||
| 1420 | Ga0436363_0349297 | |||
| 1421 | Ga0451791_1703147 | |||
| 1422 | Ga0451793_1141815 | |||
| 1423 | Ga0451793_1456958 | |||
| 1424 | Ga0451807_1257146 | |||
| 1425 | Ga0451833_0856020 | |||
| 1426 | Ga0451837_0749401 | |||
| 1427 | Ga0451839_1354034 | |||
| 1428 | Ga0451841_0840733 | |||
| 1429 | Ga0451847_0010677 | |||
| 1430 | Ga0451853_0254844 | |||
| 1431 | Ga0450894_053352 | |||
| 1432 | Ga0466969_0002301 | |||
| 1433 | Ga0466969_0009087 | |||
| 1434 | Ga0466966_0004002 | |||
| 1435 | Ga0466961_0044870 | |||
| 1436 | Ga0453684_0353812 | |||
| 1437 | Ga0453684_0478380 | |||
| 1438 | Ga0466970_0031996 | |||
| 1439 | Ga0466959_0001964 | |||
| 1440 | Ga0451576_0000007 | |||
| 1441 | Ga0495627_000158 | |||
| 1442 | Ga0495638_0001382 | |||
| 1443 | Ga0495638_0044272 | |||
| 1444 | Ga0495638_0245109 | |||
| 1445 | Ga0495651_0003251 | |||
| 1446 | Ga0495650_0000831 | |||
| 1447 | Ga0495662_0223583 | |||
| 1448 | Ga0495585_0109441 | |||
| 1449 | Ga0495585_0123344 | |||
| 1450 | Ga0495594_0390088 | |||
| 1451 | Ga0495596_0000539 | |||
| 1452 | Ga0495607_0021094 | |||
| 1453 | Ga0495607_0382615 | |||
| 1454 | Ga0495583_0012555 | |||
| 1455 | Ga0495583_0013765 | |||
| 1456 | Ga0495606_0003910 | |||
| 1457 | Ga0495606_0083175 | |||
| 1458 | Ga0495606_0308935 | |||
| 1459 | Ga0495610_0000020 | |||
| 1460 | Ga0495610_0000377 | |||
| 1461 | Ga0495610_0005814 | |||
| 1462 | Ga0495620_0009442 | |||
| 1463 | Ga0495628_0301069 | |||
| 1464 | Ga0495632_0001745 | |||
| 1465 | Ga0495632_0071947 | |||
| 1466 | Ga0495632_0149293 | |||
| 1467 | Ga0495643_0000007 | |||
| 1468 | Ga0495643_0007169 | |||
| 1469 | Ga0495643_0009816 | |||
| 1470 | Ga0495643_0031602 | |||
| 1471 | Ga0495643_0079094 | |||
| 1472 | Ga0495643_0142655 | |||
| 1473 | Ga0495648_0067804 | |||
| 1474 | Ga0495648_0087932 | |||
| 1475 | Ga0495648_0104429 | |||
| 1476 | Ga0495663_0065775 | |||
| 1477 | Ga0495663_0172099 | |||
| 1478 | Ga0495663_0277522 | |||
| 1479 | Ga0495652_0002206 | |||
| 1480 | Ga0495654_0000374 | |||
| 1481 | Ga0495654_0082873 | |||
| 1482 | Ga0495654_0134778 | |||
| 1483 | Ga0495609_0015309 | |||
| 1484 | Ga0495633_0061326 | |||
| 1485 | Ga0495668_0000001 | |||
| 1486 | Ga0495668_0006149 | |||
| 1487 | Ga0495668_0092432 | |||
| 1488 | Ga0495625_0000064 | |||
| 1489 | Ga0495625_0000234 | |||
| 1490 | Ga0495625_0010229 | |||
| 1491 | Ga0495588_0275591 | |||
| 1492 | Ga0495623_0173384 | |||
| 1493 | Ga0495670_0058817 | |||
| 1494 | Ga0495670_0141020 | |||
| 1495 | Ga0495670_0157714 | |||
| 1496 | Ga0495671_0300610 | |||
| 1497 | Ga0495600_0154713 | |||
| 1498 | Ga0495604_0007438 | |||
| 1499 | Ga0495675_0012675 | |||
| 1500 | Ga0495685_116284 | |||
| 1501 | Ga0495673_0170009 | |||
| 1502 | Ga0495673_0173776 | |||
| 1503 | Ga0495681_0000094 | |||
| 1504 | Ga0495686_0000145 | |||
| 1505 | Ga0495686_0027507 | |||
| 1506 | Ga0495686_0027888 | |||
| 1507 | Ga0495686_0048172 | |||
| 1508 | Ga0495686_0175411 | |||
| 1509 | Ga0495615_0000033 | |||
| 1510 | Ga0496100_0011591 | |||
| 1511 | Ga0496100_0061354 | |||
| 1512 | Ga0496100_0801751 | |||
| 1513 | Ga0496101_0009157 | |||
| 1514 | Ga0496101_0161863 | |||
| 1515 | Ga0496101_0203804 | |||
| 1516 | Ga0496101_0603190 | |||
| 1517 | Ga0496102_0000267 | |||
| 1518 | Ga0496102_0783994 | |||
| 1519 | Ga0496102_0890281 | |||
| 1520 | Ga0496103_0000139 | |||
| 1521 | Ga0496103_0014470 | |||
| 1522 | Ga0496103_0026678 | |||
| 1523 | Ga0496103_0035486 | |||
| 1524 | Ga0496103_0353879 | |||
| 1525 | Ga0496104_0001261 | |||
| 1526 | Ga0496104_0005335 | |||
| 1527 | Ga0496104_0051151 | |||
| 1528 | Ga0496104_0286807 | |||
| 1529 | Ga0496105_0004419 | |||
| 1530 | Ga0496105_0004449 | |||
| 1531 | Ga0496105_0006672 | |||
| 1532 | Ga0496105_0357718 | |||
| 1533 | Ga0496106_0664981 | |||
| 1534 | Ga0496106_1505658 | |||
| 1535 | Ga0496107_0006170 | |||
| 1536 | Ga0496108_0090157 | |||
| 1537 | Ga0496108_1186244 | |||
| 1538 | Ga0496109_0017830 | |||
| 1539 | Ga0496109_0201779 | |||
| 1540 | Ga0496110_0057248 | |||
| 1541 | Ga0496110_0068444 | |||
| 1542 | Ga0496111_0002045 | |||
| 1543 | Ga0496111_0014834 | |||
| 1544 | Ga0496111_0903153 | |||
| 1545 | Ga0496112_0588958 | |||
| 1546 | Ga0496112_0600219 | |||
| 1547 | Ga0496113_0007197 | |||
| 1548 | Ga0496113_0110664 | |||
| 1549 | Ga0496114_0023283 | |||
| 1550 | Ga0496114_0056565 | |||
| 1551 | Ga0496114_0241100 | |||
| 1552 | Ga0496116_0013857 | |||
| 1553 | Ga0496117_0009437 | |||
| 1554 | Ga0496117_0034849 | |||
| 1555 | Ga0496117_0102213 | |||
| 1556 | Ga0496117_0128287 | |||
| 1557 | Ga0496117_0220842 | |||
| 1558 | Ga0496118_0003648 | |||
| 1559 | Ga0496118_0006964 | |||
| 1560 | Ga0496118_0020455 | |||
| 1561 | Ga0496118_0083218 | |||
| 1562 | Ga0496118_0084791 | |||
| 1563 | Ga0496118_0190308 | |||
| 1564 | Ga0496119_0000077 | |||
| 1565 | Ga0496119_0012840 | |||
| 1566 | Ga0496119_0066703 | |||
| 1567 | Ga0496120_0005768 | |||
| 1568 | Ga0496120_0205030 | |||
| 1569 | Ga0496121_0000022 | |||
| 1570 | Ga0496121_0000222 | |||
| 1571 | Ga0496121_0002362 | |||
| 1572 | Ga0496121_0009408 | |||
| 1573 | Ga0496121_0058612 | |||
| 1574 | Ga0496121_0685237 | |||
| 1575 | Ga0496122_0002268 | |||
| 1576 | Ga0496122_0006858 | |||
| 1577 | Ga0496122_0008242 | |||
| 1578 | Ga0496122_0011513 | |||
| 1579 | Ga0496122_0016389 | |||
| 1580 | Ga0496123_0003406 | |||
| 1581 | Ga0496123_0005241 | |||
| 1582 | Ga0496123_0005963 | |||
| 1583 | Ga0496123_0016981 | |||
| 1584 | Ga0496124_0006200 | |||
| 1585 | Ga0496124_0183938 | |||
| 1586 | Ga0496124_0263061 | |||
| 1587 | Ga0496125_0007827 | |||
| 1588 | Ga0496125_0016149 | |||
| 1589 | Ga0496125_0028887 | |||
| 1590 | Ga0496125_0042962 | |||
| 1591 | Ga0496126_0000079 | |||
| 1592 | Ga0496126_0000619 | |||
| 1593 | Ga0496126_0003256 | |||
| 1594 | Ga0496126_0004371 | |||
| 1595 | Ga0496126_0026032 | |||
| 1596 | Ga0496126_0042184 | |||
| 1597 | Ga0496126_0563927 | |||
| 1598 | Ga0495678_026512 | |||
| 1599 | Ga0495682_0132776 | |||
| 1600 | Ga0501300_034046 | |||
| 1601 | Ga0501032_0006527 | |||
| 1602 | Ga0501033_0004215 | |||
| 1603 | Ga0501033_0031389 | |||
| 1604 | Ga0501034_0010865 | |||
| 1605 | Ga0501034_0326993 | |||
| 1606 | Ga0501036_0025362 | |||
| 1607 | Ga0501037_0009034 | |||
| 1608 | Ga0501038_0017668 | |||
| 1609 | Ga0501039_0091478 | |||
| 1610 | Ga0501043_1161883 | |||
| 1611 | Ga0501046_0067378 | |||
| 1612 | Ga0501047_0004376 | |||
| 1613 | Ga0501047_0119971 | |||
| 1614 | Ga0501047_0414497 | |||
| 1615 | Ga0501047_0431344 | |||
| 1616 | Ga0501048_0186999 | |||
| 1617 | Ga0501080_0323625 | |||
| 1618 | Ga0501083_0743537 | |||
| 1619 | Ga0501035_0017712 | |||
| 1620 | Ga0501035_0167219 | |||
| 1621 | Ga0501035_0853382 | |||
| 1622 | Ga0501044_0000098 | |||
| 1623 | Ga0501044_0007203 | |||
| 1624 | Ga0501044_0030831 | |||
| 1625 | Ga0501044_0205691 | |||
| 1626 | Ga0501044_0319955 | |||
| 1627 | nmdc:mga03683_149_c1 | |||
| 1628 | nmdc:mga03683_30_c1 | |||
| 1629 | nmdc:mga03n38_147852_c1 | |||
| 1630 | nmdc:mga03n38_6284_c1 | |||
| 1631 | nmdc:mga00v17_125984_c1 | |||
| 1632 | nmdc:mga00v17_798_c1 | |||
| 1633 | nmdc:mga00v17_83529_c1 | |||
| 1634 | nmdc:mga0k408_17004_c1 | |||
| 1635 | nmdc:mga0k408_2730_c1 | |||
| 1636 | nmdc:mga0k408_328445_c1 | |||
| 1637 | nmdc:mga0k408_49594_c1 | |||
| 1638 | nmdc:mga0k408_563438_c1 | |||
| 1639 | nmdc:mga06z11_149346_c1 | |||
| 1640 | nmdc:mga06z11_61_c1 | |||
| 1641 | nmdc:mga04h51_1140_c1 | |||
| 1642 | nmdc:mga04h51_49320_c1 | |||
| 1643 | nmdc:mga07m45_155417_c1 | |||
| 1644 | nmdc:mga07m45_19103_c1 | |||
| 1645 | nmdc:mga07m45_238675_c1 | |||
| 1646 | nmdc:mga07m45_29618_c2 | |||
| 1647 | nmdc:mga07m45_368022_c1 | |||
| 1648 | nmdc:mga07m45_3935_c1 | |||
| 1649 | nmdc:mga07m45_4960_c1 | |||
| 1650 | nmdc:mga07m45_6_c1 | |||
| 1651 | nmdc:mga0rr50_1197089_c1 | |||
| 1652 | nmdc:mga0sz30_114985_c1 | |||
| 1653 | nmdc:mga0sz30_138_c1 | |||
| 1654 | Ga0500643_000001 | |||
| 1655 | Ga0500643_004834 | |||
| 1656 | Ga0500643_063823 | |||
| 1657 | Ga0500647_0014953 | |||
| 1658 | Ga0500651_0176403 | |||
| 1659 | Ga0500556_0000122 | |||
| 1660 | Ga0500562_048940 | |||
| 1661 | Ga0500592_005142 | |||
| 1662 | Ga0500592_013611 | |||
| 1663 | Ga0500592_051448 | |||
| 1664 | Ga0500594_0063912 | |||
| 1665 | Ga0500595_000472 | |||
| 1666 | Ga0500595_007244 | |||
| 1667 | Ga0500607_000287 | |||
| 1668 | Ga0500607_000802 | |||
| 1669 | Ga0500608_001154 | |||
| 1670 | Ga0500618_037319 | |||
| 1671 | Ga0500652_004515 | |||
| 1672 | Ga0500652_119944 | |||
| 1673 | Ga0500652_254584 | |||
| 1674 | Ga0500658_0001199 | |||
| 1675 | Ga0500658_0089523 | |||
| 1676 | Ga0500559_0002605 | |||
| 1677 | Ga0500559_0010186 | |||
| 1678 | Ga0500559_0016106 | |||
| 1679 | Ga0500559_0036136 | |||
| 1680 | Ga0500559_0098195 | |||
| 1681 | Ga0500559_0104037 | |||
| 1682 | Ga0500559_0384310 | |||
| 1683 | Ga0500564_002032 | |||
| 1684 | Ga0500568_0002610 | |||
| 1685 | Ga0500568_0036903 | |||
| 1686 | Ga0500568_0097327 | |||
| 1687 | Ga0500568_0135285 | |||
| 1688 | Ga0500568_0184394 | |||
| 1689 | Ga0500573_0000082 | |||
| 1690 | Ga0500573_0197675 | |||
| 1691 | Ga0500573_0314262 | |||
| 1692 | Ga0500573_0461430 | |||
| 1693 | Ga0500577_0010263 | |||
| 1694 | Ga0500588_0130445 | |||
| 1695 | Ga0500590_000142 | |||
| 1696 | Ga0500590_034104 | |||
| 1697 | Ga0500604_0030279 | |||
| 1698 | Ga0500604_0050022 | |||
| 1699 | Ga0500616_0004405 | |||
| 1700 | Ga0500616_0015221 | |||
| 1701 | Ga0500616_0049565 | |||
| 1702 | Ga0500619_247062 | |||
| 1703 | Ga0500622_0014303 | |||
| 1704 | Ga0500627_0000004 | |||
| 1705 | Ga0500627_0000231 | |||
| 1706 | Ga0500630_250872 | |||
| 1707 | Ga0500637_0071845 | |||
| 1708 | Ga0500625_000022 | |||
| 1709 | Ga0500625_065684 | |||
| 1710 | Ga0500645_003394 | |||
| 1711 | Ga0500645_029629 | |||
| 1712 | Ga0466962_0018926 | |||
| 1713 | 2511128434 | |||
| 1714 | 2513590826 | |||
| 1715 | 2559431598 | |||
| 1716 | 2600201360 | |||
| 1717 | 2643823345 | |||
| 1718 | 2643835689 | |||
| 1719 | 2644019783 | |||
| 1720 | 2644056615 | |||
| 1721 | 2644180327 | |||
| 1722 | 2738709836 | |||
| 1723 | 2738848261 | |||
| 1724 | 2738863990 | |||
| 1725 | 2739296508 | |||
| 1726 | 2739358186 | |||
| 1727 | 2739650439 | |||
| 1728 | 2740028912 | |||
| 1729 | 2753764538 | |||
| 1730 | 2819553198 | |||
| 1731 | 2828307001 | |||
| 1732 | 2830077851 | |||
| 1733 | 2842883595 | |||
| 1734 | 2852655249 | |||
| 1735 | 2852681181 | |||
| 1736 | 2885430055 | |||
| 1737 | 2896256664 | |||
| 1738 | 2904525384 | |||
| 1739 | 2919140035 | |||
| 1740 | 2919146035 | |||
| 1741 | 2919454962 | |||
| 1742 | 2919517959 | |||
| 1743 | 2928027916 | |||
| 1744 | 2928097123 | |||
| 1745 | 2928101384 | |||
| 1746 | 2928960204 | |||
| 1747 | 2929010097 | |||
| 1748 | 2946788108 | |||
| 1749 | 2960380431 | |||
| 1750 | 2984558708 | |||
| 1751 | 2984566786 | |||
| 1752 | 2990266621 | |||
| 1753 | 2993357974 | |||
| 1754 | 2993695580 | |||
| 1755 | 3000865411 | |||
| 1756 | 8001849292 | |||
| 1757 | 8022896689 | |||
| 1758 | 8054305669 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2p5v-assembly1.cif.gz_A | crystal structure of transcriptional regulator nmb0573 from neisseria meningitidis | 0.9345 | 18 | 169 |
| 2w25-assembly1.cif.gz_B | crystal structure of glu104ala mutant | 0.9241 | 19 | 163 |
| 2ivm-assembly1.cif.gz_A | crystal structure of a transcriptional regulator | 0.9186 | 19 | 163 |
| 2zny-assembly2.cif.gz_C | crystal structure of the ffrp | 0.9164 | 20 | 168 |
| 2gqq-assembly1.cif.gz_A-2 | crystal structure of e. coli leucine-responsive regulatory protein (lrp) | 0.9159 | 20 | 170 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4pcqA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9597 | 24 | 72 | 1.10.10.10 |
| 2qz8D01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9572 | 21 | 71 | 1.10.10.10 |
| 2p5vE01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9566 | 21 | 71 | 1.10.10.10 |
| 2p6sE01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9562 | 21 | 71 | 1.10.10.10 |
| 2p6sB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9559 | 21 | 71 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H5U0L5-F1-model_v4 | Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein | 0.9679 | 17 | 163 |
GO:0005829
GO:0043200 GO:0043565 |
| AF-A0A3N7C0L3-F1-model_v4 | AsnC family transcriptional regulator | 0.964 | 17 | 169 |
GO:0005829
GO:0043200 GO:0043565 |
| AF-A0A5E8KUL6-F1-model_v4 | deleted | 0.9617 | 18 | 169 |
|
| AF-A0A1K1RDQ7-F1-model_v4 | Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein | 0.9608 | 20 | 169 |
GO:0005829
GO:0043200 GO:0043565 |
| AF-A0A381VKJ2-F1-model_v4 | HTH asnC-type domain-containing protein | 0.9605 | 20 | 170 |
GO:0005829
GO:0043200 GO:0043565 |